1ULJB

Biphenyl dioxygenase (bpha1a2) in complex with the substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
177
structure length
177
Chain Sequence
FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biphenyl dioxygenase large subunit
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Oxidoreductase
total genus 51
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uljB00
2STDA 1QMAA 5G2GA 5KP3A 1NDOB 4X2OA 1WQLB 3FGYA 1K41A 1ULIB 4L7KA 1GY7A 1OGXA 3UJMA 1OPYA 4WYKB 3OWUA 4HM3B 5IEPA 4R9KA 3FF0A 3FLJA 5JPPA 4HZ9B 4XDWA 3D9RA 1OF5B 4XBYA 3VGNA 3EHCA 1ISKA 2CHCA 5IG3A 1O7PB 1NU3A 4GB5A 3DZLA 2F98A 2UX0A 3A76A 1U5OA 3K7CA 1Q40B 3GRDA 3DUKA 5CK6A 3ECFA 3JUMA 4HM0B 4MJDA 3OX9A 2HMKB 4HM1B 3GZYB 4HM8B 5IENA 1JKGA 5AEWB 3OV4A 3KZTA 3E99A 4HM5B 3H3HA 3OWYA 4HVNA 1GY6A 1GY5A 3F7XA 1JB5A 4XBXA 5CF2A 4ORLA 3SOAA 2INXA 4LEHA 3T8NA 4STDA 2GBWB 5AEUB 1A2KA 4J9AA 5IERA 4OUQA 3MHEA 3H51A 1OUNA 3STDA 3K0ZA 1W6YA 2OWPA 2BMOB 1JKGB 2K54A 4WYKA 1AR0A 4K1VA 3IPTA 5KP1A 1OHPA 2BNGA 4R1KA 1EA2A 3EN1B 1OGZA 4XM4A 4LGQA 2HMLB 3BLZA 1OF5A 3B7CA 4FCMA 1O7NB 2YFLB 2RFRA 3MG2A 2W2CA 4I4KA 3KSPA 3FZWA 3F14A 1OHOA 3DXOA 1Q40A 4XBTA 3B4PA 3NM2A 1E3RA 3LZAA 5IG4A 3GWRA 3T8UA 2YFIB 3JUPA 3EX9A 5AIFA 3NV0A 1GS3A 5IEOA 3GZXB 3F40A 1JB2A 4XB5A 4OVMA 5D83A 2R4IA 3KKGA 1C7HA 3G0KA 4KVHA 5IF6A 1TUHA 3RGAA 1QJGA 4U13A 3FH1A 3JUOA 3F9SA 4H3UA 3NV0B 3ROBA 1UUVB 3F8HA 1W00A 3Q90A 5D81A 5BXQA 4WWUC 3EQQB 2QGUA 3HX8A 3F7SA 3ER7A 1STDA 3F8XA 4Q53A 4HM6B 2XR8B 3G16A 4L8OA 3M8CA 2IMJA 4HM4B 1W01A 3B4OA 5JPUA 3OWSA 2RCDA 1GYBA 2F99A 2Z76A 3G8ZA 1BUQA 1ZX2A 3FKAA 3MSOA 4HKVB 2B1XB 3CNXA 5STDA 3FSDA 1Q42A 2RGQA 8CHOA 2HMMB 5EVHA 3B8LA 3GZBA 1DMMA 2Z7AA 3MKIA 5AIHA 1O7WB 4LMIA 3JUNA 3HZPA 3JUQA 1CQSA 1NWWA 2HMJB 2JQ5A 4PEJA 3NBRA 2GEYA 2GEXA 5CXOA 1ULJB 1O7GB 2GBXB 1W02A 2BMRB 1ASKA 1SJWA 3MG1A 3GZRA 5TGNA 3OXAA 5KP4A 3UNLA 2YFJB 3EJVA 3MG3A 5CLKA 2GXFA 3S5CA 4N3VA 3SOYA 3EBYA 4FCJA 1IDPA 2I9WA 3EN8A 1VZZA 4J8TA 1DMNA 4HM7B 4RZMA 3DMCA 2XSOB 3EF8A 4HZBB 1ZO2A 5DREA 2XRXB 2Z77A 2HMNB 4HM2B 5AIIA 5BVBA 2XSHB 3FF2A 2CKFB 2BMQB 5IG5A 4XDVA 1TP6A 4L8PA 2A15A 5AI1A 5HGRA 5FW5A 4HJLB 4K1UA 1E3VA 4X2HA 5AIGA 4WP5A 3LYGA 4R9LA 1OHSA 3VSYA 3MYTA 1JN5A 1S5AA 1UUWB 5D82A 1DMQA 1O7MB 3HK4A 1E97A 3I0YA 3WMDA 6STDA 2B24B 1O7HB 3NXJA 1OH0A 2PZVA 3EC9A 5IG0A 3EBTA 3RGRA 3NHXA 2F86B 5CF1A 1JB4A 2QIYA 7STDA 4IIAA 3NUVA 3BB9A 1JN5B 3SEDA 4CDLA 3DM8A 3CPOA 2HMOB 5DRVA 3CU3A 3CNMA 3KE7A 1EG9B 1OCVA 1HKXA 1Z1SA
chains in the Genus database with same CATH superfamily
2STDA 1BGSA 1QMAA 1TRQA 2OOVA 4FMCA 3ALAA 5G2GA 3NM7A 5KP3A 1NDOB 3CD63 4FMBA 5HOHA 4X2OA 2XFTA 1WQLB 3FGYA 1K41A 1ULIB 4N6V0 4L7KA 3U1WA 1GY7A 1OGXA 3K5TA 3UJMA 1K28A 1VQO3 1OPYA 1DYUA 3S67A 1UCIA 1GOYA 3CCM3 3KFQC 4TX4A 1BSBA 3PXMA 4WYKB 2CWVA 3DH2A 3OWUA 3G6E3 1BOXA 4HM3B 1UCKA 1CEWI 5IG4A 2PNCA 4R9KA 5IEPA 3CCL3 3FF0A 3FLJA 3S29A 3SYUA 4HZ9B 5JPPA 1FA3A 1N8R4 1LXEA 1BRHA 1VQ53 4XDWA 3WA2X 4DKIA 3D9RA 1LQMB 1OF5B 4XBYA 1WMPA 2BHMA 2KF4A 3AHSA 1EEJA 3VGNA 1UCJA 3EHCA 1W4NA 3N54B 1ISKA 1N5PA 1K734 1BRIA 2CHCA 1YI23 5IG3A 2XF3A 1O7PB 1NU3A 4GB5A 1LRAA 1B2UA 4BTXA 1RGFA 3MWZA 2CH9A 1X1YA 3DZLA 2F98A 3NQYA 2UX0A 1B27A 2BO9B 1U5OA 3A76A 1AY7A 5AYSC 3V92A 3WA3A 3K7CA 1VQL3 1VQ63 1MWRA 1Q40B 3RNTA 3GRDA 2OCTA 3PCSA 4KT3B 1DETA 4RNYA 4BTYA 1BU4A 1VQ83 1D6YA 3DUKA 2WO0A 3HOHA 1CYVA 3T0UA 5CK6A 1IVWA 2KXGA 3ECFA 1B3SA 1UUGB 3JUMA 4HM0B 2LQVA 2ZDJA 4R4KA 2GSPA 1BNJA 4MJDA 4CJNA 3OX9A 2HMKB 1YHQ3 1LOWA 1KQS2 1TIJA 4HM1B 3GZYB 1Q824 4RNTA 4HM8B 5IENA 2GU1A 5IW9A 4JRFA 1YVSA 1W2ZA 1FYSA 1HZ1A 3Q1CA 3J7Yd 1JKGA 2ML6A 1UI8A 2KF5A 5AEWB 5M18A 3OV4A 3KZTA 3URPA 2O9UX 1T5YA 3LTDA 3PS8A 3E99A 2XFSA 4CPKA 1GSPA 4HM5B 4NREA 3H3HA 1NB5I 1PYLA 2QA43 1UGHI 4MMYB 1CYUA 3OWYA 4HVNA 1BRGA 1GY6A 1GY5A 1QAKA 2P05A 3F7XA 2E2UA 3SVAA 1JB5A 1JBSA 3A5EA 4XBXA 5CF2A 2RNTA 3KSED 1ZGXA 4ORLA 3SOAA 1DE3A 1TTOA 2WGOA 4HOHA 2Q07A 1RCLA 2UUGC 2INXA 1SIHA 1TU5A 4N6NB 2OOVC 2BIRA 4LEHA 3T8NA 4STDA 3VF1A 3ZG5A 7RNTA 1GMQA 2GBWB 4I5QA 2F5WA 4EBGA 3NQZA 5AEUB 1A2KA 3FG4A 1NO3A 3U97A 2R41A 1EKMA 2F5MA 4J9AA 4EV2A 1EQKA 2Z6BA 3ZFZA 3FG1A 3X42A 5IERA 4OUQA 3MHEA 1JZDA 1LVNA 1VQK3 3H51A 1KD14 1OUNA 1VQQA 3STDA 3K0ZA 3I563 4OK0A 1W6YA 2OWPA 4K90B 2BMOB 1JKGB 2K54A 4WYKA 1IV9A 2ML5A 1QALA 1A90A 1AR0A 4K1VA 3KIIA 2W03A 2K0MA 1I2EA 1OHPA 2BNGA 3IPTA 4R1KA 5KP1A 1EA2A 1AQZA 1W2B2 3EN1B 1OGZA 3AGOA 2F56A 3LT8A 5ELUA 1KC84 2XH9A 3GSPA 1PY3A 2IUJA 1JBRA 3QRDA 4FR9A 2P0MA 4LGQA 1RJOA 1FGMA 3PCRA 4XM4A 1BANA 1LQGC 2HMLB 3BLZA 3BNCA 4GHOA 1OF5A 3B7CA 5AYRB 3CC73 1G02A 3LTAA 1AVLA 4FCMA 4HYZA 5GSPA 1O7NB 2YFLB 1IQ8A 1B2MA 1FGRA 1W6CA 1TRPA 2RFRA 3MG2A 2W2CA 5G1LA 4I4KA 3KSPA 1B20A 2CFKA 3FZWA 1D6ZA 2CFGA 3GAXA 1AVKA 3F14A 2CFDA 2LYXA 3BNEA 1GOUA 1JRQA 1IVVA 1CH0A 1WNHA 2IA7A 1NB3I 2WGQA 3DGLA 4BU4A 1GOVA 1OHOA 1MWSA 2D1WA 3DXOA 3FCSB 1RGLA 3DGYA 1MWUA 1Q40A 4XBTA 2P09A 1BRSA 3BU4A 3B4PA 3K63A 3NM2A 1E3RA 2CC3A 3LZAA 1I2GA 2CX1A 3GWRA 2KRTA 2YFIB 3O8YA 4O3VA 5FGOA 2C10A 3JUPA 3T8UA 1VQ43 3EX9A 2H0IA 2FGTA 5AIFA 1RRHA 2CW9A 1YJ93 1YNVX 3TDGA 3NV0A 2CG1A 1GS3A 1I0VA 1Q864 1TFKA 5IEOA 1MOLA 1BNSA 1RGCA 1T2HA 1BNFA 2E2TA 3EB8A 3LXUX 3BIRA 2FXTA 3GZXB 1RTUA 4LYLB 1BSCA 3PZWA 2OTJ3 3F40A 1BNIA 1IT8A 1JB2A 2V1LA 5BU4A 1J2BA 4XB5A 4OVMA 5D83A 2R4IA 3S27A 5M19A 3NBJA 1A67A 3KKGA 4RBNA 1RGAA 5LC7A 1C7HA 4IPBA 1BNGA 2AAEA 3G0KA 4EW5A 4KVHA 5IF6A 3CXC2 1TUHA 3RGAA 1RRLA 1QJGA 3X3ZA 1FW7A 2C4BA 4U13A 8RNTA 3CCV3 4WFOA 2MC8A 3FH1A 3JUOA 4KFFA 3F9SA 1QVG2 4H3UA 1SPUA 1GMRA 1ROVA 1BIRA 2KAAA 2H0GA 5LC6A 1NJI4 1RGKA 3NV0B 3ROBA 1LNHA 2H0HA 3N8BA 4O02B 2Y74A 2HOHA 1RNBA 1K9M4 3WDGB 1UUVB 3F8HA 4KFDA 3D5GA 1UGIA 3QK9A 1YVBI 1RLSA 2KCDA 1I70A 4K61A 1UW1A 1W00A 3Q90A 5D81A 4ZM8A 5BXQA 1BNRA 4WWUC 3EQQB 4JF8A 1YGEA 1PU4A 1RGGA 2MF7A 2QGUA 3HX8A 3G4S3 1B2XA 3F7SA 3ER7A 1STDA 1LOXA 1I8VA 1HYFA 1RNTA 3DGMA 3F8XA 4HM6B 1EUIC 4Q53A 2XR8B 3G16A 2XGLA 1T2IA 4R80A 1GMPA 4L8OA 1FGOA 3M8CA 2IMJA 3CCR3 4HM4B 3I553 1US1A 1PFPA 1W01A 3N9HA 2OQEC 2RBIA 1Q7HA 4EV5A 3G713 5EQLA 3LMLA 3B4OA 3PGBA 1BAOA 3UB1A 4AKYA 1YJW3 5JPUA 1BUJA 1IVXA 3OWSA 4QWTA 2FNQA 3D79A 3LTBA 1TFOA 2RCDA 4GL6A 4KFEA 2QEX3 1GYBA 4MEIA 2F99A 2L4VA 2Z76A 3G8ZA 1KWIA 3UL5A 1R4CA 1FGQA 1BUQA 1BVIA 1ZX2A 3AHWA 1VQN3 3FKAA 3Q3FA 3MSOA 1I0XA 1DVDA 2SBLA 4HKVB 3DGOA 1UDII 4FMAA 1QVF2 1FUSA 2B1XB 3CNXA 4FMDA 1IV7A 5STDA 2K3DA 3FSDA 1Q42A 1Q9EA 3D3LA 2RGQA 3MPHA 4ILFA 4LZIA 3X3YA 3X3XA 4AEQA 3WOFB 5M1AA 1LOVA 8CHOA 5RNTA 1B2ZA 2HMMB 6RNTA 5A0OB 1IQYA 1MGWA 3CCJ3 1RGEA 1V57A 2BT3A 3LT9A 1SARA 5EVHA 3B8LA 3NBBA 1L5GB 3GZBA 1DMMA 2Z7AA 3MKIA 1A2PA 5AIHA 1O7WB 4O2HA 4LMIA 4AKZA 1JBTA 3IJEB 1JNQA 2RSXA 1C54A 3JUNA 1UCLA 3DGNA 3HZPA 3JUQA 1M1K4 3PYJA 2P38A 2JDIH 1ZS7A 2CWUA 2D42A 2W6JH 4NHFA 4N6MA 1IK3A 1Q7Y4 1CQSA 1NWWA 1UI7A 3NX0A 2E2VA 2HMJB 3UL6A 2JQ5A 3KN4A 1OACA 1RDSA 4IT7A 7GSPA 4KZ1A 4PEJA 4O8SA 3NBRA 1FZUA 3V98A 4BIRA 2GEYA 1K8A4 1AV4A 3DY5A 2GEXA 4LSOA 4EC6A 5CXOA 1TJDA 1ULJB 2W56A 5JBSA 1O7GB 1GD4A 1I3FA 2GBXB 2J8XB 4BL3A 1VQ93 3WOEB 1W02A 2BMRB 2Y73A 3CCU3 3KCHA 1ASKA 2O3OA 1SJWA 5BIRA 2W9PA 3CC43 1N8QA 3LH4A 1WTHA 1YIJ3 1DVCA 4WHAA 1IU7A 3MG1A 3GZRA 5ELJA 1VQM3 1W5ZA 4RNZA 5TGNA 3OXAA 5KP4A 1LNIA 3UNLA 2YFJB 3EJVA 3JVCA 1W6GA 3MG3A 5CLKA 2GXFA 3S5CA 1M9GA 4HBRA 2P0XA 6GSPA 1VQ73 4N3VA 3SOYA 3EBYA 3LTCA 4FCJA 1IDPA 2I9WA 3CC23 1F8NA 3EN8A 3IMAB 1B21A 1VZZA 3Q2PA 4N6TA 1IQXA 3K9MC 4J8TA 1DMNA 4HM7B 4RZMA 3DMCA 3X41A 1FGTA 1M1XB 3FG3A 2XSOB 1U8CB 3WHOA 1YIT3 1RGHA 2UGIA 3EF8A 1ZO2A 1WMOA 2M7OA 4HZBB 4N6OB 2CFLA 1MGRA 2CX0A 2W56B 1KSIA 4EYCA 5DREA 2XRXB 2Z77A 4G1MB 1X1XA 4J5KA 3CME3 1SQWA 1IT7A 2HMNB 1VQP3 4HM2B 2CIUA 5AIIA 5BVBA 2XSHB 3FF2A 2CKFB 2CK3H 4MMZB 3S28A 2BMQB 1V74A 4HAAA 2WOHA 5IG5A 1BNEA 3AMOA 2ZL8A 3HIIA 1LOYA 1N9EA 2C11A 4XDVA 1TP6A 3HI7A 4L8PA 1IVUA 1FUTA 1MNLA 3SXXA 3CPW2 3RDEA 1D6UA 2A15A 1V58A 5AI1A 1M904 2SARA 5HGRA 1FUWA 1RMSA 5FW5A 1IYYA 3HIGA 4BTWA 3CMA3 5I97A 4HJLB 1I2FA 4GSPA 3D4AA 1BSDA 3CCE3 1QAFA 4K1UA 2F4YA 1E3VA 3AGNA 4X2HA 2ZA4A 1B2SA 5AIGA 3WODG 4WP5A 3LOYA 1A2VA 3OW22 3LYGA 4R9LA 4FCZA 1YGWA 3SX1A 9RNTA 1OHSA 1ROAA 2ZHXB 4N6UA 3V99A 1S723 3VSYA 3MYTA 1JN5A 1HU9A 3BNDA 4J5GA 1S5AA 1UUWB 5D82A 1DMQA 1O7MB 3ZG0A 3HK4A 1T3BA 1WMNA 1E97A 2CFWA 2IYJA 2IY2A 3AMOB 1X1WA 4H61A 1RSNA 3I0YA 3WMDA 6STDA 5G1KA 1N9JA 2B24B 1O7HB 3NXJA 2XEPA 3X40A 1SIIA 1BRNL 1OH0A 1RN1A 2PZVA 2YX9A 1STFI 1G0TA 3EE1A 2OTL3 1NNVA 1W7CA 1BRJA 3EC9A 5EEOA 5IG0A 1I3IA 3EBTA 3SLUA 3WR2A 3RGRA 1RCKA 2L1SA 3NHXA 2CWTA 1G96A 2F86B 4N6LA 1BSAA 2KF3A 1Q814 2W9QA 5CF1A 1RN7A 3CCQ3 1Y4KA 2W0QA 3CCS3 3D5IA 1JB4A 1R4YA 2QIYA 1N5HA 1JZOA 1JV2B 3BNBA 1BSEA 1RHLA 3L0RA 4EXRA 1BRKA 2AADA 1GD3A 4BL2A 4IIAA 3NUVA 7STDA 2IUKA 1RKYA 1RN4A 3BB9A 1JN5B 1YJN3 3SEDA 4CDLA 3DM8A 3CPOA 2OQEA 2HMOB 4NPBA 4CCVA 5DRVA 2KF6A 1X1UA 3CU3A 1MWTA 2CG0A 2W04A 2BU4A 2XGNA 3CNMA 1EG9B 3KE7A 1JJ22 1OCVA 2GU3A 2WOFA 1HKXA 1Z1SA 4MMXB
chains in the Genus database with same CATH topology
2STDA 2OOVA 1QMAA 4FMCA 3ALAA 5G2GA 3NM7A 5KP3A 1NDOB 3CD63 4FMBA 4X2OA 2XFTA 1WQLB 3FGYA 1K41A 1ULIB 4N6V0 4L7KA 3U1WA 1GY7A 1OGXA 3K5TA 3UJMA 1K28A 1VQO3 1OPYA 1DYUA 3S67A 3CCM3 3KFQC 4TX4A 3PXMA 4WYKB 2CWVA 3OWUA 3G6E3 4HM3B 1CEWI 5IEPA 2PNCA 4R9KA 3CCL3 3FF0A 3FLJA 3S29A 5JPPA 4HZ9B 1FA3A 1N8R4 1LXEA 1VQ53 4XDWA 3WA2X 3D9RA 1OF5B 4XBYA 1WMPA 2BHMA 3VGNA 3EHCA 1W4NA 3N54B 1ISKA 1N5PA 1K734 2CHCA 1YI23 5IG3A 2XF3A 1O7PB 1NU3A 4GB5A 4BTXA 3MWZA 2CH9A 3DZLA 3NQYA 2F98A 5AYSC 2UX0A 2BO9B 3A76A 1U5OA 3V92A 3WA3A 1VQL3 1VQ63 3K7CA 1Q40B 3GRDA 2OCTA 3PCSA 4BTYA 4RNYA 1VQ83 1D6YA 3DUKA 2WO0A 1CYVA 5CK6A 1IVWA 2KXGA 3ECFA 3JUMA 4HM0B 2LQVA 2ZDJA 4R4KA 4MJDA 3OX9A 2HMKB 1YHQ3 1KQS2 1TIJA 4HM1B 3GZYB 1Q824 4HM8B 5IENA 2GU1A 5IW9A 4JRFA 1W2ZA 3Q1CA 3J7Yd 1JKGA 2ML6A 1UI8A 5AEWB 3OV4A 3KZTA 2O9UX 1T5YA 3LTDA 3PS8A 3E99A 2XFSA 4HM5B 4NREA 3H3HA 1NB5I 2QA43 4MMYB 1CYUA 3OWYA 4HVNA 1GY6A 1GY5A 1QAKA 2P05A 3F7XA 2E2UA 3SVAA 1JB5A 4XBXA 5CF2A 3KSED 4ORLA 3SOAA 2WGOA 2Q07A 2INXA 1SIHA 1TU5A 4N6NB 2OOVC 4LEHA 3T8NA 4STDA 3VF1A 2GBWB 4EBGA 3NQZA 5AEUB 1A2KA 3FG4A 1NO3A 3U97A 1EKMA 4J9AA 4EV2A 1EQKA 2Z6BA 3FG1A 3X42A 5IERA 4OUQA 3MHEA 1LVNA 1VQK3 3H51A 1KD14 1OUNA 3STDA 3K0ZA 3I563 4OK0A 1W6YA 2OWPA 4K90B 2BMOB 1JKGB 2K54A 4WYKA 1IV9A 2ML5A 1QALA 1A90A 1AR0A 4K1VA 3KIIA 2W03A 2K0MA 3IPTA 1OHPA 2BNGA 4R1KA 5KP1A 1EA2A 1W2B2 1KC84 3EN1B 1OGZA 3LT8A 5ELUA 2XH9A 2IUJA 3QRDA 4FR9A 2P0MA 4LGQA 1RJOA 1FGMA 3PCRA 4XM4A 2HMLB 3BLZA 3BNCA 1OF5A 3B7CA 5AYRB 3CC73 4FCMA 3LTAA 1AVLA 4HYZA 1O7NB 2YFLB 1IQ8A 1FGRA 1W6CA 2RFRA 3MG2A 2W2CA 4I4KA 3KSPA 2CFKA 3FZWA 1D6ZA 2CFGA 3GAXA 1AVKA 3F14A 2CFDA 2LYXA 3BNEA 3DGLA 1JRQA 1IVVA 1WNHA 2IA7A 3T0UA 1NB3I 2WGQA 1IK3A 1M904 1OHOA 2D1WA 3DXOA 3FCSB 1Q40A 4XBTA 2P09A 3B4PA 3K63A 3NM2A 1E3RA 2CC3A 3LZAA 4O3VA 3GWRA 3O8YA 2KRTA 2YFIB 5FGOA 3T8UA 5IG4A 2C10A 3JUPA 1VQ43 3EX9A 2FGTA 5AIFA 1RRHA 2CW9A 1YJ93 3TDGA 3NV0A 2CG1A 1GS3A 1Q864 1TFKA 5IEOA 1MOLA 2E2TA 3EB8A 3LXUX 2FXTA 3GZXB 3PZWA 2OTJ3 3F40A 2V1LA 1IT8A 1JB2A 1J2BA 4XB5A 4OVMA 5D83A 2R4IA 3S27A 3NBJA 1A67A 3KKGA 4RBNA 5LC7A 1C7HA 4IPBA 3G0KA 4KVHA 5IF6A 3CXC2 1TUHA 3RGAA 1RRLA 1QJGA 3X3ZA 4U13A 3CCV3 4WFOA 2MC8A 3FH1A 3JUOA 4KFFA 3F9SA 1QVG2 4H3UA 1SPUA 1ROVA 5LC6A 1NJI4 3NV0B 3ROBA 1LNHA 4O02B 3N8BA 2Y74A 1K9M4 3WDGB 1UUVB 3F8HA 4KFDA 3S28A 3QK9A 1YVBI 2KCDA 4K61A 1UW1A 1W00A 3Q90A 5D81A 4ZM8A 5BXQA 4WWUC 3EQQB 4JF8A 1YGEA 1PU4A 2MF7A 2QGUA 3HX8A 3G4S3 3F7SA 3ER7A 1STDA 1LOXA 3F8XA 3DGMA 4HM6B 4Q53A 2XR8B 3G16A 2XGLA 4R80A 4L8OA 1FGOA 3M8CA 2IMJA 3CCR3 4HM4B 3I553 1US1A 1PFPA 1W01A 3N9HA 2OQEC 4EV5A 3G713 5EQLA 3LMLA 3B4OA 3PGBA 3UB1A 4AKYA 1YJW3 5JPUA 1IVXA 3OWSA 4QWTA 2FNQA 3LTBA 1TFOA 2RCDA 4GL6A 4KFEA 2QEX3 1GYBA 4MEIA 2F99A 2L4VA 2Z76A 3G8ZA 1KWIA 3UL5A 1R4CA 1FGQA 1BUQA 1ZX2A 1VQN3 3FKAA 3MSOA 1DVDA 2SBLA 4HKVB 3DGOA 4FMAA 1QVF2 2B1XB 3CNXA 4FMDA 1IV7A 5STDA 3FSDA 1Q42A 3D3LA 2RGQA 3MPHA 4LZIA 3X3YA 3X3XA 4AEQA 3WOFB 8CHOA 2HMMB 5A0OB 1IQYA 3CCJ3 2BT3A 3LT9A 5EVHA 3B8LA 3NBBA 1L5GB 3GZBA 1DMMA 2Z7AA 3MKIA 5AIHA 1O7WB 4O2HA 4LMIA 4AKZA 3IJEB 1JNQA 2RSXA 3JUNA 3DGNA 3HZPA 3JUQA 1M1K4 3PYJA 2P38A 2JDIH 2CWUA 2D42A 2W6JH 4NHFA 4N6MA 1Q7Y4 1CQSA 1NWWA 1UI7A 3NX0A 2E2VA 2HMJB 3UL6A 2JQ5A 3KN4A 1OACA 4IT7A 4KZ1A 4PEJA 4O8SA 3NBRA 3V98A 2GEYA 1K8A4 1AV4A 3DY5A 2GEXA 4LSOA 4EC6A 5CXOA 1ULJB 2W56A 5JBSA 1O7GB 1GD4A 2GBXB 1VQ93 3WOEB 1W02A 2Y73A 2BMRB 3CCU3 1ASKA 2O3OA 1SJWA 2W9PA 3CC43 1N8QA 3LH4A 1WTHA 1YIJ3 1DVCA 4WHAA 1IU7A 3MG1A 3GZRA 5ELJA 1VQM3 1W5ZA 4RNZA 5TGNA 3OXAA 5KP4A 3UNLA 2YFJB 3EJVA 3JVCA 1W6GA 3MG3A 5CLKA 2GXFA 3S5CA 1M9GA 4HBRA 2P0XA 1VQ73 4N3VA 3SOYA 3EBYA 3LTCA 4FCJA 1IDPA 2I9WA 3CC23 1F8NA 3EN8A 3IMAB 1VZZA 3Q2PA 4N6TA 1IQXA 3K9MC 4J8TA 1DMNA 4HM7B 4RZMA 3DMCA 3X41A 1FGTA 1M1XB 3FG3A 2XSOB 1U8CB 1YIT3 3EF8A 4HZBB 1ZO2A 1WMOA 2M7OA 4N6OB 2CFLA 2W56B 1KSIA 4EYCA 5DREA 2XRXB 2Z77A 4G1MB 3CME3 1SQWA 1IT7A 2HMNB 1VQP3 4HM2B 2CIUA 5AIIA 5BVBA 2XSHB 3FF2A 2CKFB 2CK3H 4MMZB 2BMQB 1V74A 2WOHA 5IG5A 3AMOA 2ZL8A 3HIIA 1N9EA 2C11A 4XDVA 1TP6A 3HI7A 4L8PA 1IVUA 1MNLA 3SXXA 3CPW2 3RDEA 1D6UA 2A15A 5AI1A 1FUWA 5HGRA 5FW5A 3HIGA 4BTWA 3CMA3 5I97A 4HJLB 3CCE3 1QAFA 4K1UA 1E3VA 4X2HA 5AIGA 3WODG 4WP5A 3LOYA 1A2VA 3OW22 3LYGA 4R9LA 4FCZA 3SX1A 1OHSA 1ROAA 4N6UA 3V99A 1S723 3VSYA 3MYTA 1JN5A 1HU9A 3BNDA 1S5AA 1UUWB 5D82A 1DMQA 1O7MB 3HK4A 1WMNA 2CFWA 1E97A 3AMOB 4H61A 3I0YA 3WMDA 6STDA 1N9JA 2B24B 1O7HB 3NXJA 2XEPA 3X40A 1SIIA 1OH0A 2PZVA 2YX9A 1STFI 3EE1A 2OTL3 1W7CA 3EC9A 5EEOA 5IG0A 3EBTA 3SLUA 3RGRA 3NHXA 2CWTA 1G96A 2F86B 4N6LA 1Q814 2W9QA 5CF1A 1RN7A 3CCQ3 1Y4KA 2W0QA 3CCS3 1JB4A 2QIYA 1N5HA 1JV2B 3BNBA 3L0RA 4EXRA 7STDA 1GD3A 4IIAA 3NUVA 2IUKA 1RKYA 3BB9A 1JN5B 1YJN3 3SEDA 4CDLA 3DM8A 3CPOA 2OQEA 2HMOB 4CCVA 5DRVA 3CU3A 2CG0A 1JJ22 2W04A 2XGNA 3CNMA 3KE7A 1EG9B 1OCVA 2GU3A 2WOFA 1HKXA 1Z1SA 4MMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2STD A;  1QMA A;  5G2G A;  5KP3 A;  1NDO B;  4X2O A;  1WQL B;  3FGY A;  1K41 A;  1ULI B;  4L7K A;  1GY7 A;  1OGX A;  3UJM A;  1OPY A;  4WYK B;  3OWU A;  4HM3 B;  5IEP A;  4R9K A;  3FF0 A;  3FLJ A;  5JPP A;  4HZ9 B;  4XDW A;  3D9R A;  1OF5 B;  4XBY A;  3VGN A;  3EHC A;  1ISK A;  2CHC A;  5IG3 A;  1O7P B;  1NU3 A;  4GB5 A;  3DZL A;  2F98 A;  2UX0 A;  3A76 A;  1U5O A;  3K7C A;  1Q40 B;  3GRD A;  3DUK A;  5CK6 A;  3ECF A;  3JUM A;  4HM0 B;  4MJD A;  3OX9 A;  2HMK B;  4HM1 B;  3GZY B;  4HM8 B;  5IEN A;  1JKG A;  5AEW B;  3OV4 A;  3KZT A;  3E99 A;  4HM5 B;  3H3H A;  3OWY A;  4HVN A;  1GY6 A;  1GY5 A;  3F7X A;  1JB5 A;  4XBX A;  5CF2 A;  4ORL A;  3SOA A;  2INX A;  4LEH A;  3T8N A;  4STD A;  2GBW B;  5AEU B;  1A2K A;  4J9A A;  5IER A;  4OUQ A;  3MHE A;  3H51 A;  1OUN A;  3STD A;  3K0Z A;  1W6Y A;  2OWP A;  2BMO B;  1JKG B;  2K54 A;  4WYK A;  1AR0 A;  4K1V A;  3IPT A;  5KP1 A;  1OHP A;  2BNG A;  4R1K A;  1EA2 A;  3EN1 B;  1OGZ A;  4XM4 A;  4LGQ A;  2HML B;  3BLZ A;  1OF5 A;  3B7C A;  4FCM A;  1O7N B;  2YFL B;  2RFR A;  3MG2 A;  2W2C A;  4I4K A;  3KSP A;  3FZW A;  3F14 A;  1OHO A;  3DXO A;  1Q40 A;  4XBT A;  3B4P A;  3NM2 A;  1E3R A;  3LZA A;  5IG4 A;  3GWR A;  3T8U A;  2YFI B;  3JUP A;  3EX9 A;  5AIF A;  3NV0 A;  1GS3 A;  5IEO A;  3GZX B;  3F40 A;  1JB2 A;  4XB5 A;  4OVM A;  5D83 A;  2R4I A;  3KKG A;  1C7H A;  3G0K A;  4KVH A;  5IF6 A;  1TUH A;  3RGA A;  1QJG A;  4U13 A;  3FH1 A;  3JUO A;  3F9S A;  4H3U A;  3NV0 B;  3ROB A;  1UUV B;  3F8H A;  1W00 A;  3Q90 A;  5D81 A;  5BXQ A;  4WWU C;  3EQQ B;  2QGU A;  3HX8 A;  3F7S A;  3ER7 A;  1STD A;  3F8X A;  4Q53 A;  4HM6 B;  2XR8 B;  3G16 A;  4L8O A;  3M8C A;  2IMJ A;  4HM4 B;  1W01 A;  3B4O A;  5JPU A;  3OWS A;  2RCD A;  1GYB A;  2F99 A;  2Z76 A;  3G8Z A;  1BUQ A;  1ZX2 A;  3FKA A;  3MSO A;  4HKV B;  2B1X B;  3CNX A;  5STD A;  3FSD A;  1Q42 A;  2RGQ A;  8CHO A;  2HMM B;  5EVH A;  3B8L A;  3GZB A;  1DMM A;  2Z7A A;  3MKI A;  5AIH A;  1O7W B;  4LMI A;  3JUN A;  3HZP A;  3JUQ A;  1CQS A;  1NWW A;  2HMJ B;  2JQ5 A;  4PEJ A;  3NBR A;  2GEY A;  2GEX A;  5CXO A;  1ULJ B;  1O7G B;  2GBX B;  1W02 A;  2BMR B;  1ASK A;  1SJW A;  3MG1 A;  3GZR A;  5TGN A;  3OXA A;  5KP4 A;  3UNL A;  2YFJ B;  3EJV A;  3MG3 A;  5CLK A;  2GXF A;  3S5C A;  4N3V A;  3SOY A;  3EBY A;  4FCJ A;  1IDP A;  2I9W A;  3EN8 A;  1VZZ A;  4J8T A;  1DMN A;  4HM7 B;  4RZM A;  3DMC A;  2XSO B;  3EF8 A;  4HZB B;  1ZO2 A;  5DRE A;  2XRX B;  2Z77 A;  2HMN B;  4HM2 B;  5AII A;  5BVB A;  2XSH B;  3FF2 A;  2CKF B;  2BMQ B;  5IG5 A;  4XDV A;  1TP6 A;  4L8P A;  2A15 A;  5AI1 A;  5HGR A;  5FW5 A;  4HJL B;  4K1U A;  1E3V A;  4X2H A;  5AIG A;  4WP5 A;  3LYG A;  4R9L A;  1OHS A;  3VSY A;  3MYT A;  1JN5 A;  1S5A A;  1UUW B;  5D82 A;  1DMQ A;  1O7M B;  3HK4 A;  1E97 A;  3I0Y A;  3WMD A;  6STD A;  2B24 B;  1O7H B;  3NXJ A;  1OH0 A;  2PZV A;  3EC9 A;  5IG0 A;  3EBT A;  3RGR A;  3NHX A;  2F86 B;  5CF1 A;  1JB4 A;  2QIY A;  7STD A;  4IIA A;  3NUV A;  3BB9 A;  1JN5 B;  3SED A;  4CDL A;  3DM8 A;  3CPO A;  2HMO B;  5DRV A;  3CU3 A;  3CNM A;  3KE7 A;  1EG9 B;  1OCV A;  1HKX A;  1Z1S A; 
#chains in the Genus database with same CATH topology
 2STD A;  1BGS A;  1QMA A;  1TRQ A;  2OOV A;  4FMC A;  3ALA A;  5G2G A;  3NM7 A;  5KP3 A;  1NDO B;  3CD6 3;  4FMB A;  5HOH A;  4X2O A;  2XFT A;  1WQL B;  3FGY A;  1K41 A;  1ULI B;  4N6V 0;  4L7K A;  3U1W A;  1GY7 A;  1OGX A;  3K5T A;  3UJM A;  1K28 A;  1VQO 3;  1OPY A;  1DYU A;  3S67 A;  1UCI A;  1GOY A;  3CCM 3;  3KFQ C;  4TX4 A;  1BSB A;  3PXM A;  4WYK B;  2CWV A;  3DH2 A;  3OWU A;  3G6E 3;  1BOX A;  4HM3 B;  1UCK A;  1CEW I;  5IG4 A;  2PNC A;  4R9K A;  5IEP A;  3CCL 3;  3FF0 A;  3FLJ A;  3S29 A;  3SYU A;  4HZ9 B;  5JPP A;  1FA3 A;  1N8R 4;  1LXE A;  1BRH A;  1VQ5 3;  4XDW A;  3WA2 X;  4DKI A;  3D9R A;  1LQM B;  1OF5 B;  4XBY A;  1WMP A;  2BHM A;  2KF4 A;  3AHS A;  1EEJ A;  3VGN A;  1UCJ A;  3EHC A;  1W4N A;  3N54 B;  1ISK A;  1N5P A;  1K73 4;  1BRI A;  2CHC A;  1YI2 3;  5IG3 A;  2XF3 A;  1O7P B;  1NU3 A;  4GB5 A;  1LRA A;  1B2U A;  4BTX A;  1RGF A;  3MWZ A;  2CH9 A;  1X1Y A;  3DZL A;  2F98 A;  3NQY A;  2UX0 A;  1B27 A;  2BO9 B;  1U5O A;  3A76 A;  1AY7 A;  5AYS C;  3V92 A;  3WA3 A;  3K7C A;  1VQL 3;  1VQ6 3;  1MWR A;  1Q40 B;  3RNT A;  3GRD A;  2OCT A;  3PCS A;  4KT3 B;  1DET A;  4RNY A;  4BTY A;  1BU4 A;  1VQ8 3;  1D6Y A;  3DUK A;  2WO0 A;  3HOH A;  1CYV A;  3T0U A;  5CK6 A;  1IVW A;  2KXG A;  3ECF A;  1B3S A;  1UUG B;  3JUM A;  4HM0 B;  2LQV A;  2ZDJ A;  4R4K A;  2GSP A;  1BNJ A;  4MJD A;  4CJN A;  3OX9 A;  2HMK B;  1YHQ 3;  1LOW A;  1KQS 2;  1TIJ A;  4HM1 B;  3GZY B;  1Q82 4;  4RNT A;  4HM8 B;  5IEN A;  2GU1 A;  5IW9 A;  4JRF A;  1YVS A;  1W2Z A;  1FYS A;  1HZ1 A;  3Q1C A;  3J7Y d;  1JKG A;  2ML6 A;  1UI8 A;  2KF5 A;  5AEW B;  5M18 A;  3OV4 A;  3KZT A;  3URP A;  2O9U X;  1T5Y A;  3LTD A;  3PS8 A;  3E99 A;  2XFS A;  4CPK A;  1GSP A;  4HM5 B;  4NRE A;  3H3H A;  1NB5 I;  1PYL A;  2QA4 3;  1UGH I;  4MMY B;  1CYU A;  3OWY A;  4HVN A;  1BRG A;  1GY6 A;  1GY5 A;  1QAK A;  2P05 A;  3F7X A;  2E2U A;  3SVA A;  1JB5 A;  1JBS A;  3A5E A;  4XBX A;  5CF2 A;  2RNT A;  3KSE D;  1ZGX A;  4ORL A;  3SOA A;  1DE3 A;  1TTO A;  2WGO A;  4HOH A;  2Q07 A;  1RCL A;  2UUG C;  2INX A;  1SIH A;  1TU5 A;  4N6N B;  2OOV C;  2BIR A;  4LEH A;  3T8N A;  4STD A;  3VF1 A;  3ZG5 A;  7RNT A;  1GMQ A;  2GBW B;  4I5Q A;  2F5W A;  4EBG A;  3NQZ A;  5AEU B;  1A2K A;  3FG4 A;  1NO3 A;  3U97 A;  2R41 A;  1EKM A;  2F5M A;  4J9A A;  4EV2 A;  1EQK A;  2Z6B A;  3ZFZ A;  3FG1 A;  3X42 A;  5IER A;  4OUQ A;  3MHE A;  1JZD A;  1LVN A;  1VQK 3;  3H51 A;  1KD1 4;  1OUN A;  1VQQ A;  3STD A;  3K0Z A;  3I56 3;  4OK0 A;  1W6Y A;  2OWP A;  4K90 B;  2BMO B;  1JKG B;  2K54 A;  4WYK A;  1IV9 A;  2ML5 A;  1QAL A;  1A90 A;  1AR0 A;  4K1V A;  3KII A;  2W03 A;  2K0M A;  1I2E A;  1OHP A;  2BNG A;  3IPT A;  4R1K A;  5KP1 A;  1EA2 A;  1AQZ A;  1W2B 2;  3EN1 B;  1OGZ A;  3AGO A;  2F56 A;  3LT8 A;  5ELU A;  1KC8 4;  2XH9 A;  3GSP A;  1PY3 A;  2IUJ A;  1JBR A;  3QRD A;  4FR9 A;  2P0M A;  4LGQ A;  1RJO A;  1FGM A;  3PCR A;  4XM4 A;  1BAN A;  1LQG C;  2HML B;  3BLZ A;  3BNC A;  4GHO A;  1OF5 A;  3B7C A;  5AYR B;  3CC7 3;  1G02 A;  3LTA A;  1AVL A;  4FCM A;  4HYZ A;  5GSP A;  1O7N B;  2YFL B;  1IQ8 A;  1B2M A;  1FGR A;  1W6C A;  1TRP A;  2RFR A;  3MG2 A;  2W2C A;  5G1L A;  4I4K A;  3KSP A;  1B20 A;  2CFK A;  3FZW A;  1D6Z A;  2CFG A;  3GAX A;  1AVK A;  3F14 A;  2CFD A;  2LYX A;  3BNE A;  1GOU A;  1JRQ A;  1IVV A;  1CH0 A;  1WNH A;  2IA7 A;  1NB3 I;  2WGQ A;  3DGL A;  4BU4 A;  1GOV A;  1OHO A;  1MWS A;  2D1W A;  3DXO A;  3FCS B;  1RGL A;  3DGY A;  1MWU A;  1Q40 A;  4XBT A;  2P09 A;  1BRS A;  3BU4 A;  3B4P A;  3K63 A;  3NM2 A;  1E3R A;  2CC3 A;  3LZA A;  1I2G A;  2CX1 A;  3GWR A;  2KRT A;  2YFI B;  3O8Y A;  4O3V A;  5FGO A;  2C10 A;  3JUP A;  3T8U A;  1VQ4 3;  3EX9 A;  2H0I A;  2FGT A;  5AIF A;  1RRH A;  2CW9 A;  1YJ9 3;  1YNV X;  3TDG A;  3NV0 A;  2CG1 A;  1GS3 A;  1I0V A;  1Q86 4;  1TFK A;  5IEO A;  1MOL A;  1BNS A;  1RGC A;  1T2H A;  1BNF A;  2E2T A;  3EB8 A;  3LXU X;  3BIR A;  2FXT A;  3GZX B;  1RTU A;  4LYL B;  1BSC A;  3PZW A;  2OTJ 3;  3F40 A;  1BNI A;  1IT8 A;  1JB2 A;  2V1L A;  5BU4 A;  1J2B A;  4XB5 A;  4OVM A;  5D83 A;  2R4I A;  3S27 A;  5M19 A;  3NBJ A;  1A67 A;  3KKG A;  4RBN A;  1RGA A;  5LC7 A;  1C7H A;  4IPB A;  1BNG A;  2AAE A;  3G0K A;  4EW5 A;  4KVH A;  5IF6 A;  3CXC 2;  1TUH A;  3RGA A;  1RRL A;  1QJG A;  3X3Z A;  1FW7 A;  2C4B A;  4U13 A;  8RNT A;  3CCV 3;  4WFO A;  2MC8 A;  3FH1 A;  3JUO A;  4KFF A;  3F9S A;  1QVG 2;  4H3U A;  1SPU A;  1GMR A;  1ROV A;  1BIR A;  2KAA A;  2H0G A;  5LC6 A;  1NJI 4;  1RGK A;  3NV0 B;  3ROB A;  1LNH A;  2H0H A;  3N8B A;  4O02 B;  2Y74 A;  2HOH A;  1RNB A;  1K9M 4;  3WDG B;  1UUV B;  3F8H A;  4KFD A;  3D5G A;  1UGI A;  3QK9 A;  1YVB I;  1RLS A;  2KCD A;  1I70 A;  4K61 A;  1UW1 A;  1W00 A;  3Q90 A;  5D81 A;  4ZM8 A;  5BXQ A;  1BNR A;  4WWU C;  3EQQ B;  4JF8 A;  1YGE A;  1PU4 A;  1RGG A;  2MF7 A;  2QGU A;  3HX8 A;  3G4S 3;  1B2X A;  3F7S A;  3ER7 A;  1STD A;  1LOX A;  1I8V A;  1HYF A;  1RNT A;  3DGM A;  3F8X A;  4HM6 B;  1EUI C;  4Q53 A;  2XR8 B;  3G16 A;  2XGL A;  1T2I A;  4R80 A;  1GMP A;  4L8O A;  1FGO A;  3M8C A;  2IMJ A;  3CCR 3;  4HM4 B;  3I55 3;  1US1 A;  1PFP A;  1W01 A;  3N9H A;  2OQE C;  2RBI A;  1Q7H A;  4EV5 A;  3G71 3;  5EQL A;  3LML A;  3B4O A;  3PGB A;  1BAO A;  3UB1 A;  4AKY A;  1YJW 3;  5JPU A;  1BUJ A;  1IVX A;  3OWS A;  4QWT A;  2FNQ A;  3D79 A;  3LTB A;  1TFO A;  2RCD A;  4GL6 A;  4KFE A;  2QEX 3;  1GYB A;  4MEI A;  2F99 A;  2L4V A;  2Z76 A;  3G8Z A;  1KWI A;  3UL5 A;  1R4C A;  1FGQ A;  1BUQ A;  1BVI A;  1ZX2 A;  3AHW A;  1VQN 3;  3FKA A;  3Q3F A;  3MSO A;  1I0X A;  1DVD A;  2SBL A;  4HKV B;  3DGO A;  1UDI I;  4FMA A;  1QVF 2;  1FUS A;  2B1X B;  3CNX A;  4FMD A;  1IV7 A;  5STD A;  2K3D A;  3FSD A;  1Q42 A;  1Q9E A;  3D3L A;  2RGQ A;  3MPH A;  4ILF A;  4LZI A;  3X3Y A;  3X3X A;  4AEQ A;  3WOF B;  5M1A A;  1LOV A;  8CHO A;  5RNT A;  1B2Z A;  2HMM B;  6RNT A;  5A0O B;  1IQY A;  1MGW A;  3CCJ 3;  1RGE A;  1V57 A;  2BT3 A;  3LT9 A;  1SAR A;  5EVH A;  3B8L A;  3NBB A;  1L5G B;  3GZB A;  1DMM A;  2Z7A A;  3MKI A;  1A2P A;  5AIH A;  1O7W B;  4O2H A;  4LMI A;  4AKZ A;  1JBT A;  3IJE B;  1JNQ A;  2RSX A;  1C54 A;  3JUN A;  1UCL A;  3DGN A;  3HZP A;  3JUQ A;  1M1K 4;  3PYJ A;  2P38 A;  2JDI H;  1ZS7 A;  2CWU A;  2D42 A;  2W6J H;  4NHF A;  4N6M A;  1IK3 A;  1Q7Y 4;  1CQS A;  1NWW A;  1UI7 A;  3NX0 A;  2E2V A;  2HMJ B;  3UL6 A;  2JQ5 A;  3KN4 A;  1OAC A;  1RDS A;  4IT7 A;  7GSP A;  4KZ1 A;  4PEJ A;  4O8S A;  3NBR A;  1FZU A;  3V98 A;  4BIR A;  2GEY A;  1K8A 4;  1AV4 A;  3DY5 A;  2GEX A;  4LSO A;  4EC6 A;  5CXO A;  1TJD A;  1ULJ B;  2W56 A;  5JBS A;  1O7G B;  1GD4 A;  1I3F A;  2GBX B;  2J8X B;  4BL3 A;  1VQ9 3;  3WOE B;  1W02 A;  2BMR B;  2Y73 A;  3CCU 3;  3KCH A;  1ASK A;  2O3O A;  1SJW A;  5BIR A;  2W9P A;  3CC4 3;  1N8Q A;  3LH4 A;  1WTH A;  1YIJ 3;  1DVC A;  4WHA A;  1IU7 A;  3MG1 A;  3GZR A;  5ELJ A;  1VQM 3;  1W5Z A;  4RNZ A;  5TGN A;  3OXA A;  5KP4 A;  1LNI A;  3UNL A;  2YFJ B;  3EJV A;  3JVC A;  1W6G A;  3MG3 A;  5CLK A;  2GXF A;  3S5C A;  1M9G A;  4HBR A;  2P0X A;  6GSP A;  1VQ7 3;  4N3V A;  3SOY A;  3EBY A;  3LTC A;  4FCJ A;  1IDP A;  2I9W A;  3CC2 3;  1F8N A;  3EN8 A;  3IMA B;  1B21 A;  1VZZ A;  3Q2P A;  4N6T A;  1IQX A;  3K9M C;  4J8T A;  1DMN A;  4HM7 B;  4RZM A;  3DMC A;  3X41 A;  1FGT A;  1M1X B;  3FG3 A;  2XSO B;  1U8C B;  3WHO A;  1YIT 3;  1RGH A;  2UGI A;  3EF8 A;  1ZO2 A;  1WMO A;  2M7O A;  4HZB B;  4N6O B;  2CFL A;  1MGR A;  2CX0 A;  2W56 B;  1KSI A;  4EYC A;  5DRE A;  2XRX B;  2Z77 A;  4G1M B;  1X1X A;  4J5K A;  3CME 3;  1SQW A;  1IT7 A;  2HMN B;  1VQP 3;  4HM2 B;  2CIU A;  5AII A;  5BVB A;  2XSH B;  3FF2 A;  2CKF B;  2CK3 H;  4MMZ B;  3S28 A;  2BMQ B;  1V74 A;  4HAA A;  2WOH A;  5IG5 A;  1BNE A;  3AMO A;  2ZL8 A;  3HII A;  1LOY A;  1N9E A;  2C11 A;  4XDV A;  1TP6 A;  3HI7 A;  4L8P A;  1IVU A;  1FUT A;  1MNL A;  3SXX A;  3CPW 2;  3RDE A;  1D6U A;  2A15 A;  1V58 A;  5AI1 A;  1M90 4;  2SAR A;  5HGR A;  1FUW A;  1RMS A;  5FW5 A;  1IYY A;  3HIG A;  4BTW A;  3CMA 3;  5I97 A;  4HJL B;  1I2F A;  4GSP A;  3D4A A;  1BSD A;  3CCE 3;  1QAF A;  4K1U A;  2F4Y A;  1E3V A;  3AGN A;  4X2H A;  2ZA4 A;  1B2S A;  5AIG A;  3WOD G;  4WP5 A;  3LOY A;  1A2V A;  3OW2 2;  3LYG A;  4R9L A;  4FCZ A;  1YGW A;  3SX1 A;  9RNT A;  1OHS A;  1ROA A;  2ZHX B;  4N6U A;  3V99 A;  1S72 3;  3VSY A;  3MYT A;  1JN5 A;  1HU9 A;  3BND A;  4J5G A;  1S5A A;  1UUW B;  5D82 A;  1DMQ A;  1O7M B;  3ZG0 A;  3HK4 A;  1T3B A;  1WMN A;  1E97 A;  2CFW A;  2IYJ A;  2IY2 A;  3AMO B;  1X1W A;  4H61 A;  1RSN A;  3I0Y A;  3WMD A;  6STD A;  5G1K A;  1N9J A;  2B24 B;  1O7H B;  3NXJ A;  2XEP A;  3X40 A;  1SII A;  1BRN L;  1OH0 A;  1RN1 A;  2PZV A;  2YX9 A;  1STF I;  1G0T A;  3EE1 A;  2OTL 3;  1NNV A;  1W7C A;  1BRJ A;  3EC9 A;  5EEO A;  5IG0 A;  1I3I A;  3EBT A;  3SLU A;  3WR2 A;  3RGR A;  1RCK A;  2L1S A;  3NHX A;  2CWT A;  1G96 A;  2F86 B;  4N6L A;  1BSA A;  2KF3 A;  1Q81 4;  2W9Q A;  5CF1 A;  1RN7 A;  3CCQ 3;  1Y4K A;  2W0Q A;  3CCS 3;  3D5I A;  1JB4 A;  1R4Y A;  2QIY A;  1N5H A;  1JZO A;  1JV2 B;  3BNB A;  1BSE A;  1RHL A;  3L0R A;  4EXR A;  1BRK A;  2AAD A;  1GD3 A;  4BL2 A;  4IIA A;  3NUV A;  7STD A;  2IUK A;  1RKY A;  1RN4 A;  3BB9 A;  1JN5 B;  1YJN 3;  3SED A;  4CDL A;  3DM8 A;  3CPO A;  2OQE A;  2HMO B;  4NPB A;  4CCV A;  5DRV A;  2KF6 A;  1X1U A;  3CU3 A;  1MWT A;  2CG0 A;  2W04 A;  2BU4 A;  2XGN A;  3CNM A;  1EG9 B;  3KE7 A;  1JJ2 2;  1OCV A;  2GU3 A;  2WOF A;  1HKX A;  1Z1S A;  4MMX B; 
#chains in the Genus database with same CATH homology
 2STD A;  2OOV A;  1QMA A;  4FMC A;  3ALA A;  5G2G A;  3NM7 A;  5KP3 A;  1NDO B;  3CD6 3;  4FMB A;  4X2O A;  2XFT A;  1WQL B;  3FGY A;  1K41 A;  1ULI B;  4N6V 0;  4L7K A;  3U1W A;  1GY7 A;  1OGX A;  3K5T A;  3UJM A;  1K28 A;  1VQO 3;  1OPY A;  1DYU A;  3S67 A;  3CCM 3;  3KFQ C;  4TX4 A;  3PXM A;  4WYK B;  2CWV A;  3OWU A;  3G6E 3;  4HM3 B;  1CEW I;  5IEP A;  2PNC A;  4R9K A;  3CCL 3;  3FF0 A;  3FLJ A;  3S29 A;  5JPP A;  4HZ9 B;  1FA3 A;  1N8R 4;  1LXE A;  1VQ5 3;  4XDW A;  3WA2 X;  3D9R A;  1OF5 B;  4XBY A;  1WMP A;  2BHM A;  3VGN A;  3EHC A;  1W4N A;  3N54 B;  1ISK A;  1N5P A;  1K73 4;  2CHC A;  1YI2 3;  5IG3 A;  2XF3 A;  1O7P B;  1NU3 A;  4GB5 A;  4BTX A;  3MWZ A;  2CH9 A;  3DZL A;  3NQY A;  2F98 A;  5AYS C;  2UX0 A;  2BO9 B;  3A76 A;  1U5O A;  3V92 A;  3WA3 A;  1VQL 3;  1VQ6 3;  3K7C A;  1Q40 B;  3GRD A;  2OCT A;  3PCS A;  4BTY A;  4RNY A;  1VQ8 3;  1D6Y A;  3DUK A;  2WO0 A;  1CYV A;  5CK6 A;  1IVW A;  2KXG A;  3ECF A;  3JUM A;  4HM0 B;  2LQV A;  2ZDJ A;  4R4K A;  4MJD A;  3OX9 A;  2HMK B;  1YHQ 3;  1KQS 2;  1TIJ A;  4HM1 B;  3GZY B;  1Q82 4;  4HM8 B;  5IEN A;  2GU1 A;  5IW9 A;  4JRF A;  1W2Z A;  3Q1C A;  3J7Y d;  1JKG A;  2ML6 A;  1UI8 A;  5AEW B;  3OV4 A;  3KZT A;  2O9U X;  1T5Y A;  3LTD A;  3PS8 A;  3E99 A;  2XFS A;  4HM5 B;  4NRE A;  3H3H A;  1NB5 I;  2QA4 3;  4MMY B;  1CYU A;  3OWY A;  4HVN A;  1GY6 A;  1GY5 A;  1QAK A;  2P05 A;  3F7X A;  2E2U A;  3SVA A;  1JB5 A;  4XBX A;  5CF2 A;  3KSE D;  4ORL A;  3SOA A;  2WGO A;  2Q07 A;  2INX A;  1SIH A;  1TU5 A;  4N6N B;  2OOV C;  4LEH A;  3T8N A;  4STD A;  3VF1 A;  2GBW B;  4EBG A;  3NQZ A;  5AEU B;  1A2K A;  3FG4 A;  1NO3 A;  3U97 A;  1EKM A;  4J9A A;  4EV2 A;  1EQK A;  2Z6B A;  3FG1 A;  3X42 A;  5IER A;  4OUQ A;  3MHE A;  1LVN A;  1VQK 3;  3H51 A;  1KD1 4;  1OUN A;  3STD A;  3K0Z A;  3I56 3;  4OK0 A;  1W6Y A;  2OWP A;  4K90 B;  2BMO B;  1JKG B;  2K54 A;  4WYK A;  1IV9 A;  2ML5 A;  1QAL A;  1A90 A;  1AR0 A;  4K1V A;  3KII A;  2W03 A;  2K0M A;  3IPT A;  1OHP A;  2BNG A;  4R1K A;  5KP1 A;  1EA2 A;  1W2B 2;  1KC8 4;  3EN1 B;  1OGZ A;  3LT8 A;  5ELU A;  2XH9 A;  2IUJ A;  3QRD A;  4FR9 A;  2P0M A;  4LGQ A;  1RJO A;  1FGM A;  3PCR A;  4XM4 A;  2HML B;  3BLZ A;  3BNC A;  1OF5 A;  3B7C A;  5AYR B;  3CC7 3;  4FCM A;  3LTA A;  1AVL A;  4HYZ A;  1O7N B;  2YFL B;  1IQ8 A;  1FGR A;  1W6C A;  2RFR A;  3MG2 A;  2W2C A;  4I4K A;  3KSP A;  2CFK A;  3FZW A;  1D6Z A;  2CFG A;  3GAX A;  1AVK A;  3F14 A;  2CFD A;  2LYX A;  3BNE A;  3DGL A;  1JRQ A;  1IVV A;  1WNH A;  2IA7 A;  3T0U A;  1NB3 I;  2WGQ A;  1IK3 A;  1M90 4;  1OHO A;  2D1W A;  3DXO A;  3FCS B;  1Q40 A;  4XBT A;  2P09 A;  3B4P A;  3K63 A;  3NM2 A;  1E3R A;  2CC3 A;  3LZA A;  4O3V A;  3GWR A;  3O8Y A;  2KRT A;  2YFI B;  5FGO A;  3T8U A;  5IG4 A;  2C10 A;  3JUP A;  1VQ4 3;  3EX9 A;  2FGT A;  5AIF A;  1RRH A;  2CW9 A;  1YJ9 3;  3TDG A;  3NV0 A;  2CG1 A;  1GS3 A;  1Q86 4;  1TFK A;  5IEO A;  1MOL A;  2E2T A;  3EB8 A;  3LXU X;  2FXT A;  3GZX B;  3PZW A;  2OTJ 3;  3F40 A;  2V1L A;  1IT8 A;  1JB2 A;  1J2B A;  4XB5 A;  4OVM A;  5D83 A;  2R4I A;  3S27 A;  3NBJ A;  1A67 A;  3KKG A;  4RBN A;  5LC7 A;  1C7H A;  4IPB A;  3G0K A;  4KVH A;  5IF6 A;  3CXC 2;  1TUH A;  3RGA A;  1RRL A;  1QJG A;  3X3Z A;  4U13 A;  3CCV 3;  4WFO A;  2MC8 A;  3FH1 A;  3JUO A;  4KFF A;  3F9S A;  1QVG 2;  4H3U A;  1SPU A;  1ROV A;  5LC6 A;  1NJI 4;  3NV0 B;  3ROB A;  1LNH A;  4O02 B;  3N8B A;  2Y74 A;  1K9M 4;  3WDG B;  1UUV B;  3F8H A;  4KFD A;  3S28 A;  3QK9 A;  1YVB I;  2KCD A;  4K61 A;  1UW1 A;  1W00 A;  3Q90 A;  5D81 A;  4ZM8 A;  5BXQ A;  4WWU C;  3EQQ B;  4JF8 A;  1YGE A;  1PU4 A;  2MF7 A;  2QGU A;  3HX8 A;  3G4S 3;  3F7S A;  3ER7 A;  1STD A;  1LOX A;  3F8X A;  3DGM A;  4HM6 B;  4Q53 A;  2XR8 B;  3G16 A;  2XGL A;  4R80 A;  4L8O A;  1FGO A;  3M8C A;  2IMJ A;  3CCR 3;  4HM4 B;  3I55 3;  1US1 A;  1PFP A;  1W01 A;  3N9H A;  2OQE C;  4EV5 A;  3G71 3;  5EQL A;  3LML A;  3B4O A;  3PGB A;  3UB1 A;  4AKY A;  1YJW 3;  5JPU A;  1IVX A;  3OWS A;  4QWT A;  2FNQ A;  3LTB A;  1TFO A;  2RCD A;  4GL6 A;  4KFE A;  2QEX 3;  1GYB A;  4MEI A;  2F99 A;  2L4V A;  2Z76 A;  3G8Z A;  1KWI A;  3UL5 A;  1R4C A;  1FGQ A;  1BUQ A;  1ZX2 A;  1VQN 3;  3FKA A;  3MSO A;  1DVD A;  2SBL A;  4HKV B;  3DGO A;  4FMA A;  1QVF 2;  2B1X B;  3CNX A;  4FMD A;  1IV7 A;  5STD A;  3FSD A;  1Q42 A;  3D3L A;  2RGQ A;  3MPH A;  4LZI A;  3X3Y A;  3X3X A;  4AEQ A;  3WOF B;  8CHO A;  2HMM B;  5A0O B;  1IQY A;  3CCJ 3;  2BT3 A;  3LT9 A;  5EVH A;  3B8L A;  3NBB A;  1L5G B;  3GZB A;  1DMM A;  2Z7A A;  3MKI A;  5AIH A;  1O7W B;  4O2H A;  4LMI A;  4AKZ A;  3IJE B;  1JNQ A;  2RSX A;  3JUN A;  3DGN A;  3HZP A;  3JUQ A;  1M1K 4;  3PYJ A;  2P38 A;  2JDI H;  2CWU A;  2D42 A;  2W6J H;  4NHF A;  4N6M A;  1Q7Y 4;  1CQS A;  1NWW A;  1UI7 A;  3NX0 A;  2E2V A;  2HMJ B;  3UL6 A;  2JQ5 A;  3KN4 A;  1OAC A;  4IT7 A;  4KZ1 A;  4PEJ A;  4O8S A;  3NBR A;  3V98 A;  2GEY A;  1K8A 4;  1AV4 A;  3DY5 A;  2GEX A;  4LSO A;  4EC6 A;  5CXO A;  1ULJ B;  2W56 A;  5JBS A;  1O7G B;  1GD4 A;  2GBX B;  1VQ9 3;  3WOE B;  1W02 A;  2Y73 A;  2BMR B;  3CCU 3;  1ASK A;  2O3O A;  1SJW A;  2W9P A;  3CC4 3;  1N8Q A;  3LH4 A;  1WTH A;  1YIJ 3;  1DVC A;  4WHA A;  1IU7 A;  3MG1 A;  3GZR A;  5ELJ A;  1VQM 3;  1W5Z A;  4RNZ A;  5TGN A;  3OXA A;  5KP4 A;  3UNL A;  2YFJ B;  3EJV A;  3JVC A;  1W6G A;  3MG3 A;  5CLK A;  2GXF A;  3S5C A;  1M9G A;  4HBR A;  2P0X A;  1VQ7 3;  4N3V A;  3SOY A;  3EBY A;  3LTC A;  4FCJ A;  1IDP A;  2I9W A;  3CC2 3;  1F8N A;  3EN8 A;  3IMA B;  1VZZ A;  3Q2P A;  4N6T A;  1IQX A;  3K9M C;  4J8T A;  1DMN A;  4HM7 B;  4RZM A;  3DMC A;  3X41 A;  1FGT A;  1M1X B;  3FG3 A;  2XSO B;  1U8C B;  1YIT 3;  3EF8 A;  4HZB B;  1ZO2 A;  1WMO A;  2M7O A;  4N6O B;  2CFL A;  2W56 B;  1KSI A;  4EYC A;  5DRE A;  2XRX B;  2Z77 A;  4G1M B;  3CME 3;  1SQW A;  1IT7 A;  2HMN B;  1VQP 3;  4HM2 B;  2CIU A;  5AII A;  5BVB A;  2XSH B;  3FF2 A;  2CKF B;  2CK3 H;  4MMZ B;  2BMQ B;  1V74 A;  2WOH A;  5IG5 A;  3AMO A;  2ZL8 A;  3HII A;  1N9E A;  2C11 A;  4XDV A;  1TP6 A;  3HI7 A;  4L8P A;  1IVU A;  1MNL A;  3SXX A;  3CPW 2;  3RDE A;  1D6U A;  2A15 A;  5AI1 A;  1FUW A;  5HGR A;  5FW5 A;  3HIG A;  4BTW A;  3CMA 3;  5I97 A;  4HJL B;  3CCE 3;  1QAF A;  4K1U A;  1E3V A;  4X2H A;  5AIG A;  3WOD G;  4WP5 A;  3LOY A;  1A2V A;  3OW2 2;  3LYG A;  4R9L A;  4FCZ A;  3SX1 A;  1OHS A;  1ROA A;  4N6U A;  3V99 A;  1S72 3;  3VSY A;  3MYT A;  1JN5 A;  1HU9 A;  3BND A;  1S5A A;  1UUW B;  5D82 A;  1DMQ A;  1O7M B;  3HK4 A;  1WMN A;  2CFW A;  1E97 A;  3AMO B;  4H61 A;  3I0Y A;  3WMD A;  6STD A;  1N9J A;  2B24 B;  1O7H B;  3NXJ A;  2XEP A;  3X40 A;  1SII A;  1OH0 A;  2PZV A;  2YX9 A;  1STF I;  3EE1 A;  2OTL 3;  1W7C A;  3EC9 A;  5EEO A;  5IG0 A;  3EBT A;  3SLU A;  3RGR A;  3NHX A;  2CWT A;  1G96 A;  2F86 B;  4N6L A;  1Q81 4;  2W9Q A;  5CF1 A;  1RN7 A;  3CCQ 3;  1Y4K A;  2W0Q A;  3CCS 3;  1JB4 A;  2QIY A;  1N5H A;  1JV2 B;  3BNB A;  3L0R A;  4EXR A;  7STD A;  1GD3 A;  4IIA A;  3NUV A;  2IUK A;  1RKY A;  3BB9 A;  1JN5 B;  1YJN 3;  3SED A;  4CDL A;  3DM8 A;  3CPO A;  2OQE A;  2HMO B;  4CCV A;  5DRV A;  3CU3 A;  2CG0 A;  1JJ2 2;  2W04 A;  2XGN A;  3CNM A;  3KE7 A;  1EG9 B;  1OCV A;  2GU3 A;  2WOF A;  1HKX A;  1Z1S A;  4MMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...