1UW1A

A novel adp- and zinc-binding fold from function-directed in vitro evolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
b'DDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)
publication title A Novel Adp- and Zinc-Binding Fold from Function-Directed in Vitro Evolution
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uw1A00
3DGNA 3LT8A 3LTAA 3DGMA 2P09A 3DGLA 3LTDA 3LTCA 3LTBA 1UW1A 3DGOA 2P0XA 3LT9A 2P05A
chains in the Genus database with same CATH superfamily
4HM1B 1RHLA 3HZPA 2CFDA 1O7HB 3B4OA 5FW5A 4GL6A 1W6YA 3WA3A 1B2UA 1AVKA 1Z1SA 2WGOA 4STDA 4FMCA 2UUGC 5TGNA 2BMRB 4N3VA 4MMZB 4AEQA 2GBXB 4EBGA 3UL5A 4BU4A 1A2PA 3CD63 4GSPA 4WYKB 5AIIA 1EQKA 1GOVA 1FUSA 1PY3A 1QAKA 1RRHA 1BIRA 2PNCA 3NM7A 2LQVA 3RNTA 1RGFA 4BTWA 1M1XB 3NBRA 1N8R4 2C10A 3EE1A 1JN5A 1T5YA 4R80A 5FGOA 2GEXA 1DE3A 5KP4A 4MMYB 1KQS2 2XEPA 1UCIA 3SX1A 1ULIB 2HMOB 2HMMB 3GAXA 1T3BA 3SXXA 3QK9A 2GSPA 1YVSA 5AEUB 1C54A 1FGTA 3G0KA 3MG1A 3QRDA 3N54B 1JNQA 5CXOA 4BL2A 5IERA 1B2XA 3EBTA 5EVHA 1B20A 3MG2A 1FW7A 2XH9A 3JVCA 3DY5A 3ZFZA 1GMPA 1QVF2 3LTDA 3GZRA 2F5MA 3FG1A 2W56A 1MWUA 2F56A 4LGQA 2GU1A 4FCJA 4CJNA 4HOHA 4K1UA 3ALAA 1BVIA 1ZGXA 1KD14 1OF5B 2OTJ3 3V98A 3HX8A 3CCL3 1BUJA 1RTUA 1EG9B 2AAEA 1DMMA 3FLJA 1RN1A 2E2VA 3NHXA 1BSAA 6STDA 3KZTA 1S5AA 5CF2A 3S29A 1MGWA 4KVHA 1S723 2KF3A 1IDPA 2P0MA 3IJEB 1NO3A 1DYUA 3F7SA 3CCS3 1K8A4 1D6ZA 1FGMA 1YIT3 4GHOA 2XGNA 3WMDA 1LOXA 3D79A 4HKVB 3CCM3 1Q42A 3IMAB 4RNTA 2CFLA 3KSED 1STDA 1Q824 3F8HA 1B2MA 3CU3A 4HM4B 1I8VA 3E99A 4NREA 1W5ZA 4U13A 3LT8A 3TDGA 1GOYA 2K0MA 1JZDA 3KN4A 1J2BA 2XRXB 3FKAA 4ORLA 2BHMA 4K1VA 4Q53A 2Y73A 4ZM8A 3G4S3 3CMA3 1JBRA 4HM0B 1PFPA 1GY5A 1BRHA 1WTHA 5M19A 3EBYA 4XBYA 3A5EA 3GZXB 2CHCA 4XDVA 4HM7B 5GSPA 1ZO2A 2L4VA 1RKYA 1Q7HA 2CG0A 4FCMA 4FCZA 1UCKA 4LMIA 1IYYA 2GU3A 2XFTA 2RNTA 1UGHI 2MC8A 2W9QA 4AKZA 1NJI4 4WHAA 3G16A 1OACA 1V58A 2RFRA 1E3VA 4K90B 2D42A 5IG5A 5A0OB 1TU5A 4WP5A 1B2SA 4MEIA 8CHOA 1BGSA 3EB8A 1VQK3 3MPHA 1CH0A 1UUVB 2KRTA 3ZG0A 1N9JA 3WOEB 3S27A 4EYCA 1JJ22 3BB9A 4R9KA 2K54A 2M7OA 1OHSA 1NWWA 1BANA 1IVUA 3WHOA 1Q7Y4 1W2B2 5LC7A 7STDA 1UI8A 2GBWB 1JBSA 1QAFA 2E2TA 1U5OA 3FGYA 1VQ73 4J8TA 4OUQA 1RN7A 2KCDA 1FZUA 1RGGA 3SYUA 5IEPA 1LOWA 1GD3A 1W2ZA 1C7HA 1BRGA 1TUHA 3CME3 2D1WA 5AYSC 1B21A 2WOFA 2L1SA 3CC73 3AMOB 1LOYA 3O8YA 5DRVA 5AYRB 1YGEA 2F99A 4EC6A 2Q07A 1YNVX 4XM4A 1AVLA 1ISKA 4BIRA 3LMLA 1BNFA 3CNXA 1UCJA 3CCU3 2R41A 3MKIA 2RSXA 1I70A 4RNYA 3S5CA 2CWTA 3CC43 1BOXA 5G2GA 1FUTA 2IMJA 5AIFA 1GD4A 1NU3A 1WMNA 4IPBA 4CPKA 3DZLA 1N5PA 4I5QA 1I0XA 1JZOA 1JN5B 2P05A 3PCRA 3GZBA 3URPA 4MMXB 2XF3A 4EW5A 5BIRA 1G0TA 2KAAA 2ML5A 3MSOA 3DGOA 1DVDA 1RMSA 2CX1A 2CX0A 1RN4A 1EKMA 1GOUA 2CKFB 3T0UA 1K734 1B3SA 2XSHB 1LRAA 1BUQA 2CK3H 1RGEA 4KT3B 5AIHA 4XBTA 3ROBA 1W00A 1X1UA 1BNSA 5IENA 4X2HA 1VQP3 3AGOA 3D5IA 5KP1A 3PZWA 1CYVA 3CNMA 3PGBA 3CCJ3 1CYUA 1BSEA 5CF1A 2BO9B 3OXAA 2H0GA 3SVAA 4WWUC 1A67A 3SOAA 1UUWB 1TJDA 3GSPA 3K5TA 3FH1A 1HYFA 3EN1B 2F86B 2W56B 4LYLB 1F8NA 1JB5A 3BIRA 9RNTA 2CW9A 2O3OA 3Q1CA 3HIIA 1IQYA 2BMQB 1YJW3 3CC23 3HK4A 2HMJB 1SJWA 1KSIA 1RGHA 2RBIA 3ECFA 3T8UA 4HJLB 3F9SA 3LOYA 1N5HA 8RNTA 2INXA 3NV0B 1LOVA 1X1WA 3NX0A 2W2CA 3D3LA 2C4BA 2BIRA 5G1LA 1YI23 1YHQ3 1RNTA 1OPYA 4BL3A 4CCVA 3EF8A 1AR0A 3T8NA 1GS3A 1BU4A 3JUPA 4IIAA 4N6MA 4O2HA 1IVVA 3PYJA 5IG3A 2YFJB 1VZZA 6GSPA 1TRPA 4EV5A 1BRSA 4HVNA 1I2GA 4LZIA 1VQL3 1BRIA 1SIHA 2KF6A 2QEX3 4HAAA 3FF0A 3MG3A 3X3ZA 2QA43 1IV7A 1SPUA 1T2IA 2KF5A 4KFDA 1K41A 2ZL8A 4HZBB 3MHEA 2P0XA 2CFGA 3KIIA 5IW9A 1FA3A 4TX4A 1ROVA 3JUMA 3OX9A 1RNBA 3NUVA 2Z76A 2Z77A 1HU9A 1LVNA 1GY6A 1O7NB 3AGNA 3H51A 1TTOA 3KE7A 3DXOA 3I563 4J9AA 2RGQA 3X41A 4ILFA 4MJDA 7RNTA 1RGKA 1RRLA 5HGRA 3CCV3 1KC84 4AKYA 3G713 3D9RA 3RGAA 4FMDA 3EX9A 5AEWB 4KFEA 5CLKA 4H3UA 1VQ83 1JKGA 1E97A 2IUJA 3Q3FA 4EXRA 3NXJA 2GXFA 1D6YA 1RJOA 4GB5A 1O7GB 1JV2B 3DM8A 2BU4A 3EQQB 2A15A 2CWUA 1PU4A 4LEHA 5STDA 4HM2B 1GYBA 1Y4KA 4G1MB 5IG0A 2BNGA 4DKIA 4RZMA 3PXMA 2FGTA 3Q2PA 2O9UX 3EN8A 3PCSA 1LQGC 1TFOA 1GMQA 1I3FA 5EEOA 2I9WA 3B8LA 2BMOB 1GMRA 1MWSA 3V92A 2CC3A 3HOHA 1MWRA 1VQ53 3WOFB 5KP3A 3UNLA 1I2EA 1IVWA 1YJN3 1IQXA 1LNIA 3SOYA 1MNLA 3GZYB 1GY7A 1OUNA 2HOHA 3OV4A 1BRKA 2CIUA 2P38A 3FCSB 4JRFA 2YFIB 4FR9A 3KSPA 2UX0A 2WOHA 2YX9A 3CPOA 1W4NA 4HZ9B 3D4AA 4IT7A 1TRQA 5JBSA 2YFLB 3M8CA 4R9LA 3UJMA 1A2VA 1NB5I 1X1YA 2MF7A 3LTAA 5D82A 1NNVA 2GEYA 5AIGA 3DGLA 3F40A 4K61A 5I97A 3S28A 4HM6B 5BVBA 1YVBI 4J5GA 1QVG2 3A76A 4R1KA 4QWTA 3DGYA 4FMBA 4LSOA 2WO0A 2J8XB 2CG1A 1A2KA 1DMNA 2P09A 3EC9A 4XB5A 5DREA 1M9GA 1DETA 1YIJ3 2V1LA 1V74A 2KF4A 3RGRA 3VF1A 3GRDA 1VQO3 5ELUA 1UUGB 2RCDA 3X42A 1ASKA 5D83A 1SIIA 4L8OA 3NBBA 1LQMB 1O7MB 3G8ZA 3BU4A 1RCLA 3LH4A 2OTL3 4OVMA 2STDA 1OGZA 3LTCA 2CWVA 1W6GA 4HYZA 3EHCA 1B27A 1DMQA 1OGXA 3U97A 1LNHA 4I4KA 1FUWA 3BNEA 2ZDJA 3DGNA 5M1AA 1Q40A 1B2ZA 3F7XA 1YJ93 4HM5B 5BU4A 1VQ63 4XBXA 5HOHA 1FGQA 5JPPA 2PZVA 3LT9A 1RCKA 2UGIA 2XSOB 2XGLA 1D6UA 1BSBA 3KFQC 5ELJA 2B1XB 3V99A 1EA2A 2B24B 1BNGA 2OCTA 3HI7A 3NQYA 2ML6A 1QMAA 4BTXA 1YGWA 3WA2X 3DH2A 2OQEA 4RNZA 3K7CA 1ROAA 1JB2A 2SBLA 3K9MC 1US1A 3LXUX 4WYKA 1BNIA 4N6OB 2IUKA 1BAOA 1JBTA 3ER7A 4NHFA 1HKXA 1DVCA 2OOVA 3H3HA 1OH0A 3CCE3 3N8BA 3I0YA 3MYTA 4KZ1A 1O7PB 3D5GA 3X40A 1K28A 2W6JH 3FG4A 5D81A 2ZA4A 3JUQA 1ULJB 4HM3B 4WFOA 2CH9A 3BLZA 3WR2A 3CCQ3 3ZG5A 1N8QA 3SEDA 2W9PA 2F5WA 5BXQA 4R4KA 3NQZA 3MWZA 3UB1A 3CCR3 1T2HA 2R4IA 1IU7A 1KWIA 1TFKA 1W01A 3BNBA 2W0QA 3KCHA 1ZS7A 2CFKA 1Q864 1L5GB 2OQEC 1FGOA 3K0ZA 1UCLA 2K3DA 1HZ1A 3B7CA 4RBNA 4XDWA 3UL6A 6RNTA 3LYGA 2JDIH 1OF5A 3B4PA 4OK0A 4X2OA 1AY7A 7GSPA 3G6E3 4NPBA 3OW22 3NV0A 1JB4A 3OWUA 3FF2A 5IEOA 3VGNA 1WMOA 3X3XA 1X1XA 1EUIC 1BNEA 1RSNA 4N6NB 3EJVA 4N6V0 1QALA 2OOVC 1Q814 2AADA 1JRQA 1R4CA 1JKGB 1GSPA 1W6CA 2HMKB 2IA7A 2HMNB 1STFI 4J5KA 3FG3A 3X3YA 2H0HA 1VQ93 1N9EA 2BT3A 3U1WA 1VQ43 3AHWA 3GWRA 1OHOA 2F4YA 1FYSA 4FMAA 1G96A 1VQQA 4PEJA 3SLUA 1ZX2A 3FZWA 1G02A 3I553 2OWPA 3IPTA 1IQ8A 3AHSA 1CEWI 1LXEA 2H0IA 2W04A 1M904 1IV9A 1QJGA 1W7CA 2C11A 3CXC2 3WDGB 1I0VA 2IYJA 2XR8B 4EV2A 1IVXA 3F14A 4HBRA 5EQLA 4O8SA 1NB3I 1SQWA 1E3RA 1SARA 1TP6A 1RGLA 4N6LA 2XFSA 1I2FA 1UGIA 2FNQA 3STDA 1IT7A 3OWSA 2E2UA 1MWTA 1R4YA 1I3IA 2QGUA 2KXGA 3DUKA 3HIGA 3L0RA 1K9M4 5LC6A 1RDSA 1IT8A 3NM2A 1BRNL 2W03A 1BRJA 3NBJA 5IF6A 2FXTA 2QIYA 2HMLB 3DGMA 3RDEA 1BSDA 1IK3A 1BNJA 4L7KA 5CK6A 1BNRA 3PS8A 1UDII 1W02A 2SARA 1VQM3 3F8XA 3K63A 4BTYA 3BNDA 1V57A 4N6UA 4N6TA 1WNHA 1AQZA 1OHPA 1RLSA 1CQSA 2IY2A 3N9HA 4HM8B 1M1K4 1RGAA 2Z6BA 1U8CB 1VQN3 2JQ5A 2WGQA 3OWYA 5M18A 3BNCA 4JF8A 3JUOA 4L8PA 3CPW2 1PYLA 2Z7AA 2ZHXB 1FGRA 1AV4A 1UW1A 3LTBA 3DMCA 3LZAA 1MGRA 5JPUA 3J7Yd 1EEJA 2CFWA 3VSYA 4CDLA 1TIJA 5G1KA 1A90A 1Q9EA 1BSCA 4O3VA 1MOLA 2LYXA 1Q40B 3Q90A 1WMPA 4H61A 4KFFA 3S67A 1NDOB 1RGCA 5RNTA 5IG4A 1WQLB 3AMOA 3WODG 4O02B 2F98A 3JUNA 3KKGA 2Y74A 1UI7A 1OCVA 3FSDA 1O7WB 5AI1A
chains in the Genus database with same CATH topology
4HM1B 3HZPA 2CFDA 1O7HB 3B4OA 5FW5A 4GL6A 1W6YA 3WA3A 1AVKA 1Z1SA 2WGOA 4STDA 4FMCA 5TGNA 4AEQA 2BMRB 4N3VA 4MMZB 2GBXB 4EBGA 3UL5A 3CD63 4WYKB 5AIIA 1EQKA 1QAKA 1RRHA 2PNCA 3NM7A 2LQVA 4BTWA 1M1XB 3NBRA 1N8R4 2C10A 3EE1A 1JN5A 1T5YA 4R80A 5FGOA 2GEXA 5KP4A 4MMYB 1KQS2 2XEPA 3SX1A 1ULIB 2HMOB 2HMMB 3GAXA 3SXXA 3QK9A 5AEUB 1FGTA 3G0KA 3MG1A 3QRDA 3N54B 1JNQA 5CXOA 5IERA 3EBTA 5EVHA 3MG2A 2XH9A 3JVCA 3DY5A 1QVF2 3LTDA 3GZRA 3FG1A 2W56A 4LGQA 2GU1A 4FCJA 4K1UA 3ALAA 1KD14 1OF5B 2OTJ3 3V98A 3HX8A 3CCL3 1EG9B 1DMMA 3FLJA 3NHXA 2E2VA 6STDA 3KZTA 1S5AA 5CF2A 3S29A 4KVHA 1S723 1IDPA 2P0MA 3IJEB 1NO3A 1DYUA 3F7SA 3CCS3 1K8A4 1D6ZA 1FGMA 1YIT3 2XGNA 3WMDA 1LOXA 4HKVB 3CCM3 1Q42A 3IMAB 2CFLA 3KSED 1STDA 1Q824 3F8HA 3CU3A 4HM4B 3E99A 4NREA 1W5ZA 4U13A 3LT8A 3TDGA 2K0MA 3KN4A 1J2BA 2XRXB 3FKAA 4ORLA 2BHMA 4K1VA 4Q53A 2Y73A 4ZM8A 3G4S3 3CMA3 4HM0B 1PFPA 1GY5A 1WTHA 3EBYA 4XBYA 3GZXB 2CHCA 4XDVA 4HM7B 1ZO2A 2L4VA 1RKYA 2CG0A 4FCMA 4FCZA 4LMIA 2GU3A 2XFTA 2MC8A 2W9QA 4AKZA 1NJI4 4WHAA 3G16A 1OACA 2RFRA 1E3VA 4K90B 2D42A 5IG5A 5A0OB 1TU5A 4WP5A 4MEIA 8CHOA 1VQK3 3EB8A 3MPHA 1UUVB 2KRTA 1N9JA 3WOEB 3S27A 4EYCA 1JJ22 3BB9A 4R9KA 2K54A 2M7OA 1OHSA 1NWWA 1IVUA 1Q7Y4 1W2B2 5LC7A 7STDA 1UI8A 2GBWB 1QAFA 2E2TA 1U5OA 3FGYA 1VQ73 4J8TA 4OUQA 1RN7A 2KCDA 5IEPA 1GD3A 1W2ZA 1C7HA 1TUHA 3CME3 2D1WA 5AYSC 2WOFA 3CC73 3AMOB 3O8YA 5DRVA 5AYRB 1YGEA 2F99A 4EC6A 2Q07A 4XM4A 1AVLA 1ISKA 3LMLA 3CNXA 3CCU3 3MKIA 2RSXA 4RNYA 3S5CA 2CWTA 3CC43 5G2GA 2IMJA 5AIFA 1GD4A 1NU3A 1WMNA 4IPBA 3DZLA 1N5PA 1JN5B 2P05A 3PCRA 3GZBA 4MMXB 2XF3A 2ML5A 3MSOA 3DGOA 1DVDA 1EKMA 1K734 2CKFB 3T0UA 1BUQA 2XSHB 2CK3H 5AIHA 4XBTA 3ROBA 1W00A 5IENA 1VQP3 4X2HA 5KP1A 3PZWA 1CYVA 3CNMA 3PGBA 3CCJ3 1CYUA 5CF1A 2BO9B 3OXAA 3SVAA 4WWUC 1A67A 3SOAA 1UUWB 3K5TA 3FH1A 3EN1B 2F86B 2W56B 1F8NA 1JB5A 2CW9A 2O3OA 3Q1CA 3HIIA 1IQYA 2BMQB 1YJW3 3CC23 3HK4A 2HMJB 1SJWA 1KSIA 3ECFA 3T8UA 4HJLB 3F9SA 3LOYA 1N5HA 2INXA 3NV0B 3NX0A 2W2CA 3D3LA 1YI23 1YHQ3 1OPYA 4CCVA 3EF8A 1AR0A 3T8NA 1GS3A 4IIAA 3JUPA 4N6MA 4O2HA 1IVVA 3PYJA 5IG3A 2YFJB 1VZZA 4EV5A 4HVNA 4LZIA 1VQL3 1SIHA 2QEX3 3FF0A 3MG3A 3X3ZA 2QA43 1IV7A 1SPUA 4KFDA 1K41A 2ZL8A 4HZBB 3MHEA 2P0XA 2CFGA 3KIIA 5IW9A 1FA3A 4TX4A 1ROVA 3JUMA 3OX9A 3NUVA 2Z77A 2Z76A 1HU9A 1LVNA 1GY6A 1O7NB 3H51A 3KE7A 3I563 1YIJ3 3DXOA 4J9AA 2RGQA 3X41A 4MJDA 1RRLA 5HGRA 3CCV3 1KC84 4AKYA 3G713 3D9RA 3RGAA 4FMDA 3EX9A 5AEWB 4KFEA 5CLKA 4H3UA 1VQ83 1JKGA 1E97A 2IUJA 4EXRA 3NXJA 2GXFA 1D6YA 1RJOA 4GB5A 1O7GB 1JV2B 3DM8A 3EQQB 2A15A 2CWUA 1PU4A 4LEHA 5STDA 4HM2B 1GYBA 1Y4KA 4G1MB 5IG0A 2BNGA 4RZMA 3PXMA 2FGTA 3Q2PA 2O9UX 3EN8A 3PCSA 1TFOA 5EEOA 2I9WA 3B8LA 2BMOB 3V92A 2CC3A 1VQ53 3WOFB 5KP3A 3UNLA 1IVWA 1YJN3 1IQXA 3SOYA 1MNLA 3GZYB 1GY7A 1OUNA 3OV4A 2P38A 2CIUA 3FCSB 4JRFA 2YFIB 4FR9A 3KSPA 2UX0A 2WOHA 2YX9A 3CPOA 1W4NA 4HZ9B 4IT7A 1NB5I 5JBSA 2YFLB 3M8CA 4R9LA 3UJMA 1A2VA 5D82A 2MF7A 3LTAA 2GEYA 5AIGA 3DGLA 3F40A 4K61A 5I97A 3S28A 4HM6B 5BVBA 1YVBI 1QVG2 3A76A 4R1KA 4QWTA 4LSOA 4FMBA 2WO0A 2CG1A 1A2KA 1DMNA 2P09A 3EC9A 4XB5A 5DREA 1M9GA 2V1LA 1V74A 3RGRA 3VF1A 3GRDA 1VQO3 5ELUA 2RCDA 3X42A 1ASKA 5D83A 1SIIA 4L8OA 3NBBA 1O7MB 3G8ZA 3LH4A 2OTL3 4OVMA 2STDA 1OGZA 3LTCA 2CWVA 1W6GA 4HYZA 3EHCA 1DMQA 1OGXA 3U97A 1LNHA 4I4KA 1FUWA 3BNEA 2ZDJA 3DGNA 1Q40A 3F7XA 1YJ93 4HM5B 1VQ63 4XBXA 1FGQA 5JPPA 2PZVA 3LT9A 2XSOB 2XGLA 1D6UA 3KFQC 5ELJA 2B1XB 3V99A 1EA2A 2B24B 3NQYA 2OCTA 3HI7A 2ML6A 1QMAA 4BTXA 3WA2X 2OQEA 4RNZA 3K7CA 1ROAA 1JB2A 2SBLA 3K9MC 1US1A 3LXUX 4WYKA 4N6OB 2IUKA 3ER7A 4NHFA 1HKXA 1DVCA 2OOVA 3H3HA 1OH0A 3CCE3 3N8BA 3I0YA 3MYTA 4KZ1A 1O7PB 3X40A 1K28A 2W6JH 3FG4A 5D81A 3JUQA 1ULJB 4HM3B 4WFOA 2CH9A 3BLZA 3CCQ3 1N8QA 3SEDA 2W9PA 5BXQA 4R4KA 3NQZA 3MWZA 3UB1A 3CCR3 2R4IA 1IU7A 1KWIA 1TFKA 1W01A 3BNBA 2W0QA 2CFKA 1Q864 1L5GB 2OQEC 1FGOA 3K0ZA 3B7CA 4RBNA 4XDWA 3UL6A 3LYGA 2JDIH 1OF5A 3B4PA 4OK0A 4X2OA 3G6E3 3OW22 3NV0A 1JB4A 3OWUA 3FF2A 5IEOA 3VGNA 1WMOA 3X3XA 4N6V0 4N6NB 3EJVA 1QALA 2OOVC 1Q814 1JRQA 1R4CA 1JKGB 1W6CA 2HMKB 2IA7A 2HMNB 1STFI 3FG3A 3X3YA 1VQ93 1N9EA 2BT3A 3U1WA 1VQ43 3GWRA 1OHOA 4FMAA 1G96A 4PEJA 3SLUA 1ZX2A 3FZWA 3I553 2OWPA 3IPTA 1IQ8A 1CEWI 1LXEA 2W04A 1M904 1IV9A 1QJGA 1W7CA 2C11A 3CXC2 3WDGB 2XR8B 4EV2A 1IVXA 3F14A 4HBRA 5EQLA 4O8SA 1NB3I 1SQWA 1E3RA 1TP6A 4N6LA 2XFSA 2FNQA 3STDA 1IT7A 3OWSA 2E2UA 3HIGA 1K9M4 2QGUA 2KXGA 3DUKA 3L0RA 5LC6A 1IT8A 3NM2A 2W03A 3NBJA 5IF6A 2FXTA 2QIYA 2HMLB 3DGMA 3RDEA 1IK3A 4L7KA 5CK6A 3PS8A 1W02A 1VQM3 3F8XA 3K63A 4BTYA 3BNDA 4N6UA 4N6TA 1WNHA 1OHPA 1CQSA 1M1K4 3N9HA 4HM8B 2Z6BA 1U8CB 1VQN3 2JQ5A 2WGQA 3OWYA 3BNCA 4JF8A 3JUOA 4L8PA 3CPW2 2Z7AA 1FGRA 1AV4A 1UW1A 3LTBA 3DMCA 3LZAA 5JPUA 3J7Yd 2CFWA 3VSYA 4CDLA 1TIJA 1A90A 4O3VA 1MOLA 2LYXA 1Q40B 3Q90A 1WMPA 4H61A 4KFFA 3S67A 1NDOB 5IG4A 1WQLB 3AMOA 3WODG 4O02B 2F98A 3JUNA 3KKGA 2Y74A 1UI7A 1OCVA 3FSDA 1O7WB 5AI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  3LT8 A;  3LTA A;  3DGM A;  2P09 A;  3DGL A;  3LTD A;  3LTC A;  3LTB A;  1UW1 A;  3DGO A;  2P0X A;  3LT9 A;  2P05 A; 
#chains in the Genus database with same CATH topology
 4HM1 B;  1RHL A;  3HZP A;  2CFD A;  1O7H B;  3B4O A;  5FW5 A;  4GL6 A;  1W6Y A;  3WA3 A;  1B2U A;  1AVK A;  1Z1S A;  2WGO A;  4STD A;  4FMC A;  2UUG C;  5TGN A;  2BMR B;  4N3V A;  4MMZ B;  4AEQ A;  2GBX B;  4EBG A;  3UL5 A;  4BU4 A;  1A2P A;  3CD6 3;  4GSP A;  4WYK B;  5AII A;  1EQK A;  1GOV A;  1FUS A;  1PY3 A;  1QAK A;  1RRH A;  1BIR A;  2PNC A;  3NM7 A;  2LQV A;  3RNT A;  1RGF A;  4BTW A;  1M1X B;  3NBR A;  1N8R 4;  2C10 A;  3EE1 A;  1JN5 A;  1T5Y A;  4R80 A;  5FGO A;  2GEX A;  1DE3 A;  5KP4 A;  4MMY B;  1KQS 2;  2XEP A;  1UCI A;  3SX1 A;  1ULI B;  2HMO B;  2HMM B;  3GAX A;  1T3B A;  3SXX A;  3QK9 A;  2GSP A;  1YVS A;  5AEU B;  1C54 A;  1FGT A;  3G0K A;  3MG1 A;  3QRD A;  3N54 B;  1JNQ A;  5CXO A;  4BL2 A;  5IER A;  1B2X A;  3EBT A;  5EVH A;  1B20 A;  3MG2 A;  1FW7 A;  2XH9 A;  3JVC A;  3DY5 A;  3ZFZ A;  1GMP A;  1QVF 2;  3LTD A;  3GZR A;  2F5M A;  3FG1 A;  2W56 A;  1MWU A;  2F56 A;  4LGQ A;  2GU1 A;  4FCJ A;  4CJN A;  4HOH A;  4K1U A;  3ALA A;  1BVI A;  1ZGX A;  1KD1 4;  1OF5 B;  2OTJ 3;  3V98 A;  3HX8 A;  3CCL 3;  1BUJ A;  1RTU A;  1EG9 B;  2AAE A;  1DMM A;  3FLJ A;  1RN1 A;  2E2V A;  3NHX A;  1BSA A;  6STD A;  3KZT A;  1S5A A;  5CF2 A;  3S29 A;  1MGW A;  4KVH A;  1S72 3;  2KF3 A;  1IDP A;  2P0M A;  3IJE B;  1NO3 A;  1DYU A;  3F7S A;  3CCS 3;  1K8A 4;  1D6Z A;  1FGM A;  1YIT 3;  4GHO A;  2XGN A;  3WMD A;  1LOX A;  3D79 A;  4HKV B;  3CCM 3;  1Q42 A;  3IMA B;  4RNT A;  2CFL A;  3KSE D;  1STD A;  1Q82 4;  3F8H A;  1B2M A;  3CU3 A;  4HM4 B;  1I8V A;  3E99 A;  4NRE A;  1W5Z A;  4U13 A;  3LT8 A;  3TDG A;  1GOY A;  2K0M A;  1JZD A;  3KN4 A;  1J2B A;  2XRX B;  3FKA A;  4ORL A;  2BHM A;  4K1V A;  4Q53 A;  2Y73 A;  4ZM8 A;  3G4S 3;  3CMA 3;  1JBR A;  4HM0 B;  1PFP A;  1GY5 A;  1BRH A;  1WTH A;  5M19 A;  3EBY A;  4XBY A;  3A5E A;  3GZX B;  2CHC A;  4XDV A;  4HM7 B;  5GSP A;  1ZO2 A;  2L4V A;  1RKY A;  1Q7H A;  2CG0 A;  4FCM A;  4FCZ A;  1UCK A;  4LMI A;  1IYY A;  2GU3 A;  2XFT A;  2RNT A;  1UGH I;  2MC8 A;  2W9Q A;  4AKZ A;  1NJI 4;  4WHA A;  3G16 A;  1OAC A;  1V58 A;  2RFR A;  1E3V A;  4K90 B;  2D42 A;  5IG5 A;  5A0O B;  1TU5 A;  4WP5 A;  1B2S A;  4MEI A;  8CHO A;  1BGS A;  3EB8 A;  1VQK 3;  3MPH A;  1CH0 A;  1UUV B;  2KRT A;  3ZG0 A;  1N9J A;  3WOE B;  3S27 A;  4EYC A;  1JJ2 2;  3BB9 A;  4R9K A;  2K54 A;  2M7O A;  1OHS A;  1NWW A;  1BAN A;  1IVU A;  3WHO A;  1Q7Y 4;  1W2B 2;  5LC7 A;  7STD A;  1UI8 A;  2GBW B;  1JBS A;  1QAF A;  2E2T A;  1U5O A;  3FGY A;  1VQ7 3;  4J8T A;  4OUQ A;  1RN7 A;  2KCD A;  1FZU A;  1RGG A;  3SYU A;  5IEP A;  1LOW A;  1GD3 A;  1W2Z A;  1C7H A;  1BRG A;  1TUH A;  3CME 3;  2D1W A;  5AYS C;  1B21 A;  2WOF A;  2L1S A;  3CC7 3;  3AMO B;  1LOY A;  3O8Y A;  5DRV A;  5AYR B;  1YGE A;  2F99 A;  4EC6 A;  2Q07 A;  1YNV X;  4XM4 A;  1AVL A;  1ISK A;  4BIR A;  3LML A;  1BNF A;  3CNX A;  1UCJ A;  3CCU 3;  2R41 A;  3MKI A;  2RSX A;  1I70 A;  4RNY A;  3S5C A;  2CWT A;  3CC4 3;  1BOX A;  5G2G A;  1FUT A;  2IMJ A;  5AIF A;  1GD4 A;  1NU3 A;  1WMN A;  4IPB A;  4CPK A;  3DZL A;  1N5P A;  4I5Q A;  1I0X A;  1JZO A;  1JN5 B;  2P05 A;  3PCR A;  3GZB A;  3URP A;  4MMX B;  2XF3 A;  4EW5 A;  5BIR A;  1G0T A;  2KAA A;  2ML5 A;  3MSO A;  3DGO A;  1DVD A;  1RMS A;  2CX1 A;  2CX0 A;  1RN4 A;  1EKM A;  1GOU A;  2CKF B;  3T0U A;  1K73 4;  1B3S A;  2XSH B;  1LRA A;  1BUQ A;  2CK3 H;  1RGE A;  4KT3 B;  5AIH A;  4XBT A;  3ROB A;  1W00 A;  1X1U A;  1BNS A;  5IEN A;  4X2H A;  1VQP 3;  3AGO A;  3D5I A;  5KP1 A;  3PZW A;  1CYV A;  3CNM A;  3PGB A;  3CCJ 3;  1CYU A;  1BSE A;  5CF1 A;  2BO9 B;  3OXA A;  2H0G A;  3SVA A;  4WWU C;  1A67 A;  3SOA A;  1UUW B;  1TJD A;  3GSP A;  3K5T A;  3FH1 A;  1HYF A;  3EN1 B;  2F86 B;  2W56 B;  4LYL B;  1F8N A;  1JB5 A;  3BIR A;  9RNT A;  2CW9 A;  2O3O A;  3Q1C A;  3HII A;  1IQY A;  2BMQ B;  1YJW 3;  3CC2 3;  3HK4 A;  2HMJ B;  1SJW A;  1KSI A;  1RGH A;  2RBI A;  3ECF A;  3T8U A;  4HJL B;  3F9S A;  3LOY A;  1N5H A;  8RNT A;  2INX A;  3NV0 B;  1LOV A;  1X1W A;  3NX0 A;  2W2C A;  3D3L A;  2C4B A;  2BIR A;  5G1L A;  1YI2 3;  1YHQ 3;  1RNT A;  1OPY A;  4BL3 A;  4CCV A;  3EF8 A;  1AR0 A;  3T8N A;  1GS3 A;  1BU4 A;  3JUP A;  4IIA A;  4N6M A;  4O2H A;  1IVV A;  3PYJ A;  5IG3 A;  2YFJ B;  1VZZ A;  6GSP A;  1TRP A;  4EV5 A;  1BRS A;  4HVN A;  1I2G A;  4LZI A;  1VQL 3;  1BRI A;  1SIH A;  2KF6 A;  2QEX 3;  4HAA A;  3FF0 A;  3MG3 A;  3X3Z A;  2QA4 3;  1IV7 A;  1SPU A;  1T2I A;  2KF5 A;  4KFD A;  1K41 A;  2ZL8 A;  4HZB B;  3MHE A;  2P0X A;  2CFG A;  3KII A;  5IW9 A;  1FA3 A;  4TX4 A;  1ROV A;  3JUM A;  3OX9 A;  1RNB A;  3NUV A;  2Z76 A;  2Z77 A;  1HU9 A;  1LVN A;  1GY6 A;  1O7N B;  3AGN A;  3H51 A;  1TTO A;  3KE7 A;  3DXO A;  3I56 3;  4J9A A;  2RGQ A;  3X41 A;  4ILF A;  4MJD A;  7RNT A;  1RGK A;  1RRL A;  5HGR A;  3CCV 3;  1KC8 4;  4AKY A;  3G71 3;  3D9R A;  3RGA A;  4FMD A;  3EX9 A;  5AEW B;  4KFE A;  5CLK A;  4H3U A;  1VQ8 3;  1JKG A;  1E97 A;  2IUJ A;  3Q3F A;  4EXR A;  3NXJ A;  2GXF A;  1D6Y A;  1RJO A;  4GB5 A;  1O7G B;  1JV2 B;  3DM8 A;  2BU4 A;  3EQQ B;  2A15 A;  2CWU A;  1PU4 A;  4LEH A;  5STD A;  4HM2 B;  1GYB A;  1Y4K A;  4G1M B;  5IG0 A;  2BNG A;  4DKI A;  4RZM A;  3PXM A;  2FGT A;  3Q2P A;  2O9U X;  3EN8 A;  3PCS A;  1LQG C;  1TFO A;  1GMQ A;  1I3F A;  5EEO A;  2I9W A;  3B8L A;  2BMO B;  1GMR A;  1MWS A;  3V92 A;  2CC3 A;  3HOH A;  1MWR A;  1VQ5 3;  3WOF B;  5KP3 A;  3UNL A;  1I2E A;  1IVW A;  1YJN 3;  1IQX A;  1LNI A;  3SOY A;  1MNL A;  3GZY B;  1GY7 A;  1OUN A;  2HOH A;  3OV4 A;  1BRK A;  2CIU A;  2P38 A;  3FCS B;  4JRF A;  2YFI B;  4FR9 A;  3KSP A;  2UX0 A;  2WOH A;  2YX9 A;  3CPO A;  1W4N A;  4HZ9 B;  3D4A A;  4IT7 A;  1TRQ A;  5JBS A;  2YFL B;  3M8C A;  4R9L A;  3UJM A;  1A2V A;  1NB5 I;  1X1Y A;  2MF7 A;  3LTA A;  5D82 A;  1NNV A;  2GEY A;  5AIG A;  3DGL A;  3F40 A;  4K61 A;  5I97 A;  3S28 A;  4HM6 B;  5BVB A;  1YVB I;  4J5G A;  1QVG 2;  3A76 A;  4R1K A;  4QWT A;  3DGY A;  4FMB A;  4LSO A;  2WO0 A;  2J8X B;  2CG1 A;  1A2K A;  1DMN A;  2P09 A;  3EC9 A;  4XB5 A;  5DRE A;  1M9G A;  1DET A;  1YIJ 3;  2V1L A;  1V74 A;  2KF4 A;  3RGR A;  3VF1 A;  3GRD A;  1VQO 3;  5ELU A;  1UUG B;  2RCD A;  3X42 A;  1ASK A;  5D83 A;  1SII A;  4L8O A;  3NBB A;  1LQM B;  1O7M B;  3G8Z A;  3BU4 A;  1RCL A;  3LH4 A;  2OTL 3;  4OVM A;  2STD A;  1OGZ A;  3LTC A;  2CWV A;  1W6G A;  4HYZ A;  3EHC A;  1B27 A;  1DMQ A;  1OGX A;  3U97 A;  1LNH A;  4I4K A;  1FUW A;  3BNE A;  2ZDJ A;  3DGN A;  5M1A A;  1Q40 A;  1B2Z A;  3F7X A;  1YJ9 3;  4HM5 B;  5BU4 A;  1VQ6 3;  4XBX A;  5HOH A;  1FGQ A;  5JPP A;  2PZV A;  3LT9 A;  1RCK A;  2UGI A;  2XSO B;  2XGL A;  1D6U A;  1BSB A;  3KFQ C;  5ELJ A;  2B1X B;  3V99 A;  1EA2 A;  2B24 B;  1BNG A;  2OCT A;  3HI7 A;  3NQY A;  2ML6 A;  1QMA A;  4BTX A;  1YGW A;  3WA2 X;  3DH2 A;  2OQE A;  4RNZ A;  3K7C A;  1ROA A;  1JB2 A;  2SBL A;  3K9M C;  1US1 A;  3LXU X;  4WYK A;  1BNI A;  4N6O B;  2IUK A;  1BAO A;  1JBT A;  3ER7 A;  4NHF A;  1HKX A;  1DVC A;  2OOV A;  3H3H A;  1OH0 A;  3CCE 3;  3N8B A;  3I0Y A;  3MYT A;  4KZ1 A;  1O7P B;  3D5G A;  3X40 A;  1K28 A;  2W6J H;  3FG4 A;  5D81 A;  2ZA4 A;  3JUQ A;  1ULJ B;  4HM3 B;  4WFO A;  2CH9 A;  3BLZ A;  3WR2 A;  3CCQ 3;  3ZG5 A;  1N8Q A;  3SED A;  2W9P A;  2F5W A;  5BXQ A;  4R4K A;  3NQZ A;  3MWZ A;  3UB1 A;  3CCR 3;  1T2H A;  2R4I A;  1IU7 A;  1KWI A;  1TFK A;  1W01 A;  3BNB A;  2W0Q A;  3KCH A;  1ZS7 A;  2CFK A;  1Q86 4;  1L5G B;  2OQE C;  1FGO A;  3K0Z A;  1UCL A;  2K3D A;  1HZ1 A;  3B7C A;  4RBN A;  4XDW A;  3UL6 A;  6RNT A;  3LYG A;  2JDI H;  1OF5 A;  3B4P A;  4OK0 A;  4X2O A;  1AY7 A;  7GSP A;  3G6E 3;  4NPB A;  3OW2 2;  3NV0 A;  1JB4 A;  3OWU A;  3FF2 A;  5IEO A;  3VGN A;  1WMO A;  3X3X A;  1X1X A;  1EUI C;  1BNE A;  1RSN A;  4N6N B;  3EJV A;  4N6V 0;  1QAL A;  2OOV C;  1Q81 4;  2AAD A;  1JRQ A;  1R4C A;  1JKG B;  1GSP A;  1W6C A;  2HMK B;  2IA7 A;  2HMN B;  1STF I;  4J5K A;  3FG3 A;  3X3Y A;  2H0H A;  1VQ9 3;  1N9E A;  2BT3 A;  3U1W A;  1VQ4 3;  3AHW A;  3GWR A;  1OHO A;  2F4Y A;  1FYS A;  4FMA A;  1G96 A;  1VQQ A;  4PEJ A;  3SLU A;  1ZX2 A;  3FZW A;  1G02 A;  3I55 3;  2OWP A;  3IPT A;  1IQ8 A;  3AHS A;  1CEW I;  1LXE A;  2H0I A;  2W04 A;  1M90 4;  1IV9 A;  1QJG A;  1W7C A;  2C11 A;  3CXC 2;  3WDG B;  1I0V A;  2IYJ A;  2XR8 B;  4EV2 A;  1IVX A;  3F14 A;  4HBR A;  5EQL A;  4O8S A;  1NB3 I;  1SQW A;  1E3R A;  1SAR A;  1TP6 A;  1RGL A;  4N6L A;  2XFS A;  1I2F A;  1UGI A;  2FNQ A;  3STD A;  1IT7 A;  3OWS A;  2E2U A;  1MWT A;  1R4Y A;  1I3I A;  2QGU A;  2KXG A;  3DUK A;  3HIG A;  3L0R A;  1K9M 4;  5LC6 A;  1RDS A;  1IT8 A;  3NM2 A;  1BRN L;  2W03 A;  1BRJ A;  3NBJ A;  5IF6 A;  2FXT A;  2QIY A;  2HML B;  3DGM A;  3RDE A;  1BSD A;  1IK3 A;  1BNJ A;  4L7K A;  5CK6 A;  1BNR A;  3PS8 A;  1UDI I;  1W02 A;  2SAR A;  1VQM 3;  3F8X A;  3K63 A;  4BTY A;  3BND A;  1V57 A;  4N6U A;  4N6T A;  1WNH A;  1AQZ A;  1OHP A;  1RLS A;  1CQS A;  2IY2 A;  3N9H A;  4HM8 B;  1M1K 4;  1RGA A;  2Z6B A;  1U8C B;  1VQN 3;  2JQ5 A;  2WGQ A;  3OWY A;  5M18 A;  3BNC A;  4JF8 A;  3JUO A;  4L8P A;  3CPW 2;  1PYL A;  2Z7A A;  2ZHX B;  1FGR A;  1AV4 A;  1UW1 A;  3LTB A;  3DMC A;  3LZA A;  1MGR A;  5JPU A;  3J7Y d;  1EEJ A;  2CFW A;  3VSY A;  4CDL A;  1TIJ A;  5G1K A;  1A90 A;  1Q9E A;  1BSC A;  4O3V A;  1MOL A;  2LYX A;  1Q40 B;  3Q90 A;  1WMP A;  4H61 A;  4KFF A;  3S67 A;  1NDO B;  1RGC A;  5RNT A;  5IG4 A;  1WQL B;  3AMO A;  3WOD G;  4O02 B;  2F98 A;  3JUN A;  3KKG A;  2Y74 A;  1UI7 A;  1OCV A;  3FSD A;  1O7W B;  5AI1 A; 
#chains in the Genus database with same CATH homology
 4HM1 B;  3HZP A;  2CFD A;  1O7H B;  3B4O A;  5FW5 A;  4GL6 A;  1W6Y A;  3WA3 A;  1AVK A;  1Z1S A;  2WGO A;  4STD A;  4FMC A;  5TGN A;  4AEQ A;  2BMR B;  4N3V A;  4MMZ B;  2GBX B;  4EBG A;  3UL5 A;  3CD6 3;  4WYK B;  5AII A;  1EQK A;  1QAK A;  1RRH A;  2PNC A;  3NM7 A;  2LQV A;  4BTW A;  1M1X B;  3NBR A;  1N8R 4;  2C10 A;  3EE1 A;  1JN5 A;  1T5Y A;  4R80 A;  5FGO A;  2GEX A;  5KP4 A;  4MMY B;  1KQS 2;  2XEP A;  3SX1 A;  1ULI B;  2HMO B;  2HMM B;  3GAX A;  3SXX A;  3QK9 A;  5AEU B;  1FGT A;  3G0K A;  3MG1 A;  3QRD A;  3N54 B;  1JNQ A;  5CXO A;  5IER A;  3EBT A;  5EVH A;  3MG2 A;  2XH9 A;  3JVC A;  3DY5 A;  1QVF 2;  3LTD A;  3GZR A;  3FG1 A;  2W56 A;  4LGQ A;  2GU1 A;  4FCJ A;  4K1U A;  3ALA A;  1KD1 4;  1OF5 B;  2OTJ 3;  3V98 A;  3HX8 A;  3CCL 3;  1EG9 B;  1DMM A;  3FLJ A;  3NHX A;  2E2V A;  6STD A;  3KZT A;  1S5A A;  5CF2 A;  3S29 A;  4KVH A;  1S72 3;  1IDP A;  2P0M A;  3IJE B;  1NO3 A;  1DYU A;  3F7S A;  3CCS 3;  1K8A 4;  1D6Z A;  1FGM A;  1YIT 3;  2XGN A;  3WMD A;  1LOX A;  4HKV B;  3CCM 3;  1Q42 A;  3IMA B;  2CFL A;  3KSE D;  1STD A;  1Q82 4;  3F8H A;  3CU3 A;  4HM4 B;  3E99 A;  4NRE A;  1W5Z A;  4U13 A;  3LT8 A;  3TDG A;  2K0M A;  3KN4 A;  1J2B A;  2XRX B;  3FKA A;  4ORL A;  2BHM A;  4K1V A;  4Q53 A;  2Y73 A;  4ZM8 A;  3G4S 3;  3CMA 3;  4HM0 B;  1PFP A;  1GY5 A;  1WTH A;  3EBY A;  4XBY A;  3GZX B;  2CHC A;  4XDV A;  4HM7 B;  1ZO2 A;  2L4V A;  1RKY A;  2CG0 A;  4FCM A;  4FCZ A;  4LMI A;  2GU3 A;  2XFT A;  2MC8 A;  2W9Q A;  4AKZ A;  1NJI 4;  4WHA A;  3G16 A;  1OAC A;  2RFR A;  1E3V A;  4K90 B;  2D42 A;  5IG5 A;  5A0O B;  1TU5 A;  4WP5 A;  4MEI A;  8CHO A;  1VQK 3;  3EB8 A;  3MPH A;  1UUV B;  2KRT A;  1N9J A;  3WOE B;  3S27 A;  4EYC A;  1JJ2 2;  3BB9 A;  4R9K A;  2K54 A;  2M7O A;  1OHS A;  1NWW A;  1IVU A;  1Q7Y 4;  1W2B 2;  5LC7 A;  7STD A;  1UI8 A;  2GBW B;  1QAF A;  2E2T A;  1U5O A;  3FGY A;  1VQ7 3;  4J8T A;  4OUQ A;  1RN7 A;  2KCD A;  5IEP A;  1GD3 A;  1W2Z A;  1C7H A;  1TUH A;  3CME 3;  2D1W A;  5AYS C;  2WOF A;  3CC7 3;  3AMO B;  3O8Y A;  5DRV A;  5AYR B;  1YGE A;  2F99 A;  4EC6 A;  2Q07 A;  4XM4 A;  1AVL A;  1ISK A;  3LML A;  3CNX A;  3CCU 3;  3MKI A;  2RSX A;  4RNY A;  3S5C A;  2CWT A;  3CC4 3;  5G2G A;  2IMJ A;  5AIF A;  1GD4 A;  1NU3 A;  1WMN A;  4IPB A;  3DZL A;  1N5P A;  1JN5 B;  2P05 A;  3PCR A;  3GZB A;  4MMX B;  2XF3 A;  2ML5 A;  3MSO A;  3DGO A;  1DVD A;  1EKM A;  1K73 4;  2CKF B;  3T0U A;  1BUQ A;  2XSH B;  2CK3 H;  5AIH A;  4XBT A;  3ROB A;  1W00 A;  5IEN A;  1VQP 3;  4X2H A;  5KP1 A;  3PZW A;  1CYV A;  3CNM A;  3PGB A;  3CCJ 3;  1CYU A;  5CF1 A;  2BO9 B;  3OXA A;  3SVA A;  4WWU C;  1A67 A;  3SOA A;  1UUW B;  3K5T A;  3FH1 A;  3EN1 B;  2F86 B;  2W56 B;  1F8N A;  1JB5 A;  2CW9 A;  2O3O A;  3Q1C A;  3HII A;  1IQY A;  2BMQ B;  1YJW 3;  3CC2 3;  3HK4 A;  2HMJ B;  1SJW A;  1KSI A;  3ECF A;  3T8U A;  4HJL B;  3F9S A;  3LOY A;  1N5H A;  2INX A;  3NV0 B;  3NX0 A;  2W2C A;  3D3L A;  1YI2 3;  1YHQ 3;  1OPY A;  4CCV A;  3EF8 A;  1AR0 A;  3T8N A;  1GS3 A;  4IIA A;  3JUP A;  4N6M A;  4O2H A;  1IVV A;  3PYJ A;  5IG3 A;  2YFJ B;  1VZZ A;  4EV5 A;  4HVN A;  4LZI A;  1VQL 3;  1SIH A;  2QEX 3;  3FF0 A;  3MG3 A;  3X3Z A;  2QA4 3;  1IV7 A;  1SPU A;  4KFD A;  1K41 A;  2ZL8 A;  4HZB B;  3MHE A;  2P0X A;  2CFG A;  3KII A;  5IW9 A;  1FA3 A;  4TX4 A;  1ROV A;  3JUM A;  3OX9 A;  3NUV A;  2Z77 A;  2Z76 A;  1HU9 A;  1LVN A;  1GY6 A;  1O7N B;  3H51 A;  3KE7 A;  3I56 3;  1YIJ 3;  3DXO A;  4J9A A;  2RGQ A;  3X41 A;  4MJD A;  1RRL A;  5HGR A;  3CCV 3;  1KC8 4;  4AKY A;  3G71 3;  3D9R A;  3RGA A;  4FMD A;  3EX9 A;  5AEW B;  4KFE A;  5CLK A;  4H3U A;  1VQ8 3;  1JKG A;  1E97 A;  2IUJ A;  4EXR A;  3NXJ A;  2GXF A;  1D6Y A;  1RJO A;  4GB5 A;  1O7G B;  1JV2 B;  3DM8 A;  3EQQ B;  2A15 A;  2CWU A;  1PU4 A;  4LEH A;  5STD A;  4HM2 B;  1GYB A;  1Y4K A;  4G1M B;  5IG0 A;  2BNG A;  4RZM A;  3PXM A;  2FGT A;  3Q2P A;  2O9U X;  3EN8 A;  3PCS A;  1TFO A;  5EEO A;  2I9W A;  3B8L A;  2BMO B;  3V92 A;  2CC3 A;  1VQ5 3;  3WOF B;  5KP3 A;  3UNL A;  1IVW A;  1YJN 3;  1IQX A;  3SOY A;  1MNL A;  3GZY B;  1GY7 A;  1OUN A;  3OV4 A;  2P38 A;  2CIU A;  3FCS B;  4JRF A;  2YFI B;  4FR9 A;  3KSP A;  2UX0 A;  2WOH A;  2YX9 A;  3CPO A;  1W4N A;  4HZ9 B;  4IT7 A;  1NB5 I;  5JBS A;  2YFL B;  3M8C A;  4R9L A;  3UJM A;  1A2V A;  5D82 A;  2MF7 A;  3LTA A;  2GEY A;  5AIG A;  3DGL A;  3F40 A;  4K61 A;  5I97 A;  3S28 A;  4HM6 B;  5BVB A;  1YVB I;  1QVG 2;  3A76 A;  4R1K A;  4QWT A;  4LSO A;  4FMB A;  2WO0 A;  2CG1 A;  1A2K A;  1DMN A;  2P09 A;  3EC9 A;  4XB5 A;  5DRE A;  1M9G A;  2V1L A;  1V74 A;  3RGR A;  3VF1 A;  3GRD A;  1VQO 3;  5ELU A;  2RCD A;  3X42 A;  1ASK A;  5D83 A;  1SII A;  4L8O A;  3NBB A;  1O7M B;  3G8Z A;  3LH4 A;  2OTL 3;  4OVM A;  2STD A;  1OGZ A;  3LTC A;  2CWV A;  1W6G A;  4HYZ A;  3EHC A;  1DMQ A;  1OGX A;  3U97 A;  1LNH A;  4I4K A;  1FUW A;  3BNE A;  2ZDJ A;  3DGN A;  1Q40 A;  3F7X A;  1YJ9 3;  4HM5 B;  1VQ6 3;  4XBX A;  1FGQ A;  5JPP A;  2PZV A;  3LT9 A;  2XSO B;  2XGL A;  1D6U A;  3KFQ C;  5ELJ A;  2B1X B;  3V99 A;  1EA2 A;  2B24 B;  3NQY A;  2OCT A;  3HI7 A;  2ML6 A;  1QMA A;  4BTX A;  3WA2 X;  2OQE A;  4RNZ A;  3K7C A;  1ROA A;  1JB2 A;  2SBL A;  3K9M C;  1US1 A;  3LXU X;  4WYK A;  4N6O B;  2IUK A;  3ER7 A;  4NHF A;  1HKX A;  1DVC A;  2OOV A;  3H3H A;  1OH0 A;  3CCE 3;  3N8B A;  3I0Y A;  3MYT A;  4KZ1 A;  1O7P B;  3X40 A;  1K28 A;  2W6J H;  3FG4 A;  5D81 A;  3JUQ A;  1ULJ B;  4HM3 B;  4WFO A;  2CH9 A;  3BLZ A;  3CCQ 3;  1N8Q A;  3SED A;  2W9P A;  5BXQ A;  4R4K A;  3NQZ A;  3MWZ A;  3UB1 A;  3CCR 3;  2R4I A;  1IU7 A;  1KWI A;  1TFK A;  1W01 A;  3BNB A;  2W0Q A;  2CFK A;  1Q86 4;  1L5G B;  2OQE C;  1FGO A;  3K0Z A;  3B7C A;  4RBN A;  4XDW A;  3UL6 A;  3LYG A;  2JDI H;  1OF5 A;  3B4P A;  4OK0 A;  4X2O A;  3G6E 3;  3OW2 2;  3NV0 A;  1JB4 A;  3OWU A;  3FF2 A;  5IEO A;  3VGN A;  1WMO A;  3X3X A;  4N6V 0;  4N6N B;  3EJV A;  1QAL A;  2OOV C;  1Q81 4;  1JRQ A;  1R4C A;  1JKG B;  1W6C A;  2HMK B;  2IA7 A;  2HMN B;  1STF I;  3FG3 A;  3X3Y A;  1VQ9 3;  1N9E A;  2BT3 A;  3U1W A;  1VQ4 3;  3GWR A;  1OHO A;  4FMA A;  1G96 A;  4PEJ A;  3SLU A;  1ZX2 A;  3FZW A;  3I55 3;  2OWP A;  3IPT A;  1IQ8 A;  1CEW I;  1LXE A;  2W04 A;  1M90 4;  1IV9 A;  1QJG A;  1W7C A;  2C11 A;  3CXC 2;  3WDG B;  2XR8 B;  4EV2 A;  1IVX A;  3F14 A;  4HBR A;  5EQL A;  4O8S A;  1NB3 I;  1SQW A;  1E3R A;  1TP6 A;  4N6L A;  2XFS A;  2FNQ A;  3STD A;  1IT7 A;  3OWS A;  2E2U A;  3HIG A;  1K9M 4;  2QGU A;  2KXG A;  3DUK A;  3L0R A;  5LC6 A;  1IT8 A;  3NM2 A;  2W03 A;  3NBJ A;  5IF6 A;  2FXT A;  2QIY A;  2HML B;  3DGM A;  3RDE A;  1IK3 A;  4L7K A;  5CK6 A;  3PS8 A;  1W02 A;  1VQM 3;  3F8X A;  3K63 A;  4BTY A;  3BND A;  4N6U A;  4N6T A;  1WNH A;  1OHP A;  1CQS A;  1M1K 4;  3N9H A;  4HM8 B;  2Z6B A;  1U8C B;  1VQN 3;  2JQ5 A;  2WGQ A;  3OWY A;  3BNC A;  4JF8 A;  3JUO A;  4L8P A;  3CPW 2;  2Z7A A;  1FGR A;  1AV4 A;  1UW1 A;  3LTB A;  3DMC A;  3LZA A;  5JPU A;  3J7Y d;  2CFW A;  3VSY A;  4CDL A;  1TIJ A;  1A90 A;  4O3V A;  1MOL A;  2LYX A;  1Q40 B;  3Q90 A;  1WMP A;  4H61 A;  4KFF A;  3S67 A;  1NDO B;  5IG4 A;  1WQL B;  3AMO A;  3WOD G;  4O02 B;  2F98 A;  3JUN A;  3KKG A;  2Y74 A;  1UI7 A;  1OCV A;  3FSD A;  1O7W B;  5AI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...