1UW1A

A novel adp- and zinc-binding fold from function-directed in vitro evolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
DDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)
publication title A Novel Adp- and Zinc-Binding Fold from Function-Directed in Vitro Evolution
pubmed doi rcsb
source organism Synthetic construct
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uw1A00
3DGNA 2P09A 1UW1A 3DGLA 3LTAA 3LTCA 2P05A 3DGOA 3LT8A 3LTDA 3DGMA 3LT9A 3LTBA 2P0XA
chains in the Genus database with same CATH superfamily
1GOYA 1VQQA 1VQ93 1BSBA 3CXC2 1I0XA 3HK4A 1U8CB 3PZWA 3U97A 4N6TA 3ALAA 3WODG 3CCQ3 1X1WA 3OWYA 4RBNA 2INXA 2KF4A 2STDA 1SIIA 3HIGA 3DUKA 2XH9A 3LT8A 1HKXA 1TFKA 3OWUA 5CF1A 1US1A 4XDWA 2SBLA 4MMYB 5TGNA 1BIRA 1B2SA 5IF6A 1GOUA 3ZFZA 1DVDA 1BSCA 3N54B 1Y4KA 3H51A 3KZTA 4FMCA 3S5CA 2H0IA 1B2MA 1JJ22 3JUQA 3WOFB 7GSPA 4HKVB 1W2ZA 2ML5A 3A76A 1G02A 4FMDA 3KCHA 1PYLA 4EV2A 1RGFA 2GBXB 5G2GA 2K3DA 2P38A 1W5ZA 2H0HA 1UGHI 4XBXA 5JPPA 1NWWA 1UW1A 1A2KA 1WMPA 2FGTA 4TX4A 3V92A 3T8UA 1IVVA 2YX9A 3EBTA 3DGMA 4R1KA 3LT9A 3TDGA 3ZG0A 3EE1A 1W00A 1OH0A 2F5WA 1V57A 1MWUA 3AHSA 1CYVA 2CWVA 2WOHA 3MKIA 3CCU3 2XR8B 4CCVA 1NB3I 1X1UA 2W2CA 2W56A 1LNHA 1BNFA 1WNHA 1YHQ3 3LTDA 1RN1A 3SOAA 1TIJA 3NV0A 4HAAA 1BRSA 4MMXB 2W04A 4EXRA 1AQZA 1RDSA 3LOYA 5EQLA 4FCMA 3NBBA 4O8SA 2AAEA 3UJMA 5KP3A 3EB8A 1CQSA 4RZMA 1BRNL 4XBYA 2GU1A 2GU3A 1RGLA 3LTAA 1TUHA 1KC84 1JB2A 3KSPA 1NJI4 4O02B 1G96A 1Q9EA 5JPUA 3BNBA 1RSNA 3AMOA 2JDIH 4LYLB 1BGSA 3UL5A 2HMKB 4HJLB 1JKGB 2GSPA 8RNTA 2AADA 3F8XA 1N5HA 1E3VA 3BNEA 3MG3A 3Q2PA 3X3ZA 4GHOA 2MC8A 1CEWI 1N5PA 3I563 2V1LA 3WOEB 5IG4A 4FR9A 3PS8A 2IA7A 1JRQA 1O7MB 5DREA 4WP5A 4BL3A 1V58A 2BU4A 4L7KA 1IK3A 5FGOA 3MG1A 4KZ1A 3URPA 1N9EA 1X1XA 1VQ53 1GD3A 4EW5A 4HM8B 1VQL3 2CC3A 3NQZA 1PU4A 3GWRA 3O8YA 5LC6A 1W6YA 1I8VA 4N3VA 1UCKA 5BXQA 1UGIA 3F7XA 3OWSA 1I2GA 1YJN3 2W9QA 4XM4A 1J2BA 3F8HA 3EC9A 1T2HA 3FF2A 1HYFA 1YVBI 3L0RA 2B24B 5IEPA 1ZX2A 1I3FA 4I5QA 1AVKA 4LZIA 1IT7A 1JNQA 1IV9A 2GEYA 3E99A 4WYKB 1M904 3EF8A 3X3YA 3Q90A 1BNRA 3G8ZA 3HIIA 3MPHA 5BIRA 3DMCA 4N6OB 1TU5A 1JBSA 1PFPA 3UNLA 3I553 1I3IA 2XGLA 2L1SA 3PXMA 1RCKA 2CFWA 1ROVA 1MGRA 2XSOB 3D5IA 3F40A 2CH9A 1OF5B 1EKMA 1VQ83 3UB1A 3BB9A 3LXUX 4HM6B 3CNMA 3FG4A 2YFLB 3QK9A 4MMZB 3K7CA 2LYXA 3H3HA 1GY5A 2R41A 1R4CA 3Q3FA 2CFGA 3CC23 4J5KA 4OUQA 3K63A 1MWTA 1QJGA 2OOVA 2R4IA 1UI8A 3FKAA 3KSED 5IW9A 4DKIA 1UCIA 2F4YA 4CDLA 2GXFA 1FUTA 1C54A 4JRFA 3JUPA 4LMIA 2W6JH 4XB5A 1FUSA 3X42A 1IV7A 2OTL3 1BU4A 5IENA 2BMQB 3K0ZA 1VQO3 2C4BA 1KWIA 1YNVX 4HM0B 2XEPA 1TFOA 3EJVA 4QWTA 4X2HA 5IERA 6RNTA 2CFLA 2QA43 1DYUA 2CG1A 1RN7A 4MEIA 4O2HA 2D42A 4N6UA 3WA2X 1TJDA 3SXXA 1G0TA 1EEJA 2BMRB 3F7SA 1BNIA 1BNEA 5D82A 3ZG5A 1IDPA 3GZYB 2W0QA 2ZHXB 4BTWA 1BRGA 3VF1A 1I0VA 2K0MA 1IQYA 3N9HA 1SPUA 3AGOA 1SJWA 1Q824 1GOVA 4J9AA 3LH4A 1MWSA 2O9UX 4R9KA 3CU3A 3K9MC 1IT8A 5JBSA 1RLSA 3FZWA 2P05A 3LMLA 1YGWA 3MG2A 1O7GB 2KRTA 3X40A 1EG9B 3Q1CA 4BTXA 2O3OA 1K41A 2ZA4A 1DE3A 7STDA 1A2VA 2Y73A 3RGRA 1JBTA 3A5EA 1DMQA 2ZL8A 3D4AA 2QIYA 3OX9A 3VSYA 1A90A 3MSOA 4RNTA 5G1KA 4I4KA 1JB4A 5IG5A 1M1XB 4HM4B 1A2PA 4EBGA 1AV4A 3VGNA 3G4S3 3PGBA 3SX1A 1GMPA 3EN8A 2KF3A 1CYUA 1EQKA 2MF7A 2YFIB 1BUJA 1VQ63 5FW5A 1FA3A 4KT3B 3D9RA 3LTCA 1FGMA 3BU4A 4O3VA 1QAKA 1LNIA 1GMRA 1BSDA 1T5YA 1VQ43 1MOLA 2W56B 4KFFA 3G713 2CHCA 3SOYA 3T8NA 1GSPA 1KQS2 4HYZA 3ECFA 9RNTA 1N9JA 1Q42A 3NV0B 3CC73 1YJW3 3NHXA 1RCLA 3SVAA 1B20A 4JF8A 3KKGA 2CW9A 2F56A 2XRXB 3GSPA 2SARA 5CXOA 2JQ5A 4KFEA 1E97A 2RGQA 1W6CA 1HZ1A 1CH0A 2XF3A 4K1UA 3RNTA 1ZO2A 3QRDA 3JUMA 3BIRA 1ZGXA 1W6GA 3AMOB 4J8TA 4K1VA 1OGXA 4KVHA 1QAFA 3X3XA 2IYJA 3DY5A 5HGRA 5CLKA 3CCM3 4EC6A 2BT3A 1AR0A 3F14A 3GZXB 4ORLA 1IU7A 1OACA 4XDVA 2FNQA 1JZOA 1GS3A 4FCZA 8CHOA 3K5TA 1UUWB 3DGYA 5AYRB 2OCTA 3HX8A 2UX0A 1RKYA 1YGEA 4FMBA 4BTYA 1YVSA 2UGIA 1OUNA 2F5MA 2BO9B 5M19A 1GMQA 1X1YA 3S27A 2PNCA 1Z1SA 2PZVA 2P0MA 2M7OA 3EQQB 3CNXA 4EYCA 2E2VA 2RSXA 1WMNA 1BRIA 4EV5A 1WQLB 1SIHA 2KF5A 3ER7A 1V74A 1ASKA 4IPBA 3OW22 1Q40A 1OPYA 1JV2B 4K61A 3MWZA 1UCJA 1DVCA 1OGZA 2IMJA 3JVCA 4OK0A 5CK6A 3IPTA 4N6MA 2RNTA 2OWPA 3HZPA 3PCRA 2CKFB 1RN4A 1R4YA 1BVIA 2K54A 2Z76A 3NQYA 1RTUA 4GB5A 1STFI 5IG3A 3CC43 4HM2B 1K28A 1O7NB 1OHSA 1N8R4 3GZRA 1O7PB 4IIAA 3BLZA 1YJ93 1Q7Y4 1I2EA 2KXGA 1C7HA 2WGOA 5ELUA 1YIT3 1DMNA 1A67A 1HU9A 1BNGA 2W9PA 5D83A 4LSOA 1B21A 2XFTA 2KF6A 3CME3 4OVMA 4R80A 1BOXA 2F99A 1O7WB 2CFKA 1FGRA 1DMMA 4HM1B 3RDEA 1I2FA 3GAXA 4ZM8A 3LTBA 4ILFA 2GEXA 1K9M4 1OHOA 1E3RA 1AVLA 1BRJA 2ML6A 3X41A 2Z6BA 4CPKA 5I97A 3WMDA 2Z7AA 1B2XA 1JB5A 2IUJA 5KP1A 3I0YA 1LOVA 1JN5A 1UI7A 4MJDA 5AEWB 2D1WA 1BRKA 3D79A 4HOHA 1W4NA 3G0KA 3NX0A 4HM5B 1ULJB 3DM8A 5M1AA 1NDOB 4AEQA 1RRHA 1UCLA 1D6ZA 1WMOA 3PCSA 4IT7A 3SEDA 3IJEB 6GSPA 1IVXA 1B27A 3DGLA 3CCV3 1ISKA 1NU3A 1UDII 3CPOA 2RFRA 5CF2A 2KCDA 2YFJB 3WA3A 1JBRA 2HMJB 4GSPA 2B1XB 3CCE3 2CWUA 2CFDA 3U1WA 3B4OA 3KN4A 1M1K4 2C10A 1RHLA 1RGHA 2HMMB 1TRQA 1GY7A 3JUNA 3WHOA 1B2ZA 1QVF2 3D5GA 5AIGA 1VQM3 2FXTA 1S723 7RNTA 2L4VA 3HOHA 2BNGA 2IY2A 2E2UA 3NBRA 1NO3A 4R4KA 2Y74A 3DZLA 1S5AA 1UUVB 4L8OA 1LXEA 3FGYA 5IG0A 1IYYA 5BU4A 5AYSC 4WFOA 1W2B2 3CD63 4BL2A 2WGQA 2I9WA 2HMLB 3SYUA 3FSDA 4AKYA 5STDA 1NB5I 1ULIB 1W7CA 5AIHA 3ROBA 1NNVA 2CX0A 2XSHB 3OV4A 4H3UA 5A0OB 4AKZA 5DRVA 5BVBA 1QVG2 1RGGA 3KE7A 1YI23 1GYBA 3GZBA 3EN1B 1VZZA 3B8LA 3FCSB 3DXOA 2CWTA 1I70A 5AEUB 5M18A 1VQ73 1N8QA 3G16A 4X2OA 3NUVA 2UUGC 3B7CA 2OQEC 5G1LA 1BUQA 1LQMB 2BMOB 3MYTA 1VQK3 3CMA3 1QMAA 4RNZA 4R9LA 3FG1A 4LEHA 1IQ8A 1LVNA 3FG3A 5D81A 1K8A4 1RNTA 3F9SA 4NHFA 1M9GA 2IUKA 1D6UA 3LZAA 5HOHA 5LC7A 2GBWB 3EX9A 1W02A 4GL6A 3JUOA 4FCJA 4STDA 2ZDJA 3NM2A 2RBIA 1JKGA 3T0UA 5EVHA 5ELJA 1FGOA 1O7HB 1PY3A 2BIRA 1GY6A 4BIRA 1RGEA 3S28A 1FZUA 3S29A 4K90B 1RGCA 1D6YA 1F8NA 1FGQA 2CIUA 3EBYA 3PYJA 1TRPA 1EA2A 3FH1A 3OXAA 1K734 3CCS3 1TP6A 1GD4A 1FUWA 1IQXA 3UL6A 4BU4A 1RNBA 3WR2A 4HZ9B 2A15A 1ROAA 3KFQC 1RGAA 2OOVC 1KSIA 1W01A 3V99A 3G6E3 2C11A 4HM3B 1FW7A 1BAOA 3EHCA 4N6LA 4PEJA 4U13A 3NXJA 5GSPA 3IMAB 4WHAA 4CJNA 3J7Yd 2Q07A 4N6V0 1VQN3 1QALA 1RJOA 1TTOA 2P0XA 2E2TA 1BNJA 1RRLA 2P09A 1MWRA 4HBRA 1U5OA 4WYKA 1UUGB 2OQEA 5RNTA 1LQGC 1LRAA 5IEOA 4HM7B 1JZDA 5EEOA 1FYSA 3V98A 1BSEA 1RMSA 3CCJ3 2CG0A 1OCVA 2HMNB 1Q7HA 3BNCA 1T2IA 1Q40B 1T3BA 3B4PA 3KIIA 2F86B 1LOYA 3LYGA 1ZS7A 1OF5A 1SQWA 1IVUA 3RGAA 2QGUA 4NREA 4RNYA 4L8PA 2RCDA 2F98A 2BHMA 3FF0A 3MHEA 1YIJ3 3SLUA 1RGKA 4Q53A 3GRDA 5AIFA 1FGTA 3AGNA 3HI7A 6STDA 4H61A 1STDA 3BNDA 1BNSA 4N6NB 4KFDA 4WWUC 1LOWA 2XFSA 2CK3H 4LGQA 3WDGB 3DGOA 3CPW2 1VQP3 1Q864 5AI1A 1WTHA 2XGNA 2W03A 3D3LA 1MGWA 4HVNA 2Z77A 2CX1A 3M8CA 2OTJ3 3STDA 1L5GB 1BANA 2QEX3 3NBJA 1MNLA 1EUIC 3AHWA 3CCL3 1Q814 3NM7A 1BSAA 1B3SA 2WOFA 4NPBA 3FLJA 1IVWA 2HMOB 5KP4A 1KD14 2KAAA 1BRHA 4XBTA 1OHPA 5AIIA 4FMAA 4G1MB 1SARA 4HZBB 1AY7A 2J8XB 1B2UA 2LQVA 2H0GA 1JN5B 2WO0A 3DH2A 3DGNA 2HOHA 3N8BA 3CCR3 1LOXA 3S67A 1DETA 4J5GA
chains in the Genus database with same CATH topology
1VQ93 3CXC2 3HK4A 1U8CB 3PZWA 3U97A 4N6TA 3ALAA 3WODG 3CCQ3 3OWYA 4RBNA 2INXA 2STDA 1SIIA 3HIGA 3DUKA 2XH9A 3LT8A 1HKXA 1TFKA 3OWUA 5CF1A 1US1A 4XDWA 2SBLA 4MMYB 5TGNA 5IF6A 1DVDA 3N54B 1Y4KA 3H51A 3KZTA 4FMCA 3S5CA 1JJ22 3JUQA 3WOFB 4HKVB 1W2ZA 2ML5A 3A76A 4FMDA 4EV2A 2GBXB 5G2GA 2P38A 1W5ZA 4XBXA 5JPPA 1NWWA 1UW1A 1A2KA 1WMPA 2FGTA 4TX4A 3V92A 3T8UA 1IVVA 2YX9A 3EBTA 3DGMA 4R1KA 3LT9A 3TDGA 3EE1A 1W00A 1OH0A 1CYVA 2CWVA 2WOHA 3MKIA 3CCU3 2XR8B 4CCVA 1NB3I 2W2CA 2W56A 1LNHA 1WNHA 1YHQ3 3LTDA 3SOAA 1TIJA 3NV0A 4EXRA 4MMXB 2W04A 3LOYA 5EQLA 4FCMA 3NBBA 4O8SA 3UJMA 5KP3A 3EB8A 1CQSA 4RZMA 4XBYA 2GU1A 2GU3A 3LTAA 1TUHA 1KC84 1JB2A 3KSPA 1NJI4 4O02B 1G96A 5JPUA 3BNBA 3AMOA 2JDIH 3UL5A 2HMKB 4HJLB 1JKGB 3F8XA 3MG3A 1N5HA 1E3VA 3BNEA 3Q2PA 3X3ZA 2MC8A 1CEWI 1N5PA 3I563 2V1LA 3WOEB 5IG4A 4FR9A 3PS8A 2IA7A 1JRQA 1O7MB 5DREA 4WP5A 1IK3A 4L7KA 5FGOA 3MG1A 4KZ1A 1N9EA 1VQ53 1GD3A 4HM8B 1VQL3 2CC3A 3NQZA 1PU4A 3GWRA 3O8YA 5LC6A 1W6YA 4N3VA 5BXQA 3F7XA 3OWSA 1YJN3 2W9QA 4XM4A 1J2BA 3F8HA 3EC9A 3FF2A 1YVBI 3L0RA 2B24B 5IEPA 1ZX2A 1AVKA 4LZIA 1IT7A 1JNQA 1IV9A 2GEYA 3E99A 4WYKB 1M904 3EF8A 3X3YA 3Q90A 3G8ZA 3HIIA 3MPHA 3DMCA 4N6OB 1TU5A 1PFPA 3UNLA 3I553 2XGLA 3PXMA 2CFWA 1ROVA 2XSOB 3F40A 2CH9A 1OF5B 1EKMA 3UB1A 3BB9A 3LXUX 4HM6B 3CNMA 3FG4A 2YFLB 3QK9A 4MMZB 3K7CA 2LYXA 3H3HA 1GY5A 1R4CA 2CFGA 3CC23 4OUQA 3K63A 1QJGA 2OOVA 2R4IA 1UI8A 3FKAA 3KSED 5IW9A 4CDLA 2GXFA 4JRFA 3JUPA 4LMIA 2W6JH 4XB5A 3X42A 2OTL3 1IV7A 5IENA 2BMQB 3K0ZA 1VQO3 1KWIA 4HM0B 2XEPA 1TFOA 3EJVA 4QWTA 4X2HA 5IERA 2CFLA 2QA43 1DYUA 2CG1A 1RN7A 4MEIA 4O2HA 2D42A 4N6UA 3WA2X 3SXXA 2BMRB 3F7SA 5D82A 1IDPA 3GZYB 2W0QA 4BTWA 3VF1A 2K0MA 1IQYA 3N9HA 1SPUA 1SJWA 1Q824 4J9AA 3LH4A 2O9UX 4R9KA 3CU3A 3K9MC 1IT8A 5JBSA 3FZWA 3MG2A 2P05A 3LMLA 1VQ83 1O7GB 2KRTA 3X40A 1EG9B 3Q1CA 4BTXA 2O3OA 1K41A 7STDA 1A2VA 2Y73A 3RGRA 1DMQA 2ZL8A 1A90A 2QIYA 3OX9A 3VSYA 3MSOA 4I4KA 1JB4A 5IG5A 1M1XB 4HM4B 4EBGA 1AV4A 3VGNA 3G4S3 3PGBA 3SX1A 3EN8A 1CYUA 1EQKA 2MF7A 2YFIB 1VQ63 5FW5A 1FA3A 3D9RA 3LTCA 1FGMA 4O3VA 1QAKA 1T5YA 1VQ43 1MOLA 2W56B 4KFFA 3G713 2CHCA 3SOYA 3T8NA 1KQS2 4HYZA 3ECFA 1N9JA 1Q42A 3NV0B 3CC73 1YJW3 3NHXA 3SVAA 4JF8A 3KKGA 2CW9A 2XRXB 5CXOA 2JQ5A 4KFEA 1E97A 2RGQA 1W6CA 4K1UA 2XF3A 1ZO2A 3QRDA 3JUMA 1W6GA 3AMOB 4J8TA 4K1VA 1OGXA 4KVHA 1QAFA 3X3XA 3CCM3 3DY5A 5HGRA 5CLKA 4EC6A 2BT3A 1AR0A 3F14A 3GZXB 4ORLA 1IU7A 1OACA 4XDVA 2FNQA 1GS3A 4FCZA 8CHOA 3K5TA 1UUWB 5AYRB 2OCTA 3HX8A 2UX0A 1RKYA 1YGEA 4FMBA 4BTYA 1OUNA 2BO9B 3S27A 2PNCA 1Z1SA 2PZVA 2P0MA 2M7OA 3EQQB 3CNXA 4EYCA 2E2VA 2RSXA 1WMNA 4EV5A 1WQLB 1SIHA 3ER7A 1V74A 1ASKA 4IPBA 3OW22 1Q40A 1OPYA 1JV2B 4K61A 3MWZA 1DVCA 1OGZA 2IMJA 3JVCA 4OK0A 5CK6A 3IPTA 4N6MA 2OWPA 3HZPA 3PCRA 2CKFB 3NQYA 2K54A 2Z76A 5IG3A 4GB5A 1STFI 3CC43 4HM2B 1K28A 1O7NB 1OHSA 1N8R4 3GZRA 1O7PB 4IIAA 3BLZA 1YJ93 1Q7Y4 2KXGA 1C7HA 2WGOA 5ELUA 1YIT3 1DMNA 1A67A 1HU9A 2W9PA 5D83A 4LSOA 2XFTA 3CME3 4OVMA 4R80A 2F99A 1O7WB 2CFKA 1FGRA 1DMMA 4HM1B 3RDEA 4ZM8A 3GAXA 3LTBA 2GEXA 1K9M4 1OHOA 1E3RA 1AVLA 3X41A 2ML6A 2Z6BA 5I97A 3WMDA 2Z7AA 1JB5A 5KP1A 2IUJA 3I0YA 5AEWB 1JN5A 1UI7A 4MJDA 2D1WA 1W4NA 3G0KA 3NX0A 4HM5B 1ULJB 3DM8A 1NDOB 4AEQA 1RRHA 1D6ZA 1WMOA 3PCSA 4IT7A 3SEDA 3IJEB 1IVXA 3DGLA 3CCV3 1ISKA 1NU3A 3CPOA 2RFRA 5CF2A 2KCDA 2YFJB 3WA3A 2HMJB 3CCE3 2B1XB 2CWUA 2CFDA 3U1WA 3B4OA 3KN4A 1M1K4 2C10A 2HMMB 1GY7A 3JUNA 1QVF2 5AIGA 1VQM3 1S723 2FXTA 2L4VA 2BNGA 2E2UA 3NBRA 1NO3A 4R4KA 2Y74A 3DZLA 1S5AA 1UUVB 4L8OA 1LXEA 3FGYA 5IG0A 5AYSC 4WFOA 1W2B2 3CD63 2WGQA 2I9WA 2HMLB 3FSDA 4AKYA 5STDA 1NB5I 1ULIB 1W7CA 5AIHA 3ROBA 3OV4A 2XSHB 4H3UA 5A0OB 4AKZA 5DRVA 5BVBA 1QVG2 3KE7A 1YI23 1GYBA 3GZBA 3EN1B 1VZZA 3B8LA 3FCSB 3DXOA 2CWTA 5AEUB 1VQ73 1N8QA 3G16A 4X2OA 3NUVA 3B7CA 2OQEC 1BUQA 2BMOB 3MYTA 1VQK3 3CMA3 1QMAA 4RNZA 4R9LA 3FG1A 4LEHA 1IQ8A 1LVNA 3FG3A 5D81A 1K8A4 3F9SA 4NHFA 1M9GA 2IUKA 1D6UA 3LZAA 5LC7A 2GBWB 3EX9A 1W02A 4GL6A 3JUOA 4FCJA 4STDA 2ZDJA 3NM2A 1JKGA 3T0UA 5EVHA 5ELJA 1FGOA 1O7HB 1GY6A 3S28A 3S29A 4K90B 1D6YA 1F8NA 1FGQA 2CIUA 3EBYA 3PYJA 1EA2A 3FH1A 3OXAA 1K734 3CCS3 1TP6A 1GD4A 1FUWA 1IQXA 3UL6A 4HZ9B 2A15A 1ROAA 3KFQC 2OOVC 1KSIA 1W01A 3V99A 3G6E3 2C11A 4HM3B 3EHCA 4N6LA 4PEJA 4U13A 3NXJA 3J7Yd 3IMAB 4WHAA 2Q07A 4N6V0 1VQN3 1QALA 1RJOA 2P0XA 2E2TA 2P09A 1RRLA 4HBRA 1U5OA 4WYKA 2OQEA 5IEOA 4HM7B 5EEOA 3V98A 3CCJ3 2CG0A 1OCVA 2HMNB 3BNCA 1Q40B 3B4PA 3KIIA 2F86B 3LYGA 1OF5A 1SQWA 1IVUA 3RGAA 2QGUA 4NREA 4RNYA 4L8PA 2RCDA 2F98A 2BHMA 3FF0A 3MHEA 1YIJ3 3SLUA 4Q53A 3GRDA 5AIFA 1FGTA 3HI7A 6STDA 4H61A 1STDA 3BNDA 4N6NB 4KFDA 4WWUC 2XFSA 2CK3H 4LGQA 3WDGB 3DGOA 3CPW2 1VQP3 1Q864 5AI1A 1WTHA 2XGNA 2W03A 3D3LA 4HVNA 2OTJ3 2Z77A 3M8CA 3STDA 1L5GB 2QEX3 3NBJA 1MNLA 3CCL3 1Q814 3NM7A 2WOFA 3FLJA 1IVWA 2HMOB 5KP4A 1KD14 4XBTA 1OHPA 5AIIA 4FMAA 4G1MB 4HZBB 2LQVA 1JN5B 2WO0A 3N8BA 3DGNA 3CCR3 1LOXA 3S67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  2P09 A;  1UW1 A;  3DGL A;  3LTA A;  3LTC A;  2P05 A;  3DGO A;  3LT8 A;  3LTD A;  3DGM A;  3LT9 A;  3LTB A;  2P0X A; 
#chains in the Genus database with same CATH topology
 1GOY A;  1VQQ A;  1VQ9 3;  1BSB A;  3CXC 2;  1I0X A;  3HK4 A;  1U8C B;  3PZW A;  3U97 A;  4N6T A;  3ALA A;  3WOD G;  3CCQ 3;  1X1W A;  3OWY A;  4RBN A;  2INX A;  2KF4 A;  2STD A;  1SII A;  3HIG A;  3DUK A;  2XH9 A;  3LT8 A;  1HKX A;  1TFK A;  3OWU A;  5CF1 A;  1US1 A;  4XDW A;  2SBL A;  4MMY B;  5TGN A;  1BIR A;  1B2S A;  5IF6 A;  1GOU A;  3ZFZ A;  1DVD A;  1BSC A;  3N54 B;  1Y4K A;  3H51 A;  3KZT A;  4FMC A;  3S5C A;  2H0I A;  1B2M A;  1JJ2 2;  3JUQ A;  3WOF B;  7GSP A;  4HKV B;  1W2Z A;  2ML5 A;  3A76 A;  1G02 A;  4FMD A;  3KCH A;  1PYL A;  4EV2 A;  1RGF A;  2GBX B;  5G2G A;  2K3D A;  2P38 A;  1W5Z A;  2H0H A;  1UGH I;  4XBX A;  5JPP A;  1NWW A;  1UW1 A;  1A2K A;  1WMP A;  2FGT A;  4TX4 A;  3V92 A;  3T8U A;  1IVV A;  2YX9 A;  3EBT A;  3DGM A;  4R1K A;  3LT9 A;  3TDG A;  3ZG0 A;  3EE1 A;  1W00 A;  1OH0 A;  2F5W A;  1V57 A;  1MWU A;  3AHS A;  1CYV A;  2CWV A;  2WOH A;  3MKI A;  3CCU 3;  2XR8 B;  4CCV A;  1NB3 I;  1X1U A;  2W2C A;  2W56 A;  1LNH A;  1BNF A;  1WNH A;  1YHQ 3;  3LTD A;  1RN1 A;  3SOA A;  1TIJ A;  3NV0 A;  4HAA A;  1BRS A;  4MMX B;  2W04 A;  4EXR A;  1AQZ A;  1RDS A;  3LOY A;  5EQL A;  4FCM A;  3NBB A;  4O8S A;  2AAE A;  3UJM A;  5KP3 A;  3EB8 A;  1CQS A;  4RZM A;  1BRN L;  4XBY A;  2GU1 A;  2GU3 A;  1RGL A;  3LTA A;  1TUH A;  1KC8 4;  1JB2 A;  3KSP A;  1NJI 4;  4O02 B;  1G96 A;  1Q9E A;  5JPU A;  3BNB A;  1RSN A;  3AMO A;  2JDI H;  4LYL B;  1BGS A;  3UL5 A;  2HMK B;  4HJL B;  1JKG B;  2GSP A;  8RNT A;  2AAD A;  3F8X A;  1N5H A;  1E3V A;  3BNE A;  3MG3 A;  3Q2P A;  3X3Z A;  4GHO A;  2MC8 A;  1CEW I;  1N5P A;  3I56 3;  2V1L A;  3WOE B;  5IG4 A;  4FR9 A;  3PS8 A;  2IA7 A;  1JRQ A;  1O7M B;  5DRE A;  4WP5 A;  4BL3 A;  1V58 A;  2BU4 A;  4L7K A;  1IK3 A;  5FGO A;  3MG1 A;  4KZ1 A;  3URP A;  1N9E A;  1X1X A;  1VQ5 3;  1GD3 A;  4EW5 A;  4HM8 B;  1VQL 3;  2CC3 A;  3NQZ A;  1PU4 A;  3GWR A;  3O8Y A;  5LC6 A;  1W6Y A;  1I8V A;  4N3V A;  1UCK A;  5BXQ A;  1UGI A;  3F7X A;  3OWS A;  1I2G A;  1YJN 3;  2W9Q A;  4XM4 A;  1J2B A;  3F8H A;  3EC9 A;  1T2H A;  3FF2 A;  1HYF A;  1YVB I;  3L0R A;  2B24 B;  5IEP A;  1ZX2 A;  1I3F A;  4I5Q A;  1AVK A;  4LZI A;  1IT7 A;  1JNQ A;  1IV9 A;  2GEY A;  3E99 A;  4WYK B;  1M90 4;  3EF8 A;  3X3Y A;  3Q90 A;  1BNR A;  3G8Z A;  3HII A;  3MPH A;  5BIR A;  3DMC A;  4N6O B;  1TU5 A;  1JBS A;  1PFP A;  3UNL A;  3I55 3;  1I3I A;  2XGL A;  2L1S A;  3PXM A;  1RCK A;  2CFW A;  1ROV A;  1MGR A;  2XSO B;  3D5I A;  3F40 A;  2CH9 A;  1OF5 B;  1EKM A;  1VQ8 3;  3UB1 A;  3BB9 A;  3LXU X;  4HM6 B;  3CNM A;  3FG4 A;  2YFL B;  3QK9 A;  4MMZ B;  3K7C A;  2LYX A;  3H3H A;  1GY5 A;  2R41 A;  1R4C A;  3Q3F A;  2CFG A;  3CC2 3;  4J5K A;  4OUQ A;  3K63 A;  1MWT A;  1QJG A;  2OOV A;  2R4I A;  1UI8 A;  3FKA A;  3KSE D;  5IW9 A;  4DKI A;  1UCI A;  2F4Y A;  4CDL A;  2GXF A;  1FUT A;  1C54 A;  4JRF A;  3JUP A;  4LMI A;  2W6J H;  4XB5 A;  1FUS A;  3X42 A;  1IV7 A;  2OTL 3;  1BU4 A;  5IEN A;  2BMQ B;  3K0Z A;  1VQO 3;  2C4B A;  1KWI A;  1YNV X;  4HM0 B;  2XEP A;  1TFO A;  3EJV A;  4QWT A;  4X2H A;  5IER A;  6RNT A;  2CFL A;  2QA4 3;  1DYU A;  2CG1 A;  1RN7 A;  4MEI A;  4O2H A;  2D42 A;  4N6U A;  3WA2 X;  1TJD A;  3SXX A;  1G0T A;  1EEJ A;  2BMR B;  3F7S A;  1BNI A;  1BNE A;  5D82 A;  3ZG5 A;  1IDP A;  3GZY B;  2W0Q A;  2ZHX B;  4BTW A;  1BRG A;  3VF1 A;  1I0V A;  2K0M A;  1IQY A;  3N9H A;  1SPU A;  3AGO A;  1SJW A;  1Q82 4;  1GOV A;  4J9A A;  3LH4 A;  1MWS A;  2O9U X;  4R9K A;  3CU3 A;  3K9M C;  1IT8 A;  5JBS A;  1RLS A;  3FZW A;  2P05 A;  3LML A;  1YGW A;  3MG2 A;  1O7G B;  2KRT A;  3X40 A;  1EG9 B;  3Q1C A;  4BTX A;  2O3O A;  1K41 A;  2ZA4 A;  1DE3 A;  7STD A;  1A2V A;  2Y73 A;  3RGR A;  1JBT A;  3A5E A;  1DMQ A;  2ZL8 A;  3D4A A;  2QIY A;  3OX9 A;  3VSY A;  1A90 A;  3MSO A;  4RNT A;  5G1K A;  4I4K A;  1JB4 A;  5IG5 A;  1M1X B;  4HM4 B;  1A2P A;  4EBG A;  1AV4 A;  3VGN A;  3G4S 3;  3PGB A;  3SX1 A;  1GMP A;  3EN8 A;  2KF3 A;  1CYU A;  1EQK A;  2MF7 A;  2YFI B;  1BUJ A;  1VQ6 3;  5FW5 A;  1FA3 A;  4KT3 B;  3D9R A;  3LTC A;  1FGM A;  3BU4 A;  4O3V A;  1QAK A;  1LNI A;  1GMR A;  1BSD A;  1T5Y A;  1VQ4 3;  1MOL A;  2W56 B;  4KFF A;  3G71 3;  2CHC A;  3SOY A;  3T8N A;  1GSP A;  1KQS 2;  4HYZ A;  3ECF A;  9RNT A;  1N9J A;  1Q42 A;  3NV0 B;  3CC7 3;  1YJW 3;  3NHX A;  1RCL A;  3SVA A;  1B20 A;  4JF8 A;  3KKG A;  2CW9 A;  2F56 A;  2XRX B;  3GSP A;  2SAR A;  5CXO A;  2JQ5 A;  4KFE A;  1E97 A;  2RGQ A;  1W6C A;  1HZ1 A;  1CH0 A;  2XF3 A;  4K1U A;  3RNT A;  1ZO2 A;  3QRD A;  3JUM A;  3BIR A;  1ZGX A;  1W6G A;  3AMO B;  4J8T A;  4K1V A;  1OGX A;  4KVH A;  1QAF A;  3X3X A;  2IYJ A;  3DY5 A;  5HGR A;  5CLK A;  3CCM 3;  4EC6 A;  2BT3 A;  1AR0 A;  3F14 A;  3GZX B;  4ORL A;  1IU7 A;  1OAC A;  4XDV A;  2FNQ A;  1JZO A;  1GS3 A;  4FCZ A;  8CHO A;  3K5T A;  1UUW B;  3DGY A;  5AYR B;  2OCT A;  3HX8 A;  2UX0 A;  1RKY A;  1YGE A;  4FMB A;  4BTY A;  1YVS A;  2UGI A;  1OUN A;  2F5M A;  2BO9 B;  5M19 A;  1GMQ A;  1X1Y A;  3S27 A;  2PNC A;  1Z1S A;  2PZV A;  2P0M A;  2M7O A;  3EQQ B;  3CNX A;  4EYC A;  2E2V A;  2RSX A;  1WMN A;  1BRI A;  4EV5 A;  1WQL B;  1SIH A;  2KF5 A;  3ER7 A;  1V74 A;  1ASK A;  4IPB A;  3OW2 2;  1Q40 A;  1OPY A;  1JV2 B;  4K61 A;  3MWZ A;  1UCJ A;  1DVC A;  1OGZ A;  2IMJ A;  3JVC A;  4OK0 A;  5CK6 A;  3IPT A;  4N6M A;  2RNT A;  2OWP A;  3HZP A;  3PCR A;  2CKF B;  1RN4 A;  1R4Y A;  1BVI A;  2K54 A;  2Z76 A;  3NQY A;  1RTU A;  4GB5 A;  1STF I;  5IG3 A;  3CC4 3;  4HM2 B;  1K28 A;  1O7N B;  1OHS A;  1N8R 4;  3GZR A;  1O7P B;  4IIA A;  3BLZ A;  1YJ9 3;  1Q7Y 4;  1I2E A;  2KXG A;  1C7H A;  2WGO A;  5ELU A;  1YIT 3;  1DMN A;  1A67 A;  1HU9 A;  1BNG A;  2W9P A;  5D83 A;  4LSO A;  1B21 A;  2XFT A;  2KF6 A;  3CME 3;  4OVM A;  4R80 A;  1BOX A;  2F99 A;  1O7W B;  2CFK A;  1FGR A;  1DMM A;  4HM1 B;  3RDE A;  1I2F A;  3GAX A;  4ZM8 A;  3LTB A;  4ILF A;  2GEX A;  1K9M 4;  1OHO A;  1E3R A;  1AVL A;  1BRJ A;  2ML6 A;  3X41 A;  2Z6B A;  4CPK A;  5I97 A;  3WMD A;  2Z7A A;  1B2X A;  1JB5 A;  2IUJ A;  5KP1 A;  3I0Y A;  1LOV A;  1JN5 A;  1UI7 A;  4MJD A;  5AEW B;  2D1W A;  1BRK A;  3D79 A;  4HOH A;  1W4N A;  3G0K A;  3NX0 A;  4HM5 B;  1ULJ B;  3DM8 A;  5M1A A;  1NDO B;  4AEQ A;  1RRH A;  1UCL A;  1D6Z A;  1WMO A;  3PCS A;  4IT7 A;  3SED A;  3IJE B;  6GSP A;  1IVX A;  1B27 A;  3DGL A;  3CCV 3;  1ISK A;  1NU3 A;  1UDI I;  3CPO A;  2RFR A;  5CF2 A;  2KCD A;  2YFJ B;  3WA3 A;  1JBR A;  2HMJ B;  4GSP A;  2B1X B;  3CCE 3;  2CWU A;  2CFD A;  3U1W A;  3B4O A;  3KN4 A;  1M1K 4;  2C10 A;  1RHL A;  1RGH A;  2HMM B;  1TRQ A;  1GY7 A;  3JUN A;  3WHO A;  1B2Z A;  1QVF 2;  3D5G A;  5AIG A;  1VQM 3;  2FXT A;  1S72 3;  7RNT A;  2L4V A;  3HOH A;  2BNG A;  2IY2 A;  2E2U A;  3NBR A;  1NO3 A;  4R4K A;  2Y74 A;  3DZL A;  1S5A A;  1UUV B;  4L8O A;  1LXE A;  3FGY A;  5IG0 A;  1IYY A;  5BU4 A;  5AYS C;  4WFO A;  1W2B 2;  3CD6 3;  4BL2 A;  2WGQ A;  2I9W A;  2HML B;  3SYU A;  3FSD A;  4AKY A;  5STD A;  1NB5 I;  1ULI B;  1W7C A;  5AIH A;  3ROB A;  1NNV A;  2CX0 A;  2XSH B;  3OV4 A;  4H3U A;  5A0O B;  4AKZ A;  5DRV A;  5BVB A;  1QVG 2;  1RGG A;  3KE7 A;  1YI2 3;  1GYB A;  3GZB A;  3EN1 B;  1VZZ A;  3B8L A;  3FCS B;  3DXO A;  2CWT A;  1I70 A;  5AEU B;  5M18 A;  1VQ7 3;  1N8Q A;  3G16 A;  4X2O A;  3NUV A;  2UUG C;  3B7C A;  2OQE C;  5G1L A;  1BUQ A;  1LQM B;  2BMO B;  3MYT A;  1VQK 3;  3CMA 3;  1QMA A;  4RNZ A;  4R9L A;  3FG1 A;  4LEH A;  1IQ8 A;  1LVN A;  3FG3 A;  5D81 A;  1K8A 4;  1RNT A;  3F9S A;  4NHF A;  1M9G A;  2IUK A;  1D6U A;  3LZA A;  5HOH A;  5LC7 A;  2GBW B;  3EX9 A;  1W02 A;  4GL6 A;  3JUO A;  4FCJ A;  4STD A;  2ZDJ A;  3NM2 A;  2RBI A;  1JKG A;  3T0U A;  5EVH A;  5ELJ A;  1FGO A;  1O7H B;  1PY3 A;  2BIR A;  1GY6 A;  4BIR A;  1RGE A;  3S28 A;  1FZU A;  3S29 A;  4K90 B;  1RGC A;  1D6Y A;  1F8N A;  1FGQ A;  2CIU A;  3EBY A;  3PYJ A;  1TRP A;  1EA2 A;  3FH1 A;  3OXA A;  1K73 4;  3CCS 3;  1TP6 A;  1GD4 A;  1FUW A;  1IQX A;  3UL6 A;  4BU4 A;  1RNB A;  3WR2 A;  4HZ9 B;  2A15 A;  1ROA A;  3KFQ C;  1RGA A;  2OOV C;  1KSI A;  1W01 A;  3V99 A;  3G6E 3;  2C11 A;  4HM3 B;  1FW7 A;  1BAO A;  3EHC A;  4N6L A;  4PEJ A;  4U13 A;  3NXJ A;  5GSP A;  3IMA B;  4WHA A;  4CJN A;  3J7Y d;  2Q07 A;  4N6V 0;  1VQN 3;  1QAL A;  1RJO A;  1TTO A;  2P0X A;  2E2T A;  1BNJ A;  1RRL A;  2P09 A;  1MWR A;  4HBR A;  1U5O A;  4WYK A;  1UUG B;  2OQE A;  5RNT A;  1LQG C;  1LRA A;  5IEO A;  4HM7 B;  1JZD A;  5EEO A;  1FYS A;  3V98 A;  1BSE A;  1RMS A;  3CCJ 3;  2CG0 A;  1OCV A;  2HMN B;  1Q7H A;  3BNC A;  1T2I A;  1Q40 B;  1T3B A;  3B4P A;  3KII A;  2F86 B;  1LOY A;  3LYG A;  1ZS7 A;  1OF5 A;  1SQW A;  1IVU A;  3RGA A;  2QGU A;  4NRE A;  4RNY A;  4L8P A;  2RCD A;  2F98 A;  2BHM A;  3FF0 A;  3MHE A;  1YIJ 3;  3SLU A;  1RGK A;  4Q53 A;  3GRD A;  5AIF A;  1FGT A;  3AGN A;  3HI7 A;  6STD A;  4H61 A;  1STD A;  3BND A;  1BNS A;  4N6N B;  4KFD A;  4WWU C;  1LOW A;  2XFS A;  2CK3 H;  4LGQ A;  3WDG B;  3DGO A;  3CPW 2;  1VQP 3;  1Q86 4;  5AI1 A;  1WTH A;  2XGN A;  2W03 A;  3D3L A;  1MGW A;  4HVN A;  2Z77 A;  2CX1 A;  3M8C A;  2OTJ 3;  3STD A;  1L5G B;  1BAN A;  2QEX 3;  3NBJ A;  1MNL A;  1EUI C;  3AHW A;  3CCL 3;  1Q81 4;  3NM7 A;  1BSA A;  1B3S A;  2WOF A;  4NPB A;  3FLJ A;  1IVW A;  2HMO B;  5KP4 A;  1KD1 4;  2KAA A;  1BRH A;  4XBT A;  1OHP A;  5AII A;  4FMA A;  4G1M B;  1SAR A;  4HZB B;  1AY7 A;  2J8X B;  1B2U A;  2LQV A;  2H0G A;  1JN5 B;  2WO0 A;  3DH2 A;  3DGN A;  2HOH A;  3N8B A;  3CCR 3;  1LOX A;  3S67 A;  1DET A;  4J5G A; 
#chains in the Genus database with same CATH homology
 1VQ9 3;  3CXC 2;  3HK4 A;  1U8C B;  3PZW A;  3U97 A;  4N6T A;  3ALA A;  3WOD G;  3CCQ 3;  3OWY A;  4RBN A;  2INX A;  2STD A;  1SII A;  3HIG A;  3DUK A;  2XH9 A;  3LT8 A;  1HKX A;  1TFK A;  3OWU A;  5CF1 A;  1US1 A;  4XDW A;  2SBL A;  4MMY B;  5TGN A;  5IF6 A;  1DVD A;  3N54 B;  1Y4K A;  3H51 A;  3KZT A;  4FMC A;  3S5C A;  1JJ2 2;  3JUQ A;  3WOF B;  4HKV B;  1W2Z A;  2ML5 A;  3A76 A;  4FMD A;  4EV2 A;  2GBX B;  5G2G A;  2P38 A;  1W5Z A;  4XBX A;  5JPP A;  1NWW A;  1UW1 A;  1A2K A;  1WMP A;  2FGT A;  4TX4 A;  3V92 A;  3T8U A;  1IVV A;  2YX9 A;  3EBT A;  3DGM A;  4R1K A;  3LT9 A;  3TDG A;  3EE1 A;  1W00 A;  1OH0 A;  1CYV A;  2CWV A;  2WOH A;  3MKI A;  3CCU 3;  2XR8 B;  4CCV A;  1NB3 I;  2W2C A;  2W56 A;  1LNH A;  1WNH A;  1YHQ 3;  3LTD A;  3SOA A;  1TIJ A;  3NV0 A;  4EXR A;  4MMX B;  2W04 A;  3LOY A;  5EQL A;  4FCM A;  3NBB A;  4O8S A;  3UJM A;  5KP3 A;  3EB8 A;  1CQS A;  4RZM A;  4XBY A;  2GU1 A;  2GU3 A;  3LTA A;  1TUH A;  1KC8 4;  1JB2 A;  3KSP A;  1NJI 4;  4O02 B;  1G96 A;  5JPU A;  3BNB A;  3AMO A;  2JDI H;  3UL5 A;  2HMK B;  4HJL B;  1JKG B;  3F8X A;  3MG3 A;  1N5H A;  1E3V A;  3BNE A;  3Q2P A;  3X3Z A;  2MC8 A;  1CEW I;  1N5P A;  3I56 3;  2V1L A;  3WOE B;  5IG4 A;  4FR9 A;  3PS8 A;  2IA7 A;  1JRQ A;  1O7M B;  5DRE A;  4WP5 A;  1IK3 A;  4L7K A;  5FGO A;  3MG1 A;  4KZ1 A;  1N9E A;  1VQ5 3;  1GD3 A;  4HM8 B;  1VQL 3;  2CC3 A;  3NQZ A;  1PU4 A;  3GWR A;  3O8Y A;  5LC6 A;  1W6Y A;  4N3V A;  5BXQ A;  3F7X A;  3OWS A;  1YJN 3;  2W9Q A;  4XM4 A;  1J2B A;  3F8H A;  3EC9 A;  3FF2 A;  1YVB I;  3L0R A;  2B24 B;  5IEP A;  1ZX2 A;  1AVK A;  4LZI A;  1IT7 A;  1JNQ A;  1IV9 A;  2GEY A;  3E99 A;  4WYK B;  1M90 4;  3EF8 A;  3X3Y A;  3Q90 A;  3G8Z A;  3HII A;  3MPH A;  3DMC A;  4N6O B;  1TU5 A;  1PFP A;  3UNL A;  3I55 3;  2XGL A;  3PXM A;  2CFW A;  1ROV A;  2XSO B;  3F40 A;  2CH9 A;  1OF5 B;  1EKM A;  3UB1 A;  3BB9 A;  3LXU X;  4HM6 B;  3CNM A;  3FG4 A;  2YFL B;  3QK9 A;  4MMZ B;  3K7C A;  2LYX A;  3H3H A;  1GY5 A;  1R4C A;  2CFG A;  3CC2 3;  4OUQ A;  3K63 A;  1QJG A;  2OOV A;  2R4I A;  1UI8 A;  3FKA A;  3KSE D;  5IW9 A;  4CDL A;  2GXF A;  4JRF A;  3JUP A;  4LMI A;  2W6J H;  4XB5 A;  3X42 A;  2OTL 3;  1IV7 A;  5IEN A;  2BMQ B;  3K0Z A;  1VQO 3;  1KWI A;  4HM0 B;  2XEP A;  1TFO A;  3EJV A;  4QWT A;  4X2H A;  5IER A;  2CFL A;  2QA4 3;  1DYU A;  2CG1 A;  1RN7 A;  4MEI A;  4O2H A;  2D42 A;  4N6U A;  3WA2 X;  3SXX A;  2BMR B;  3F7S A;  5D82 A;  1IDP A;  3GZY B;  2W0Q A;  4BTW A;  3VF1 A;  2K0M A;  1IQY A;  3N9H A;  1SPU A;  1SJW A;  1Q82 4;  4J9A A;  3LH4 A;  2O9U X;  4R9K A;  3CU3 A;  3K9M C;  1IT8 A;  5JBS A;  3FZW A;  3MG2 A;  2P05 A;  3LML A;  1VQ8 3;  1O7G B;  2KRT A;  3X40 A;  1EG9 B;  3Q1C A;  4BTX A;  2O3O A;  1K41 A;  7STD A;  1A2V A;  2Y73 A;  3RGR A;  1DMQ A;  2ZL8 A;  1A90 A;  2QIY A;  3OX9 A;  3VSY A;  3MSO A;  4I4K A;  1JB4 A;  5IG5 A;  1M1X B;  4HM4 B;  4EBG A;  1AV4 A;  3VGN A;  3G4S 3;  3PGB A;  3SX1 A;  3EN8 A;  1CYU A;  1EQK A;  2MF7 A;  2YFI B;  1VQ6 3;  5FW5 A;  1FA3 A;  3D9R A;  3LTC A;  1FGM A;  4O3V A;  1QAK A;  1T5Y A;  1VQ4 3;  1MOL A;  2W56 B;  4KFF A;  3G71 3;  2CHC A;  3SOY A;  3T8N A;  1KQS 2;  4HYZ A;  3ECF A;  1N9J A;  1Q42 A;  3NV0 B;  3CC7 3;  1YJW 3;  3NHX A;  3SVA A;  4JF8 A;  3KKG A;  2CW9 A;  2XRX B;  5CXO A;  2JQ5 A;  4KFE A;  1E97 A;  2RGQ A;  1W6C A;  4K1U A;  2XF3 A;  1ZO2 A;  3QRD A;  3JUM A;  1W6G A;  3AMO B;  4J8T A;  4K1V A;  1OGX A;  4KVH A;  1QAF A;  3X3X A;  3CCM 3;  3DY5 A;  5HGR A;  5CLK A;  4EC6 A;  2BT3 A;  1AR0 A;  3F14 A;  3GZX B;  4ORL A;  1IU7 A;  1OAC A;  4XDV A;  2FNQ A;  1GS3 A;  4FCZ A;  8CHO A;  3K5T A;  1UUW B;  5AYR B;  2OCT A;  3HX8 A;  2UX0 A;  1RKY A;  1YGE A;  4FMB A;  4BTY A;  1OUN A;  2BO9 B;  3S27 A;  2PNC A;  1Z1S A;  2PZV A;  2P0M A;  2M7O A;  3EQQ B;  3CNX A;  4EYC A;  2E2V A;  2RSX A;  1WMN A;  4EV5 A;  1WQL B;  1SIH A;  3ER7 A;  1V74 A;  1ASK A;  4IPB A;  3OW2 2;  1Q40 A;  1OPY A;  1JV2 B;  4K61 A;  3MWZ A;  1DVC A;  1OGZ A;  2IMJ A;  3JVC A;  4OK0 A;  5CK6 A;  3IPT A;  4N6M A;  2OWP A;  3HZP A;  3PCR A;  2CKF B;  3NQY A;  2K54 A;  2Z76 A;  5IG3 A;  4GB5 A;  1STF I;  3CC4 3;  4HM2 B;  1K28 A;  1O7N B;  1OHS A;  1N8R 4;  3GZR A;  1O7P B;  4IIA A;  3BLZ A;  1YJ9 3;  1Q7Y 4;  2KXG A;  1C7H A;  2WGO A;  5ELU A;  1YIT 3;  1DMN A;  1A67 A;  1HU9 A;  2W9P A;  5D83 A;  4LSO A;  2XFT A;  3CME 3;  4OVM A;  4R80 A;  2F99 A;  1O7W B;  2CFK A;  1FGR A;  1DMM A;  4HM1 B;  3RDE A;  4ZM8 A;  3GAX A;  3LTB A;  2GEX A;  1K9M 4;  1OHO A;  1E3R A;  1AVL A;  3X41 A;  2ML6 A;  2Z6B A;  5I97 A;  3WMD A;  2Z7A A;  1JB5 A;  5KP1 A;  2IUJ A;  3I0Y A;  5AEW B;  1JN5 A;  1UI7 A;  4MJD A;  2D1W A;  1W4N A;  3G0K A;  3NX0 A;  4HM5 B;  1ULJ B;  3DM8 A;  1NDO B;  4AEQ A;  1RRH A;  1D6Z A;  1WMO A;  3PCS A;  4IT7 A;  3SED A;  3IJE B;  1IVX A;  3DGL A;  3CCV 3;  1ISK A;  1NU3 A;  3CPO A;  2RFR A;  5CF2 A;  2KCD A;  2YFJ B;  3WA3 A;  2HMJ B;  3CCE 3;  2B1X B;  2CWU A;  2CFD A;  3U1W A;  3B4O A;  3KN4 A;  1M1K 4;  2C10 A;  2HMM B;  1GY7 A;  3JUN A;  1QVF 2;  5AIG A;  1VQM 3;  1S72 3;  2FXT A;  2L4V A;  2BNG A;  2E2U A;  3NBR A;  1NO3 A;  4R4K A;  2Y74 A;  3DZL A;  1S5A A;  1UUV B;  4L8O A;  1LXE A;  3FGY A;  5IG0 A;  5AYS C;  4WFO A;  1W2B 2;  3CD6 3;  2WGQ A;  2I9W A;  2HML B;  3FSD A;  4AKY A;  5STD A;  1NB5 I;  1ULI B;  1W7C A;  5AIH A;  3ROB A;  3OV4 A;  2XSH B;  4H3U A;  5A0O B;  4AKZ A;  5DRV A;  5BVB A;  1QVG 2;  3KE7 A;  1YI2 3;  1GYB A;  3GZB A;  3EN1 B;  1VZZ A;  3B8L A;  3FCS B;  3DXO A;  2CWT A;  5AEU B;  1VQ7 3;  1N8Q A;  3G16 A;  4X2O A;  3NUV A;  3B7C A;  2OQE C;  1BUQ A;  2BMO B;  3MYT A;  1VQK 3;  3CMA 3;  1QMA A;  4RNZ A;  4R9L A;  3FG1 A;  4LEH A;  1IQ8 A;  1LVN A;  3FG3 A;  5D81 A;  1K8A 4;  3F9S A;  4NHF A;  1M9G A;  2IUK A;  1D6U A;  3LZA A;  5LC7 A;  2GBW B;  3EX9 A;  1W02 A;  4GL6 A;  3JUO A;  4FCJ A;  4STD A;  2ZDJ A;  3NM2 A;  1JKG A;  3T0U A;  5EVH A;  5ELJ A;  1FGO A;  1O7H B;  1GY6 A;  3S28 A;  3S29 A;  4K90 B;  1D6Y A;  1F8N A;  1FGQ A;  2CIU A;  3EBY A;  3PYJ A;  1EA2 A;  3FH1 A;  3OXA A;  1K73 4;  3CCS 3;  1TP6 A;  1GD4 A;  1FUW A;  1IQX A;  3UL6 A;  4HZ9 B;  2A15 A;  1ROA A;  3KFQ C;  2OOV C;  1KSI A;  1W01 A;  3V99 A;  3G6E 3;  2C11 A;  4HM3 B;  3EHC A;  4N6L A;  4PEJ A;  4U13 A;  3NXJ A;  3J7Y d;  3IMA B;  4WHA A;  2Q07 A;  4N6V 0;  1VQN 3;  1QAL A;  1RJO A;  2P0X A;  2E2T A;  2P09 A;  1RRL A;  4HBR A;  1U5O A;  4WYK A;  2OQE A;  5IEO A;  4HM7 B;  5EEO A;  3V98 A;  3CCJ 3;  2CG0 A;  1OCV A;  2HMN B;  3BNC A;  1Q40 B;  3B4P A;  3KII A;  2F86 B;  3LYG A;  1OF5 A;  1SQW A;  1IVU A;  3RGA A;  2QGU A;  4NRE A;  4RNY A;  4L8P A;  2RCD A;  2F98 A;  2BHM A;  3FF0 A;  3MHE A;  1YIJ 3;  3SLU A;  4Q53 A;  3GRD A;  5AIF A;  1FGT A;  3HI7 A;  6STD A;  4H61 A;  1STD A;  3BND A;  4N6N B;  4KFD A;  4WWU C;  2XFS A;  2CK3 H;  4LGQ A;  3WDG B;  3DGO A;  3CPW 2;  1VQP 3;  1Q86 4;  5AI1 A;  1WTH A;  2XGN A;  2W03 A;  3D3L A;  4HVN A;  2OTJ 3;  2Z77 A;  3M8C A;  3STD A;  1L5G B;  2QEX 3;  3NBJ A;  1MNL A;  3CCL 3;  1Q81 4;  3NM7 A;  2WOF A;  3FLJ A;  1IVW A;  2HMO B;  5KP4 A;  1KD1 4;  4XBT A;  1OHP A;  5AII A;  4FMA A;  4G1M B;  4HZB B;  2LQV A;  1JN5 B;  2WO0 A;  3N8B A;  3DGN A;  3CCR 3;  1LOX A;  3S67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...