1UW1A

A novel adp- and zinc-binding fold from function-directed in vitro evolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
DDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Adp- and Zinc-Binding Fold from Function-Directed in Vitro Evolution
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uw1A00
2P05A 3LT9A 3DGLA 3LTAA 1UW1A 2P09A 3LTBA 2P0XA 3DGNA 3LT8A 3LTCA 3LTDA 3DGMA 3DGOA
chains in the Genus database with same CATH superfamily
1NB5I 1TP6A 1UW1A 3GZXB 1W6YA 3CME3 3EQQB 1G0TA 5IEPA 3CCM3 1UGHI 1O7PB 2FNQA 3RNTA 3UJMA 5G2GA 1STDA 2O3OA 1GMPA 3X3XA 3BU4A 4XM4A 1VQL3 4HM8B 1UI8A 1YGWA 2FXTA 1PFPA 2CX0A 4I5QA 3FG1A 1LOXA 1OGXA 1U5OA 5LC7A 2CWUA 1RTUA 1ASKA 5AIHA 3NV0B 4GL6A 2GBWB 1IV9A 3CCU3 1E3VA 2H0GA 3NBRA 3HZPA 5GSPA 1KWIA 4FCZA 5AYSC 1QJGA 2Z6BA 3JVCA 1DETA 3NM7A 5KP1A 3CC73 3F8HA 4XDVA 1M9GA 3SYUA 4IT7A 3F8XA 2JDIH 3F14A 2JQ5A 1I2GA 3DMCA 4WHAA 3NQYA 5AYRB 3DUKA 1CEWI 1YJN3 1RGKA 1PYLA 4FCMA 3GZRA 5M19A 3BNEA 3U1WA 3ZG0A 3NV0A 4FR9A 2F56A 1GMQA 2BHMA 2XFSA 4HM5B 4WWUC 3AGNA 4IPBA 1JRQA 1IVUA 1R4YA 4O3VA 4RZMA 1Q814 1WMNA 7GSPA 3G713 1VQM3 2V1LA 2AAEA 1S723 1D6YA 1YJ93 1B2XA 3FG4A 1QVG2 2KF4A 1FUTA 3EB8A 5ELJA 1NU3A 4HZBB 3AMOA 1BRKA 5KP4A 2CWVA 1A2PA 1OF5B 4HYZA 3GAXA 3MKIA 3G0KA 5M18A 5KP3A 2ML6A 4R9KA 1GSPA 3L0RA 3Q90A 1BIRA 4HJLB 2OOVA 3LT9A 1RNTA 4FMCA 5AI1A 1HU9A 3CC43 3EBYA 2BT3A 1LQMB 1KC84 1B2SA 1R4CA 4CJNA 1BSBA 2HMJB 3B8LA 2HMKB 3PGBA 1K734 2P09A 4MJDA 3HIGA 3HX8A 4J5GA 1BAOA 5ELUA 1GD3A 3URPA 3AMOB 4EV2A 6STDA 3H3HA 1BRNL 4HAAA 2IUKA 1GOYA 3CCQ3 1V57A 1RGGA 4DKIA 4XBTA 1NDOB 3D4AA 3F7SA 1VQ83 1BRIA 1A90A 1UGIA 1TU5A 1DE3A 3KIIA 1GY6A 1AY7A 1PY3A 1W00A 3B4PA 1QAFA 2BMRB 2XRXB 4HOHA 4TX4A 5BXQA 2CWTA 3V99A 1WTHA 1JB5A 1RRLA 1U8CB 4BU4A 3GSPA 3WR2A 2Z7AA 3X3YA 1YJW3 3UNLA 3LXUX 2K54A 2I9WA 2HOHA 1STFI 3NX0A 3G6E3 2RCDA 1RDSA 3DGOA 3X3ZA 1N5PA 1NO3A 1I2EA 1DMNA 1NB3I 2P0MA 4CCVA 1BRHA 1N8R4 4HM6B 4LSOA 2D1WA 1B3SA 4ILFA 2CG1A 1J2BA 1B2MA 4KFFA 1VQ93 1V58A 3NM2A 1Q864 1JJ22 3CNXA 3BB9A 2XGNA 3CCR3 4RNTA 1Q42A 1Q7Y4 1B27A 1E97A 3EF8A 3FGYA 2XH9A 5D81A 1YGEA 5IG0A 1KQS2 3BNBA 2WGQA 1Y4KA 2XGLA 3K7CA 3FLJA 3MPHA 1IK3A 1ROVA 3WODG 5HGRA 4EXRA 1I2FA 1W6GA 3SLUA 1JBSA 2OCTA 3DGNA 5M1AA 1DVDA 1JZDA 1W02A 2HMLB 1TTOA 3G16A 6RNTA 1YNVX 2F5WA 1E3RA 1OHOA 2SBLA 1WNHA 1JBRA 1EQKA 1C54A 3O8YA 1RHLA 3FZWA 3JUPA 1SPUA 1CH0A 5LC6A 1Q40A 1Z1SA 3MHEA 2AADA 1UCJA 4R9LA 1MWTA 1JB4A 3N54B 3PYJA 4ORLA 1LNIA 1VQ73 1LOVA 2UUGC 4OK0A 4H61A 5AEUB 2BMQB 2GU3A 2WOHA 1VQO3 3ER7A 3JUOA 4PEJA 3FCSB 1FGRA 4HZ9B 3KFQC 1O7MB 1W6CA 1FUSA 3NXJA 5HOHA 5IW9A 3G4S3 4EW5A 2E2TA 3OWYA 2OTJ3 1SIIA 2L4VA 1JB2A 4K61A 1KD14 2KF6A 1IQ8A 5BVBA 1EEJA 1I3FA 4JF8A 8RNTA 1ROAA 2KRTA 2P0XA 4HKVB 1BUJA 1GS3A 1F8NA 1T2IA 1BOXA 2CFGA 4L7KA 2KF5A 3T8NA 3D79A 4KFDA 1QAKA 1SQWA 3S5CA 1I0VA 1ULJB 4I4KA 1B21A 2H0HA 2F98A 1A2KA 1Q824 1UCLA 3OWUA 5JBSA 2P38A 4STDA 1C7HA 1SJWA 1X1YA 4N6NB 3LZAA 1OPYA 4BIRA 3CCV3 4LZIA 2OOVC 1UDII 2W56A 3N9HA 2HMNB 1GMRA 2YFIB 1RGCA 3H51A 2W6JH 2SARA 1FGMA 5EQLA 4KT3B 1YIT3 3SVAA 2CFKA 4R1KA 1DVCA 3VGNA 3EBTA 1M1XB 3HIIA 2W9PA 1BANA 2XR8B 1NWWA 4CDLA 3S29A 3HK4A 4MMZB 5AIGA 1HYFA 1VQ63 3RGRA 3EE1A 3T8UA 2J8XB 3MG3A 4CPKA 3ALAA 3HOHA 3LTBA 1VZZA 4L8PA 3MG1A 2FGTA 1N9EA 1M1K4 2LYXA 1OACA 1N8QA 4H3UA 1TFOA 4AKYA 1US1A 3EHCA 2CFWA 2E2UA 4ZM8A 1FUWA 1IDPA 3UB1A 1MWUA 1TFKA 3UL5A 4MMYB 3LTAA 4BL2A 1FGOA 1A67A 3NBBA 1IVWA 3F7XA 2XSOB 2WGOA 3FF2A 3IPTA 3GRDA 4XB5A 3STDA 1UUWB 2YFLB 1Q7HA 1ZGXA 4KFEA 4EBGA 4J5KA 3LTCA 1QVF2 3NUVA 3KZTA 3Q2PA 3V92A 3ZFZA 1EKMA 4Q53A 4EV5A 5IEOA 1JN5B 1BVIA 2CX1A 3JUNA 1G02A 3QRDA 1JBTA 1ZX2A 4FMBA 1B2ZA 2RBIA 2OWPA 7RNTA 2HMMB 1YVBI 2PNCA 2CKFB 3CPW2 2YFJB 4HM7B 4R4KA 3PCRA 4HVNA 1JZOA 2W03A 4HM2B 3CPOA 3SX1A 4AKZA 4N6UA 3DZLA 1FZUA 4FMAA 1B20A 3K63A 4O2HA 3CCL3 4K1UA 1BNFA 1CQSA 4EC6A 1ZS7A 3LYGA 2E2VA 3Q1CA 2RGQA 3PXMA 1IU7A 3AGOA 3D5GA 3JUMA 3LTDA 2INXA 2F5MA 2XFTA 1UCIA 1JKGB 1RRHA 4L8OA 4MEIA 1IV7A 3ROBA 1AV4A 1IVVA 2C4BA 1LQGC 1FW7A 3LMLA 1BUQA 1BGSA 3AHSA 1OF5A 3LOYA 4MMXB 1TUHA 1DMQA 3DGMA 4WFOA 4RNYA 2STDA 2Y73A 3VSYA 3ZG5A 3PCSA 3Q3FA 1I70A 5D82A 1TRQA 3MSOA 1BNGA 2C10A 3WA3A 2BMOB 2QA43 2QIYA 1OGZA 3WOFB 3OW22 5CLKA 3V98A 2WO0A 2D42A 4R80A 3NQZA 4LEHA 5FW5A 3FH1A 4LGQA 1RCKA 2BU4A 2H0IA 1IT7A 2MC8A 1ULIB 2OQEA 1FYSA 1EA2A 3EC9A 4N6V0 1RN7A 1YVSA 1MGRA 4NPBA 3SOYA 2YX9A 2BNGA 3LT8A 5D83A 5JPPA 3FSDA 3X40A 1GOVA 3PZWA 1AVKA 2XEPA 3AHWA 1WMOA 5G1LA 2W04A 2R41A 1N9JA 3SEDA 3CCS3 3FKAA 5JPUA 1Q9EA 3WDGB 1MWSA 3GZBA 3CCJ3 1VQK3 1RSNA 3HI7A 4BTYA 1Q40B 2XF3A 2ML5A 3D3LA 1N5HA 1BRSA 3K5TA 1VQP3 1K8A4 1RNBA 3X42A 2WOFA 3M8CA 1YIJ3 2A15A 2GBXB 3JUQA 5STDA 1VQ43 1W01A 4WYKA 4X2HA 1GD4A 4BTXA 1LOYA 1TIJA 3G8ZA 2RFRA 1ZO2A 3A76A 2HMOB 1SARA 3WHOA 5G1KA 2F4YA 2QGUA 1D6UA 1RJOA 1W2B2 1I3IA 3EJVA 3X41A 4XBYA 1BSEA 1AQZA 4BTWA 1CYVA 4LYLB 5RNTA 3VF1A 5BU4A 2RNTA 2L1SA 1WMPA 3DM8A 1RGFA 2O9UX 1RGHA 5CF1A 3BLZA 2RSXA 3DY5A 3S28A 1IYYA 1W7CA 3EX9A 4WYKB 2K3DA 4N6LA 3WA2X 5EEOA 4J8TA 4X2OA 3N8BA 2BO9B 3QK9A 3KSPA 2W0QA 2GEXA 1EUIC 1RCLA 1QALA 4RBNA 4LMIA 2UGIA 1X1WA 4NREA 3BIRA 1BNJA 1I0XA 4FMDA 2CG0A 2IA7A 2XSHB 3MYTA 4HBRA 1OCVA 4U13A 1B2UA 4EYCA 4GSPA 1HKXA 3WOEB 3DGYA 3OWSA 2GEYA 2Z77A 4N6OB 8CHOA 1RKYA 5IG3A 5DRVA 1OHPA 2CHCA 1OUNA 1V74A 2CK3H 2Z76A 1UUGB 4GB5A 4HM3B 2CFLA 2GU1A 4K90B 3I553 3SOAA 1OHSA 3S67A 4QWTA 3CC23 1LOWA 1RGLA 1RGEA 3U97A 3CMA3 1BSCA 4FCJA 4N6MA 6GSPA 1TJDA 1T5YA 1FGTA 3KKGA 2IYJA 1BNEA 1YHQ3 3BNCA 5AIFA 1QMAA 2KF3A 1LRAA 3NBJA 3I0YA 1BSDA 3IMAB 1BSAA 3S27A 2ZHXB 1S5AA 4WP5A 3WMDA 1RN1A 2F99A 1KSIA 3CU3A 2CIUA 5BIRA 1W2ZA 3FF0A 1FGQA 4HM0B 2IUJA 3A5EA 3J7Yd 2W56B 3E99A 1BNIA 1VQQA 1CYUA 1JN5A 3RDEA 3DXOA 1VQN3 5CXOA 3EN1B 1DMMA 1GY5A 5IG5A 3K0ZA 1AR0A 5CK6A 3UL6A 7STDA 4KZ1A 4O8SA 2OTL3 3SXXA 2KCDA 2KXGA 1T2HA 5I97A 3GZYB 1BU4A 4XDWA 1VQ53 5AIIA 3ECFA 1IQYA 2F86B 4NHFA 1SIHA 4OVMA 1HZ1A 1K41A 4OUQA 4RNZA 3RGAA 3TDGA 1W4NA 2UX0A 2GSPA 3FG3A 3PS8A 4HM4B 1RGAA 3D5IA 1MNLA 1M904 2W2CA 2B1XB 4O02B 2IMJA 3KSED 3OX9A 3CCE3 1IT8A 2IY2A 3F40A 5IERA 4GHOA 1UUVB 2K0MA 3DGLA 2QEX3 3DH2A 5TGNA 1IVXA 3OXAA 2ZDJA 2R4IA 3LH4A 3GWRA 2CW9A 1K28A 1RMSA 4IIAA 2ZA4A 9RNTA 3K9MC 2PZVA 2Y74A 5EVHA 4J9AA 1X1XA 3B7CA 3T0UA 4BL3A 1MOLA 4AEQA 5DREA 1W5ZA 1JNQA 3NHXA 1NNVA 1GOUA 1O7NB 1WQLB 1RLSA 2MF7A 1BRGA 2BIRA 2LQVA 4N3VA 2C11A 1K9M4 4K1VA 3CNMA 3F9SA 1UCKA 5FGOA 3EN8A 1DYUA 1TRPA 1AVLA 1BRJA 1LXEA 3KN4A 2M7OA 4HM1B 3CXC2 1G96A 2P05A 1NJI4 1ISKA 2B24B 4XBXA 5IG4A 3KE7A 1X1UA 2CFDA 1GYBA 2CH9A 1EG9B 1OH0A 3MG2A 3KCHA 2KAAA 3MWZA 1I8VA 2W9QA 3B4OA 4N6TA 5IF6A 1A2VA 2ZL8A 1UI7A 4G1MB 4JRFA 1PU4A 3D9RA 2GXFA 1JKGA 1O7HB 2Q07A 5AEWB 5CF2A 1D6ZA 1JV2B 3BNDA 1BNRA 1L5GB 1LVNA 3IJEB 1MGWA 2CC3A 1BNSA 1GY7A 5A0OB 3CD63 1T3BA 1MWRA 2OQEC 1IQXA 1LNHA 3I563 4KVHA 3OV4A 5IENA 1RN4A 1O7WB 1FA3A 1O7GB 1YI23
chains in the Genus database with same CATH topology
1NB5I 1TP6A 1UW1A 3GZXB 1W6YA 3CME3 3EQQB 5IEPA 3CCM3 1O7PB 2FNQA 3UJMA 5G2GA 1STDA 2O3OA 3X3XA 4XM4A 1VQL3 4HM8B 1UI8A 2FXTA 1PFPA 3FG1A 1LOXA 1OGXA 1U5OA 5LC7A 2CWUA 1ASKA 5AIHA 3NV0B 4GL6A 2GBWB 1IV9A 3CCU3 1E3VA 3NBRA 3HZPA 1KWIA 4FCZA 5AYSC 1QJGA 2Z6BA 3JVCA 3CC73 3NM7A 5KP1A 3F8HA 4XDVA 1M9GA 4IT7A 3F8XA 2JDIH 3F14A 2JQ5A 3DMCA 4WHAA 3NQYA 5AYRB 3DUKA 1CEWI 1YJN3 4FCMA 3GZRA 3BNEA 3U1WA 3NV0A 4FR9A 2BHMA 2XFSA 4HM5B 4WWUC 4IPBA 1JRQA 1IVUA 4O3VA 4RZMA 1Q814 1WMNA 3G713 1VQM3 2V1LA 1S723 1D6YA 1YJ93 3FG4A 1QVG2 3EB8A 5ELJA 1NU3A 4HZBB 3AMOA 5KP4A 2CWVA 1OF5B 4HYZA 3GAXA 3MKIA 3G0KA 5KP3A 2ML6A 4R9KA 3L0RA 3Q90A 4HJLB 2OOVA 3LT9A 4FMCA 5AI1A 1HU9A 3CC43 3EBYA 2BT3A 1KC84 1R4CA 2HMJB 3B8LA 2HMKB 3PGBA 1K734 2P09A 4MJDA 3HIGA 3HX8A 5ELUA 1GD3A 3AMOB 4EV2A 6STDA 3H3HA 2IUKA 3CCQ3 4XBTA 1NDOB 3F7SA 1VQ83 1A90A 1TU5A 3KIIA 1GY6A 3B4PA 1W00A 1QAFA 2BMRB 2XRXB 4TX4A 5BXQA 2CWTA 3V99A 1WTHA 1JB5A 1RRLA 1U8CB 2Z7AA 3X3YA 1YJW3 3UNLA 3LXUX 2K54A 2I9WA 1STFI 3NX0A 3G6E3 2RCDA 3DGOA 3X3ZA 1N5PA 1NO3A 1DMNA 1NB3I 2P0MA 4CCVA 1N8R4 4HM6B 4LSOA 2D1WA 2CG1A 1J2BA 4KFFA 1VQ93 3NM2A 1Q864 1JJ22 3CNXA 3BB9A 2XGNA 3CCR3 1Q42A 1Q7Y4 1E97A 3EF8A 3FGYA 2XH9A 5D81A 1YGEA 5IG0A 1KQS2 3BNBA 2WGQA 1Y4KA 2XGLA 3K7CA 3FLJA 3MPHA 1IK3A 1ROVA 3WODG 5HGRA 4EXRA 1W6GA 3SLUA 2OCTA 3DGNA 1DVDA 1W02A 2HMLB 3G16A 1E3RA 1OHOA 2SBLA 1WNHA 1EQKA 3O8YA 3FZWA 3JUPA 1SPUA 5LC6A 1Q40A 1Z1SA 3MHEA 4R9LA 1JB4A 3N54B 3PYJA 4ORLA 1VQ73 4OK0A 4H61A 5AEUB 2BMQB 2GU3A 2WOHA 1VQO3 3ER7A 3JUOA 4PEJA 3FCSB 1FGRA 4HZ9B 3KFQC 1O7MB 1W6CA 3NXJA 5IW9A 3G4S3 2OTJ3 2E2TA 3OWYA 1SIIA 2L4VA 1JB2A 4K61A 1KD14 1IQ8A 5BVBA 4JF8A 1ROAA 2KRTA 2P0XA 4HKVB 1GS3A 1F8NA 2CFGA 4L7KA 3T8NA 4KFDA 1QAKA 1SQWA 3S5CA 4I4KA 1ULJB 2F98A 1A2KA 1Q824 3OWUA 5JBSA 2P38A 4STDA 1C7HA 1SJWA 4N6NB 3CCV3 3LZAA 1OPYA 4LZIA 2OOVC 2W56A 3N9HA 2HMNB 2YFIB 3H51A 2W6JH 1FGMA 5EQLA 1YIT3 3SVAA 2CFKA 4R1KA 1DVCA 3VGNA 3EBTA 1M1XB 3HIIA 2W9PA 2XR8B 1NWWA 4CDLA 3S29A 3HK4A 4MMZB 5AIGA 1VQ63 3RGRA 3EE1A 3T8UA 3MG3A 3ALAA 3LTBA 1VZZA 4L8PA 3MG1A 2FGTA 1N9EA 1M1K4 2LYXA 1OACA 1N8QA 4H3UA 1TFOA 4AKYA 1US1A 3EHCA 2CFWA 2E2UA 4ZM8A 1FUWA 1IDPA 3UB1A 1TFKA 3UL5A 4MMYB 3LTAA 1FGOA 1A67A 3NBBA 1IVWA 3F7XA 2XSOB 2WGOA 3FF2A 3IPTA 3GRDA 4XB5A 3STDA 2YFLB 1UUWB 4KFEA 4EBGA 3LTCA 1QVF2 3NUVA 3KZTA 3Q2PA 3V92A 1EKMA 4Q53A 4EV5A 5IEOA 1JN5B 3JUNA 3QRDA 1ZX2A 4FMBA 2OWPA 2HMMB 1YVBI 2PNCA 2CKFB 3CPW2 2YFJB 4HM7B 4R4KA 3PCRA 4HVNA 4HM2B 2W03A 3SX1A 3CPOA 4AKZA 4N6UA 3DZLA 4FMAA 3K63A 4O2HA 3CCL3 4K1UA 1CQSA 4EC6A 3LYGA 2E2VA 3Q1CA 2RGQA 3PXMA 1IU7A 3JUMA 3LTDA 2INXA 2XFTA 1JKGB 1RRHA 4L8OA 4MEIA 1IV7A 3ROBA 1AV4A 1IVVA 3LMLA 1BUQA 3LOYA 1OF5A 4MMXB 1TUHA 1DMQA 3DGMA 4WFOA 4RNYA 2STDA 2Y73A 3VSYA 3PCSA 5D82A 3MSOA 2C10A 3WA3A 2BMOB 2QA43 2QIYA 1OGZA 3WOFB 3OW22 5CLKA 3V98A 2WO0A 2D42A 4R80A 3NQZA 4LEHA 5FW5A 3FH1A 4LGQA 1IT7A 2MC8A 1ULIB 2OQEA 1EA2A 3EC9A 4N6V0 1RN7A 3SOYA 2YX9A 2BNGA 3LT8A 5D83A 5JPPA 3FSDA 3X40A 3PZWA 1AVKA 2XEPA 1WMOA 2W04A 1N9JA 3SEDA 3CCS3 3FKAA 5JPUA 3WDGB 3GZBA 3CCJ3 1VQK3 3HI7A 4BTYA 1Q40B 2XF3A 2ML5A 3D3LA 1N5HA 3K5TA 1VQP3 1K8A4 3X42A 2WOFA 3M8CA 1YIJ3 2A15A 2GBXB 3JUQA 5STDA 1VQ43 1W01A 4WYKA 4X2HA 1GD4A 4BTXA 1TIJA 3G8ZA 2RFRA 1ZO2A 3A76A 2HMOB 2QGUA 1D6UA 1RJOA 1W2B2 3EJVA 3X41A 4XBYA 4BTWA 1CYVA 3VF1A 3DM8A 1WMPA 2O9UX 5CF1A 3BLZA 2RSXA 3DY5A 3S28A 1W7CA 3EX9A 4WYKB 4N6LA 3WA2X 5EEOA 4J8TA 4X2OA 3N8BA 2BO9B 3QK9A 3KSPA 2W0QA 2GEXA 1QALA 4RBNA 4LMIA 4NREA 4FMDA 2CG0A 2IA7A 2XSHB 3MYTA 4HBRA 1OCVA 4U13A 4EYCA 1HKXA 3WOEB 3OWSA 4N6OB 2GEYA 2Z77A 8CHOA 1RKYA 5IG3A 5DRVA 1OHPA 2CHCA 1OUNA 1V74A 2CK3H 2Z76A 4GB5A 4HM3B 2CFLA 2GU1A 4K90B 3I553 3SOAA 1OHSA 3S67A 4QWTA 3CC23 3U97A 3CMA3 4FCJA 4N6MA 1T5YA 1FGTA 3KKGA 1YHQ3 3BNCA 5AIFA 1QMAA 3NBJA 3I0YA 3IMAB 3S27A 1S5AA 4WP5A 3WMDA 2F99A 1KSIA 3CU3A 2CIUA 1W2ZA 3FF0A 1FGQA 4HM0B 2IUJA 3J7Yd 2W56B 3E99A 1CYUA 1JN5A 3RDEA 3DXOA 1VQN3 5CXOA 3EN1B 1DMMA 1GY5A 5IG5A 3K0ZA 1AR0A 5CK6A 3UL6A 7STDA 4KZ1A 4O8SA 2OTL3 3SXXA 2KCDA 2KXGA 5I97A 3GZYB 4XDWA 1VQ53 5AIIA 3ECFA 1IQYA 2F86B 4NHFA 1SIHA 4OVMA 1K41A 4OUQA 4RNZA 3RGAA 3TDGA 1W4NA 2UX0A 3FG3A 4HM4B 3PS8A 1MNLA 1M904 2W2CA 2B1XB 4O02B 2IMJA 3KSED 3OX9A 3CCE3 1IT8A 3F40A 5IERA 1UUVB 2K0MA 3DGLA 2QEX3 5TGNA 1IVXA 3OXAA 2ZDJA 2R4IA 3LH4A 3GWRA 2CW9A 1K28A 4IIAA 3K9MC 2PZVA 2Y74A 5EVHA 4J9AA 3B7CA 3T0UA 1MOLA 4AEQA 5DREA 1W5ZA 1JNQA 3NHXA 1O7NB 1WQLB 2MF7A 4N3VA 1K9M4 2LQVA 2C11A 4K1VA 3CNMA 3F9SA 5FGOA 3EN8A 1DYUA 1AVLA 1LXEA 3KN4A 2M7OA 4HM1B 3CXC2 1G96A 2P05A 1NJI4 1ISKA 2B24B 4XBXA 5IG4A 3KE7A 2CFDA 1GYBA 2CH9A 1EG9B 1OH0A 3MG2A 3MWZA 5IF6A 2W9QA 4N6TA 3B4OA 1A2VA 2ZL8A 1UI7A 4G1MB 4JRFA 1PU4A 3D9RA 2GXFA 1JKGA 1O7HB 2Q07A 5AEWB 5CF2A 1D6ZA 1JV2B 3BNDA 1L5GB 1LVNA 3IJEB 2CC3A 1GY7A 5A0OB 3CD63 2OQEC 1LNHA 1IQXA 3I563 4KVHA 3OV4A 5IENA 1O7WB 1FA3A 1O7GB 1YI23
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  3LT9 A;  3DGL A;  3LTA A;  1UW1 A;  2P09 A;  3LTB A;  2P0X A;  3DGN A;  3LT8 A;  3LTC A;  3LTD A;  3DGM A;  3DGO A; 
#chains in the Genus database with same CATH topology
 1NB5 I;  1TP6 A;  1UW1 A;  3GZX B;  1W6Y A;  3CME 3;  3EQQ B;  1G0T A;  5IEP A;  3CCM 3;  1UGH I;  1O7P B;  2FNQ A;  3RNT A;  3UJM A;  5G2G A;  1STD A;  2O3O A;  1GMP A;  3X3X A;  3BU4 A;  4XM4 A;  1VQL 3;  4HM8 B;  1UI8 A;  1YGW A;  2FXT A;  1PFP A;  2CX0 A;  4I5Q A;  3FG1 A;  1LOX A;  1OGX A;  1U5O A;  5LC7 A;  2CWU A;  1RTU A;  1ASK A;  5AIH A;  3NV0 B;  4GL6 A;  2GBW B;  1IV9 A;  3CCU 3;  1E3V A;  2H0G A;  3NBR A;  3HZP A;  5GSP A;  1KWI A;  4FCZ A;  5AYS C;  1QJG A;  2Z6B A;  3JVC A;  1DET A;  3NM7 A;  5KP1 A;  3CC7 3;  3F8H A;  4XDV A;  1M9G A;  3SYU A;  4IT7 A;  3F8X A;  2JDI H;  3F14 A;  2JQ5 A;  1I2G A;  3DMC A;  4WHA A;  3NQY A;  5AYR B;  3DUK A;  1CEW I;  1YJN 3;  1RGK A;  1PYL A;  4FCM A;  3GZR A;  5M19 A;  3BNE A;  3U1W A;  3ZG0 A;  3NV0 A;  4FR9 A;  2F56 A;  1GMQ A;  2BHM A;  2XFS A;  4HM5 B;  4WWU C;  3AGN A;  4IPB A;  1JRQ A;  1IVU A;  1R4Y A;  4O3V A;  4RZM A;  1Q81 4;  1WMN A;  7GSP A;  3G71 3;  1VQM 3;  2V1L A;  2AAE A;  1S72 3;  1D6Y A;  1YJ9 3;  1B2X A;  3FG4 A;  1QVG 2;  2KF4 A;  1FUT A;  3EB8 A;  5ELJ A;  1NU3 A;  4HZB B;  3AMO A;  1BRK A;  5KP4 A;  2CWV A;  1A2P A;  1OF5 B;  4HYZ A;  3GAX A;  3MKI A;  3G0K A;  5M18 A;  5KP3 A;  2ML6 A;  4R9K A;  1GSP A;  3L0R A;  3Q90 A;  1BIR A;  4HJL B;  2OOV A;  3LT9 A;  1RNT A;  4FMC A;  5AI1 A;  1HU9 A;  3CC4 3;  3EBY A;  2BT3 A;  1LQM B;  1KC8 4;  1B2S A;  1R4C A;  4CJN A;  1BSB A;  2HMJ B;  3B8L A;  2HMK B;  3PGB A;  1K73 4;  2P09 A;  4MJD A;  3HIG A;  3HX8 A;  4J5G A;  1BAO A;  5ELU A;  1GD3 A;  3URP A;  3AMO B;  4EV2 A;  6STD A;  3H3H A;  1BRN L;  4HAA A;  2IUK A;  1GOY A;  3CCQ 3;  1V57 A;  1RGG A;  4DKI A;  4XBT A;  1NDO B;  3D4A A;  3F7S A;  1VQ8 3;  1BRI A;  1A90 A;  1UGI A;  1TU5 A;  1DE3 A;  3KII A;  1GY6 A;  1AY7 A;  1PY3 A;  1W00 A;  3B4P A;  1QAF A;  2BMR B;  2XRX B;  4HOH A;  4TX4 A;  5BXQ A;  2CWT A;  3V99 A;  1WTH A;  1JB5 A;  1RRL A;  1U8C B;  4BU4 A;  3GSP A;  3WR2 A;  2Z7A A;  3X3Y A;  1YJW 3;  3UNL A;  3LXU X;  2K54 A;  2I9W A;  2HOH A;  1STF I;  3NX0 A;  3G6E 3;  2RCD A;  1RDS A;  3DGO A;  3X3Z A;  1N5P A;  1NO3 A;  1I2E A;  1DMN A;  1NB3 I;  2P0M A;  4CCV A;  1BRH A;  1N8R 4;  4HM6 B;  4LSO A;  2D1W A;  1B3S A;  4ILF A;  2CG1 A;  1J2B A;  1B2M A;  4KFF A;  1VQ9 3;  1V58 A;  3NM2 A;  1Q86 4;  1JJ2 2;  3CNX A;  3BB9 A;  2XGN A;  3CCR 3;  4RNT A;  1Q42 A;  1Q7Y 4;  1B27 A;  1E97 A;  3EF8 A;  3FGY A;  2XH9 A;  5D81 A;  1YGE A;  5IG0 A;  1KQS 2;  3BNB A;  2WGQ A;  1Y4K A;  2XGL A;  3K7C A;  3FLJ A;  3MPH A;  1IK3 A;  1ROV A;  3WOD G;  5HGR A;  4EXR A;  1I2F A;  1W6G A;  3SLU A;  1JBS A;  2OCT A;  3DGN A;  5M1A A;  1DVD A;  1JZD A;  1W02 A;  2HML B;  1TTO A;  3G16 A;  6RNT A;  1YNV X;  2F5W A;  1E3R A;  1OHO A;  2SBL A;  1WNH A;  1JBR A;  1EQK A;  1C54 A;  3O8Y A;  1RHL A;  3FZW A;  3JUP A;  1SPU A;  1CH0 A;  5LC6 A;  1Q40 A;  1Z1S A;  3MHE A;  2AAD A;  1UCJ A;  4R9L A;  1MWT A;  1JB4 A;  3N54 B;  3PYJ A;  4ORL A;  1LNI A;  1VQ7 3;  1LOV A;  2UUG C;  4OK0 A;  4H61 A;  5AEU B;  2BMQ B;  2GU3 A;  2WOH A;  1VQO 3;  3ER7 A;  3JUO A;  4PEJ A;  3FCS B;  1FGR A;  4HZ9 B;  3KFQ C;  1O7M B;  1W6C A;  1FUS A;  3NXJ A;  5HOH A;  5IW9 A;  3G4S 3;  4EW5 A;  2E2T A;  3OWY A;  2OTJ 3;  1SII A;  2L4V A;  1JB2 A;  4K61 A;  1KD1 4;  2KF6 A;  1IQ8 A;  5BVB A;  1EEJ A;  1I3F A;  4JF8 A;  8RNT A;  1ROA A;  2KRT A;  2P0X A;  4HKV B;  1BUJ A;  1GS3 A;  1F8N A;  1T2I A;  1BOX A;  2CFG A;  4L7K A;  2KF5 A;  3T8N A;  3D79 A;  4KFD A;  1QAK A;  1SQW A;  3S5C A;  1I0V A;  1ULJ B;  4I4K A;  1B21 A;  2H0H A;  2F98 A;  1A2K A;  1Q82 4;  1UCL A;  3OWU A;  5JBS A;  2P38 A;  4STD A;  1C7H A;  1SJW A;  1X1Y A;  4N6N B;  3LZA A;  1OPY A;  4BIR A;  3CCV 3;  4LZI A;  2OOV C;  1UDI I;  2W56 A;  3N9H A;  2HMN B;  1GMR A;  2YFI B;  1RGC A;  3H51 A;  2W6J H;  2SAR A;  1FGM A;  5EQL A;  4KT3 B;  1YIT 3;  3SVA A;  2CFK A;  4R1K A;  1DVC A;  3VGN A;  3EBT A;  1M1X B;  3HII A;  2W9P A;  1BAN A;  2XR8 B;  1NWW A;  4CDL A;  3S29 A;  3HK4 A;  4MMZ B;  5AIG A;  1HYF A;  1VQ6 3;  3RGR A;  3EE1 A;  3T8U A;  2J8X B;  3MG3 A;  4CPK A;  3ALA A;  3HOH A;  3LTB A;  1VZZ A;  4L8P A;  3MG1 A;  2FGT A;  1N9E A;  1M1K 4;  2LYX A;  1OAC A;  1N8Q A;  4H3U A;  1TFO A;  4AKY A;  1US1 A;  3EHC A;  2CFW A;  2E2U A;  4ZM8 A;  1FUW A;  1IDP A;  3UB1 A;  1MWU A;  1TFK A;  3UL5 A;  4MMY B;  3LTA A;  4BL2 A;  1FGO A;  1A67 A;  3NBB A;  1IVW A;  3F7X A;  2XSO B;  2WGO A;  3FF2 A;  3IPT A;  3GRD A;  4XB5 A;  3STD A;  1UUW B;  2YFL B;  1Q7H A;  1ZGX A;  4KFE A;  4EBG A;  4J5K A;  3LTC A;  1QVF 2;  3NUV A;  3KZT A;  3Q2P A;  3V92 A;  3ZFZ A;  1EKM A;  4Q53 A;  4EV5 A;  5IEO A;  1JN5 B;  1BVI A;  2CX1 A;  3JUN A;  1G02 A;  3QRD A;  1JBT A;  1ZX2 A;  4FMB A;  1B2Z A;  2RBI A;  2OWP A;  7RNT A;  2HMM B;  1YVB I;  2PNC A;  2CKF B;  3CPW 2;  2YFJ B;  4HM7 B;  4R4K A;  3PCR A;  4HVN A;  1JZO A;  2W03 A;  4HM2 B;  3CPO A;  3SX1 A;  4AKZ A;  4N6U A;  3DZL A;  1FZU A;  4FMA A;  1B20 A;  3K63 A;  4O2H A;  3CCL 3;  4K1U A;  1BNF A;  1CQS A;  4EC6 A;  1ZS7 A;  3LYG A;  2E2V A;  3Q1C A;  2RGQ A;  3PXM A;  1IU7 A;  3AGO A;  3D5G A;  3JUM A;  3LTD A;  2INX A;  2F5M A;  2XFT A;  1UCI A;  1JKG B;  1RRH A;  4L8O A;  4MEI A;  1IV7 A;  3ROB A;  1AV4 A;  1IVV A;  2C4B A;  1LQG C;  1FW7 A;  3LML A;  1BUQ A;  1BGS A;  3AHS A;  1OF5 A;  3LOY A;  4MMX B;  1TUH A;  1DMQ A;  3DGM A;  4WFO A;  4RNY A;  2STD A;  2Y73 A;  3VSY A;  3ZG5 A;  3PCS A;  3Q3F A;  1I70 A;  5D82 A;  1TRQ A;  3MSO A;  1BNG A;  2C10 A;  3WA3 A;  2BMO B;  2QA4 3;  2QIY A;  1OGZ A;  3WOF B;  3OW2 2;  5CLK A;  3V98 A;  2WO0 A;  2D42 A;  4R80 A;  3NQZ A;  4LEH A;  5FW5 A;  3FH1 A;  4LGQ A;  1RCK A;  2BU4 A;  2H0I A;  1IT7 A;  2MC8 A;  1ULI B;  2OQE A;  1FYS A;  1EA2 A;  3EC9 A;  4N6V 0;  1RN7 A;  1YVS A;  1MGR A;  4NPB A;  3SOY A;  2YX9 A;  2BNG A;  3LT8 A;  5D83 A;  5JPP A;  3FSD A;  3X40 A;  1GOV A;  3PZW A;  1AVK A;  2XEP A;  3AHW A;  1WMO A;  5G1L A;  2W04 A;  2R41 A;  1N9J A;  3SED A;  3CCS 3;  3FKA A;  5JPU A;  1Q9E A;  3WDG B;  1MWS A;  3GZB A;  3CCJ 3;  1VQK 3;  1RSN A;  3HI7 A;  4BTY A;  1Q40 B;  2XF3 A;  2ML5 A;  3D3L A;  1N5H A;  1BRS A;  3K5T A;  1VQP 3;  1K8A 4;  1RNB A;  3X42 A;  2WOF A;  3M8C A;  1YIJ 3;  2A15 A;  2GBX B;  3JUQ A;  5STD A;  1VQ4 3;  1W01 A;  4WYK A;  4X2H A;  1GD4 A;  4BTX A;  1LOY A;  1TIJ A;  3G8Z A;  2RFR A;  1ZO2 A;  3A76 A;  2HMO B;  1SAR A;  3WHO A;  5G1K A;  2F4Y A;  2QGU A;  1D6U A;  1RJO A;  1W2B 2;  1I3I A;  3EJV A;  3X41 A;  4XBY A;  1BSE A;  1AQZ A;  4BTW A;  1CYV A;  4LYL B;  5RNT A;  3VF1 A;  5BU4 A;  2RNT A;  2L1S A;  1WMP A;  3DM8 A;  1RGF A;  2O9U X;  1RGH A;  5CF1 A;  3BLZ A;  2RSX A;  3DY5 A;  3S28 A;  1IYY A;  1W7C A;  3EX9 A;  4WYK B;  2K3D A;  4N6L A;  3WA2 X;  5EEO A;  4J8T A;  4X2O A;  3N8B A;  2BO9 B;  3QK9 A;  3KSP A;  2W0Q A;  2GEX A;  1EUI C;  1RCL A;  1QAL A;  4RBN A;  4LMI A;  2UGI A;  1X1W A;  4NRE A;  3BIR A;  1BNJ A;  1I0X A;  4FMD A;  2CG0 A;  2IA7 A;  2XSH B;  3MYT A;  4HBR A;  1OCV A;  4U13 A;  1B2U A;  4EYC A;  4GSP A;  1HKX A;  3WOE B;  3DGY A;  3OWS A;  2GEY A;  2Z77 A;  4N6O B;  8CHO A;  1RKY A;  5IG3 A;  5DRV A;  1OHP A;  2CHC A;  1OUN A;  1V74 A;  2CK3 H;  2Z76 A;  1UUG B;  4GB5 A;  4HM3 B;  2CFL A;  2GU1 A;  4K90 B;  3I55 3;  3SOA A;  1OHS A;  3S67 A;  4QWT A;  3CC2 3;  1LOW A;  1RGL A;  1RGE A;  3U97 A;  3CMA 3;  1BSC A;  4FCJ A;  4N6M A;  6GSP A;  1TJD A;  1T5Y A;  1FGT A;  3KKG A;  2IYJ A;  1BNE A;  1YHQ 3;  3BNC A;  5AIF A;  1QMA A;  2KF3 A;  1LRA A;  3NBJ A;  3I0Y A;  1BSD A;  3IMA B;  1BSA A;  3S27 A;  2ZHX B;  1S5A A;  4WP5 A;  3WMD A;  1RN1 A;  2F99 A;  1KSI A;  3CU3 A;  2CIU A;  5BIR A;  1W2Z A;  3FF0 A;  1FGQ A;  4HM0 B;  2IUJ A;  3A5E A;  3J7Y d;  2W56 B;  3E99 A;  1BNI A;  1VQQ A;  1CYU A;  1JN5 A;  3RDE A;  3DXO A;  1VQN 3;  5CXO A;  3EN1 B;  1DMM A;  1GY5 A;  5IG5 A;  3K0Z A;  1AR0 A;  5CK6 A;  3UL6 A;  7STD A;  4KZ1 A;  4O8S A;  2OTL 3;  3SXX A;  2KCD A;  2KXG A;  1T2H A;  5I97 A;  3GZY B;  1BU4 A;  4XDW A;  1VQ5 3;  5AII A;  3ECF A;  1IQY A;  2F86 B;  4NHF A;  1SIH A;  4OVM A;  1HZ1 A;  1K41 A;  4OUQ A;  4RNZ A;  3RGA A;  3TDG A;  1W4N A;  2UX0 A;  2GSP A;  3FG3 A;  3PS8 A;  4HM4 B;  1RGA A;  3D5I A;  1MNL A;  1M90 4;  2W2C A;  2B1X B;  4O02 B;  2IMJ A;  3KSE D;  3OX9 A;  3CCE 3;  1IT8 A;  2IY2 A;  3F40 A;  5IER A;  4GHO A;  1UUV B;  2K0M A;  3DGL A;  2QEX 3;  3DH2 A;  5TGN A;  1IVX A;  3OXA A;  2ZDJ A;  2R4I A;  3LH4 A;  3GWR A;  2CW9 A;  1K28 A;  1RMS A;  4IIA A;  2ZA4 A;  9RNT A;  3K9M C;  2PZV A;  2Y74 A;  5EVH A;  4J9A A;  1X1X A;  3B7C A;  3T0U A;  4BL3 A;  1MOL A;  4AEQ A;  5DRE A;  1W5Z A;  1JNQ A;  3NHX A;  1NNV A;  1GOU A;  1O7N B;  1WQL B;  1RLS A;  2MF7 A;  1BRG A;  2BIR A;  2LQV A;  4N3V A;  2C11 A;  1K9M 4;  4K1V A;  3CNM A;  3F9S A;  1UCK A;  5FGO A;  3EN8 A;  1DYU A;  1TRP A;  1AVL A;  1BRJ A;  1LXE A;  3KN4 A;  2M7O A;  4HM1 B;  3CXC 2;  1G96 A;  2P05 A;  1NJI 4;  1ISK A;  2B24 B;  4XBX A;  5IG4 A;  3KE7 A;  1X1U A;  2CFD A;  1GYB A;  2CH9 A;  1EG9 B;  1OH0 A;  3MG2 A;  3KCH A;  2KAA A;  3MWZ A;  1I8V A;  2W9Q A;  3B4O A;  4N6T A;  5IF6 A;  1A2V A;  2ZL8 A;  1UI7 A;  4G1M B;  4JRF A;  1PU4 A;  3D9R A;  2GXF A;  1JKG A;  1O7H B;  2Q07 A;  5AEW B;  5CF2 A;  1D6Z A;  1JV2 B;  3BND A;  1BNR A;  1L5G B;  1LVN A;  3IJE B;  1MGW A;  2CC3 A;  1BNS A;  1GY7 A;  5A0O B;  3CD6 3;  1T3B A;  1MWR A;  2OQE C;  1IQX A;  1LNH A;  3I56 3;  4KVH A;  3OV4 A;  5IEN A;  1RN4 A;  1O7W B;  1FA3 A;  1O7G B;  1YI2 3; 
#chains in the Genus database with same CATH homology
 1NB5 I;  1TP6 A;  1UW1 A;  3GZX B;  1W6Y A;  3CME 3;  3EQQ B;  5IEP A;  3CCM 3;  1O7P B;  2FNQ A;  3UJM A;  5G2G A;  1STD A;  2O3O A;  3X3X A;  4XM4 A;  1VQL 3;  4HM8 B;  1UI8 A;  2FXT A;  1PFP A;  3FG1 A;  1LOX A;  1OGX A;  1U5O A;  5LC7 A;  2CWU A;  1ASK A;  5AIH A;  3NV0 B;  4GL6 A;  2GBW B;  1IV9 A;  3CCU 3;  1E3V A;  3NBR A;  3HZP A;  1KWI A;  4FCZ A;  5AYS C;  1QJG A;  2Z6B A;  3JVC A;  3CC7 3;  3NM7 A;  5KP1 A;  3F8H A;  4XDV A;  1M9G A;  4IT7 A;  3F8X A;  2JDI H;  3F14 A;  2JQ5 A;  3DMC A;  4WHA A;  3NQY A;  5AYR B;  3DUK A;  1CEW I;  1YJN 3;  4FCM A;  3GZR A;  3BNE A;  3U1W A;  3NV0 A;  4FR9 A;  2BHM A;  2XFS A;  4HM5 B;  4WWU C;  4IPB A;  1JRQ A;  1IVU A;  4O3V A;  4RZM A;  1Q81 4;  1WMN A;  3G71 3;  1VQM 3;  2V1L A;  1S72 3;  1D6Y A;  1YJ9 3;  3FG4 A;  1QVG 2;  3EB8 A;  5ELJ A;  1NU3 A;  4HZB B;  3AMO A;  5KP4 A;  2CWV A;  1OF5 B;  4HYZ A;  3GAX A;  3MKI A;  3G0K A;  5KP3 A;  2ML6 A;  4R9K A;  3L0R A;  3Q90 A;  4HJL B;  2OOV A;  3LT9 A;  4FMC A;  5AI1 A;  1HU9 A;  3CC4 3;  3EBY A;  2BT3 A;  1KC8 4;  1R4C A;  2HMJ B;  3B8L A;  2HMK B;  3PGB A;  1K73 4;  2P09 A;  4MJD A;  3HIG A;  3HX8 A;  5ELU A;  1GD3 A;  3AMO B;  4EV2 A;  6STD A;  3H3H A;  2IUK A;  3CCQ 3;  4XBT A;  1NDO B;  3F7S A;  1VQ8 3;  1A90 A;  1TU5 A;  3KII A;  1GY6 A;  3B4P A;  1W00 A;  1QAF A;  2BMR B;  2XRX B;  4TX4 A;  5BXQ A;  2CWT A;  3V99 A;  1WTH A;  1JB5 A;  1RRL A;  1U8C B;  2Z7A A;  3X3Y A;  1YJW 3;  3UNL A;  3LXU X;  2K54 A;  2I9W A;  1STF I;  3NX0 A;  3G6E 3;  2RCD A;  3DGO A;  3X3Z A;  1N5P A;  1NO3 A;  1DMN A;  1NB3 I;  2P0M A;  4CCV A;  1N8R 4;  4HM6 B;  4LSO A;  2D1W A;  2CG1 A;  1J2B A;  4KFF A;  1VQ9 3;  3NM2 A;  1Q86 4;  1JJ2 2;  3CNX A;  3BB9 A;  2XGN A;  3CCR 3;  1Q42 A;  1Q7Y 4;  1E97 A;  3EF8 A;  3FGY A;  2XH9 A;  5D81 A;  1YGE A;  5IG0 A;  1KQS 2;  3BNB A;  2WGQ A;  1Y4K A;  2XGL A;  3K7C A;  3FLJ A;  3MPH A;  1IK3 A;  1ROV A;  3WOD G;  5HGR A;  4EXR A;  1W6G A;  3SLU A;  2OCT A;  3DGN A;  1DVD A;  1W02 A;  2HML B;  3G16 A;  1E3R A;  1OHO A;  2SBL A;  1WNH A;  1EQK A;  3O8Y A;  3FZW A;  3JUP A;  1SPU A;  5LC6 A;  1Q40 A;  1Z1S A;  3MHE A;  4R9L A;  1JB4 A;  3N54 B;  3PYJ A;  4ORL A;  1VQ7 3;  4OK0 A;  4H61 A;  5AEU B;  2BMQ B;  2GU3 A;  2WOH A;  1VQO 3;  3ER7 A;  3JUO A;  4PEJ A;  3FCS B;  1FGR A;  4HZ9 B;  3KFQ C;  1O7M B;  1W6C A;  3NXJ A;  5IW9 A;  3G4S 3;  2OTJ 3;  2E2T A;  3OWY A;  1SII A;  2L4V A;  1JB2 A;  4K61 A;  1KD1 4;  1IQ8 A;  5BVB A;  4JF8 A;  1ROA A;  2KRT A;  2P0X A;  4HKV B;  1GS3 A;  1F8N A;  2CFG A;  4L7K A;  3T8N A;  4KFD A;  1QAK A;  1SQW A;  3S5C A;  4I4K A;  1ULJ B;  2F98 A;  1A2K A;  1Q82 4;  3OWU A;  5JBS A;  2P38 A;  4STD A;  1C7H A;  1SJW A;  4N6N B;  3CCV 3;  3LZA A;  1OPY A;  4LZI A;  2OOV C;  2W56 A;  3N9H A;  2HMN B;  2YFI B;  3H51 A;  2W6J H;  1FGM A;  5EQL A;  1YIT 3;  3SVA A;  2CFK A;  4R1K A;  1DVC A;  3VGN A;  3EBT A;  1M1X B;  3HII A;  2W9P A;  2XR8 B;  1NWW A;  4CDL A;  3S29 A;  3HK4 A;  4MMZ B;  5AIG A;  1VQ6 3;  3RGR A;  3EE1 A;  3T8U A;  3MG3 A;  3ALA A;  3LTB A;  1VZZ A;  4L8P A;  3MG1 A;  2FGT A;  1N9E A;  1M1K 4;  2LYX A;  1OAC A;  1N8Q A;  4H3U A;  1TFO A;  4AKY A;  1US1 A;  3EHC A;  2CFW A;  2E2U A;  4ZM8 A;  1FUW A;  1IDP A;  3UB1 A;  1TFK A;  3UL5 A;  4MMY B;  3LTA A;  1FGO A;  1A67 A;  3NBB A;  1IVW A;  3F7X A;  2XSO B;  2WGO A;  3FF2 A;  3IPT A;  3GRD A;  4XB5 A;  3STD A;  2YFL B;  1UUW B;  4KFE A;  4EBG A;  3LTC A;  1QVF 2;  3NUV A;  3KZT A;  3Q2P A;  3V92 A;  1EKM A;  4Q53 A;  4EV5 A;  5IEO A;  1JN5 B;  3JUN A;  3QRD A;  1ZX2 A;  4FMB A;  2OWP A;  2HMM B;  1YVB I;  2PNC A;  2CKF B;  3CPW 2;  2YFJ B;  4HM7 B;  4R4K A;  3PCR A;  4HVN A;  4HM2 B;  2W03 A;  3SX1 A;  3CPO A;  4AKZ A;  4N6U A;  3DZL A;  4FMA A;  3K63 A;  4O2H A;  3CCL 3;  4K1U A;  1CQS A;  4EC6 A;  3LYG A;  2E2V A;  3Q1C A;  2RGQ A;  3PXM A;  1IU7 A;  3JUM A;  3LTD A;  2INX A;  2XFT A;  1JKG B;  1RRH A;  4L8O A;  4MEI A;  1IV7 A;  3ROB A;  1AV4 A;  1IVV A;  3LML A;  1BUQ A;  3LOY A;  1OF5 A;  4MMX B;  1TUH A;  1DMQ A;  3DGM A;  4WFO A;  4RNY A;  2STD A;  2Y73 A;  3VSY A;  3PCS A;  5D82 A;  3MSO A;  2C10 A;  3WA3 A;  2BMO B;  2QA4 3;  2QIY A;  1OGZ A;  3WOF B;  3OW2 2;  5CLK A;  3V98 A;  2WO0 A;  2D42 A;  4R80 A;  3NQZ A;  4LEH A;  5FW5 A;  3FH1 A;  4LGQ A;  1IT7 A;  2MC8 A;  1ULI B;  2OQE A;  1EA2 A;  3EC9 A;  4N6V 0;  1RN7 A;  3SOY A;  2YX9 A;  2BNG A;  3LT8 A;  5D83 A;  5JPP A;  3FSD A;  3X40 A;  3PZW A;  1AVK A;  2XEP A;  1WMO A;  2W04 A;  1N9J A;  3SED A;  3CCS 3;  3FKA A;  5JPU A;  3WDG B;  3GZB A;  3CCJ 3;  1VQK 3;  3HI7 A;  4BTY A;  1Q40 B;  2XF3 A;  2ML5 A;  3D3L A;  1N5H A;  3K5T A;  1VQP 3;  1K8A 4;  3X42 A;  2WOF A;  3M8C A;  1YIJ 3;  2A15 A;  2GBX B;  3JUQ A;  5STD A;  1VQ4 3;  1W01 A;  4WYK A;  4X2H A;  1GD4 A;  4BTX A;  1TIJ A;  3G8Z A;  2RFR A;  1ZO2 A;  3A76 A;  2HMO B;  2QGU A;  1D6U A;  1RJO A;  1W2B 2;  3EJV A;  3X41 A;  4XBY A;  4BTW A;  1CYV A;  3VF1 A;  3DM8 A;  1WMP A;  2O9U X;  5CF1 A;  3BLZ A;  2RSX A;  3DY5 A;  3S28 A;  1W7C A;  3EX9 A;  4WYK B;  4N6L A;  3WA2 X;  5EEO A;  4J8T A;  4X2O A;  3N8B A;  2BO9 B;  3QK9 A;  3KSP A;  2W0Q A;  2GEX A;  1QAL A;  4RBN A;  4LMI A;  4NRE A;  4FMD A;  2CG0 A;  2IA7 A;  2XSH B;  3MYT A;  4HBR A;  1OCV A;  4U13 A;  4EYC A;  1HKX A;  3WOE B;  3OWS A;  4N6O B;  2GEY A;  2Z77 A;  8CHO A;  1RKY A;  5IG3 A;  5DRV A;  1OHP A;  2CHC A;  1OUN A;  1V74 A;  2CK3 H;  2Z76 A;  4GB5 A;  4HM3 B;  2CFL A;  2GU1 A;  4K90 B;  3I55 3;  3SOA A;  1OHS A;  3S67 A;  4QWT A;  3CC2 3;  3U97 A;  3CMA 3;  4FCJ A;  4N6M A;  1T5Y A;  1FGT A;  3KKG A;  1YHQ 3;  3BNC A;  5AIF A;  1QMA A;  3NBJ A;  3I0Y A;  3IMA B;  3S27 A;  1S5A A;  4WP5 A;  3WMD A;  2F99 A;  1KSI A;  3CU3 A;  2CIU A;  1W2Z A;  3FF0 A;  1FGQ A;  4HM0 B;  2IUJ A;  3J7Y d;  2W56 B;  3E99 A;  1CYU A;  1JN5 A;  3RDE A;  3DXO A;  1VQN 3;  5CXO A;  3EN1 B;  1DMM A;  1GY5 A;  5IG5 A;  3K0Z A;  1AR0 A;  5CK6 A;  3UL6 A;  7STD A;  4KZ1 A;  4O8S A;  2OTL 3;  3SXX A;  2KCD A;  2KXG A;  5I97 A;  3GZY B;  4XDW A;  1VQ5 3;  5AII A;  3ECF A;  1IQY A;  2F86 B;  4NHF A;  1SIH A;  4OVM A;  1K41 A;  4OUQ A;  4RNZ A;  3RGA A;  3TDG A;  1W4N A;  2UX0 A;  3FG3 A;  4HM4 B;  3PS8 A;  1MNL A;  1M90 4;  2W2C A;  2B1X B;  4O02 B;  2IMJ A;  3KSE D;  3OX9 A;  3CCE 3;  1IT8 A;  3F40 A;  5IER A;  1UUV B;  2K0M A;  3DGL A;  2QEX 3;  5TGN A;  1IVX A;  3OXA A;  2ZDJ A;  2R4I A;  3LH4 A;  3GWR A;  2CW9 A;  1K28 A;  4IIA A;  3K9M C;  2PZV A;  2Y74 A;  5EVH A;  4J9A A;  3B7C A;  3T0U A;  1MOL A;  4AEQ A;  5DRE A;  1W5Z A;  1JNQ A;  3NHX A;  1O7N B;  1WQL B;  2MF7 A;  4N3V A;  1K9M 4;  2LQV A;  2C11 A;  4K1V A;  3CNM A;  3F9S A;  5FGO A;  3EN8 A;  1DYU A;  1AVL A;  1LXE A;  3KN4 A;  2M7O A;  4HM1 B;  3CXC 2;  1G96 A;  2P05 A;  1NJI 4;  1ISK A;  2B24 B;  4XBX A;  5IG4 A;  3KE7 A;  2CFD A;  1GYB A;  2CH9 A;  1EG9 B;  1OH0 A;  3MG2 A;  3MWZ A;  5IF6 A;  2W9Q A;  4N6T A;  3B4O A;  1A2V A;  2ZL8 A;  1UI7 A;  4G1M B;  4JRF A;  1PU4 A;  3D9R A;  2GXF A;  1JKG A;  1O7H B;  2Q07 A;  5AEW B;  5CF2 A;  1D6Z A;  1JV2 B;  3BND A;  1L5G B;  1LVN A;  3IJE B;  2CC3 A;  1GY7 A;  5A0O B;  3CD6 3;  2OQE C;  1LNH A;  1IQX A;  3I56 3;  4KVH A;  3OV4 A;  5IEN A;  1O7W B;  1FA3 A;  1O7G B;  1YI2 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...