1BRSA

Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at 2.0-a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at 2.0-A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brsA00
7GSPA 1TRQA 1IYYA 2KAAA 1X1YA 1B2UA 2AADA 1AQZA 2KF5A 1BNEA 2SARA 1BRKA 1RGGA 1Q9EA 2F5WA 3AHSA 3DH2A 1I0XA 1BVIA 1I8VA 1RN4A 3AGOA 5HOHA 1AY7A 1B21A 1HYFA 1RN1A 1JBRA 1BIRA 8RNTA 1BRSA 3D5IA 3D4AA 3Q3FA 3D5GA 1I3FA 4J5KA 1G02A 1RNTA 1B2XA 1B2MA 1SARA 2KF6A 1GSPA 2GSPA 1C54A 1X1UA 1UCIA 1YNVX 1B2SA 1B20A 1UCKA 1I3IA 1X1WA 1BSAA 1LOVA 3HOHA 1MGRA 2RBIA 1BUJA 3AHWA 4HOHA 4J5GA 1HZ1A 1RMSA 1BRJA 5BU4A 4RNTA 1PYLA 1RCKA 1RGCA 1RTUA 1GMQA 1GMRA 1BNIA 1ZGXA 1GMPA 2AAEA 1I70A 1BRHA 1UCJA 2HOHA 5RNTA 1GOYA 1TTOA 3KCHA 2F5MA 1I0VA 1RGLA 1I2GA 1A2PA 1BU4A 3AGNA 1T2IA 1R4YA 1JBTA 2C4BA 3A5EA 1RCLA 1RGFA 2BIRA 1BANA 3RNTA 1I2FA 3BIRA 2ZA4A 1LOYA 3WR2A 1RGKA 1FUSA 2RNTA 1BRNL 1GOVA 1BNRA 4BU4A 1YVSA 1BAOA 2BU4A 2F56A 4GSPA 4BIRA 1RLSA 1BSBA 2F4YA 3DGYA 3WHOA 1T2HA 7RNTA 6RNTA 1BSCA 1GOUA 1I2EA 1LRAA 5GSPA 1LNIA 1UCLA 4HAAA 1BGSA 1BNJA 1RGHA 3GSPA 2KF3A 5BIRA 1TRPA 1BRGA 1DE3A 1CH0A 2KF4A 1X1XA 1BNFA 1RDSA 1BNSA 1PY3A 4GHOA 9RNTA 1FYSA 1FZUA 1FUTA 1BNGA 1BSEA 1B3SA 1JBSA 1RHLA 1B2ZA 3SYUA 1BSDA 3BU4A 3URPA 1FW7A 1DETA 1B27A 1MGWA 6GSPA 1BOXA 1BRIA 1RGEA 1LOWA 1RSNA 1RNBA 1RGAA 1YGWA
chains in the Genus database with same CATH superfamily
1Q814 5G1KA 1TRQA 1US1A 3WDGB 2GU1A 2Q07A 1OGZA 3EX9A 3WODG 6STDA 1OUNA 3HK4A 3OWSA 3PGBA 4WYKB 2ZL8A 2GBWB 3LTDA 1N8QA 1OCVA 2IA7A 4ILFA 3OX9A 4MMZB 1BNEA 5AEUB 2WOHA 3LH4A 5DRVA 2IUJA 3CCJ3 1GYBA 1WMPA 3GZBA 1Q9EA 2P0MA 3S28A 3ROBA 3UJMA 3X3XA 2L1SA 1TFOA 1F8NA 3CC23 3SOAA 3RDEA 1VQ63 1I0XA 3MG3A 4K90B 1LVNA 3BNEA 1B21A 2CFDA 1RN1A 1S5AA 2INXA 3O8YA 4LYLB 4EV5A 5D83A 3NM7A 8RNTA 1BRSA 2JQ5A 4KFEA 1DVCA 3CCQ3 1W7CA 5IEPA 2QGUA 1YIJ3 2CFKA 4XBXA 5JPUA 2RSXA 3CME3 2IY2A 2D42A 1DVDA 4K1VA 1OF5B 2GBXB 5LC7A 1TJDA 1BSAA 1LOVA 3KZTA 1MGRA 3GZYB 3KE7A 3DGNA 1AV4A 4FCJA 1YGEA 3ALAA 1N9JA 1CYUA 1JN5B 1V58A 4GB5A 1EG9B 3Q90A 1RGCA 3UL5A 3CCV3 5AIFA 4X2OA 3F8HA 3LT9A 3QRDA 1GMPA 4N6MA 1UCJA 2CFLA 1NU3A 1ULIB 4MEIA 4OVMA 3SOYA 5RNTA 3KSPA 1GOYA 4EXRA 1UGHI 2UUGC 2V1LA 3FZWA 4ZM8A 1JJ22 1VQO3 2CG0A 2HMMB 2XSHB 3PYJA 1R4YA 5ELJA 2F86B 2C4BA 3A5EA 1RCLA 2CWVA 4FMAA 1UUWB 3BLZA 3FGYA 1ZS7A 2C10A 4N6NB 2ZA4A 2W9QA 1LOYA 3KKGA 2CWTA 2OCTA 1HKXA 1N9EA 2GU3A 1AVLA 2BMQB 1GD4A 1GOVA 3S5CA 1BNRA 4XDWA 2CFGA 2CG1A 4BIRA 2W6JH 1A67A 1O7GB 1BSBA 4XBTA 1U8CB 1A2KA 3DGYA 3X3ZA 3WHOA 3D9RA 1T2HA 1VZZA 7RNTA 5JPPA 1R4CA 1JNQA 6RNTA 3IMAB 1I2EA 3HIGA 3FG3A 1LNIA 3M8CA 3GSPA 1E97A 2BMRB 3MWZA 2KF4A 4KFDA 1OGXA 2BO9B 3K9MC 4JRFA 2CW9A 2KRTA 4U13A 1GD3A 4HM6B 1CQSA 3EQQB 1B3SA 1B2ZA 4MMXB 4KT3B 3URPA 2D1WA 3DGOA 1MGWA 4R9LA 2CH9A 3BB9A 2P05A 2M7OA 4EW5A 1PU4A 3WMDA 1RGEA 2FNQA 1W4NA 3F40A 1QMAA 3CC43 1A90A 3RGRA 5LC6A 1IK3A 1IYYA 1O7HB 1TP6A 5IG4A 1X1YA 1VQN3 1OHPA 1Q40A 1K8A4 2HMNB 1B2UA 1ROAA 1RRHA 1Q7Y4 4HM1B 3G6E3 1VQL3 3HZPA 2KF5A 1W00A 2Z76A 4WP5A 8CHOA 3AMOA 2SARA 4O02B 3CMA3 2K3DA 3JUOA 4O2HA 2A15A 3WOFB 4AKZA 3DUKA 3CCU3 4HZ9B 1UI7A 3EBTA 3B7CA 1GS3A 1O7WB 4RZMA 3S67A 1QJGA 5CK6A 1RN4A 3U1WA 2OQEC 3MG1A 2BNGA 1YI23 3A76A 1VQQA 1HYFA 4HZBB 1STFI 5AIIA 3DY5A 4EYCA 1OHSA 3LMLA 2CX0A 5M18A 1N8R4 3D4AA 1NDOB 1L5GB 4HM4B 1K734 1I3FA 2LQVA 4J5KA 4EBGA 1RNTA 3NBRA 5DREA 2KF6A 1Q864 1JKGA 3V99A 2WO0A 2GSPA 2W56A 2OOVC 4MJDA 4XM4A 1C54A 1FGRA 1YNVX 1B2SA 3G8ZA 3DGMA 1N5HA 2YFLB 4EC6A 3K7CA 2RBIA 1WTHA 4IIAA 1BUJA 1KSIA 3EC9A 4J5GA 3NXJA 4O3VA 2OQEA 3ER7A 3CC73 3J7Yd 1BRJA 3HI7A 3G713 3CU3A 3FF2A 3SX1A 1GMQA 2PZVA 1GMRA 1BNIA 2Z6BA 4OK0A 1C7HA 2L4VA 1I70A 4LMIA 3IJEB 1BRHA 5AI1A 4CPKA 3B4PA 3N8BA 2OOVA 5FW5A 3KSED 2F5MA 1QVG2 4NPBA 3KN4A 1I0VA 4HBRA 1I2GA 2MF7A 1OACA 5BXQA 5EEOA 5IW9A 4HM8B 3F7XA 1FGQA 1YVBI 3RNTA 3CD63 2YFIB 3Q2PA 5IENA 2YX9A 3MSOA 4K1UA 3EN8A 1G96A 1O7NB 4R9KA 7STDA 5ELUA 2RNTA 2XSOB 2F99A 1JB4A 3FCSB 1LQGC 5TGNA 4NREA 4EV2A 3NHXA 3G4S3 1NB5I 1GY6A 1YVSA 1BAOA 2XFSA 5STDA 4IPBA 3CCS3 1M1K4 1UDII 3ZG0A 1W5ZA 3NUVA 2F98A 5AYRB 2FXTA 2B24B 1GOUA 3T8UA 1LRAA 4MMYB 1UCLA 1RGHA 1BNJA 1RRLA 1DE3A 2KF3A 2ML5A 1BRGA 3EF8A 1CH0A 1JZOA 1JZDA 1RDSA 3JUNA 4N6UA 9RNTA 4KVHA 3V92A 3CCR3 5FGOA 1FZUA 2J8XB 1W6CA 1WMNA 1DMQA 1HU9A 3X3YA 1BNGA 3QK9A 1JBSA 4FMCA 4N3VA 2P38A 4L8OA 1SPUA 2JDIH 3S27A 1MNLA 3OXAA 1V57A 2P09A 2BT3A 6GSPA 1IQXA 4HJLB 1T5YA 1W2ZA 1BOXA 3NM2A 4JF8A 2W0QA 1BRIA 1MWUA 4LSOA 5BVBA 3DXOA 3NV0A 1T3BA 4HM0B 2IMJA 1RNBA 1BSEA 3I0YA 1ASKA 1YGWA 1D6ZA 2CWUA 2GEYA 2CKFB 1YJ93 2STDA 1KC84 1DMNA 2KAAA 3GZRA 1VQ93 1UI8A 1RJOA 1PFPA 2GEXA 3L0RA 3OWUA 2P0XA 1ZO2A 4J8TA 3PCRA 1IQ8A 2R41A 1BRKA 1RGGA 3DMCA 4PEJA 1KQS2 4HVNA 1WQLB 2I9WA 4WHAA 3OV4A 2F5WA 2IUKA 2XEPA 1G0TA 1UGIA 3LT8A 3AHSA 3PS8A 1LNHA 1IVWA 1Q7HA 2UGIA 5CF1A 1Q824 1LXEA 3AGOA 2XRXB 2E2UA 4FMBA 1STDA 1IDPA 3S29A 3X42A 1IVUA 1FGOA 3JUMA 4N6OB 3SEDA 1U5OA 4RNYA 1EKMA 3D5IA 1JV2B 3Q3FA 3EB8A 4HM5B 3DGLA 3T8NA 3CCM3 4WYKA 4X2HA 1MOLA 3X41A 1MWTA 1B2XA 1B2MA 2CK3H 1SARA 3N9HA 3SVAA 1TU5A 1VQP3 1JRQA 1LQMB 1X1UA 3LTAA 2O3OA 2W2CA 1B20A 1I3IA 1X1WA 3OWYA 1NJI4 2BHMA 1NO3A 3MPHA 3T0UA 2GXFA 1IQYA 1CEWI 4HOHA 3STDA 4R80A 2XF3A 1HZ1A 5CLKA 3K63A 1GY7A 3BNDA 1IT8A 1PYLA 2RGQA 4N6LA 1TFKA 3NX0A 3F14A 3NV0B 4LGQA 5HGRA 3EN1B 3CPW2 1KWIA 1UUGB 1ZGXA 3N54B 1S723 1W02A 4Q53A 3UL6A 2HOHA 3EE1A 4HYZA 5KP1A 2OTJ3 3CXC2 4CDLA 1OH0A 1TTOA 1OF5A 4NHFA 4RBNA 5G2GA 4N6TA 4HM2B 4CCVA 1BU4A 1T2IA 3NBBA 3NQZA 1JBTA 2OTL3 4FMDA 2KCDA 3BIRA 4WFOA 5IF6A 2WOFA 3WR2A 3KFQC 5IG5A 2R4IA 2W04A 5CF2A 2CHCA 5KP4A 5IG0A 5D82A 1ULJB 2H0GA 3BNCA 4L8PA 1MWRA 1BRNL 1DMMA 4HKVB 1SQWA 4TX4A 4GSPA 2E2TA 2F56A 3EBYA 5IERA 1O7MB 3RGAA 2HMLB 2IYJA 2FGTA 3PZWA 4WWUC 2HMJB 2B1XB 2W9PA 1BSCA 3LOYA 4HAAA 1BGSA 1Q40B 1K41A 3PCSA 5AEWB 5IG3A 1D6YA 3LTCA 1IV9A 3H51A 1VQ73 4N6V0 1E3RA 1M1XB 1X1XA 3JVCA 1BNFA 2K54A 1NWWA 2Y73A 3ZG5A 3BNBA 3X40A 3AMOB 1FUTA 4STDA 3K5TA 1RHLA 3DM8A 3D79A 3VSYA 1IVXA 3BU4A 4LZIA 4BTXA 5I97A 1FW7A 1DETA 1NB3I 1IV7A 3CNMA 3Q1CA 1TIJA 1W6GA 1FA3A 4J9AA 3V98A 3GAXA 2CFWA 3HX8A 3U97A 1OHOA 1NNVA 2Z77A 1M9GA 3E99A 7GSPA 3SLUA 1EEJA 2W03A 1K28A 4OUQA 3ECFA 1AVKA 3LZAA 2AADA 4XBYA 1AQZA 4FCZA 1JKGB 1VQ43 2W56B 5G1LA 1FGMA 3JUQA 1SIIA 1D6UA 3FSDA 1YJW3 2PNCA 3MKIA 5M1AA 1QVF2 1AR0A 1IT7A 4GL6A 2HMOB 1SJWA 2HMKB 2XR8B 1FUWA 1RN7A 3DH2A 3GZXB 1ROVA 3GWRA 4XB5A 4FCMA 1VQM3 1EQKA 1BVIA 1UW1A 1I8VA 2CC3A 2K0MA 1QALA 3FLJA 3G16A 5HOHA 1CYVA 1AY7A 2XGNA 1JBRA 1WMOA 2XH9A 1BIRA 2LYXA 4L7KA 4BTYA 1WNHA 3D5GA 2E2VA 3NBJA 1G02A 1ZX2A 2YFJB 3MG2A 3FG1A 3UB1A 1GSPA 3MYTA 5EVHA 4ORLA 1UCIA 3FG4A 3F8XA 3I553 2QEX3 1UCKA 5AYSC 2WGQA 3HOHA 3SXXA 3K0ZA 1GY5A 4H3UA 5AIHA 2H0IA 3AHWA 3FF0A 4O8SA 5D81A 5CXOA 1OPYA 4BTWA 1VQK3 5M19A 1RMSA 2WGOA 3DZLA 5BU4A 1IU7A 4HM3B 4RNTA 2OWPA 4RNZA 1RCKA 3WA3A 3VGNA 1JB2A 1RTUA 1VQ53 4K61A 4XDVA 2AAEA 4FR9A 3FKAA 4BL3A 3HIIA 4KZ1A 4H61A 1UUVB 3NQYA 1LOXA 4I5QA 3JUPA 3KCHA 5AIGA 3UNLA 4DKIA 4QWTA 3EJVA 3OW22 1RGLA 1A2PA 1QAKA 1ISKA 2XFTA 3AGNA 2XGLA 3H3HA 1YIT3 4LEHA 1YHQ3 4CJNA 1RKYA 3F9SA 2QA43 4IT7A 2BIRA 1RGFA 4R4KA 1BANA 1M904 1I2FA 3ZFZA 1Q42A 1DYUA 3LTBA 1Z1SA 2CX1A 5EQLA 1RGKA 1FUSA 1BUQA 1W2B2 2RFRA 2Y74A 2MC8A 3LXUX 3PXMA 3MHEA 4G1MB 4BU4A 3B8LA 3EHCA 1QAFA 3F7SA 3KIIA 1MWSA 2BU4A 1SIHA 2KXGA 1K9M4 1RLSA 2ZHXB 5KP3A 3G0KA 3FH1A 2F4YA 1YJN3 1W01A 1FGTA 2QIYA 3GRDA 1Y4KA 2BMOB 3CNXA 1A2VA 4AKYA 3CCE3 1KD14 3B4OA 5GSPA 4R1KA 5A0OB 2ZDJA 2C11A 5BIRA 5JBSA 1TRPA 3IPTA 4I4KA 3VF1A 3WA2X 5IEOA 2RCDA 4BL2A 4GHOA 1BNSA 1PY3A 1E3VA 1IVVA 1FYSA 1VQ83 2UX0A 4AEQA 3I563 2CIUA 3CCL3 3D3LA 3SYUA 1BSDA 1V74A 2H0HA 2ML6A 1N5PA 3WOEB 1JN5A 1B27A 3TDGA 1J2BA 1RGAA 3CPOA 4HM7B 4KFFA 1EA2A 2SBLA 1RSNA 1LOWA 1TUHA 2Z7AA 3LYGA 1O7PB 1W6YA 2O9UX 1EUIC 1JB5A
chains in the Genus database with same CATH topology
7GSPA 1TRQA 1IYYA 2KAAA 1X1YA 1B2UA 2AADA 1AQZA 2KF5A 1BNEA 2SARA 1BRKA 1RGGA 1Q9EA 2F5WA 3AHSA 3DH2A 1I0XA 1BVIA 1I8VA 1RN4A 3AGOA 5HOHA 1AY7A 1B21A 1HYFA 1RN1A 1JBRA 1BIRA 8RNTA 1BRSA 3D5IA 3D4AA 3Q3FA 3D5GA 1I3FA 4J5KA 1G02A 1RNTA 1B2XA 1B2MA 1SARA 2KF6A 1GSPA 2GSPA 1C54A 1X1UA 1UCIA 1YNVX 1B2SA 1B20A 1UCKA 1I3IA 1X1WA 1BSAA 1LOVA 3HOHA 1MGRA 2RBIA 1BUJA 3AHWA 4HOHA 4J5GA 1HZ1A 1RMSA 1BRJA 5BU4A 4RNTA 1PYLA 1RCKA 1RGCA 1RTUA 1GMQA 1GMRA 1BNIA 1ZGXA 1GMPA 2AAEA 1I70A 1BRHA 1UCJA 2HOHA 5RNTA 1GOYA 1TTOA 3KCHA 2F5MA 1I0VA 1RGLA 1I2GA 1A2PA 1BU4A 3AGNA 1T2IA 1R4YA 1JBTA 2C4BA 3A5EA 1RCLA 1RGFA 2BIRA 1BANA 3RNTA 1I2FA 3BIRA 2ZA4A 1LOYA 3WR2A 1RGKA 1FUSA 2RNTA 1BRNL 1GOVA 1BNRA 4BU4A 1YVSA 1BAOA 2BU4A 2F56A 4GSPA 4BIRA 1RLSA 1BSBA 2F4YA 3DGYA 3WHOA 1T2HA 7RNTA 6RNTA 1BSCA 1GOUA 1I2EA 1LRAA 5GSPA 1LNIA 1UCLA 4HAAA 1BGSA 1BNJA 1RGHA 3GSPA 2KF3A 5BIRA 1TRPA 1BRGA 1DE3A 1CH0A 2KF4A 1X1XA 1BNFA 1RDSA 1BNSA 1PY3A 4GHOA 9RNTA 1FYSA 1FZUA 1FUTA 1BNGA 1BSEA 1B3SA 1JBSA 1RHLA 1B2ZA 3SYUA 1BSDA 3BU4A 3URPA 1FW7A 1DETA 1B27A 1MGWA 6GSPA 1BOXA 1BRIA 1RGEA 1LOWA 1RSNA 1RNBA 1RGAA 1YGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7GSP A;  1TRQ A;  1IYY A;  2KAA A;  1X1Y A;  1B2U A;  2AAD A;  1AQZ A;  2KF5 A;  1BNE A;  2SAR A;  1BRK A;  1RGG A;  1Q9E A;  2F5W A;  3AHS A;  3DH2 A;  1I0X A;  1BVI A;  1I8V A;  1RN4 A;  3AGO A;  5HOH A;  1AY7 A;  1B21 A;  1HYF A;  1RN1 A;  1JBR A;  1BIR A;  8RNT A;  1BRS A;  3D5I A;  3D4A A;  3Q3F A;  3D5G A;  1I3F A;  4J5K A;  1G02 A;  1RNT A;  1B2X A;  1B2M A;  1SAR A;  2KF6 A;  1GSP A;  2GSP A;  1C54 A;  1X1U A;  1UCI A;  1YNV X;  1B2S A;  1B20 A;  1UCK A;  1I3I A;  1X1W A;  1BSA A;  1LOV A;  3HOH A;  1MGR A;  2RBI A;  1BUJ A;  3AHW A;  4HOH A;  4J5G A;  1HZ1 A;  1RMS A;  1BRJ A;  5BU4 A;  4RNT A;  1PYL A;  1RCK A;  1RGC A;  1RTU A;  1GMQ A;  1GMR A;  1BNI A;  1ZGX A;  1GMP A;  2AAE A;  1I70 A;  1BRH A;  1UCJ A;  2HOH A;  5RNT A;  1GOY A;  1TTO A;  3KCH A;  2F5M A;  1I0V A;  1RGL A;  1I2G A;  1A2P A;  1BU4 A;  3AGN A;  1T2I A;  1R4Y A;  1JBT A;  2C4B A;  3A5E A;  1RCL A;  1RGF A;  2BIR A;  1BAN A;  3RNT A;  1I2F A;  3BIR A;  2ZA4 A;  1LOY A;  3WR2 A;  1RGK A;  1FUS A;  2RNT A;  1BRN L;  1GOV A;  1BNR A;  4BU4 A;  1YVS A;  1BAO A;  2BU4 A;  2F56 A;  4GSP A;  4BIR A;  1RLS A;  1BSB A;  2F4Y A;  3DGY A;  3WHO A;  1T2H A;  7RNT A;  6RNT A;  1BSC A;  1GOU A;  1I2E A;  1LRA A;  5GSP A;  1LNI A;  1UCL A;  4HAA A;  1BGS A;  1BNJ A;  1RGH A;  3GSP A;  2KF3 A;  5BIR A;  1TRP A;  1BRG A;  1DE3 A;  1CH0 A;  2KF4 A;  1X1X A;  1BNF A;  1RDS A;  1BNS A;  1PY3 A;  4GHO A;  9RNT A;  1FYS A;  1FZU A;  1FUT A;  1BNG A;  1BSE A;  1B3S A;  1JBS A;  1RHL A;  1B2Z A;  3SYU A;  1BSD A;  3BU4 A;  3URP A;  1FW7 A;  1DET A;  1B27 A;  1MGW A;  6GSP A;  1BOX A;  1BRI A;  1RGE A;  1LOW A;  1RSN A;  1RNB A;  1RGA A;  1YGW A; 
#chains in the Genus database with same CATH topology
 1Q81 4;  5G1K A;  1TRQ A;  1US1 A;  3WDG B;  2GU1 A;  2Q07 A;  1OGZ A;  3EX9 A;  3WOD G;  6STD A;  1OUN A;  3HK4 A;  3OWS A;  3PGB A;  4WYK B;  2ZL8 A;  2GBW B;  3LTD A;  1N8Q A;  1OCV A;  2IA7 A;  4ILF A;  3OX9 A;  4MMZ B;  1BNE A;  5AEU B;  2WOH A;  3LH4 A;  5DRV A;  2IUJ A;  3CCJ 3;  1GYB A;  1WMP A;  3GZB A;  1Q9E A;  2P0M A;  3S28 A;  3ROB A;  3UJM A;  3X3X A;  2L1S A;  1TFO A;  1F8N A;  3CC2 3;  3SOA A;  3RDE A;  1VQ6 3;  1I0X A;  3MG3 A;  4K90 B;  1LVN A;  3BNE A;  1B21 A;  2CFD A;  1RN1 A;  1S5A A;  2INX A;  3O8Y A;  4LYL B;  4EV5 A;  5D83 A;  3NM7 A;  8RNT A;  1BRS A;  2JQ5 A;  4KFE A;  1DVC A;  3CCQ 3;  1W7C A;  5IEP A;  2QGU A;  1YIJ 3;  2CFK A;  4XBX A;  5JPU A;  2RSX A;  3CME 3;  2IY2 A;  2D42 A;  1DVD A;  4K1V A;  1OF5 B;  2GBX B;  5LC7 A;  1TJD A;  1BSA A;  1LOV A;  3KZT A;  1MGR A;  3GZY B;  3KE7 A;  3DGN A;  1AV4 A;  4FCJ A;  1YGE A;  3ALA A;  1N9J A;  1CYU A;  1JN5 B;  1V58 A;  4GB5 A;  1EG9 B;  3Q90 A;  1RGC A;  3UL5 A;  3CCV 3;  5AIF A;  4X2O A;  3F8H A;  3LT9 A;  3QRD A;  1GMP A;  4N6M A;  1UCJ A;  2CFL A;  1NU3 A;  1ULI B;  4MEI A;  4OVM A;  3SOY A;  5RNT A;  3KSP A;  1GOY A;  4EXR A;  1UGH I;  2UUG C;  2V1L A;  3FZW A;  4ZM8 A;  1JJ2 2;  1VQO 3;  2CG0 A;  2HMM B;  2XSH B;  3PYJ A;  1R4Y A;  5ELJ A;  2F86 B;  2C4B A;  3A5E A;  1RCL A;  2CWV A;  4FMA A;  1UUW B;  3BLZ A;  3FGY A;  1ZS7 A;  2C10 A;  4N6N B;  2ZA4 A;  2W9Q A;  1LOY A;  3KKG A;  2CWT A;  2OCT A;  1HKX A;  1N9E A;  2GU3 A;  1AVL A;  2BMQ B;  1GD4 A;  1GOV A;  3S5C A;  1BNR A;  4XDW A;  2CFG A;  2CG1 A;  4BIR A;  2W6J H;  1A67 A;  1O7G B;  1BSB A;  4XBT A;  1U8C B;  1A2K A;  3DGY A;  3X3Z A;  3WHO A;  3D9R A;  1T2H A;  1VZZ A;  7RNT A;  5JPP A;  1R4C A;  1JNQ A;  6RNT A;  3IMA B;  1I2E A;  3HIG A;  3FG3 A;  1LNI A;  3M8C A;  3GSP A;  1E97 A;  2BMR B;  3MWZ A;  2KF4 A;  4KFD A;  1OGX A;  2BO9 B;  3K9M C;  4JRF A;  2CW9 A;  2KRT A;  4U13 A;  1GD3 A;  4HM6 B;  1CQS A;  3EQQ B;  1B3S A;  1B2Z A;  4MMX B;  4KT3 B;  3URP A;  2D1W A;  3DGO A;  1MGW A;  4R9L A;  2CH9 A;  3BB9 A;  2P05 A;  2M7O A;  4EW5 A;  1PU4 A;  3WMD A;  1RGE A;  2FNQ A;  1W4N A;  3F40 A;  1QMA A;  3CC4 3;  1A90 A;  3RGR A;  5LC6 A;  1IK3 A;  1IYY A;  1O7H B;  1TP6 A;  5IG4 A;  1X1Y A;  1VQN 3;  1OHP A;  1Q40 A;  1K8A 4;  2HMN B;  1B2U A;  1ROA A;  1RRH A;  1Q7Y 4;  4HM1 B;  3G6E 3;  1VQL 3;  3HZP A;  2KF5 A;  1W00 A;  2Z76 A;  4WP5 A;  8CHO A;  3AMO A;  2SAR A;  4O02 B;  3CMA 3;  2K3D A;  3JUO A;  4O2H A;  2A15 A;  3WOF B;  4AKZ A;  3DUK A;  3CCU 3;  4HZ9 B;  1UI7 A;  3EBT A;  3B7C A;  1GS3 A;  1O7W B;  4RZM A;  3S67 A;  1QJG A;  5CK6 A;  1RN4 A;  3U1W A;  2OQE C;  3MG1 A;  2BNG A;  1YI2 3;  3A76 A;  1VQQ A;  1HYF A;  4HZB B;  1STF I;  5AII A;  3DY5 A;  4EYC A;  1OHS A;  3LML A;  2CX0 A;  5M18 A;  1N8R 4;  3D4A A;  1NDO B;  1L5G B;  4HM4 B;  1K73 4;  1I3F A;  2LQV A;  4J5K A;  4EBG A;  1RNT A;  3NBR A;  5DRE A;  2KF6 A;  1Q86 4;  1JKG A;  3V99 A;  2WO0 A;  2GSP A;  2W56 A;  2OOV C;  4MJD A;  4XM4 A;  1C54 A;  1FGR A;  1YNV X;  1B2S A;  3G8Z A;  3DGM A;  1N5H A;  2YFL B;  4EC6 A;  3K7C A;  2RBI A;  1WTH A;  4IIA A;  1BUJ A;  1KSI A;  3EC9 A;  4J5G A;  3NXJ A;  4O3V A;  2OQE A;  3ER7 A;  3CC7 3;  3J7Y d;  1BRJ A;  3HI7 A;  3G71 3;  3CU3 A;  3FF2 A;  3SX1 A;  1GMQ A;  2PZV A;  1GMR A;  1BNI A;  2Z6B A;  4OK0 A;  1C7H A;  2L4V A;  1I70 A;  4LMI A;  3IJE B;  1BRH A;  5AI1 A;  4CPK A;  3B4P A;  3N8B A;  2OOV A;  5FW5 A;  3KSE D;  2F5M A;  1QVG 2;  4NPB A;  3KN4 A;  1I0V A;  4HBR A;  1I2G A;  2MF7 A;  1OAC A;  5BXQ A;  5EEO A;  5IW9 A;  4HM8 B;  3F7X A;  1FGQ A;  1YVB I;  3RNT A;  3CD6 3;  2YFI B;  3Q2P A;  5IEN A;  2YX9 A;  3MSO A;  4K1U A;  3EN8 A;  1G96 A;  1O7N B;  4R9K A;  7STD A;  5ELU A;  2RNT A;  2XSO B;  2F99 A;  1JB4 A;  3FCS B;  1LQG C;  5TGN A;  4NRE A;  4EV2 A;  3NHX A;  3G4S 3;  1NB5 I;  1GY6 A;  1YVS A;  1BAO A;  2XFS A;  5STD A;  4IPB A;  3CCS 3;  1M1K 4;  1UDI I;  3ZG0 A;  1W5Z A;  3NUV A;  2F98 A;  5AYR B;  2FXT A;  2B24 B;  1GOU A;  3T8U A;  1LRA A;  4MMY B;  1UCL A;  1RGH A;  1BNJ A;  1RRL A;  1DE3 A;  2KF3 A;  2ML5 A;  1BRG A;  3EF8 A;  1CH0 A;  1JZO A;  1JZD A;  1RDS A;  3JUN A;  4N6U A;  9RNT A;  4KVH A;  3V92 A;  3CCR 3;  5FGO A;  1FZU A;  2J8X B;  1W6C A;  1WMN A;  1DMQ A;  1HU9 A;  3X3Y A;  1BNG A;  3QK9 A;  1JBS A;  4FMC A;  4N3V A;  2P38 A;  4L8O A;  1SPU A;  2JDI H;  3S27 A;  1MNL A;  3OXA A;  1V57 A;  2P09 A;  2BT3 A;  6GSP A;  1IQX A;  4HJL B;  1T5Y A;  1W2Z A;  1BOX A;  3NM2 A;  4JF8 A;  2W0Q A;  1BRI A;  1MWU A;  4LSO A;  5BVB A;  3DXO A;  3NV0 A;  1T3B A;  4HM0 B;  2IMJ A;  1RNB A;  1BSE A;  3I0Y A;  1ASK A;  1YGW A;  1D6Z A;  2CWU A;  2GEY A;  2CKF B;  1YJ9 3;  2STD A;  1KC8 4;  1DMN A;  2KAA A;  3GZR A;  1VQ9 3;  1UI8 A;  1RJO A;  1PFP A;  2GEX A;  3L0R A;  3OWU A;  2P0X A;  1ZO2 A;  4J8T A;  3PCR A;  1IQ8 A;  2R41 A;  1BRK A;  1RGG A;  3DMC A;  4PEJ A;  1KQS 2;  4HVN A;  1WQL B;  2I9W A;  4WHA A;  3OV4 A;  2F5W A;  2IUK A;  2XEP A;  1G0T A;  1UGI A;  3LT8 A;  3AHS A;  3PS8 A;  1LNH A;  1IVW A;  1Q7H A;  2UGI A;  5CF1 A;  1Q82 4;  1LXE A;  3AGO A;  2XRX B;  2E2U A;  4FMB A;  1STD A;  1IDP A;  3S29 A;  3X42 A;  1IVU A;  1FGO A;  3JUM A;  4N6O B;  3SED A;  1U5O A;  4RNY A;  1EKM A;  3D5I A;  1JV2 B;  3Q3F A;  3EB8 A;  4HM5 B;  3DGL A;  3T8N A;  3CCM 3;  4WYK A;  4X2H A;  1MOL A;  3X41 A;  1MWT A;  1B2X A;  1B2M A;  2CK3 H;  1SAR A;  3N9H A;  3SVA A;  1TU5 A;  1VQP 3;  1JRQ A;  1LQM B;  1X1U A;  3LTA A;  2O3O A;  2W2C A;  1B20 A;  1I3I A;  1X1W A;  3OWY A;  1NJI 4;  2BHM A;  1NO3 A;  3MPH A;  3T0U A;  2GXF A;  1IQY A;  1CEW I;  4HOH A;  3STD A;  4R80 A;  2XF3 A;  1HZ1 A;  5CLK A;  3K63 A;  1GY7 A;  3BND A;  1IT8 A;  1PYL A;  2RGQ A;  4N6L A;  1TFK A;  3NX0 A;  3F14 A;  3NV0 B;  4LGQ A;  5HGR A;  3EN1 B;  3CPW 2;  1KWI A;  1UUG B;  1ZGX A;  3N54 B;  1S72 3;  1W02 A;  4Q53 A;  3UL6 A;  2HOH A;  3EE1 A;  4HYZ A;  5KP1 A;  2OTJ 3;  3CXC 2;  4CDL A;  1OH0 A;  1TTO A;  1OF5 A;  4NHF A;  4RBN A;  5G2G A;  4N6T A;  4HM2 B;  4CCV A;  1BU4 A;  1T2I A;  3NBB A;  3NQZ A;  1JBT A;  2OTL 3;  4FMD A;  2KCD A;  3BIR A;  4WFO A;  5IF6 A;  2WOF A;  3WR2 A;  3KFQ C;  5IG5 A;  2R4I A;  2W04 A;  5CF2 A;  2CHC A;  5KP4 A;  5IG0 A;  5D82 A;  1ULJ B;  2H0G A;  3BNC A;  4L8P A;  1MWR A;  1BRN L;  1DMM A;  4HKV B;  1SQW A;  4TX4 A;  4GSP A;  2E2T A;  2F56 A;  3EBY A;  5IER A;  1O7M B;  3RGA A;  2HML B;  2IYJ A;  2FGT A;  3PZW A;  4WWU C;  2HMJ B;  2B1X B;  2W9P A;  1BSC A;  3LOY A;  4HAA A;  1BGS A;  1Q40 B;  1K41 A;  3PCS A;  5AEW B;  5IG3 A;  1D6Y A;  3LTC A;  1IV9 A;  3H51 A;  1VQ7 3;  4N6V 0;  1E3R A;  1M1X B;  1X1X A;  3JVC A;  1BNF A;  2K54 A;  1NWW A;  2Y73 A;  3ZG5 A;  3BNB A;  3X40 A;  3AMO B;  1FUT A;  4STD A;  3K5T A;  1RHL A;  3DM8 A;  3D79 A;  3VSY A;  1IVX A;  3BU4 A;  4LZI A;  4BTX A;  5I97 A;  1FW7 A;  1DET A;  1NB3 I;  1IV7 A;  3CNM A;  3Q1C A;  1TIJ A;  1W6G A;  1FA3 A;  4J9A A;  3V98 A;  3GAX A;  2CFW A;  3HX8 A;  3U97 A;  1OHO A;  1NNV A;  2Z77 A;  1M9G A;  3E99 A;  7GSP A;  3SLU A;  1EEJ A;  2W03 A;  1K28 A;  4OUQ A;  3ECF A;  1AVK A;  3LZA A;  2AAD A;  4XBY A;  1AQZ A;  4FCZ A;  1JKG B;  1VQ4 3;  2W56 B;  5G1L A;  1FGM A;  3JUQ A;  1SII A;  1D6U A;  3FSD A;  1YJW 3;  2PNC A;  3MKI A;  5M1A A;  1QVF 2;  1AR0 A;  1IT7 A;  4GL6 A;  2HMO B;  1SJW A;  2HMK B;  2XR8 B;  1FUW A;  1RN7 A;  3DH2 A;  3GZX B;  1ROV A;  3GWR A;  4XB5 A;  4FCM A;  1VQM 3;  1EQK A;  1BVI A;  1UW1 A;  1I8V A;  2CC3 A;  2K0M A;  1QAL A;  3FLJ A;  3G16 A;  5HOH A;  1CYV A;  1AY7 A;  2XGN A;  1JBR A;  1WMO A;  2XH9 A;  1BIR A;  2LYX A;  4L7K A;  4BTY A;  1WNH A;  3D5G A;  2E2V A;  3NBJ A;  1G02 A;  1ZX2 A;  2YFJ B;  3MG2 A;  3FG1 A;  3UB1 A;  1GSP A;  3MYT A;  5EVH A;  4ORL A;  1UCI A;  3FG4 A;  3F8X A;  3I55 3;  2QEX 3;  1UCK A;  5AYS C;  2WGQ A;  3HOH A;  3SXX A;  3K0Z A;  1GY5 A;  4H3U A;  5AIH A;  2H0I A;  3AHW A;  3FF0 A;  4O8S A;  5D81 A;  5CXO A;  1OPY A;  4BTW A;  1VQK 3;  5M19 A;  1RMS A;  2WGO A;  3DZL A;  5BU4 A;  1IU7 A;  4HM3 B;  4RNT A;  2OWP A;  4RNZ A;  1RCK A;  3WA3 A;  3VGN A;  1JB2 A;  1RTU A;  1VQ5 3;  4K61 A;  4XDV A;  2AAE A;  4FR9 A;  3FKA A;  4BL3 A;  3HII A;  4KZ1 A;  4H61 A;  1UUV B;  3NQY A;  1LOX A;  4I5Q A;  3JUP A;  3KCH A;  5AIG A;  3UNL A;  4DKI A;  4QWT A;  3EJV A;  3OW2 2;  1RGL A;  1A2P A;  1QAK A;  1ISK A;  2XFT A;  3AGN A;  2XGL A;  3H3H A;  1YIT 3;  4LEH A;  1YHQ 3;  4CJN A;  1RKY A;  3F9S A;  2QA4 3;  4IT7 A;  2BIR A;  1RGF A;  4R4K A;  1BAN A;  1M90 4;  1I2F A;  3ZFZ A;  1Q42 A;  1DYU A;  3LTB A;  1Z1S A;  2CX1 A;  5EQL A;  1RGK A;  1FUS A;  1BUQ A;  1W2B 2;  2RFR A;  2Y74 A;  2MC8 A;  3LXU X;  3PXM A;  3MHE A;  4G1M B;  4BU4 A;  3B8L A;  3EHC A;  1QAF A;  3F7S A;  3KII A;  1MWS A;  2BU4 A;  1SIH A;  2KXG A;  1K9M 4;  1RLS A;  2ZHX B;  5KP3 A;  3G0K A;  3FH1 A;  2F4Y A;  1YJN 3;  1W01 A;  1FGT A;  2QIY A;  3GRD A;  1Y4K A;  2BMO B;  3CNX A;  1A2V A;  4AKY A;  3CCE 3;  1KD1 4;  3B4O A;  5GSP A;  4R1K A;  5A0O B;  2ZDJ A;  2C11 A;  5BIR A;  5JBS A;  1TRP A;  3IPT A;  4I4K A;  3VF1 A;  3WA2 X;  5IEO A;  2RCD A;  4BL2 A;  4GHO A;  1BNS A;  1PY3 A;  1E3V A;  1IVV A;  1FYS A;  1VQ8 3;  2UX0 A;  4AEQ A;  3I56 3;  2CIU A;  3CCL 3;  3D3L A;  3SYU A;  1BSD A;  1V74 A;  2H0H A;  2ML6 A;  1N5P A;  3WOE B;  1JN5 A;  1B27 A;  3TDG A;  1J2B A;  1RGA A;  3CPO A;  4HM7 B;  4KFF A;  1EA2 A;  2SBL A;  1RSN A;  1LOW A;  1TUH A;  2Z7A A;  3LYG A;  1O7P B;  1W6Y A;  2O9U X;  1EUI C;  1JB5 A; 
#chains in the Genus database with same CATH homology
 7GSP A;  1TRQ A;  1IYY A;  2KAA A;  1X1Y A;  1B2U A;  2AAD A;  1AQZ A;  2KF5 A;  1BNE A;  2SAR A;  1BRK A;  1RGG A;  1Q9E A;  2F5W A;  3AHS A;  3DH2 A;  1I0X A;  1BVI A;  1I8V A;  1RN4 A;  3AGO A;  5HOH A;  1AY7 A;  1B21 A;  1HYF A;  1RN1 A;  1JBR A;  1BIR A;  8RNT A;  1BRS A;  3D5I A;  3D4A A;  3Q3F A;  3D5G A;  1I3F A;  4J5K A;  1G02 A;  1RNT A;  1B2X A;  1B2M A;  1SAR A;  2KF6 A;  1GSP A;  2GSP A;  1C54 A;  1X1U A;  1UCI A;  1YNV X;  1B2S A;  1B20 A;  1UCK A;  1I3I A;  1X1W A;  1BSA A;  1LOV A;  3HOH A;  1MGR A;  2RBI A;  1BUJ A;  3AHW A;  4HOH A;  4J5G A;  1HZ1 A;  1RMS A;  1BRJ A;  5BU4 A;  4RNT A;  1PYL A;  1RCK A;  1RGC A;  1RTU A;  1GMQ A;  1GMR A;  1BNI A;  1ZGX A;  1GMP A;  2AAE A;  1I70 A;  1BRH A;  1UCJ A;  2HOH A;  5RNT A;  1GOY A;  1TTO A;  3KCH A;  2F5M A;  1I0V A;  1RGL A;  1I2G A;  1A2P A;  1BU4 A;  3AGN A;  1T2I A;  1R4Y A;  1JBT A;  2C4B A;  3A5E A;  1RCL A;  1RGF A;  2BIR A;  1BAN A;  3RNT A;  1I2F A;  3BIR A;  2ZA4 A;  1LOY A;  3WR2 A;  1RGK A;  1FUS A;  2RNT A;  1BRN L;  1GOV A;  1BNR A;  4BU4 A;  1YVS A;  1BAO A;  2BU4 A;  2F56 A;  4GSP A;  4BIR A;  1RLS A;  1BSB A;  2F4Y A;  3DGY A;  3WHO A;  1T2H A;  7RNT A;  6RNT A;  1BSC A;  1GOU A;  1I2E A;  1LRA A;  5GSP A;  1LNI A;  1UCL A;  4HAA A;  1BGS A;  1BNJ A;  1RGH A;  3GSP A;  2KF3 A;  5BIR A;  1TRP A;  1BRG A;  1DE3 A;  1CH0 A;  2KF4 A;  1X1X A;  1BNF A;  1RDS A;  1BNS A;  1PY3 A;  4GHO A;  9RNT A;  1FYS A;  1FZU A;  1FUT A;  1BNG A;  1BSE A;  1B3S A;  1JBS A;  1RHL A;  1B2Z A;  3SYU A;  1BSD A;  3BU4 A;  3URP A;  1FW7 A;  1DET A;  1B27 A;  1MGW A;  6GSP A;  1BOX A;  1BRI A;  1RGE A;  1LOW A;  1RSN A;  1RNB A;  1RGA A;  1YGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...