1BRSA

Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at 2.0-a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Protein-protein recognition: crystal structural analysis of a barnase-barstar complex at 2.0-A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1994-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brsA00
1RN4A 1RCKA 2F56A 1RCLA 5RNTA 6RNTA 1JBTA 1FZUA 1BOXA 1DETA 1B2XA 1I2EA 1I70A 2HOHA 1RTUA 1RHLA 1MGRA 5BU4A 1FUTA 1B27A 1MGWA 1X1XA 3D5GA 1BRIA 1BRJA 1RGCA 3AGOA 1JBSA 1X1WA 4GSPA 2KF5A 1BU4A 1RN1A 3D4AA 3RNTA 1GOVA 2SARA 1RGEA 1LOWA 1B21A 3D5IA 5BIRA 3GSPA 3KCHA 1GOYA 1LOVA 1BSEA 1GMRA 3Q3FA 2RBIA 1RGKA 1BNIA 4BU4A 1RNBA 1SARA 2KF4A 1BANA 1FYSA 4J5GA 1BNSA 1BRHA 1UCLA 1A2PA 1BNEA 1CH0A 1X1YA 1BNRA 1GOUA 1BSDA 1ZGXA 1GSPA 1IYYA 3DGYA 1LRAA 2AADA 1UCJA 3SYUA 1BIRA 1BUJA 2GSPA 1RDSA 1HYFA 1RGHA 1BGSA 1LNIA 2ZA4A 1X1UA 1FW7A 5HOHA 2F5WA 1R4YA 2KAAA 1TRQA 3AHSA 1YNVX 2RNTA 3A5EA 1JBRA 1RMSA 1B3SA 1GMPA 1RGGA 4HAAA 1Q9EA 3AHWA 1T2HA 8RNTA 1BRGA 3WHOA 1HZ1A 9RNTA 3URPA 2AAEA 1BNJA 1BVIA 1I2FA 1I8VA 2KF3A 1AY7A 3WR2A 3BIRA 3HOHA 1I3FA 2KF6A 1C54A 4RNTA 1TTOA 3BU4A 1LOYA 2F5MA 1BSBA 1B2UA 1GMQA 1I2GA 1UCKA 1BRKA 1YGWA 1RGAA 4GHOA 1BSAA 1B2ZA 1BSCA 1BAOA 1RGFA 1I0XA 1BNFA 1DE3A 2BIRA 2C4BA 1RSNA 1B20A 1PYLA 4J5KA 1RGLA 2F4YA 6GSPA 1BNGA 1FUSA 4HOHA 1I3IA 1B2SA 1RNTA 1BRNL 1B2MA 4BIRA 5GSPA 2BU4A 7RNTA 1G02A 1I0VA 3AGNA 1RLSA 1BRSA 1TRPA 3DH2A 7GSPA 1PY3A 1T2IA 1YVSA 1UCIA 1AQZA
chains in the Genus database with same CATH superfamily
2GXFA 3CCS3 4WYKB 1STDA 4DKIA 3SX1A 4RBNA 4FMDA 4CPKA 5IERA 3EF8A 1QJGA 1B2XA 3ER7A 3BB9A 2LYXA 1D6YA 3B4OA 1JKGB 3DMCA 1RHLA 1FUTA 5AIIA 1MWSA 3AMOB 3JUMA 3QK9A 4GSPA 1D6ZA 2WGOA 1VZZA 3T8UA 1BU4A 3SLUA 1IV7A 2QA43 1CYVA 1VQ43 1VQ83 3F8HA 4HVNA 4IT7A 2ML5A 2SARA 3BNCA 1RGEA 1LOWA 1GY6A 2CH9A 1B21A 3H3HA 5IW9A 5BIRA 3GSPA 3KCHA 1VQN3 1LOVA 1Q7Y4 4FCJA 4N6UA 3H51A 3K9MC 3PCRA 3Q3FA 1FA3A 3SVAA 4BU4A 1ZO2A 1SARA 4HM6B 1Y4KA 2B24B 4KFDA 4LGQA 1QAFA 3DGNA 3LH4A 4EXRA 1E97A 1DMNA 5AEUB 4LZIA 5LC6A 1S723 3SXXA 1CH0A 1X1YA 2CHCA 1Q814 3LZAA 1ZX2A 1M9GA 4X2OA 2YFIB 1K734 5AIGA 1AV4A 2JDIH 1BIRA 2GSPA 2YX9A 3EN1B 1HKXA 2H0GA 2INXA 5CF2A 3OWSA 4HJLB 1CQSA 2L4VA 1LNIA 2Z76A 2ZA4A 5G1LA 1JNQA 3O8YA 4BL2A 1FW7A 2FXTA 3B7CA 3D79A 1Q864 4MMZB 3AHSA 5IG5A 1LXEA 4XDVA 2RGQA 2J8XB 3CNXA 3GZXB 1JBRA 3CNMA 1C7HA 1B3SA 1GMPA 3LT9A 3VF1A 4FCZA 3BNDA 2OOVA 5IG4A 3HK4A 2CWVA 2STDA 3UNLA 2XH9A 1JV2B 1JN5A 3BNEA 3WHOA 2ZHXB 4R9KA 4H3UA 3G8ZA 4EW5A 4MMYB 9RNTA 3URPA 3NQYA 3CC23 2WGQA 1BVIA 4LYLB 3V98A 1I8VA 1FGTA 2W04A 1MWRA 6STDA 2KF3A 1GY5A 3WR2A 4K1UA 3MWZA 3U97A 3HOHA 1C54A 3GRDA 4RNTA 5D81A 3FSDA 3CCQ3 1N8R4 5D82A 1LQGC 1BSBA 1LVNA 4TX4A 1KQS2 1JRQA 3CPW2 1RGAA 2P09A 2CKFB 3EQQB 3NBJA 4HZBB 4KZ1A 4R9LA 3IMAB 1BSCA 1IVVA 3OWUA 2OWPA 3NV0B 1EQKA 2L1SA 1K9M4 3MKIA 4OK0A 4XBTA 1NB3I 2H0HA 5HGRA 1FGOA 1RGLA 2WO0A 4FR9A 4WP5A 4J8TA 3GWRA 1YJN3 1WMOA 4HOHA 1YIT3 2XFTA 3BLZA 1RNTA 1B2SA 1D6UA 1SQWA 1WNHA 2MF7A 3NX0A 3WODG 3DM8A 4EC6A 1B2MA 2FNQA 3B4PA 2Z77A 2PZVA 3MG1A 1W01A 1TRPA 1OHOA 3DH2A 4BTXA 1PY3A 1T2IA 3X3ZA 5KP1A 2D1WA 2K0MA 1NJI4 1QALA 2ZL8A 5G2GA 3Q1CA 6RNTA 3M8CA 1G96A 3FF2A 2QEX3 3HIGA 1DETA 1V58A 2HOHA 2R41A 1SIHA 2D42A 2XFSA 4N3VA 3RGAA 1MGRA 1YI23 4G1MB 1WTHA 3CCE3 1B27A 1MGWA 3ZG0A 2WOFA 1BRIA 3D5GA 4KFEA 1BRJA 1RGCA 1EG9B 1X1WA 1TIJA 3N9HA 1G0TA 5BXQA 5CLKA 4ZM8A 5IENA 1FGMA 4CCVA 1Q40A 3LXUX 4IIAA 3LTAA 4N6OB 1DMQA 2GEYA 1GOVA 5G1KA 1JZOA 5M18A 1IT8A 1UW1A 2ML6A 3ALAA 3S5CA 3D5IA 3CME3 4NREA 3VSYA 3CCR3 3ZFZA 1GMRA 1UUVB 1WMPA 4XBXA 2OTJ3 2PNCA 2CIUA 2P0XA 2KF4A 1EKMA 1LQMB 2CFLA 1FYSA 3PZWA 1MWTA 1M904 4AEQA 1UI7A 2QGUA 2YFJB 1A2PA 4R1KA 1M1K4 3LYGA 2I9WA 3KZTA 4LMIA 1IU7A 1GOUA 2HMOB 1BSDA 3D9RA 3JUNA 1YJW3 5AI1A 1Z1SA 1OPYA 1A2KA 4EBGA 1N9EA 1MWUA 1GY7A 4XDWA 3EBTA 2AADA 3ECFA 3FCSB 2Q07A 3MYTA 1JN5B 1PU4A 1BUJA 1STFI 1SPUA 1O7HB 1QVG2 1BGSA 5DREA 3SEDA 1LOXA 3K5TA 1NDOB 4ORLA 1RRHA 1NNVA 3X42A 5HOHA 3KN4A 1K28A 3CMA3 3CCM3 1VQ93 5FGOA 3A5EA 4KT3B 2W03A 3G16A 3KIIA 3K63A 3Q90A 2OQEA 4R80A 3EJVA 3EE1A 3AHWA 4N6NB 1GD3A 8RNTA 1BRGA 1VQO3 3Q2PA 3EN8A 2CG0A 1HZ1A 3DY5A 3K0ZA 3F14A 2V1LA 2AAEA 1CEWI 1W5ZA 1I2FA 2K54A 1E3RA 1N5PA 2KCDA 1VQ63 3CCU3 3DGOA 2MC8A 2IMJA 5CK6A 1TTOA 3BU4A 2CK3H 2HMLB 1LOYA 1DYUA 1NU3A 4O2HA 3CU3A 2Y73A 4XBYA 5EEOA 1NB5I 1I2GA 2IUKA 1UCKA 4I5QA 3UJMA 1BRKA 2JQ5A 3DZLA 4JF8A 3T8NA 4HM3B 1B2ZA 1F8NA 3PXMA 3NQZA 5AIFA 4CJNA 1BAOA 2CFGA 4WHAA 3S28A 1I0XA 1BNFA 2XSHB 8CHOA 1RSNA 2CWUA 3CPOA 1PYLA 2F4YA 6GSPA 5IEPA 2XF3A 3CCL3 1BNGA 1FUSA 1PFPA 2OCTA 3JUOA 1BRNL 5EQLA 5GSPA 1TFOA 2BU4A 2C11A 1ULIB 3V99A 7RNTA 3HX8A 5AYRB 7GSPA 2BNGA 3F40A 4O8SA 1CYUA 3WA3A 1VQ73 1RN4A 3FGYA 4RZMA 1RCKA 1KSIA 1Q40B 2IYJA 3WDGB 5RNTA 1US1A 2E2TA 1V74A 4LEHA 3CD63 5KP3A 1JBTA 1FZUA 1W6CA 1A2VA 1I2EA 2W0QA 1RTUA 3PYJA 3KSPA 2CX0A 4N6TA 2UUGC 4O3VA 1X1XA 4WFOA 1QVF2 1OCVA 4FCMA 1JB4A 4HYZA 1JBSA 1A67A 3CXC2 3NM7A 4RNYA 3FKAA 1OF5A 1W00A 1BUQA 2CFKA 1RN1A 3HZPA 2BT3A 1EUIC 2RFRA 4GL6A 4WWUC 1Q42A 3F7XA 2BO9B 2UGIA 1MOLA 1LNHA 3E99A 1UUWB 3LMLA 3LOYA 3OX9A 4FMBA 1BSEA 1W2ZA 1IVUA 3PS8A 3ROBA 2XR8B 4HM4B 3EX9A 1RNBA 1YGEA 3FLJA 1BANA 3MG3A 4J5GA 5JPPA 3SOYA 3JVCA 1FGQA 2W56A 1UCLA 1N5HA 4HM7B 4MJDA 1DMMA 1SIIA 1TFKA 1BNEA 4LSOA 1SJWA 3KKGA 4HKVB 4L8OA 1ZGXA 4QWTA 1TP6A 3OV4A 1GSPA 2P38A 4I4KA 1ROAA 2KXGA 3BNBA 3KE7A 3NXJA 5CXOA 3WMDA 1IYYA 1RN7A 1JB2A 1LRAA 3HI7A 3A76A 1IVWA 3SYUA 5JBSA 1RKYA 3RGRA 5TGNA 4FMCA 1FGRA 1ROVA 2W6JH 1RGHA 5JPUA 3HIIA 2IY2A 3NHXA 2BHMA 4J9AA 4EV5A 2W9QA 1R4YA 1IT7A 1DVDA 7STDA 1YIJ3 1GD4A 1YNVX 2RNTA 3UL5A 1VQ53 1O7MB 1RMSA 1RGGA 1U8CB 2E2UA 4GB5A 4AKZA 2O3OA 1ZS7A 1TJDA 2HMJB 1Q9EA 3IJEB 2HMMB 4Q53A 5IG0A 2CWTA 5BVBA 3X40A 1VQK3 2LQVA 2SBLA 3JUQA 3PCSA 4XM4A 1BNJA 2F99A 1MNLA 3IPTA 1UGIA 1IQ8A 2ZDJA 1AY7A 1NO3A 2HMNB 4EYCA 1VQQA 1V57A 1JB5A 2A15A 1OH0A 4BL3A 1S5AA 4FMAA 1AVLA 3EC9A 1E3VA 3NUVA 5IG3A 3CCJ3 1TUHA 4CDLA 3MHEA 3D3LA 2OOVC 1YGWA 2P05A 3U1WA 2OTL3 3VGNA 1BSAA 1UUGB 3EBYA 2UX0A 2KRTA 4K61A 4STDA 5M1AA 3WA2X 2B1XB 3K7CA 2H0IA 3EB8A 1RGFA 5IF6A 3QRDA 3DUKA 1L5GB 1DE3A 2BIRA 2C4BA 2GEXA 1YVBI 3FG4A 4J5KA 3ZG5A 5STDA 1RRLA 5A0OB 2F98A 2RSXA 3N8BA 5EVHA 4OVMA 4BIRA 1ASKA 1J2BA 1G02A 1I0VA 1R4CA 3AGNA 1HU9A 1RLSA 3V92A 4N6V0 1YVSA 1OF5B 1AQZA 3LTCA 4BTWA 1WQLB 1O7WB 2F56A 1RCLA 4HM2B 5D83A 2E2VA 3OWYA 1KWIA 1IQYA 1BOXA 4HZ9B 1I70A 2XSOB 1QMAA 1GS3A 3F9SA 3LTDA 1IDPA 1OACA 5BU4A 1OHSA 3MPHA 4MMXB 1N8QA 1JJ22 1EA2A 2FGTA 4N6LA 1OGZA 5AIHA 5IEOA 1A90A 1M1XB 3AGOA 3OXAA 1VQM3 2KF5A 1OUNA 1RJOA 4HBRA 1DVCA 5FW5A 3PGBA 3STDA 1UI8A 4AKYA 4H61A 3D4AA 2QIYA 4WYKA 2W56B 1O7GB 5ELJA 1YHQ3 2XGLA 3T0UA 3RNTA 1IVXA 2O9UX 4JRFA 3X3XA 5ELUA 3G713 3X3YA 1KD14 1TU5A 2GBWB 3DXOA 1KC84 1GYBA 2XRXB 3GZBA 3MG2A 1JKGA 2Z7AA 1GOYA 3S29A 2BMOB 2R4IA 4NPBA 3UB1A 3I563 1W6YA 2C10A 3AMOA 5LC7A 2CG1A 2RBIA 2IA7A 1RGKA 3FH1A 1BNIA 3GZRA 1O7PB 3S67A 3WOEB 1YJ93 4K90B 1BNSA 1BRHA 3J7Yd 3G0KA 2WOHA 1U5OA 1JZDA 1VQP3 2GU1A 3OW22 1T5YA 3NBRA 4KFFA 1ULJB 3CC73 5KP4A 1K8A4 3CC43 1BNRA 5I97A 2GBXB 3NBBA 3FZWA 4IPBA 3G6E3 1W2B2 3DGYA 1O7NB 1N9JA 1UCJA 2CFDA 3FF0A 3CCV3 3MSOA 3X41A 1T3BA 1OGXA 1RDSA 1HYFA 2F86B 3I0YA 4OUQA 1UGHI 2CC3A 5AEWB 5M19A 4BTYA 1X1UA 1IQXA 2F5WA 3G4S3 2KAAA 1TRQA 4XB5A 3LTBA 2W2CA 2YFLB 3F7SA 3F8XA 1K41A 1IK3A 3S27A 3EHCA 2HMKB 3DGMA 1VQL3 1AVKA 2Y74A 1IV9A 1NWWA 3GZYB 4HAAA 4PEJA 5AYSC 4X2HA 2Z6BA 2BMQB 2IUJA 1UDII 3RDEA 1T2HA 1EEJA 3WOFB 2XGNA 3GAXA 4EV2A 1Q7HA 2P0MA 4HM1B 2CFWA 3JUPA 4L8PA 4R4KA 4U13A 1Q824 2M7OA 4MEIA 3LT8A 1FUWA 4HM8B 3BIRA 1I3FA 2KF6A 4HM5B 2XEPA 3N54B 2W9PA 3B8LA 3FG1A 2F5MA 1ISKA 2OQEC 1B2UA 1GMQA 2GU3A 1W6GA 4GHOA 1W4NA 3FG3A 2CW9A 2BMRB 3KSED 3DGLA 4N6MA 2CX1A 4KVHA 5DRVA 2RCDA 3KFQC 1B20A 3TDGA 4NHFA 3UL6A 4O02B 1W02A 2K3DA 1AR0A 1OHPA 1I3IA 3NM2A 1WMNA 4ILFA 4L7KA 4HM0B 1QAKA 3L0RA 1BRSA 4K1VA 3I553 5CF1A 1W7CA 3SOAA 1UCIA 3NV0A 4RNZA
chains in the Genus database with same CATH topology
1RN4A 1RCKA 2F56A 1RCLA 5RNTA 6RNTA 1JBTA 1FZUA 1BOXA 1DETA 1B2XA 1I2EA 1I70A 2HOHA 1RTUA 1RHLA 1MGRA 5BU4A 1FUTA 1B27A 1MGWA 1X1XA 3D5GA 1BRIA 1BRJA 1RGCA 3AGOA 1JBSA 1X1WA 4GSPA 2KF5A 1BU4A 1RN1A 3D4AA 3RNTA 1GOVA 2SARA 1RGEA 1LOWA 1B21A 3D5IA 5BIRA 3GSPA 3KCHA 1GOYA 1LOVA 1BSEA 1GMRA 3Q3FA 2RBIA 1RGKA 1BNIA 4BU4A 1RNBA 1SARA 2KF4A 1BANA 1FYSA 4J5GA 1BNSA 1BRHA 1UCLA 1A2PA 1BNEA 1CH0A 1X1YA 1BNRA 1GOUA 1BSDA 1ZGXA 1GSPA 1IYYA 3DGYA 1LRAA 2AADA 1UCJA 3SYUA 1BIRA 1BUJA 2GSPA 1RDSA 1HYFA 1RGHA 1BGSA 1LNIA 2ZA4A 1X1UA 1FW7A 5HOHA 2F5WA 1R4YA 2KAAA 1TRQA 3AHSA 1YNVX 2RNTA 3A5EA 1JBRA 1RMSA 1B3SA 1GMPA 1RGGA 4HAAA 1Q9EA 3AHWA 1T2HA 8RNTA 1BRGA 3WHOA 1HZ1A 9RNTA 3URPA 2AAEA 1BNJA 1BVIA 1I2FA 1I8VA 2KF3A 1AY7A 3WR2A 3BIRA 3HOHA 1I3FA 2KF6A 1C54A 4RNTA 1TTOA 3BU4A 1LOYA 2F5MA 1BSBA 1B2UA 1GMQA 1I2GA 1UCKA 1BRKA 1YGWA 1RGAA 4GHOA 1BSAA 1B2ZA 1BSCA 1BAOA 1RGFA 1I0XA 1BNFA 1DE3A 2BIRA 2C4BA 1RSNA 1B20A 1PYLA 4J5KA 1RGLA 2F4YA 6GSPA 1BNGA 1FUSA 4HOHA 1I3IA 1B2SA 1RNTA 1BRNL 1B2MA 4BIRA 5GSPA 2BU4A 7RNTA 1G02A 1I0VA 3AGNA 1RLSA 1BRSA 1TRPA 3DH2A 7GSPA 1PY3A 1T2IA 1YVSA 1UCIA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN4 A;  1RCK A;  2F56 A;  1RCL A;  5RNT A;  6RNT A;  1JBT A;  1FZU A;  1BOX A;  1DET A;  1B2X A;  1I2E A;  1I70 A;  2HOH A;  1RTU A;  1RHL A;  1MGR A;  5BU4 A;  1FUT A;  1B27 A;  1MGW A;  1X1X A;  3D5G A;  1BRI A;  1BRJ A;  1RGC A;  3AGO A;  1JBS A;  1X1W A;  4GSP A;  2KF5 A;  1BU4 A;  1RN1 A;  3D4A A;  3RNT A;  1GOV A;  2SAR A;  1RGE A;  1LOW A;  1B21 A;  3D5I A;  5BIR A;  3GSP A;  3KCH A;  1GOY A;  1LOV A;  1BSE A;  1GMR A;  3Q3F A;  2RBI A;  1RGK A;  1BNI A;  4BU4 A;  1RNB A;  1SAR A;  2KF4 A;  1BAN A;  1FYS A;  4J5G A;  1BNS A;  1BRH A;  1UCL A;  1A2P A;  1BNE A;  1CH0 A;  1X1Y A;  1BNR A;  1GOU A;  1BSD A;  1ZGX A;  1GSP A;  1IYY A;  3DGY A;  1LRA A;  2AAD A;  1UCJ A;  3SYU A;  1BIR A;  1BUJ A;  2GSP A;  1RDS A;  1HYF A;  1RGH A;  1BGS A;  1LNI A;  2ZA4 A;  1X1U A;  1FW7 A;  5HOH A;  2F5W A;  1R4Y A;  2KAA A;  1TRQ A;  3AHS A;  1YNV X;  2RNT A;  3A5E A;  1JBR A;  1RMS A;  1B3S A;  1GMP A;  1RGG A;  4HAA A;  1Q9E A;  3AHW A;  1T2H A;  8RNT A;  1BRG A;  3WHO A;  1HZ1 A;  9RNT A;  3URP A;  2AAE A;  1BNJ A;  1BVI A;  1I2F A;  1I8V A;  2KF3 A;  1AY7 A;  3WR2 A;  3BIR A;  3HOH A;  1I3F A;  2KF6 A;  1C54 A;  4RNT A;  1TTO A;  3BU4 A;  1LOY A;  2F5M A;  1BSB A;  1B2U A;  1GMQ A;  1I2G A;  1UCK A;  1BRK A;  1YGW A;  1RGA A;  4GHO A;  1BSA A;  1B2Z A;  1BSC A;  1BAO A;  1RGF A;  1I0X A;  1BNF A;  1DE3 A;  2BIR A;  2C4B A;  1RSN A;  1B20 A;  1PYL A;  4J5K A;  1RGL A;  2F4Y A;  6GSP A;  1BNG A;  1FUS A;  4HOH A;  1I3I A;  1B2S A;  1RNT A;  1BRN L;  1B2M A;  4BIR A;  5GSP A;  2BU4 A;  7RNT A;  1G02 A;  1I0V A;  3AGN A;  1RLS A;  1BRS A;  1TRP A;  3DH2 A;  7GSP A;  1PY3 A;  1T2I A;  1YVS A;  1UCI A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 2GXF A;  3CCS 3;  4WYK B;  1STD A;  4DKI A;  3SX1 A;  4RBN A;  4FMD A;  4CPK A;  5IER A;  3EF8 A;  1QJG A;  1B2X A;  3ER7 A;  3BB9 A;  2LYX A;  1D6Y A;  3B4O A;  1JKG B;  3DMC A;  1RHL A;  1FUT A;  5AII A;  1MWS A;  3AMO B;  3JUM A;  3QK9 A;  4GSP A;  1D6Z A;  2WGO A;  1VZZ A;  3T8U A;  1BU4 A;  3SLU A;  1IV7 A;  2QA4 3;  1CYV A;  1VQ4 3;  1VQ8 3;  3F8H A;  4HVN A;  4IT7 A;  2ML5 A;  2SAR A;  3BNC A;  1RGE A;  1LOW A;  1GY6 A;  2CH9 A;  1B21 A;  3H3H A;  5IW9 A;  5BIR A;  3GSP A;  3KCH A;  1VQN 3;  1LOV A;  1Q7Y 4;  4FCJ A;  4N6U A;  3H51 A;  3K9M C;  3PCR A;  3Q3F A;  1FA3 A;  3SVA A;  4BU4 A;  1ZO2 A;  1SAR A;  4HM6 B;  1Y4K A;  2B24 B;  4KFD A;  4LGQ A;  1QAF A;  3DGN A;  3LH4 A;  4EXR A;  1E97 A;  1DMN A;  5AEU B;  4LZI A;  5LC6 A;  1S72 3;  3SXX A;  1CH0 A;  1X1Y A;  2CHC A;  1Q81 4;  3LZA A;  1ZX2 A;  1M9G A;  4X2O A;  2YFI B;  1K73 4;  5AIG A;  1AV4 A;  2JDI H;  1BIR A;  2GSP A;  2YX9 A;  3EN1 B;  1HKX A;  2H0G A;  2INX A;  5CF2 A;  3OWS A;  4HJL B;  1CQS A;  2L4V A;  1LNI A;  2Z76 A;  2ZA4 A;  5G1L A;  1JNQ A;  3O8Y A;  4BL2 A;  1FW7 A;  2FXT A;  3B7C A;  3D79 A;  1Q86 4;  4MMZ B;  3AHS A;  5IG5 A;  1LXE A;  4XDV A;  2RGQ A;  2J8X B;  3CNX A;  3GZX B;  1JBR A;  3CNM A;  1C7H A;  1B3S A;  1GMP A;  3LT9 A;  3VF1 A;  4FCZ A;  3BND A;  2OOV A;  5IG4 A;  3HK4 A;  2CWV A;  2STD A;  3UNL A;  2XH9 A;  1JV2 B;  1JN5 A;  3BNE A;  3WHO A;  2ZHX B;  4R9K A;  4H3U A;  3G8Z A;  4EW5 A;  4MMY B;  9RNT A;  3URP A;  3NQY A;  3CC2 3;  2WGQ A;  1BVI A;  4LYL B;  3V98 A;  1I8V A;  1FGT A;  2W04 A;  1MWR A;  6STD A;  2KF3 A;  1GY5 A;  3WR2 A;  4K1U A;  3MWZ A;  3U97 A;  3HOH A;  1C54 A;  3GRD A;  4RNT A;  5D81 A;  3FSD A;  3CCQ 3;  1N8R 4;  5D82 A;  1LQG C;  1BSB A;  1LVN A;  4TX4 A;  1KQS 2;  1JRQ A;  3CPW 2;  1RGA A;  2P09 A;  2CKF B;  3EQQ B;  3NBJ A;  4HZB B;  4KZ1 A;  4R9L A;  3IMA B;  1BSC A;  1IVV A;  3OWU A;  2OWP A;  3NV0 B;  1EQK A;  2L1S A;  1K9M 4;  3MKI A;  4OK0 A;  4XBT A;  1NB3 I;  2H0H A;  5HGR A;  1FGO A;  1RGL A;  2WO0 A;  4FR9 A;  4WP5 A;  4J8T A;  3GWR A;  1YJN 3;  1WMO A;  4HOH A;  1YIT 3;  2XFT A;  3BLZ A;  1RNT A;  1B2S A;  1D6U A;  1SQW A;  1WNH A;  2MF7 A;  3NX0 A;  3WOD G;  3DM8 A;  4EC6 A;  1B2M A;  2FNQ A;  3B4P A;  2Z77 A;  2PZV A;  3MG1 A;  1W01 A;  1TRP A;  1OHO A;  3DH2 A;  4BTX A;  1PY3 A;  1T2I A;  3X3Z A;  5KP1 A;  2D1W A;  2K0M A;  1NJI 4;  1QAL A;  2ZL8 A;  5G2G A;  3Q1C A;  6RNT A;  3M8C A;  1G96 A;  3FF2 A;  2QEX 3;  3HIG A;  1DET A;  1V58 A;  2HOH A;  2R41 A;  1SIH A;  2D42 A;  2XFS A;  4N3V A;  3RGA A;  1MGR A;  1YI2 3;  4G1M B;  1WTH A;  3CCE 3;  1B27 A;  1MGW A;  3ZG0 A;  2WOF A;  1BRI A;  3D5G A;  4KFE A;  1BRJ A;  1RGC A;  1EG9 B;  1X1W A;  1TIJ A;  3N9H A;  1G0T A;  5BXQ A;  5CLK A;  4ZM8 A;  5IEN A;  1FGM A;  4CCV A;  1Q40 A;  3LXU X;  4IIA A;  3LTA A;  4N6O B;  1DMQ A;  2GEY A;  1GOV A;  5G1K A;  1JZO A;  5M18 A;  1IT8 A;  1UW1 A;  2ML6 A;  3ALA A;  3S5C A;  3D5I A;  3CME 3;  4NRE A;  3VSY A;  3CCR 3;  3ZFZ A;  1GMR A;  1UUV B;  1WMP A;  4XBX A;  2OTJ 3;  2PNC A;  2CIU A;  2P0X A;  2KF4 A;  1EKM A;  1LQM B;  2CFL A;  1FYS A;  3PZW A;  1MWT A;  1M90 4;  4AEQ A;  1UI7 A;  2QGU A;  2YFJ B;  1A2P A;  4R1K A;  1M1K 4;  3LYG A;  2I9W A;  3KZT A;  4LMI A;  1IU7 A;  1GOU A;  2HMO B;  1BSD A;  3D9R A;  3JUN A;  1YJW 3;  5AI1 A;  1Z1S A;  1OPY A;  1A2K A;  4EBG A;  1N9E A;  1MWU A;  1GY7 A;  4XDW A;  3EBT A;  2AAD A;  3ECF A;  3FCS B;  2Q07 A;  3MYT A;  1JN5 B;  1PU4 A;  1BUJ A;  1STF I;  1SPU A;  1O7H B;  1QVG 2;  1BGS A;  5DRE A;  3SED A;  1LOX A;  3K5T A;  1NDO B;  4ORL A;  1RRH A;  1NNV A;  3X42 A;  5HOH A;  3KN4 A;  1K28 A;  3CMA 3;  3CCM 3;  1VQ9 3;  5FGO A;  3A5E A;  4KT3 B;  2W03 A;  3G16 A;  3KII A;  3K63 A;  3Q90 A;  2OQE A;  4R80 A;  3EJV A;  3EE1 A;  3AHW A;  4N6N B;  1GD3 A;  8RNT A;  1BRG A;  1VQO 3;  3Q2P A;  3EN8 A;  2CG0 A;  1HZ1 A;  3DY5 A;  3K0Z A;  3F14 A;  2V1L A;  2AAE A;  1CEW I;  1W5Z A;  1I2F A;  2K54 A;  1E3R A;  1N5P A;  2KCD A;  1VQ6 3;  3CCU 3;  3DGO A;  2MC8 A;  2IMJ A;  5CK6 A;  1TTO A;  3BU4 A;  2CK3 H;  2HML B;  1LOY A;  1DYU A;  1NU3 A;  4O2H A;  3CU3 A;  2Y73 A;  4XBY A;  5EEO A;  1NB5 I;  1I2G A;  2IUK A;  1UCK A;  4I5Q A;  3UJM A;  1BRK A;  2JQ5 A;  3DZL A;  4JF8 A;  3T8N A;  4HM3 B;  1B2Z A;  1F8N A;  3PXM A;  3NQZ A;  5AIF A;  4CJN A;  1BAO A;  2CFG A;  4WHA A;  3S28 A;  1I0X A;  1BNF A;  2XSH B;  8CHO A;  1RSN A;  2CWU A;  3CPO A;  1PYL A;  2F4Y A;  6GSP A;  5IEP A;  2XF3 A;  3CCL 3;  1BNG A;  1FUS A;  1PFP A;  2OCT A;  3JUO A;  1BRN L;  5EQL A;  5GSP A;  1TFO A;  2BU4 A;  2C11 A;  1ULI B;  3V99 A;  7RNT A;  3HX8 A;  5AYR B;  7GSP A;  2BNG A;  3F40 A;  4O8S A;  1CYU A;  3WA3 A;  1VQ7 3;  1RN4 A;  3FGY A;  4RZM A;  1RCK A;  1KSI A;  1Q40 B;  2IYJ A;  3WDG B;  5RNT A;  1US1 A;  2E2T A;  1V74 A;  4LEH A;  3CD6 3;  5KP3 A;  1JBT A;  1FZU A;  1W6C A;  1A2V A;  1I2E A;  2W0Q A;  1RTU A;  3PYJ A;  3KSP A;  2CX0 A;  4N6T A;  2UUG C;  4O3V A;  1X1X A;  4WFO A;  1QVF 2;  1OCV A;  4FCM A;  1JB4 A;  4HYZ A;  1JBS A;  1A67 A;  3CXC 2;  3NM7 A;  4RNY A;  3FKA A;  1OF5 A;  1W00 A;  1BUQ A;  2CFK A;  1RN1 A;  3HZP A;  2BT3 A;  1EUI C;  2RFR A;  4GL6 A;  4WWU C;  1Q42 A;  3F7X A;  2BO9 B;  2UGI A;  1MOL A;  1LNH A;  3E99 A;  1UUW B;  3LML A;  3LOY A;  3OX9 A;  4FMB A;  1BSE A;  1W2Z A;  1IVU A;  3PS8 A;  3ROB A;  2XR8 B;  4HM4 B;  3EX9 A;  1RNB A;  1YGE A;  3FLJ A;  1BAN A;  3MG3 A;  4J5G A;  5JPP A;  3SOY A;  3JVC A;  1FGQ A;  2W56 A;  1UCL A;  1N5H A;  4HM7 B;  4MJD A;  1DMM A;  1SII A;  1TFK A;  1BNE A;  4LSO A;  1SJW A;  3KKG A;  4HKV B;  4L8O A;  1ZGX A;  4QWT A;  1TP6 A;  3OV4 A;  1GSP A;  2P38 A;  4I4K A;  1ROA A;  2KXG A;  3BNB A;  3KE7 A;  3NXJ A;  5CXO A;  3WMD A;  1IYY A;  1RN7 A;  1JB2 A;  1LRA A;  3HI7 A;  3A76 A;  1IVW A;  3SYU A;  5JBS A;  1RKY A;  3RGR A;  5TGN A;  4FMC A;  1FGR A;  1ROV A;  2W6J H;  1RGH A;  5JPU A;  3HII A;  2IY2 A;  3NHX A;  2BHM A;  4J9A A;  4EV5 A;  2W9Q A;  1R4Y A;  1IT7 A;  1DVD A;  7STD A;  1YIJ 3;  1GD4 A;  1YNV X;  2RNT A;  3UL5 A;  1VQ5 3;  1O7M B;  1RMS A;  1RGG A;  1U8C B;  2E2U A;  4GB5 A;  4AKZ A;  2O3O A;  1ZS7 A;  1TJD A;  2HMJ B;  1Q9E A;  3IJE B;  2HMM B;  4Q53 A;  5IG0 A;  2CWT A;  5BVB A;  3X40 A;  1VQK 3;  2LQV A;  2SBL A;  3JUQ A;  3PCS A;  4XM4 A;  1BNJ A;  2F99 A;  1MNL A;  3IPT A;  1UGI A;  1IQ8 A;  2ZDJ A;  1AY7 A;  1NO3 A;  2HMN B;  4EYC A;  1VQQ A;  1V57 A;  1JB5 A;  2A15 A;  1OH0 A;  4BL3 A;  1S5A A;  4FMA A;  1AVL A;  3EC9 A;  1E3V A;  3NUV A;  5IG3 A;  3CCJ 3;  1TUH A;  4CDL A;  3MHE A;  3D3L A;  2OOV C;  1YGW A;  2P05 A;  3U1W A;  2OTL 3;  3VGN A;  1BSA A;  1UUG B;  3EBY A;  2UX0 A;  2KRT A;  4K61 A;  4STD A;  5M1A A;  3WA2 X;  2B1X B;  3K7C A;  2H0I A;  3EB8 A;  1RGF A;  5IF6 A;  3QRD A;  3DUK A;  1L5G B;  1DE3 A;  2BIR A;  2C4B A;  2GEX A;  1YVB I;  3FG4 A;  4J5K A;  3ZG5 A;  5STD A;  1RRL A;  5A0O B;  2F98 A;  2RSX A;  3N8B A;  5EVH A;  4OVM A;  4BIR A;  1ASK A;  1J2B A;  1G02 A;  1I0V A;  1R4C A;  3AGN A;  1HU9 A;  1RLS A;  3V92 A;  4N6V 0;  1YVS A;  1OF5 B;  1AQZ A;  3LTC A;  4BTW A;  1WQL B;  1O7W B;  2F56 A;  1RCL A;  4HM2 B;  5D83 A;  2E2V A;  3OWY A;  1KWI A;  1IQY A;  1BOX A;  4HZ9 B;  1I70 A;  2XSO B;  1QMA A;  1GS3 A;  3F9S A;  3LTD A;  1IDP A;  1OAC A;  5BU4 A;  1OHS A;  3MPH A;  4MMX B;  1N8Q A;  1JJ2 2;  1EA2 A;  2FGT A;  4N6L A;  1OGZ A;  5AIH A;  5IEO A;  1A90 A;  1M1X B;  3AGO A;  3OXA A;  1VQM 3;  2KF5 A;  1OUN A;  1RJO A;  4HBR A;  1DVC A;  5FW5 A;  3PGB A;  3STD A;  1UI8 A;  4AKY A;  4H61 A;  3D4A A;  2QIY A;  4WYK A;  2W56 B;  1O7G B;  5ELJ A;  1YHQ 3;  2XGL A;  3T0U A;  3RNT A;  1IVX A;  2O9U X;  4JRF A;  3X3X A;  5ELU A;  3G71 3;  3X3Y A;  1KD1 4;  1TU5 A;  2GBW B;  3DXO A;  1KC8 4;  1GYB A;  2XRX B;  3GZB A;  3MG2 A;  1JKG A;  2Z7A A;  1GOY A;  3S29 A;  2BMO B;  2R4I A;  4NPB A;  3UB1 A;  3I56 3;  1W6Y A;  2C10 A;  3AMO A;  5LC7 A;  2CG1 A;  2RBI A;  2IA7 A;  1RGK A;  3FH1 A;  1BNI A;  3GZR A;  1O7P B;  3S67 A;  3WOE B;  1YJ9 3;  4K90 B;  1BNS A;  1BRH A;  3J7Y d;  3G0K A;  2WOH A;  1U5O A;  1JZD A;  1VQP 3;  2GU1 A;  3OW2 2;  1T5Y A;  3NBR A;  4KFF A;  1ULJ B;  3CC7 3;  5KP4 A;  1K8A 4;  3CC4 3;  1BNR A;  5I97 A;  2GBX B;  3NBB A;  3FZW A;  4IPB A;  3G6E 3;  1W2B 2;  3DGY A;  1O7N B;  1N9J A;  1UCJ A;  2CFD A;  3FF0 A;  3CCV 3;  3MSO A;  3X41 A;  1T3B A;  1OGX A;  1RDS A;  1HYF A;  2F86 B;  3I0Y A;  4OUQ A;  1UGH I;  2CC3 A;  5AEW B;  5M19 A;  4BTY A;  1X1U A;  1IQX A;  2F5W A;  3G4S 3;  2KAA A;  1TRQ A;  4XB5 A;  3LTB A;  2W2C A;  2YFL B;  3F7S A;  3F8X A;  1K41 A;  1IK3 A;  3S27 A;  3EHC A;  2HMK B;  3DGM A;  1VQL 3;  1AVK A;  2Y74 A;  1IV9 A;  1NWW A;  3GZY B;  4HAA A;  4PEJ A;  5AYS C;  4X2H A;  2Z6B A;  2BMQ B;  2IUJ A;  1UDI I;  3RDE A;  1T2H A;  1EEJ A;  3WOF B;  2XGN A;  3GAX A;  4EV2 A;  1Q7H A;  2P0M A;  4HM1 B;  2CFW A;  3JUP A;  4L8P A;  4R4K A;  4U13 A;  1Q82 4;  2M7O A;  4MEI A;  3LT8 A;  1FUW A;  4HM8 B;  3BIR A;  1I3F A;  2KF6 A;  4HM5 B;  2XEP A;  3N54 B;  2W9P A;  3B8L A;  3FG1 A;  2F5M A;  1ISK A;  2OQE C;  1B2U A;  1GMQ A;  2GU3 A;  1W6G A;  4GHO A;  1W4N A;  3FG3 A;  2CW9 A;  2BMR B;  3KSE D;  3DGL A;  4N6M A;  2CX1 A;  4KVH A;  5DRV A;  2RCD A;  3KFQ C;  1B20 A;  3TDG A;  4NHF A;  3UL6 A;  4O02 B;  1W02 A;  2K3D A;  1AR0 A;  1OHP A;  1I3I A;  3NM2 A;  1WMN A;  4ILF A;  4L7K A;  4HM0 B;  1QAK A;  3L0R A;  1BRS A;  4K1V A;  3I55 3;  5CF1 A;  1W7C A;  3SOA A;  1UCI A;  3NV0 A;  4RNZ A; 
#chains in the Genus database with same CATH homology
 1RN4 A;  1RCK A;  2F56 A;  1RCL A;  5RNT A;  6RNT A;  1JBT A;  1FZU A;  1BOX A;  1DET A;  1B2X A;  1I2E A;  1I70 A;  2HOH A;  1RTU A;  1RHL A;  1MGR A;  5BU4 A;  1FUT A;  1B27 A;  1MGW A;  1X1X A;  3D5G A;  1BRI A;  1BRJ A;  1RGC A;  3AGO A;  1JBS A;  1X1W A;  4GSP A;  2KF5 A;  1BU4 A;  1RN1 A;  3D4A A;  3RNT A;  1GOV A;  2SAR A;  1RGE A;  1LOW A;  1B21 A;  3D5I A;  5BIR A;  3GSP A;  3KCH A;  1GOY A;  1LOV A;  1BSE A;  1GMR A;  3Q3F A;  2RBI A;  1RGK A;  1BNI A;  4BU4 A;  1RNB A;  1SAR A;  2KF4 A;  1BAN A;  1FYS A;  4J5G A;  1BNS A;  1BRH A;  1UCL A;  1A2P A;  1BNE A;  1CH0 A;  1X1Y A;  1BNR A;  1GOU A;  1BSD A;  1ZGX A;  1GSP A;  1IYY A;  3DGY A;  1LRA A;  2AAD A;  1UCJ A;  3SYU A;  1BIR A;  1BUJ A;  2GSP A;  1RDS A;  1HYF A;  1RGH A;  1BGS A;  1LNI A;  2ZA4 A;  1X1U A;  1FW7 A;  5HOH A;  2F5W A;  1R4Y A;  2KAA A;  1TRQ A;  3AHS A;  1YNV X;  2RNT A;  3A5E A;  1JBR A;  1RMS A;  1B3S A;  1GMP A;  1RGG A;  4HAA A;  1Q9E A;  3AHW A;  1T2H A;  8RNT A;  1BRG A;  3WHO A;  1HZ1 A;  9RNT A;  3URP A;  2AAE A;  1BNJ A;  1BVI A;  1I2F A;  1I8V A;  2KF3 A;  1AY7 A;  3WR2 A;  3BIR A;  3HOH A;  1I3F A;  2KF6 A;  1C54 A;  4RNT A;  1TTO A;  3BU4 A;  1LOY A;  2F5M A;  1BSB A;  1B2U A;  1GMQ A;  1I2G A;  1UCK A;  1BRK A;  1YGW A;  1RGA A;  4GHO A;  1BSA A;  1B2Z A;  1BSC A;  1BAO A;  1RGF A;  1I0X A;  1BNF A;  1DE3 A;  2BIR A;  2C4B A;  1RSN A;  1B20 A;  1PYL A;  4J5K A;  1RGL A;  2F4Y A;  6GSP A;  1BNG A;  1FUS A;  4HOH A;  1I3I A;  1B2S A;  1RNT A;  1BRN L;  1B2M A;  4BIR A;  5GSP A;  2BU4 A;  7RNT A;  1G02 A;  1I0V A;  3AGN A;  1RLS A;  1BRS A;  1TRP A;  3DH2 A;  7GSP A;  1PY3 A;  1T2I A;  1YVS A;  1UCI A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...