1UW1A

A novel adp- and zinc-binding fold from function-directed in vitro evolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
DDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Adp- and Zinc-Binding Fold from Function-Directed in Vitro Evolution
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uw1A00
3LT8A 1UW1A 3LTCA 2P05A 3DGLA 2P09A 2P0XA 3DGNA 3LTAA 3DGOA 3LT9A 3LTDA 3LTBA 3DGMA
chains in the Genus database with same CATH superfamily
3OW22 5AEUB 1MGWA 1UW1A 1G96A 3LOYA 2K3DA 3NV0B 1ULJB 2PZVA 1KSIA 3FGYA 4XBTA 3G6E3 3CPOA 4HM6B 4J5GA 3OV4A 3X40A 3EN1B 3CD63 1DMMA 5M1AA 1A90A 1RKYA 1B3SA 2D42A 1EA2A 2P0XA 2XGLA 4FCZA 2QIYA 3EF8A 1RGGA 5AEWB 3TDGA 3EJVA 3KFQC 3DUKA 3F8XA 1N5HA 3WDGB 3SX1A 1WMOA 3NM7A 3OWUA 3PS8A 4RNYA 1RMSA 1LOYA 2XR8B 3JVCA 4N6UA 1BAOA 4HBRA 3GZBA 5IG4A 3LZAA 3LTAA 4IT7A 1BNIA 2Y74A 3T8UA 3SVAA 3QK9A 1D6ZA 1O7WB 1ROVA 3BIRA 2OQEC 5KP4A 1BNSA 3ER7A 4XDWA 2GXFA 5TGNA 1VQ93 1AY7A 3AMOB 4XB5A 2ZHXB 3BNBA 3NHXA 1I0XA 1RRHA 2SBLA 3D5GA 3N54B 2BMRB 4LYLB 2HOHA 1LOWA 3K0ZA 5IF6A 2YX9A 3RGRA 1VQN3 3A5EA 5AYSC 4IIAA 3N8BA 4L8OA 2P09A 4KFEA 4FR9A 4K61A 1RN1A 2ZL8A 4EV5A 2C10A 2BMOB 3HZPA 4AEQA 4CPKA 2R4IA 1W2B2 5BIRA 2XSOB 1I2FA 5LC7A 1HYFA 3EBYA 2K0MA 3FKAA 4FMDA 4HOHA 1MWTA 4J5KA 1QMAA 1YVSA 2JDIH 3SLUA 1MNLA 4KFFA 2CFGA 4NREA 3PYJA 2D1WA 1B2ZA 1OF5B 2KF3A 3X41A 2C4BA 1RJOA 1RCLA 2WOFA 3JUQA 1EUIC 2AAEA 1LQMB 2HMKB 3S29A 1UCJA 1GOUA 3URPA 1Q9EA 4FMCA 5CK6A 4RNZA 1BGSA 1MOLA 2CWTA 3MG3A 5EEOA 1BUQA 1FW7A 1BRKA 1IV7A 2GBXB 1M1K4 3LXUX 1D6YA 1TP6A 3EE1A 2XGNA 4NHFA 1YHQ3 1OHOA 1X1YA 1JN5A 2I9WA 1MWRA 1RSNA 3X42A 3FH1A 3WOFB 2W56A 1BRHA 3AMOA 2CFLA 1FUWA 4L8PA 1LNIA 3LMLA 5AIIA 1UGHI 5CF2A 3FLJA 3UJMA 1CH0A 2WGQA 5I97A 5IEPA 1SPUA 1IYYA 4OVMA 2E2TA 1JB5A 1CEWI 1X1UA 5AIHA 1B2MA 1OGXA 1DYUA 1I70A 3L0RA 3Q3FA 5BU4A 1JB4A 1YIJ3 5HGRA 2YFLB 4G1MB 4EBGA 2BO9B 4XBYA 1BSAA 3X3ZA 1CYUA 4JRFA 4J8TA 6STDA 2AADA 1W00A 1TFKA 3AHSA 5IG0A 4FCMA 3CCR3 2XH9A 3EHCA 2GU1A 3PGBA 3PXMA 1GMQA 1MWUA 1BVIA 2E2VA 2R41A 3AGOA 1E3RA 2CX0A 4I5QA 4WYKB 1X1XA 1ISKA 3VGNA 3SOAA 3G0KA 3ZFZA 1ULIB 2P38A 4HM3B 1BSEA 3D9RA 1D6UA 3UL6A 3V98A 2ZDJA 4XBXA 3MPHA 3MWZA 3WHOA 3DGMA 1UI8A 1PY3A 1UDII 3S5CA 3X3XA 1YGWA 4HM5B 5IENA 1I0VA 5G1KA 1TU5A 1LVNA 1IVWA 4HKVB 2Z7AA 4R4KA 4U13A 7RNTA 3NBBA 1C7HA 8RNTA 1Q814 1VQ73 1I3IA 1OACA 1GMPA 1W5ZA 2CWVA 1AV4A 3NV0A 2QGUA 5A0OB 3GZXB 5AIGA 3GAXA 1GOYA 1U5OA 1B21A 2WO0A 3MG2A 1UUGB 3CU3A 3CPW2 1RNBA 1JV2B 1BSBA 4K90B 2IMJA 4BL3A 3CC23 3LT9A 3I0YA 1HKXA 2BT3A 2KF4A 1SIHA 2L1SA 4X2HA 3S27A 5JPPA 1IK3A 1TRQA 4LSOA 1WQLB 1YNVX 3EC9A 1E3VA 1EEJA 2ML6A 1V57A 1UUVB 3K7CA 1YJN3 4FMBA 1B2SA 3ZG0A 1BNEA 4Q53A 5FGOA 3RGAA 1N8R4 1I2EA 1M1XB 2H0HA 2GU3A 2UGIA 1B27A 1EG9B 1TFOA 2XFSA 3DZLA 2YFJB 1N8QA 1IV9A 1OCVA 1RDSA 1GOVA 2BMQB 2H0IA 2RCDA 1US1A 2HMLB 1W6YA 1STDA 4R1KA 3WR2A 3D79A 1RCKA 6RNTA 5RNTA 2FGTA 3PCRA 4MMXB 4CCVA 4K1VA 4MEIA 5DRVA 3CNXA 4FMAA 1UUWB 1X1WA 3ECFA 4FCJA 1PU4A 1BUJA 2CC3A 2Z6BA 1IU7A 2C11A 2HMJB 2F4YA 1W01A 3K5TA 1S723 5FW5A 2OTJ3 1IDPA 1VQ63 2QA43 2SARA 2MF7A 4BIRA 3CCU3 2OOVC 1BNJA 1OUNA 1HZ1A 2P0MA 5STDA 1IQYA 1Y4KA 4GL6A 1HU9A 4IPBA 5HOHA 1T3BA 1W4NA 3B4PA 3BNDA 3T8NA 1GYBA 1UGIA 1JBRA 3CME3 5GSPA 3CCV3 4HYZA 1T5YA 4GB5A 1Q40A 1FUTA 4O3VA 4HM7B 3BNCA 1A2PA 3DH2A 3F7XA 5D81A 3EBTA 3MKIA 2FXTA 1U8CB 1IQ8A 2W04A 1O7GB 1OGZA 1RN4A 4H61A 2XF3A 1Z1SA 3GSPA 4BTWA 4LMIA 3NBRA 4R80A 3LTCA 1GD4A 3F14A 2A15A 1YIT3 4X2OA 1VQP3 1VQL3 1PFPA 1VQK3 1RLSA 4EV2A 1TRPA 3CC43 3HI7A 1BANA 3WODG 2QEX3 2OCTA 2CX1A 1RGFA 3A76A 3F9SA 5IEOA 1UCIA 1JZOA 1NWWA 2W0QA 3O8YA 1YJ93 2F5MA 3NQZA 3GZRA 4OUQA 2F56A 3DY5A 3SEDA 3GRDA 1A67A 3HK4A 2H0GA 2PNCA 3KSPA 4HM2B 4ZM8A 1AVKA 1Q824 2HMMB 4MMZB 1VQ43 1W7CA 4BL2A 4ORLA 2FNQA 1JB2A 3AHWA 1YJW3 1BSDA 3KN4A 5IERA 4QWTA 3GWRA 1B2XA 5CLKA 4EXRA 1Q864 1K734 1K41A 3NQYA 1WMPA 1O7MB 5AIFA 3UB1A 3WA2X 1B2UA 1WTHA 3D5IA 1SIIA 4N3VA 3MYTA 4TX4A 1YGEA 4LGQA 3HIIA 3D4AA 1DMQA 3HIGA 1Q42A 1N9JA 1EQKA 2XRXB 3FZWA 4HM1B 5BVBA 4HVNA 2CFDA 3KIIA 2RFRA 4HM8B 1IVUA 1J2BA 5BXQA 3IPTA 3LTBA 3F8HA 2B1XB 1STFI 3B7CA 1JNQA 3BNEA 2P05A 2K54A 2OWPA 3WMDA 2BNGA 2OTL3 5CF1A 2CH9A 2HMNB 4BTYA 5M19A 1K8A4 2CFWA 1KQS2 3CCE3 2GEYA 3CMA3 4OK0A 3NM2A 1AQZA 1YI23 3B4OA 2BU4A 3FCSB 3WOEB 2Z76A 1R4YA 1A2KA 3OWSA 1QJGA 1V74A 3MHEA 3EN8A 1TJDA 4WWUC 1WNHA 3KZTA 4WP5A 4XDVA 3EX9A 4N6LA 4GSPA 1OHSA 1JBSA 1I8VA 2Q07A 1UI7A 1BNRA 4N6NB 2IUKA 1RGCA 1JKGA 2KF5A 2LQVA 3CXC2 4MJDA 4WFOA 3JUNA 2UUGC 1BRNL 3U1WA 1NDOB 2W2CA 1EKMA 4WHAA 5DREA 4O8SA 4STDA 4KT3B 3LTDA 2W03A 5EVHA 1DVCA 1CQSA 4N6TA 3SXXA 2RBIA 1O7HB 2Y73A 1NNVA 1E97A 1FUSA 3Q2PA 4K1UA 4MMYB 5G1LA 3X3YA 1OH0A 1LQGC 1R4CA 2LYXA 3RNTA 1ZS7A 3VF1A 3FG1A 2O9UX 1GMRA 3FF0A 5IG5A 5M18A 1BRSA 2L4VA 1FGQA 2YFIB 1Q40B 1O7PB 2ZA4A 3CCJ3 3H3HA 1AR0A 4NPBA 3KSED 1T2HA 1JZDA 1RN7A 3ROBA 1NJI4 3Q90A 2XSHB 1W2ZA 4LEHA 3MSOA 1DVDA 2INXA 3S67A 1FZUA 5AYRB 1SQWA 1QAFA 1FGTA 2ML5A 1ASKA 1BRIA 1F8NA 1Q7Y4 1GSPA 3FF2A 1DE3A 2CG0A 4AKZA 1DMNA 3FSDA 1UCKA 4PEJA 4L7KA 1ZO2A 1G0TA 1NO3A 3CCS3 2BHMA 2KRTA 4N6V0 4H3UA 4KZ1A 2F99A 3KE7A 1K28A 1TTOA 1FGRA 1B20A 2BIRA 5JBSA 2CK3H 3NUVA 3OWYA 2GEXA 1G02A 1IT8A 3LH4A 2F98A 3T0UA 3DGLA 3HX8A 3EQQB 2GBWB 5G2GA 2CWUA 3GZYB 1JBTA 1AVLA 1RGKA 1W6CA 3LT8A 5JPUA 4HM0B 1NB5I 1FYSA 1KD14 3DGOA 2CIUA 3NX0A 1LRAA 1NU3A 2KXGA 3RDEA 3CC73 1LOVA 3JUOA 2F86B 4WYKA 2OQEA 1SARA 3VSYA 2RGQA 2JQ5A 5KP3A 2KCDA 1KWIA 1QAKA 1S5AA 1QVF2 3UL5A 3PCSA 3DXOA 7STDA 1QVG2 5D82A 3K9MC 1CYVA 2STDA 3K63A 1A2VA 2OOVA 5LC6A 2O3OA 1K9M4 1RNTA 2RSXA 5KP1A 4RNTA 1VZZA 2KF6A 2UX0A 3ALAA 4CJNA 1GY6A 1FGOA 2W6JH 3LYGA 5D83A 2CG1A 5ELUA 1VQ83 3KCHA 1WMNA 1RRLA 4BU4A 4DKIA 4N6OB 3UNLA 3E99A 1LNHA 3OX9A 1GY7A 1GY5A 2CHCA 4ILFA 1BRJA 4O2HA 1BNFA 1DETA 2W56B 3HOHA 4O02B 3JUMA 3V99A 5IW9A 3FG4A 1FA3A 1RGEA 4I4KA 2CFKA 2KAAA 5IG3A 3PZWA 4GHOA 2IUJA 1VQM3 1BSCA 3IJEB 3BB9A 3KKGA 1V58A 3STDA 1ZX2A 8CHOA 2W9PA 3G16A 3AGNA 1UCLA 1N9EA 1BU4A 3G713 2GSPA 1TIJA 2M7OA 3D3LA 1BRGA 1I3FA 3WA3A 1MWSA 4HJLB 3BU4A 5AI1A 3CCM3 1OHPA 2IY2A 2J8XB 3CNMA 3IMAB 4HZ9B 1I2GA 3H51A 4KVHA 3I553 4HZBB 3N9HA 5EQLA 1JKGB 1O7NB 1TUHA 1RGAA 1RTUA 4R9LA 1RGLA 1RHLA 2V1LA 3FG3A 1SJWA 4HAAA 2MC8A 3S28A 1BOXA 2RNTA 6GSPA 1RGHA 3OXAA 1JN5B 5CXOA 3I563 3CCL3 1PYLA 3G4S3 1IVVA 4XM4A 4EYCA 1Q7HA 2IA7A 1BIRA 1KC84 1OF5A 3CCQ3 2WGOA 2F5WA 2E2UA 1MGRA 4JF8A 4AKYA 1IT7A 1FGMA 3DGNA 1QALA 3EB8A 3M8CA 3Q1CA 4RBNA 4CDLA 1ROAA 3U97A 3MG1A 3NXJA 3JUPA 9RNTA 1IQXA 4N6MA 1W02A 4BTXA 4HM4B 4EC6A 1JJ22 1GS3A 2W9QA 4LZIA 3F40A 3F7SA 1IVXA 3B8LA 3BLZA 4EW5A 1M9GA 2B24B 3V92A 2Z77A 2XEPA 1VQQA 7GSPA 1M904 2CKFB 1ZGXA 3J7Yd 3DGYA 3NBJA 3QRDA 1T2IA 2HMOB 4KFDA 1JRQA 1OPYA 1YVBI 4RZMA 1BNGA 3DMCA 2XFTA 1C54A 3SYUA 3DM8A 5ELJA 3SOYA 1VQ53 4J9AA 1GD3A 2IYJA 4R9KA 1VQO3 1LOXA 2CW9A 1N5PA 2WOHA 1NB3I 1W6GA 3G8ZA 1L5GB 1LXEA 3ZG5A
chains in the Genus database with same CATH topology
3OW22 5AEUB 1UW1A 1G96A 3LOYA 3NV0B 1ULJB 2PZVA 1KSIA 3FGYA 4XBTA 3G6E3 3CPOA 4HM6B 3X40A 3OV4A 3CD63 3EN1B 1DMMA 1A90A 1RKYA 2D42A 1EA2A 2P0XA 2XGLA 4FCZA 2QIYA 3EF8A 5AEWB 3TDGA 3EJVA 3KFQC 3DUKA 3F8XA 1N5HA 3WDGB 3SX1A 1WMOA 3NM7A 3OWUA 3PS8A 4RNYA 2XR8B 3JVCA 4N6UA 4HBRA 3GZBA 5IG4A 3LZAA 3LTAA 4IT7A 2Y74A 3T8UA 3SVAA 3QK9A 1D6ZA 1O7WB 1ROVA 2OQEC 5KP4A 3ER7A 4XDWA 2GXFA 5TGNA 1VQ93 3AMOB 4XB5A 3BNBA 3NHXA 1RRHA 2SBLA 3N54B 2BMRB 3K0ZA 5IF6A 2YX9A 3RGRA 1VQN3 5AYSC 4IIAA 3N8BA 4L8OA 2P09A 4KFEA 4FR9A 4K61A 2ZL8A 4EV5A 2C10A 2BMOB 3HZPA 4AEQA 2R4IA 1W2B2 2XSOB 5LC7A 3EBYA 2K0MA 3FKAA 4FMDA 3SLUA 1QMAA 2JDIH 1MNLA 4KFFA 2CFGA 4NREA 3PYJA 2D1WA 1OF5B 3X41A 1RJOA 2WOFA 3JUQA 2HMKB 3S29A 4FMCA 5CK6A 4RNZA 1MOLA 2CWTA 3MG3A 5EEOA 1BUQA 1IV7A 2GBXB 1M1K4 3LXUX 1D6YA 1TP6A 3EE1A 2XGNA 4NHFA 1YHQ3 1OHOA 2I9WA 1JN5A 3X42A 3FH1A 3WOFB 2W56A 3AMOA 2CFLA 1FUWA 4L8PA 3LMLA 5AIIA 5CF2A 3FLJA 3UJMA 5I97A 2WGQA 5IEPA 1SPUA 4OVMA 2E2TA 1JB5A 1CEWI 5AIHA 1OGXA 1DYUA 1YIJ3 3L0RA 1JB4A 5HGRA 2YFLB 4G1MB 4EBGA 2BO9B 4XBYA 3X3ZA 1CYUA 4JRFA 4J8TA 6STDA 1W00A 1TFKA 5IG0A 4FCMA 3CCR3 2XH9A 3EHCA 2GU1A 3PGBA 3PXMA 2E2VA 4WYKB 1E3RA 1ISKA 3VGNA 3SOAA 3G0KA 1ULIB 2P38A 4HM3B 3D9RA 1D6UA 3UL6A 3V98A 2ZDJA 4XBXA 3MPHA 3MWZA 3DGMA 1UI8A 3S5CA 3X3XA 5IENA 4HM5B 1TU5A 1LVNA 1IVWA 4HKVB 2Z7AA 4R4KA 4U13A 1Q814 3NBBA 1C7HA 1VQ73 1OACA 1W5ZA 2CWVA 1AV4A 3NV0A 2QGUA 5A0OB 3GZXB 5AIGA 3GAXA 1U5OA 2WO0A 3MG2A 3CPW2 3CU3A 1JV2B 4K90B 2IMJA 3CC23 3LT9A 3I0YA 1HKXA 2BT3A 4X2HA 1SIHA 3S27A 5JPPA 1IK3A 4LSOA 1WQLB 1E3VA 2ML6A 1YJN3 1UUVB 3K7CA 4FMBA 4Q53A 5FGOA 3RGAA 1N8R4 1M1XB 2GU3A 2XFSA 1EG9B 1TFOA 3DZLA 2YFJB 1N8QA 2RCDA 1IV9A 1OCVA 2BMQB 1US1A 2HMLB 1W6YA 1STDA 4R1KA 2FGTA 3PCRA 4MMXB 4CCVA 4K1VA 4MEIA 5DRVA 3CNXA 4FMAA 1UUWB 3ECFA 4FCJA 1PU4A 2CC3A 2Z6BA 1IU7A 2C11A 2HMJB 3K5TA 1W01A 1S723 5FW5A 2OTJ3 1IDPA 1VQ63 2QA43 2MF7A 3CCU3 2OOVC 1LXEA 1OUNA 2P0MA 5STDA 1IQYA 1Y4KA 4GL6A 1HU9A 4IPBA 3B4PA 1W4NA 3BNDA 3T8NA 1GYBA 3CME3 3CCV3 4HYZA 1T5YA 4GB5A 1Q40A 4O3VA 4HM7B 3BNCA 3F7XA 5D81A 3EBTA 3MKIA 2FXTA 1U8CB 1IQ8A 2W04A 1O7GB 1OGZA 4H61A 2XF3A 1Z1SA 4BTWA 4LMIA 3NBRA 4R80A 3LTCA 1GD4A 3F14A 2A15A 1YIT3 4X2OA 1VQP3 1VQL3 1PFPA 1VQK3 4EV2A 3CC43 3HI7A 3WODG 2QEX3 2OCTA 3A76A 3F9SA 5IEOA 1NWWA 3O8YA 2W0QA 1YJ93 3NQZA 3GZRA 4OUQA 3DY5A 3SEDA 3GRDA 1A67A 3HK4A 2PNCA 3KSPA 4HM2B 4ZM8A 1Q824 1AVKA 2HMMB 4MMZB 1VQ43 1W7CA 4ORLA 2FNQA 1JB2A 1YJW3 3KN4A 5IERA 4QWTA 3GWRA 5CLKA 4EXRA 1K734 1Q864 1K41A 3NQYA 1WMPA 1O7MB 5AIFA 3UB1A 3WA2X 1WTHA 4N3VA 1SIIA 3MYTA 4TX4A 1YGEA 4LGQA 3HIIA 1DMQA 3HIGA 1Q42A 1N9JA 1EQKA 2XRXB 3FZWA 4HM1B 5BVBA 4HVNA 2CFDA 3KIIA 2RFRA 4HM8B 1IVUA 1J2BA 5BXQA 3IPTA 3LTBA 3F8HA 2B1XB 1STFI 3B7CA 1JNQA 3BNEA 2P05A 2K54A 2OWPA 3WMDA 2BNGA 2OTL3 5CF1A 2CH9A 2HMNB 4BTYA 1K8A4 2CFWA 1KQS2 3CCE3 2GEYA 3CMA3 4OK0A 3NM2A 1YI23 3B4OA 3FCSB 3WOEB 2Z76A 1A2KA 3OWSA 1QJGA 1V74A 3MHEA 3EN8A 4WWUC 1WNHA 3KZTA 4WP5A 4XDVA 3EX9A 4N6LA 1OHSA 2Q07A 1UI7A 4N6NB 2IUKA 2LQVA 1JKGA 3CXC2 4MJDA 4WFOA 3JUNA 3U1WA 1NDOB 2W2CA 1EKMA 4WHAA 5DREA 4O8SA 4STDA 3LTDA 2W03A 5EVHA 1DVCA 1CQSA 4N6TA 3SXXA 1O7HB 2Y73A 1E97A 4K1UA 3Q2PA 4MMYB 3X3YA 1OH0A 1R4CA 2LYXA 3VF1A 3FG1A 2O9UX 3FF0A 5IG5A 2L4VA 1FGQA 2YFIB 1Q40B 1O7PB 3CCJ3 3H3HA 1AR0A 3KSED 1RN7A 3ROBA 1NJI4 3Q90A 2XSHB 1W2ZA 4LEHA 3MSOA 1DVDA 2INXA 3S67A 5AYRB 1SQWA 1QAFA 1FGTA 2ML5A 1ASKA 1F8NA 1Q7Y4 3FF2A 2CG0A 4AKZA 1DMNA 3FSDA 4PEJA 4L7KA 1ZO2A 1NO3A 3CCS3 2BHMA 2KRTA 4N6V0 4H3UA 4KZ1A 2F99A 3KE7A 1K28A 1FGRA 5JBSA 2CK3H 3NUVA 3OWYA 2GEXA 1IT8A 3LH4A 2F98A 3T0UA 3DGLA 3HX8A 3EQQB 2GBWB 5G2GA 2CWUA 3GZYB 1AVLA 1W6CA 3LT8A 5JPUA 4HM0B 1NB5I 1KD14 3DGOA 2CIUA 3NX0A 2KXGA 1NU3A 3CC73 3RDEA 3JUOA 2F86B 4WYKA 2OQEA 3VSYA 2RGQA 2JQ5A 5KP3A 2KCDA 1KWIA 1QAKA 1S5AA 1QVF2 3UL5A 3PCSA 3DXOA 7STDA 1QVG2 5D82A 3K9MC 1CYVA 2STDA 3K63A 1A2VA 2OOVA 5LC6A 2O3OA 1K9M4 2RSXA 5KP1A 1VZZA 2UX0A 3ALAA 1GY6A 1FGOA 2W6JH 3LYGA 5D83A 2CG1A 5ELUA 1VQ83 1WMNA 1RRLA 4N6OB 3UNLA 3E99A 1LNHA 3OX9A 1GY7A 1GY5A 2CHCA 4O2HA 2W56B 4O02B 3JUMA 3V99A 5IW9A 3FG4A 1FA3A 4I4KA 2CFKA 5IG3A 3PZWA 2IUJA 1VQM3 3IJEB 3BB9A 3KKGA 3STDA 8CHOA 1ZX2A 2W9PA 3G16A 1N9EA 3G713 1TIJA 2M7OA 3D3LA 3WA3A 4HJLB 5AI1A 3CCM3 1OHPA 3CNMA 3I553 3IMAB 4HZ9B 3H51A 4KVHA 4HZBB 3N9HA 5EQLA 1JKGB 1O7NB 1TUHA 4R9LA 2MC8A 2V1LA 3FG3A 3S28A 1SJWA 3OXAA 1JN5B 5CXOA 3I563 3CCL3 3G4S3 1IVVA 4XM4A 4EYCA 2IA7A 1KC84 1OF5A 3CCQ3 2WGOA 2E2UA 4JF8A 4AKYA 1IT7A 1FGMA 3DGNA 1QALA 3EB8A 3M8CA 3Q1CA 4RBNA 4CDLA 1ROAA 3U97A 3MG1A 3NXJA 3JUPA 1IQXA 4N6MA 1W02A 4BTXA 4HM4B 4EC6A 1JJ22 1GS3A 2W9QA 4LZIA 3F40A 3F7SA 1IVXA 3B8LA 3BLZA 1M9GA 2B24B 3V92A 2Z77A 2XEPA 1M904 2CKFB 3J7Yd 3NBJA 3QRDA 2HMOB 4KFDA 1JRQA 1OPYA 1YVBI 4RZMA 3DMCA 2XFTA 3DM8A 5ELJA 3SOYA 1VQ53 4J9AA 1GD3A 4R9KA 1VQO3 1LOXA 2CW9A 1N5PA 2WOHA 1NB3I 1W6GA 3G8ZA 1L5GB 3EC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT8 A;  1UW1 A;  3LTC A;  2P05 A;  3DGL A;  2P09 A;  2P0X A;  3DGN A;  3LTA A;  3DGO A;  3LT9 A;  3LTD A;  3LTB A;  3DGM A; 
#chains in the Genus database with same CATH topology
 3OW2 2;  5AEU B;  1MGW A;  1UW1 A;  1G96 A;  3LOY A;  2K3D A;  3NV0 B;  1ULJ B;  2PZV A;  1KSI A;  3FGY A;  4XBT A;  3G6E 3;  3CPO A;  4HM6 B;  4J5G A;  3OV4 A;  3X40 A;  3EN1 B;  3CD6 3;  1DMM A;  5M1A A;  1A90 A;  1RKY A;  1B3S A;  2D42 A;  1EA2 A;  2P0X A;  2XGL A;  4FCZ A;  2QIY A;  3EF8 A;  1RGG A;  5AEW B;  3TDG A;  3EJV A;  3KFQ C;  3DUK A;  3F8X A;  1N5H A;  3WDG B;  3SX1 A;  1WMO A;  3NM7 A;  3OWU A;  3PS8 A;  4RNY A;  1RMS A;  1LOY A;  2XR8 B;  3JVC A;  4N6U A;  1BAO A;  4HBR A;  3GZB A;  5IG4 A;  3LZA A;  3LTA A;  4IT7 A;  1BNI A;  2Y74 A;  3T8U A;  3SVA A;  3QK9 A;  1D6Z A;  1O7W B;  1ROV A;  3BIR A;  2OQE C;  5KP4 A;  1BNS A;  3ER7 A;  4XDW A;  2GXF A;  5TGN A;  1VQ9 3;  1AY7 A;  3AMO B;  4XB5 A;  2ZHX B;  3BNB A;  3NHX A;  1I0X A;  1RRH A;  2SBL A;  3D5G A;  3N54 B;  2BMR B;  4LYL B;  2HOH A;  1LOW A;  3K0Z A;  5IF6 A;  2YX9 A;  3RGR A;  1VQN 3;  3A5E A;  5AYS C;  4IIA A;  3N8B A;  4L8O A;  2P09 A;  4KFE A;  4FR9 A;  4K61 A;  1RN1 A;  2ZL8 A;  4EV5 A;  2C10 A;  2BMO B;  3HZP A;  4AEQ A;  4CPK A;  2R4I A;  1W2B 2;  5BIR A;  2XSO B;  1I2F A;  5LC7 A;  1HYF A;  3EBY A;  2K0M A;  3FKA A;  4FMD A;  4HOH A;  1MWT A;  4J5K A;  1QMA A;  1YVS A;  2JDI H;  3SLU A;  1MNL A;  4KFF A;  2CFG A;  4NRE A;  3PYJ A;  2D1W A;  1B2Z A;  1OF5 B;  2KF3 A;  3X41 A;  2C4B A;  1RJO A;  1RCL A;  2WOF A;  3JUQ A;  1EUI C;  2AAE A;  1LQM B;  2HMK B;  3S29 A;  1UCJ A;  1GOU A;  3URP A;  1Q9E A;  4FMC A;  5CK6 A;  4RNZ A;  1BGS A;  1MOL A;  2CWT A;  3MG3 A;  5EEO A;  1BUQ A;  1FW7 A;  1BRK A;  1IV7 A;  2GBX B;  1M1K 4;  3LXU X;  1D6Y A;  1TP6 A;  3EE1 A;  2XGN A;  4NHF A;  1YHQ 3;  1OHO A;  1X1Y A;  1JN5 A;  2I9W A;  1MWR A;  1RSN A;  3X42 A;  3FH1 A;  3WOF B;  2W56 A;  1BRH A;  3AMO A;  2CFL A;  1FUW A;  4L8P A;  1LNI A;  3LML A;  5AII A;  1UGH I;  5CF2 A;  3FLJ A;  3UJM A;  1CH0 A;  2WGQ A;  5I97 A;  5IEP A;  1SPU A;  1IYY A;  4OVM A;  2E2T A;  1JB5 A;  1CEW I;  1X1U A;  5AIH A;  1B2M A;  1OGX A;  1DYU A;  1I70 A;  3L0R A;  3Q3F A;  5BU4 A;  1JB4 A;  1YIJ 3;  5HGR A;  2YFL B;  4G1M B;  4EBG A;  2BO9 B;  4XBY A;  1BSA A;  3X3Z A;  1CYU A;  4JRF A;  4J8T A;  6STD A;  2AAD A;  1W00 A;  1TFK A;  3AHS A;  5IG0 A;  4FCM A;  3CCR 3;  2XH9 A;  3EHC A;  2GU1 A;  3PGB A;  3PXM A;  1GMQ A;  1MWU A;  1BVI A;  2E2V A;  2R41 A;  3AGO A;  1E3R A;  2CX0 A;  4I5Q A;  4WYK B;  1X1X A;  1ISK A;  3VGN A;  3SOA A;  3G0K A;  3ZFZ A;  1ULI B;  2P38 A;  4HM3 B;  1BSE A;  3D9R A;  1D6U A;  3UL6 A;  3V98 A;  2ZDJ A;  4XBX A;  3MPH A;  3MWZ A;  3WHO A;  3DGM A;  1UI8 A;  1PY3 A;  1UDI I;  3S5C A;  3X3X A;  1YGW A;  4HM5 B;  5IEN A;  1I0V A;  5G1K A;  1TU5 A;  1LVN A;  1IVW A;  4HKV B;  2Z7A A;  4R4K A;  4U13 A;  7RNT A;  3NBB A;  1C7H A;  8RNT A;  1Q81 4;  1VQ7 3;  1I3I A;  1OAC A;  1GMP A;  1W5Z A;  2CWV A;  1AV4 A;  3NV0 A;  2QGU A;  5A0O B;  3GZX B;  5AIG A;  3GAX A;  1GOY A;  1U5O A;  1B21 A;  2WO0 A;  3MG2 A;  1UUG B;  3CU3 A;  3CPW 2;  1RNB A;  1JV2 B;  1BSB A;  4K90 B;  2IMJ A;  4BL3 A;  3CC2 3;  3LT9 A;  3I0Y A;  1HKX A;  2BT3 A;  2KF4 A;  1SIH A;  2L1S A;  4X2H A;  3S27 A;  5JPP A;  1IK3 A;  1TRQ A;  4LSO A;  1WQL B;  1YNV X;  3EC9 A;  1E3V A;  1EEJ A;  2ML6 A;  1V57 A;  1UUV B;  3K7C A;  1YJN 3;  4FMB A;  1B2S A;  3ZG0 A;  1BNE A;  4Q53 A;  5FGO A;  3RGA A;  1N8R 4;  1I2E A;  1M1X B;  2H0H A;  2GU3 A;  2UGI A;  1B27 A;  1EG9 B;  1TFO A;  2XFS A;  3DZL A;  2YFJ B;  1N8Q A;  1IV9 A;  1OCV A;  1RDS A;  1GOV A;  2BMQ B;  2H0I A;  2RCD A;  1US1 A;  2HML B;  1W6Y A;  1STD A;  4R1K A;  3WR2 A;  3D79 A;  1RCK A;  6RNT A;  5RNT A;  2FGT A;  3PCR A;  4MMX B;  4CCV A;  4K1V A;  4MEI A;  5DRV A;  3CNX A;  4FMA A;  1UUW B;  1X1W A;  3ECF A;  4FCJ A;  1PU4 A;  1BUJ A;  2CC3 A;  2Z6B A;  1IU7 A;  2C11 A;  2HMJ B;  2F4Y A;  1W01 A;  3K5T A;  1S72 3;  5FW5 A;  2OTJ 3;  1IDP A;  1VQ6 3;  2QA4 3;  2SAR A;  2MF7 A;  4BIR A;  3CCU 3;  2OOV C;  1BNJ A;  1OUN A;  1HZ1 A;  2P0M A;  5STD A;  1IQY A;  1Y4K A;  4GL6 A;  1HU9 A;  4IPB A;  5HOH A;  1T3B A;  1W4N A;  3B4P A;  3BND A;  3T8N A;  1GYB A;  1UGI A;  1JBR A;  3CME 3;  5GSP A;  3CCV 3;  4HYZ A;  1T5Y A;  4GB5 A;  1Q40 A;  1FUT A;  4O3V A;  4HM7 B;  3BNC A;  1A2P A;  3DH2 A;  3F7X A;  5D81 A;  3EBT A;  3MKI A;  2FXT A;  1U8C B;  1IQ8 A;  2W04 A;  1O7G B;  1OGZ A;  1RN4 A;  4H61 A;  2XF3 A;  1Z1S A;  3GSP A;  4BTW A;  4LMI A;  3NBR A;  4R80 A;  3LTC A;  1GD4 A;  3F14 A;  2A15 A;  1YIT 3;  4X2O A;  1VQP 3;  1VQL 3;  1PFP A;  1VQK 3;  1RLS A;  4EV2 A;  1TRP A;  3CC4 3;  3HI7 A;  1BAN A;  3WOD G;  2QEX 3;  2OCT A;  2CX1 A;  1RGF A;  3A76 A;  3F9S A;  5IEO A;  1UCI A;  1JZO A;  1NWW A;  2W0Q A;  3O8Y A;  1YJ9 3;  2F5M A;  3NQZ A;  3GZR A;  4OUQ A;  2F56 A;  3DY5 A;  3SED A;  3GRD A;  1A67 A;  3HK4 A;  2H0G A;  2PNC A;  3KSP A;  4HM2 B;  4ZM8 A;  1AVK A;  1Q82 4;  2HMM B;  4MMZ B;  1VQ4 3;  1W7C A;  4BL2 A;  4ORL A;  2FNQ A;  1JB2 A;  3AHW A;  1YJW 3;  1BSD A;  3KN4 A;  5IER A;  4QWT A;  3GWR A;  1B2X A;  5CLK A;  4EXR A;  1Q86 4;  1K73 4;  1K41 A;  3NQY A;  1WMP A;  1O7M B;  5AIF A;  3UB1 A;  3WA2 X;  1B2U A;  1WTH A;  3D5I A;  1SII A;  4N3V A;  3MYT A;  4TX4 A;  1YGE A;  4LGQ A;  3HII A;  3D4A A;  1DMQ A;  3HIG A;  1Q42 A;  1N9J A;  1EQK A;  2XRX B;  3FZW A;  4HM1 B;  5BVB A;  4HVN A;  2CFD A;  3KII A;  2RFR A;  4HM8 B;  1IVU A;  1J2B A;  5BXQ A;  3IPT A;  3LTB A;  3F8H A;  2B1X B;  1STF I;  3B7C A;  1JNQ A;  3BNE A;  2P05 A;  2K54 A;  2OWP A;  3WMD A;  2BNG A;  2OTL 3;  5CF1 A;  2CH9 A;  2HMN B;  4BTY A;  5M19 A;  1K8A 4;  2CFW A;  1KQS 2;  3CCE 3;  2GEY A;  3CMA 3;  4OK0 A;  3NM2 A;  1AQZ A;  1YI2 3;  3B4O A;  2BU4 A;  3FCS B;  3WOE B;  2Z76 A;  1R4Y A;  1A2K A;  3OWS A;  1QJG A;  1V74 A;  3MHE A;  3EN8 A;  1TJD A;  4WWU C;  1WNH A;  3KZT A;  4WP5 A;  4XDV A;  3EX9 A;  4N6L A;  4GSP A;  1OHS A;  1JBS A;  1I8V A;  2Q07 A;  1UI7 A;  1BNR A;  4N6N B;  2IUK A;  1RGC A;  1JKG A;  2KF5 A;  2LQV A;  3CXC 2;  4MJD A;  4WFO A;  3JUN A;  2UUG C;  1BRN L;  3U1W A;  1NDO B;  2W2C A;  1EKM A;  4WHA A;  5DRE A;  4O8S A;  4STD A;  4KT3 B;  3LTD A;  2W03 A;  5EVH A;  1DVC A;  1CQS A;  4N6T A;  3SXX A;  2RBI A;  1O7H B;  2Y73 A;  1NNV A;  1E97 A;  1FUS A;  3Q2P A;  4K1U A;  4MMY B;  5G1L A;  3X3Y A;  1OH0 A;  1LQG C;  1R4C A;  2LYX A;  3RNT A;  1ZS7 A;  3VF1 A;  3FG1 A;  2O9U X;  1GMR A;  3FF0 A;  5IG5 A;  5M18 A;  1BRS A;  2L4V A;  1FGQ A;  2YFI B;  1Q40 B;  1O7P B;  2ZA4 A;  3CCJ 3;  3H3H A;  1AR0 A;  4NPB A;  3KSE D;  1T2H A;  1JZD A;  1RN7 A;  3ROB A;  1NJI 4;  3Q90 A;  2XSH B;  1W2Z A;  4LEH A;  3MSO A;  1DVD A;  2INX A;  3S67 A;  1FZU A;  5AYR B;  1SQW A;  1QAF A;  1FGT A;  2ML5 A;  1ASK A;  1BRI A;  1F8N A;  1Q7Y 4;  1GSP A;  3FF2 A;  1DE3 A;  2CG0 A;  4AKZ A;  1DMN A;  3FSD A;  1UCK A;  4PEJ A;  4L7K A;  1ZO2 A;  1G0T A;  1NO3 A;  3CCS 3;  2BHM A;  2KRT A;  4N6V 0;  4H3U A;  4KZ1 A;  2F99 A;  3KE7 A;  1K28 A;  1TTO A;  1FGR A;  1B20 A;  2BIR A;  5JBS A;  2CK3 H;  3NUV A;  3OWY A;  2GEX A;  1G02 A;  1IT8 A;  3LH4 A;  2F98 A;  3T0U A;  3DGL A;  3HX8 A;  3EQQ B;  2GBW B;  5G2G A;  2CWU A;  3GZY B;  1JBT A;  1AVL A;  1RGK A;  1W6C A;  3LT8 A;  5JPU A;  4HM0 B;  1NB5 I;  1FYS A;  1KD1 4;  3DGO A;  2CIU A;  3NX0 A;  1LRA A;  1NU3 A;  2KXG A;  3RDE A;  3CC7 3;  1LOV A;  3JUO A;  2F86 B;  4WYK A;  2OQE A;  1SAR A;  3VSY A;  2RGQ A;  2JQ5 A;  5KP3 A;  2KCD A;  1KWI A;  1QAK A;  1S5A A;  1QVF 2;  3UL5 A;  3PCS A;  3DXO A;  7STD A;  1QVG 2;  5D82 A;  3K9M C;  1CYV A;  2STD A;  3K63 A;  1A2V A;  2OOV A;  5LC6 A;  2O3O A;  1K9M 4;  1RNT A;  2RSX A;  5KP1 A;  4RNT A;  1VZZ A;  2KF6 A;  2UX0 A;  3ALA A;  4CJN A;  1GY6 A;  1FGO A;  2W6J H;  3LYG A;  5D83 A;  2CG1 A;  5ELU A;  1VQ8 3;  3KCH A;  1WMN A;  1RRL A;  4BU4 A;  4DKI A;  4N6O B;  3UNL A;  3E99 A;  1LNH A;  3OX9 A;  1GY7 A;  1GY5 A;  2CHC A;  4ILF A;  1BRJ A;  4O2H A;  1BNF A;  1DET A;  2W56 B;  3HOH A;  4O02 B;  3JUM A;  3V99 A;  5IW9 A;  3FG4 A;  1FA3 A;  1RGE A;  4I4K A;  2CFK A;  2KAA A;  5IG3 A;  3PZW A;  4GHO A;  2IUJ A;  1VQM 3;  1BSC A;  3IJE B;  3BB9 A;  3KKG A;  1V58 A;  3STD A;  1ZX2 A;  8CHO A;  2W9P A;  3G16 A;  3AGN A;  1UCL A;  1N9E A;  1BU4 A;  3G71 3;  2GSP A;  1TIJ A;  2M7O A;  3D3L A;  1BRG A;  1I3F A;  3WA3 A;  1MWS A;  4HJL B;  3BU4 A;  5AI1 A;  3CCM 3;  1OHP A;  2IY2 A;  2J8X B;  3CNM A;  3IMA B;  4HZ9 B;  1I2G A;  3H51 A;  4KVH A;  3I55 3;  4HZB B;  3N9H A;  5EQL A;  1JKG B;  1O7N B;  1TUH A;  1RGA A;  1RTU A;  4R9L A;  1RGL A;  1RHL A;  2V1L A;  3FG3 A;  1SJW A;  4HAA A;  2MC8 A;  3S28 A;  1BOX A;  2RNT A;  6GSP A;  1RGH A;  3OXA A;  1JN5 B;  5CXO A;  3I56 3;  3CCL 3;  1PYL A;  3G4S 3;  1IVV A;  4XM4 A;  4EYC A;  1Q7H A;  2IA7 A;  1BIR A;  1KC8 4;  1OF5 A;  3CCQ 3;  2WGO A;  2F5W A;  2E2U A;  1MGR A;  4JF8 A;  4AKY A;  1IT7 A;  1FGM A;  3DGN A;  1QAL A;  3EB8 A;  3M8C A;  3Q1C A;  4RBN A;  4CDL A;  1ROA A;  3U97 A;  3MG1 A;  3NXJ A;  3JUP A;  9RNT A;  1IQX A;  4N6M A;  1W02 A;  4BTX A;  4HM4 B;  4EC6 A;  1JJ2 2;  1GS3 A;  2W9Q A;  4LZI A;  3F40 A;  3F7S A;  1IVX A;  3B8L A;  3BLZ A;  4EW5 A;  1M9G A;  2B24 B;  3V92 A;  2Z77 A;  2XEP A;  1VQQ A;  7GSP A;  1M90 4;  2CKF B;  1ZGX A;  3J7Y d;  3DGY A;  3NBJ A;  3QRD A;  1T2I A;  2HMO B;  4KFD A;  1JRQ A;  1OPY A;  1YVB I;  4RZM A;  1BNG A;  3DMC A;  2XFT A;  1C54 A;  3SYU A;  3DM8 A;  5ELJ A;  3SOY A;  1VQ5 3;  4J9A A;  1GD3 A;  2IYJ A;  4R9K A;  1VQO 3;  1LOX A;  2CW9 A;  1N5P A;  2WOH A;  1NB3 I;  1W6G A;  3G8Z A;  1L5G B;  1LXE A;  3ZG5 A; 
#chains in the Genus database with same CATH homology
 3OW2 2;  5AEU B;  1UW1 A;  1G96 A;  3LOY A;  3NV0 B;  1ULJ B;  2PZV A;  1KSI A;  3FGY A;  4XBT A;  3G6E 3;  3CPO A;  4HM6 B;  3X40 A;  3OV4 A;  3CD6 3;  3EN1 B;  1DMM A;  1A90 A;  1RKY A;  2D42 A;  1EA2 A;  2P0X A;  2XGL A;  4FCZ A;  2QIY A;  3EF8 A;  5AEW B;  3TDG A;  3EJV A;  3KFQ C;  3DUK A;  3F8X A;  1N5H A;  3WDG B;  3SX1 A;  1WMO A;  3NM7 A;  3OWU A;  3PS8 A;  4RNY A;  2XR8 B;  3JVC A;  4N6U A;  4HBR A;  3GZB A;  5IG4 A;  3LZA A;  3LTA A;  4IT7 A;  2Y74 A;  3T8U A;  3SVA A;  3QK9 A;  1D6Z A;  1O7W B;  1ROV A;  2OQE C;  5KP4 A;  3ER7 A;  4XDW A;  2GXF A;  5TGN A;  1VQ9 3;  3AMO B;  4XB5 A;  3BNB A;  3NHX A;  1RRH A;  2SBL A;  3N54 B;  2BMR B;  3K0Z A;  5IF6 A;  2YX9 A;  3RGR A;  1VQN 3;  5AYS C;  4IIA A;  3N8B A;  4L8O A;  2P09 A;  4KFE A;  4FR9 A;  4K61 A;  2ZL8 A;  4EV5 A;  2C10 A;  2BMO B;  3HZP A;  4AEQ A;  2R4I A;  1W2B 2;  2XSO B;  5LC7 A;  3EBY A;  2K0M A;  3FKA A;  4FMD A;  3SLU A;  1QMA A;  2JDI H;  1MNL A;  4KFF A;  2CFG A;  4NRE A;  3PYJ A;  2D1W A;  1OF5 B;  3X41 A;  1RJO A;  2WOF A;  3JUQ A;  2HMK B;  3S29 A;  4FMC A;  5CK6 A;  4RNZ A;  1MOL A;  2CWT A;  3MG3 A;  5EEO A;  1BUQ A;  1IV7 A;  2GBX B;  1M1K 4;  3LXU X;  1D6Y A;  1TP6 A;  3EE1 A;  2XGN A;  4NHF A;  1YHQ 3;  1OHO A;  2I9W A;  1JN5 A;  3X42 A;  3FH1 A;  3WOF B;  2W56 A;  3AMO A;  2CFL A;  1FUW A;  4L8P A;  3LML A;  5AII A;  5CF2 A;  3FLJ A;  3UJM A;  5I97 A;  2WGQ A;  5IEP A;  1SPU A;  4OVM A;  2E2T A;  1JB5 A;  1CEW I;  5AIH A;  1OGX A;  1DYU A;  1YIJ 3;  3L0R A;  1JB4 A;  5HGR A;  2YFL B;  4G1M B;  4EBG A;  2BO9 B;  4XBY A;  3X3Z A;  1CYU A;  4JRF A;  4J8T A;  6STD A;  1W00 A;  1TFK A;  5IG0 A;  4FCM A;  3CCR 3;  2XH9 A;  3EHC A;  2GU1 A;  3PGB A;  3PXM A;  2E2V A;  4WYK B;  1E3R A;  1ISK A;  3VGN A;  3SOA A;  3G0K A;  1ULI B;  2P38 A;  4HM3 B;  3D9R A;  1D6U A;  3UL6 A;  3V98 A;  2ZDJ A;  4XBX A;  3MPH A;  3MWZ A;  3DGM A;  1UI8 A;  3S5C A;  3X3X A;  5IEN A;  4HM5 B;  1TU5 A;  1LVN A;  1IVW A;  4HKV B;  2Z7A A;  4R4K A;  4U13 A;  1Q81 4;  3NBB A;  1C7H A;  1VQ7 3;  1OAC A;  1W5Z A;  2CWV A;  1AV4 A;  3NV0 A;  2QGU A;  5A0O B;  3GZX B;  5AIG A;  3GAX A;  1U5O A;  2WO0 A;  3MG2 A;  3CPW 2;  3CU3 A;  1JV2 B;  4K90 B;  2IMJ A;  3CC2 3;  3LT9 A;  3I0Y A;  1HKX A;  2BT3 A;  4X2H A;  1SIH A;  3S27 A;  5JPP A;  1IK3 A;  4LSO A;  1WQL B;  1E3V A;  2ML6 A;  1YJN 3;  1UUV B;  3K7C A;  4FMB A;  4Q53 A;  5FGO A;  3RGA A;  1N8R 4;  1M1X B;  2GU3 A;  2XFS A;  1EG9 B;  1TFO A;  3DZL A;  2YFJ B;  1N8Q A;  2RCD A;  1IV9 A;  1OCV A;  2BMQ B;  1US1 A;  2HML B;  1W6Y A;  1STD A;  4R1K A;  2FGT A;  3PCR A;  4MMX B;  4CCV A;  4K1V A;  4MEI A;  5DRV A;  3CNX A;  4FMA A;  1UUW B;  3ECF A;  4FCJ A;  1PU4 A;  2CC3 A;  2Z6B A;  1IU7 A;  2C11 A;  2HMJ B;  3K5T A;  1W01 A;  1S72 3;  5FW5 A;  2OTJ 3;  1IDP A;  1VQ6 3;  2QA4 3;  2MF7 A;  3CCU 3;  2OOV C;  1LXE A;  1OUN A;  2P0M A;  5STD A;  1IQY A;  1Y4K A;  4GL6 A;  1HU9 A;  4IPB A;  3B4P A;  1W4N A;  3BND A;  3T8N A;  1GYB A;  3CME 3;  3CCV 3;  4HYZ A;  1T5Y A;  4GB5 A;  1Q40 A;  4O3V A;  4HM7 B;  3BNC A;  3F7X A;  5D81 A;  3EBT A;  3MKI A;  2FXT A;  1U8C B;  1IQ8 A;  2W04 A;  1O7G B;  1OGZ A;  4H61 A;  2XF3 A;  1Z1S A;  4BTW A;  4LMI A;  3NBR A;  4R80 A;  3LTC A;  1GD4 A;  3F14 A;  2A15 A;  1YIT 3;  4X2O A;  1VQP 3;  1VQL 3;  1PFP A;  1VQK 3;  4EV2 A;  3CC4 3;  3HI7 A;  3WOD G;  2QEX 3;  2OCT A;  3A76 A;  3F9S A;  5IEO A;  1NWW A;  3O8Y A;  2W0Q A;  1YJ9 3;  3NQZ A;  3GZR A;  4OUQ A;  3DY5 A;  3SED A;  3GRD A;  1A67 A;  3HK4 A;  2PNC A;  3KSP A;  4HM2 B;  4ZM8 A;  1Q82 4;  1AVK A;  2HMM B;  4MMZ B;  1VQ4 3;  1W7C A;  4ORL A;  2FNQ A;  1JB2 A;  1YJW 3;  3KN4 A;  5IER A;  4QWT A;  3GWR A;  5CLK A;  4EXR A;  1K73 4;  1Q86 4;  1K41 A;  3NQY A;  1WMP A;  1O7M B;  5AIF A;  3UB1 A;  3WA2 X;  1WTH A;  4N3V A;  1SII A;  3MYT A;  4TX4 A;  1YGE A;  4LGQ A;  3HII A;  1DMQ A;  3HIG A;  1Q42 A;  1N9J A;  1EQK A;  2XRX B;  3FZW A;  4HM1 B;  5BVB A;  4HVN A;  2CFD A;  3KII A;  2RFR A;  4HM8 B;  1IVU A;  1J2B A;  5BXQ A;  3IPT A;  3LTB A;  3F8H A;  2B1X B;  1STF I;  3B7C A;  1JNQ A;  3BNE A;  2P05 A;  2K54 A;  2OWP A;  3WMD A;  2BNG A;  2OTL 3;  5CF1 A;  2CH9 A;  2HMN B;  4BTY A;  1K8A 4;  2CFW A;  1KQS 2;  3CCE 3;  2GEY A;  3CMA 3;  4OK0 A;  3NM2 A;  1YI2 3;  3B4O A;  3FCS B;  3WOE B;  2Z76 A;  1A2K A;  3OWS A;  1QJG A;  1V74 A;  3MHE A;  3EN8 A;  4WWU C;  1WNH A;  3KZT A;  4WP5 A;  4XDV A;  3EX9 A;  4N6L A;  1OHS A;  2Q07 A;  1UI7 A;  4N6N B;  2IUK A;  2LQV A;  1JKG A;  3CXC 2;  4MJD A;  4WFO A;  3JUN A;  3U1W A;  1NDO B;  2W2C A;  1EKM A;  4WHA A;  5DRE A;  4O8S A;  4STD A;  3LTD A;  2W03 A;  5EVH A;  1DVC A;  1CQS A;  4N6T A;  3SXX A;  1O7H B;  2Y73 A;  1E97 A;  4K1U A;  3Q2P A;  4MMY B;  3X3Y A;  1OH0 A;  1R4C A;  2LYX A;  3VF1 A;  3FG1 A;  2O9U X;  3FF0 A;  5IG5 A;  2L4V A;  1FGQ A;  2YFI B;  1Q40 B;  1O7P B;  3CCJ 3;  3H3H A;  1AR0 A;  3KSE D;  1RN7 A;  3ROB A;  1NJI 4;  3Q90 A;  2XSH B;  1W2Z A;  4LEH A;  3MSO A;  1DVD A;  2INX A;  3S67 A;  5AYR B;  1SQW A;  1QAF A;  1FGT A;  2ML5 A;  1ASK A;  1F8N A;  1Q7Y 4;  3FF2 A;  2CG0 A;  4AKZ A;  1DMN A;  3FSD A;  4PEJ A;  4L7K A;  1ZO2 A;  1NO3 A;  3CCS 3;  2BHM A;  2KRT A;  4N6V 0;  4H3U A;  4KZ1 A;  2F99 A;  3KE7 A;  1K28 A;  1FGR A;  5JBS A;  2CK3 H;  3NUV A;  3OWY A;  2GEX A;  1IT8 A;  3LH4 A;  2F98 A;  3T0U A;  3DGL A;  3HX8 A;  3EQQ B;  2GBW B;  5G2G A;  2CWU A;  3GZY B;  1AVL A;  1W6C A;  3LT8 A;  5JPU A;  4HM0 B;  1NB5 I;  1KD1 4;  3DGO A;  2CIU A;  3NX0 A;  2KXG A;  1NU3 A;  3CC7 3;  3RDE A;  3JUO A;  2F86 B;  4WYK A;  2OQE A;  3VSY A;  2RGQ A;  2JQ5 A;  5KP3 A;  2KCD A;  1KWI A;  1QAK A;  1S5A A;  1QVF 2;  3UL5 A;  3PCS A;  3DXO A;  7STD A;  1QVG 2;  5D82 A;  3K9M C;  1CYV A;  2STD A;  3K63 A;  1A2V A;  2OOV A;  5LC6 A;  2O3O A;  1K9M 4;  2RSX A;  5KP1 A;  1VZZ A;  2UX0 A;  3ALA A;  1GY6 A;  1FGO A;  2W6J H;  3LYG A;  5D83 A;  2CG1 A;  5ELU A;  1VQ8 3;  1WMN A;  1RRL A;  4N6O B;  3UNL A;  3E99 A;  1LNH A;  3OX9 A;  1GY7 A;  1GY5 A;  2CHC A;  4O2H A;  2W56 B;  4O02 B;  3JUM A;  3V99 A;  5IW9 A;  3FG4 A;  1FA3 A;  4I4K A;  2CFK A;  5IG3 A;  3PZW A;  2IUJ A;  1VQM 3;  3IJE B;  3BB9 A;  3KKG A;  3STD A;  8CHO A;  1ZX2 A;  2W9P A;  3G16 A;  1N9E A;  3G71 3;  1TIJ A;  2M7O A;  3D3L A;  3WA3 A;  4HJL B;  5AI1 A;  3CCM 3;  1OHP A;  3CNM A;  3I55 3;  3IMA B;  4HZ9 B;  3H51 A;  4KVH A;  4HZB B;  3N9H A;  5EQL A;  1JKG B;  1O7N B;  1TUH A;  4R9L A;  2MC8 A;  2V1L A;  3FG3 A;  3S28 A;  1SJW A;  3OXA A;  1JN5 B;  5CXO A;  3I56 3;  3CCL 3;  3G4S 3;  1IVV A;  4XM4 A;  4EYC A;  2IA7 A;  1KC8 4;  1OF5 A;  3CCQ 3;  2WGO A;  2E2U A;  4JF8 A;  4AKY A;  1IT7 A;  1FGM A;  3DGN A;  1QAL A;  3EB8 A;  3M8C A;  3Q1C A;  4RBN A;  4CDL A;  1ROA A;  3U97 A;  3MG1 A;  3NXJ A;  3JUP A;  1IQX A;  4N6M A;  1W02 A;  4BTX A;  4HM4 B;  4EC6 A;  1JJ2 2;  1GS3 A;  2W9Q A;  4LZI A;  3F40 A;  3F7S A;  1IVX A;  3B8L A;  3BLZ A;  1M9G A;  2B24 B;  3V92 A;  2Z77 A;  2XEP A;  1M90 4;  2CKF B;  3J7Y d;  3NBJ A;  3QRD A;  2HMO B;  4KFD A;  1JRQ A;  1OPY A;  1YVB I;  4RZM A;  3DMC A;  2XFT A;  3DM8 A;  5ELJ A;  3SOY A;  1VQ5 3;  4J9A A;  1GD3 A;  4R9K A;  1VQO 3;  1LOX A;  2CW9 A;  1N5P A;  2WOH A;  1NB3 I;  1W6G A;  3G8Z A;  1L5G B;  3EC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...