1ULJB

Biphenyl dioxygenase (bpha1a2) in complex with the substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
177
structure length
177
Chain Sequence
FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Oxidoreductase
molecule keywords biphenyl dioxygenase large subunit
total genus 51
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uljB00
3FKAA 5JPUA 5BXQA 4RZMA 2A15A 4J8TA 4XB5A 2YFLB 3E99A 2XSOB 3BB9A 4STDA 1EA2A 4HM5B 5IG3A 5KP4A 1VZZA 2GBXB 1CQSA 1JN5B 2UX0A 3EQQB 4HM2B 5KP1A 5D83A 3B8LA 5JPPA 1ASKA 2HMMB 3T8NA 1ULIB 3HK4A 3DZLA 5IEPA 3G0KA 1ULJB 3GWRA 5IG0A 1JKGA 2BMQB 3A76A 3CNMA 2R4IA 1C7HA 3D9RA 5AIHA 3HX8A 1Q40B 3F40A 1E3VA 1OHSA 2PZVA 2HMOB 3SOAA 8CHOA 5IG4A 3OWUA 4N3VA 2XSHB 2CKFB 1O7HB 3FF0A 1DMNA 4XBTA 4WYKB 5D81A 2YFJB 3KZTA 4L7KA 5AIIA 1E3RA 5AEUB 4MJDA 3RGRA 4HM7B 4J9AA 4K1UA 3FLJA 4XBYA 5CLKA 2QIYA 5CXOA 3H51A 4I4KA 3JUMA 3EX9A 5KP3A 5AIGA 1JB2A 1A2KA 4GB5A 2GEXA 4CDLA 5HGRA 2RCDA 3FZWA 1GY7A 2RGQA 3GZXB 1GY6A 3MG2A 3MKIA 3MYTA 1JB5A 1OF5A 5AIFA 3SOYA 2B24B 2GXFA 1GS3A 3B4PA 2F99A 2Z77A 3JUNA 4U13A 3ROBA 3OWSA 3KSPA 5IEOA 4XDVA 5IF6A 1NU3A 5FW5A 3FH1A 6STDA 1QJGA 4XDWA 1TP6A 2W2CA 2XR8B 3T8UA 3VSYA 2IMJA 1GY5A 2F86B 3K0ZA 4FCMA 4LGQA 3UNLA 2GBWB 1JB4A 1O7WB 2BNGA 2OWPA 4HJLB 4KVHA 3DMCA 3KE7A 3EBTA 3DUKA 3EN1B 3M8CA 1OGZA 3NHXA 5CF1A 1K41A 3B7CA 3NV0A 1NWWA 1QMAA 4HM4B 1OH0A 2Z76A 5DRVA 1W02A 3F7SA 1UUWB 1SJWA 3NM2A 1O7PB 1TUHA 3EBYA 3Q90A 4OVMA 4X2HA 5D82A 4WWUC 2GEYA 5TGNA 3RGAA 3ECFA 5BVBA 3VGNA 2Z7AA 1WQLB 2HMJB 4HM3B 1OHOA 1JN5A 1ZX2A 3MG1A 5AI1A 3JUOA 3F8XA 4R9KA 1GYBA 1NDOB 1O7MB 2RFRA 3OWYA 4L8PA 1EG9B 4ORLA 3FSDA 1O7GB 2JQ5A 2XRXB 1JKGB 1OCVA 4H3UA 5G2GA 1HKXA 3F14A 4X2OA 4R1KA 5EVHA 3FF2A 3OXAA 1Q40A 3DM8A 1W6YA 1DMMA 3WMDA 1O7NB 4LMIA 1W00A 3G16A 2F98A 4LEHA 2BMRB 4HM1B 1OUNA 1UUVB 4WYKA 5DREA 3NUVA 3GZRA 3GRDA 4HM0B 3UJMA 3HZPA 1OPYA 2B1XB 4L8OA 4IIAA 1Z1SA 3MHEA 3OX9A 2K54A 3CPOA 4XM4A 5CF2A 3IPTA 1ISKA 3S5CA 1STDA 2I9WA 2STDA 2HMKB 1AR0A 4OUQA 1OF5B 5IERA 3NXJA 3JUQA 5IG5A 5AEWB 4HZBB 1ZO2A 5CK6A 5IENA 3EN8A 4R9LA 4K1VA 1OHPA 2QGUA 3MG3A 4HM8B 4XBXA 1IDPA 3EC9A 3G8ZA 3GZBA 3CU3A 4HZ9B 4HVNA 1BUQA 2HMLB 3EF8A 1W01A 3ER7A 2INXA 3F8HA 1Q42A 3F9SA 1DMQA 3I0YA 3FGYA 3K7CA 1E97A 1U5OA 3BLZA 3DXOA 3OV4A 3KKGA 3MSOA 5STDA 2BMOB 3EHCA 3STDA 3SEDA 4Q53A 4HM6B 3F7XA 2YFIB 3GZYB 7STDA 3CNXA 3H3HA 3JUPA 3NBRA 3LZAA 4WP5A 1OGXA 2CHCA 3NV0B 3EJVA 1S5AA 2HMNB 3LYGA 4FCJA 3B4OA 4PEJA 4HKVB
chains in the Genus database with same CATH superfamily
1B2MA 3DGNA 4RZMA 3NQYA 4J8TA 5IG3A 1D6UA 2YFLB 1M904 1ZGXA 3BB9A 1EA2A 1BNEA 4EYCA 4RNZA 2E2VA 2GBXB 2UX0A 1JN5B 2SARA 5KP1A 1VQ43 1M1XB 3FG1A 3UL6A 1BRHA 3CCR3 1ASKA 3S28A 3G0KA 1FA3A 3ALAA 4N6V0 5IG0A 3LTDA 3CMA3 2BMQB 1LOVA 3CNMA 1VQ53 3IMAB 1EQKA 1DE3A 1OHSA 2PZVA 8CHOA 1DVDA 1Y4KA 3OWUA 3DGMA 4ZM8A 1NJI4 1MNLA 2P38A 3KFQC 1RGGA 3PCSA 2YFJB 3KZTA 4L7KA 4R80A 1RNBA 1RGHA 1BRIA 3RGRA 4HM7B 2CWUA 3HOHA 1BRNL 1N9EA 2M7OA 1VQQA 3WODG 3H51A 4O3VA 4HOHA 1BANA 2P09A 1LOYA 2F5MA 4HBRA 1IQXA 1WMOA 5AIFA 4BTYA 1RRHA 1BSEA 1OF5A 3ZG0A 3MWZA 3JVCA 4JRFA 4RNYA 2GXFA 4DKIA 5RNTA 1FUTA 3JUNA 4U13A 3OWSA 1SQWA 1BNIA 1RCKA 3FH1A 3KN4A 2C10A 1JNQA 2XR8B 3VSYA 3WDGB 1FZUA 3BNCA 2IMJA 3AHSA 4EV5A 1ZS7A 2E2UA 4HYZA 3ZG5A 4R4KA 4EC6A 1W7CA 2BNGA 1FGOA 3KSED 3NM7A 4KVHA 3KE7A 1B21A 3MPHA 3DUKA 3EN1B 1BNFA 3NBJA 1K41A 4N6LA 1NWWA 4HM4B 1OH0A 2Z76A 3F7SA 3Q90A 1N9JA 1UUWB 2C11A 1O7PB 1TUHA 2L4VA 2XGNA 3EBYA 4J5GA 4OVMA 4WWUC 2GEYA 5BVBA 3ECFA 1WQLB 1DYUA 3MG1A 1EKMA 5AI1A 4R9KA 1V58A 2LQVA 1TFKA 3G6E3 1EEJA 2CWTA 5ELUA 2XEPA 3CCQ3 1EG9B 1WNHA 3FSDA 1O7GB 2FXTA 5G2GA 2BHMA 3TDGA 4X2OA 4R1KA 4QWTA 3FF2A 4CPKA 1BOXA 1IVUA 1Q40A 3DM8A 1W6YA 3WMDA 1A90A 1W6CA 1KC84 1JJ22 2PNCA 1OUNA 6RNTA 1X1UA 3NUVA 1UGHI 4IT7A 4KT3B 3GRDA 4HM0B 3VF1A 3HZPA 1QVF2 2WGOA 4XM4A 3SX1A 2K54A 3CPOA 4NPBA 5CF2A 3S5CA 1LXEA 2HMKB 1PYLA 3SVAA 5IERA 2XH9A 1RRLA 3NXJA 1IQYA 3IJEB 4KFEA 2GU1A 2KXGA 3WA3A 4XBXA 1JZDA 3Q2PA 1IDPA 1FYSA 1FUWA 3GZBA 1BUQA 2HMLB 3EF8A 3ER7A 3F8HA 3FCSB 1Q42A 4HAAA 3K7CA 1IK3A 3DXOA 5STDA 3STDA 4BU4A 3LT9A 1YVSA 1VQO3 2AAEA 8RNTA 2QA43 3NBRA 3WR2A 4O2HA 4WP5A 2OQEC 1RGKA 3S67A 3HI7A 2RNTA 1BNGA 1I70A 3EB8A 3PXMA 1N5HA 2CH9A 2A15A 1B27A 1FGTA 1T2IA 3FG4A 3GSPA 1LQGC 4STDA 5A0OB 1N8QA 4HM5B 2BT3A 1VZZA 3GAXA 2XF3A 1Q7HA 3K5TA 3U1WA 5D83A 1RGFA 1CH0A 5JBSA 2HMMB 2H0HA 1ULIB 1US1A 3HK4A 5IEPA 4FMCA 1QVG2 3AGNA 1JBSA 1LOWA 5EEOA 3WA2X 4EXRA 2XFTA 3WOEB 1C7HA 1KWIA 3D9RA 2KF3A 3NBBA 4N6TA 1YJW3 2Y74A 5IG4A 4N3VA 5BIRA 2XSHB 1FGMA 1O7HB 2CKFB 4XBTA 1TRQA 2OOVC 5D81A 5AEUB 1LRAA 1E3RA 2CK3H 4MJDA 4NHFA 5CLKA 1IQ8A 4I4KA 3JUMA 5KP3A 2OOVA 1BRGA 2KF6A 3MYTA 1GY7A 3MKIA 3BU4A 3GZXB 3KIIA 3SOYA 1VQK3 1BSDA 6GSPA 3B4PA 4KFDA 1GS3A 1X1WA 4TX4A 3ROBA 1I2GA 1V57A 1BRSA 1AVLA 1NU3A 2D42A 1QJGA 1TP6A 3X40A 2W04A 1IVXA 1NNVA 1KD14 2BIRA 2F86B 2IY2A 4LGQA 1JB4A 1O7WB 2GBWB 4G1MB 3CPW2 3DMCA 4BTXA 1M1K4 1YGWA 1N5PA 1TJDA 3EE1A 4BTWA 5CF1A 1S723 3B7CA 3N9HA 2XFSA 1W2B2 5DRVA 1W02A 3QK9A 1CYVA 2R41A 5D82A 4CCVA 3PS8A 5EQLA 1MWTA 2C4BA 2HMJB 4HM3B 2V1LA 1JN5A 2CFGA 3F8XA 1GYBA 1RCLA 4FMBA 3SXXA 1MWSA 1RGCA 2W0QA 1TTOA 2CC3A 4H61A 5FGOA 3V92A 2JQ5A 1JKGB 4H3UA 4FMAA 5EVHA 1O7NB 4LMIA 3G16A 1BUJA 2Q07A 3X3YA 2F98A 5AYSC 3V98A 2RBIA 1TRPA 1JRQA 4HM1B 4WYKA 5DREA 3CCM3 1T5YA 2F56A 2CX1A 1TU5A 3SYUA 3UJMA 2CFDA 4GSPA 1J2BA 4IIAA 1F8NA 1VQN3 3DH2A 1W5ZA 3IPTA 3HIGA 3PYJA 1ISKA 1B2ZA 1STDA 2STDA 1RTUA 2W9PA 1OF5B 1VQ93 1BSAA 3JUQA 1Q824 3AGOA 5IENA 5CK6A 3EN8A 4R9LA 1MWUA 2QGUA 1ROAA 3CC23 1G96A 4HM8B 1TFOA 5GSPA 1GMRA 1BNRA 1AQZA 1UCJA 4EBGA 2MF7A 1D6YA 3PZWA 2HOHA 3F9SA 3CCV3 3I0YA 1IVWA 1GMPA 3N54B 1RGAA 2SBLA 1B2UA 3AMOA 3MSOA 1UGIA 3HIIA 1IT8A 2YFIB 3GZYB 3H3HA 3O8YA 1RLSA 3LZAA 3NV0B 3BNEA 5JPUA 1KQS2 3UB1A 1YIT3 2KRTA 1LQMB 1AVKA 1OACA 1IV9A 2H0IA 3DGLA 3E99A 2CWVA 4HM2B 1RN4A 4J5KA 3SLUA 3B8LA 5JPPA 1IT7A 4WHAA 3GWRA 1BSCA 1FUSA 3A76A 5AIHA 4CJNA 1Q40B 3F40A 1E3VA 1AV4A 1G02A 3SOAA 1LNIA 1X1YA 5AIIA 1A2PA 2W6JH 4LZIA 1UCIA 3I563 4J9AA 4K1UA 9RNTA 2AADA 3FLJA 4XBYA 1JV2B 2QIYA 2L1SA 2OCTA 1RKYA 2BU4A 1HZ1A 2GEXA 5HGRA 2RCDA 1JBTA 3FZWA 1G0TA 1QAFA 2P05A 1A2VA 1JB5A 1I2FA 3X41A 2CFLA 4K90B 4OK0A 2F99A 3PGBA 4GHOA 2IUJA 3KSPA 4KZ1A 1NB3I 1Q7Y4 2FGTA 5IF6A 5FW5A 3X42A 5HOHA 5M1AA 1RHLA 3CCJ3 1SIIA 1K9M4 1RSNA 1BNSA 1VQ83 1JBRA 1VQ63 1GY5A 2W56B 3UNLA 5IW9A 1RJOA 1YIJ3 1KSIA 2CFKA 4HJLB 2ML5A 1QAKA 2ZDJA 3AHWA 2CX0A 3M8CA 3NHXA 2CG1A 4N6NB 2OQEA 5BU4A 1BSBA 5M18A 2CG0A 2O9UX 4KFFA 5G1LA 3J7Yd 1YJ93 3CCE3 1R4YA 1NO3A 4BIRA 3RGAA 1FGQA 4AKYA 2F5WA 1IU7A 4FCZA 3CC73 1ZX2A 1VQM3 3JUOA 1NDOB 1O7MB 2CFWA 2RFRA 1LNHA 3D5IA 3K9MC 3L0RA 3LTBA 3OWYA 1PU4A 2KAAA 3NX0A 4O8SA 2ZL8A 2D1WA 1X1XA 1FGRA 1W6GA 1RGEA 1IV7A 2XRXB 1PY3A 4ORLA 1IVVA 3F14A 3URPA 2E2TA 1UDII 4WFOA 5AYRB 4MMZB 1UCLA 1DVCA 3FG3A 4LEHA 2Z6BA 3D4AA 5M19A 3CCS3 2WO0A 1Q9EA 2UGIA 1RGLA 2BO9B 1ROVA 5G1KA 4BL3A 1HU9A 1BIRA 2B1XB 3BNBA 4L8OA 1GOYA 3N8BA 1Z1SA 1CEWI 1I2EA 4LSOA 3WHOA 1BRJA 5I97A 2K3DA 1I8VA 5IG5A 4HZBB 1ZO2A 4K1VA 1T2HA 1I3IA 3D5GA 3LMLA 3EC9A 1STFI 1SPUA 1U8CB 3Q3FA 4HVNA 1I0VA 1WMNA 4GB5A 1DMQA 3LXUX 3FGYA 4I5QA 1B2XA 4RBNA 3KKGA 7RNTA 3EHCA 3BIRA 4NREA 3SEDA 1RNTA 3LTCA 1RN1A 7STDA 1V74A 2IUKA 3JUPA 3CC43 4BL2A 3D3LA 1SARA 2CHCA 3EJVA 3PCRA 2HMNB 2P0MA 2MC8A 4HKVB 2IYJA 1R4CA 3FKAA 3OW22 4XB5A 3X3XA 2XSOB 2K0MA 5KP4A 3T0UA 3X3ZA 3EQQB 3G713 1CQSA 4EW5A 1YVBI 1Q864 2W9QA 3U97A 3G4S3 3LT8A 1RMSA 4N6UA 3T8NA 2ZHXB 3DZLA 4O02B 1ULJB 2WOHA 1JKGA 1UI7A 1WTHA 3A5EA 2R4IA 3K63A 2O3OA 1DETA 3HX8A 2HMOB 4LYLB 2W03A 3FF0A 1DMNA 1BVIA 4WYKB 3DGOA 1UW1A 2CIUA 2KCDA 3CME3 1UUGB 2ML6A 1W4NA 5CXOA 3EX9A 1YNVX 5AIGA 1JB2A 1A2KA 4GL6A 4CDLA 4IPBA 2GSPA 2RGQA 3MG2A 1GY6A 3CCL3 1VQ73 1NB5I 3D79A 2B24B 1BNJA 1N8R4 1MOLA 3CD63 2Z77A 3LH4A 1W2ZA 5IEOA 1JZOA 1EUIC 4XDVA 1YJN3 1I3FA 1LOXA 3S29A 6STDA 4XDWA 1CYUA 3DGYA 1A67A 1MWRA 2UUGC 2W2CA 1TIJA 3T8UA 4EV2A 2YX9A 1RDSA 3I553 2F4YA 3K0ZA 3AMOB 2WGQA 4FCMA 1MGRA 1VQP3 2OWPA 2Y73A 2ZA4A 1IYYA 1B3SA 3DY5A 3EBTA 1GMQA 1OGZA 1T3BA 1B20A 3NV0A 1QMAA 2OTJ3 4MMXB 1YHQ3 2QEX3 1LVNA 3NM2A 1SJWA 4AKZA 5TGNA 1YI23 4X2HA 4ILFA 5ELJA 2FNQA 1PFPA 3VGNA 2Z7AA 1M9GA 1OHOA 1UCKA 1SIHA 1AY7A 4L8PA 2LYXA 4FR9A 3RNTA 1BGSA 1OCVA 1HKXA 1RN7A 2KF4A 1WMPA 4N6MA 3ZFZA 7GSPA 3OXAA 3CCU3 1C54A 4N6OB 1DMMA 1FW7A 1MGWA 1W00A 2H0GA 2XGLA 4MEIA 3Q1CA 2BMRB 1UUVB 2J8XB 1GOUA 3NQZA 1L5GB 3GZRA 1Q814 1OPYA 3CXC2 3KCHA 3MHEA 3OX9A 3WOFB 4MMYB 3QRDA 4JF8A 5LC6A 2I9WA 2KF5A 2WOFA 1GD4A 1AR0A 4OUQA 2GU3A 3LOYA 5LC7A 4K61A 1HYFA 5AEWB 1BAOA 3UL5A 1K8A4 2P0XA 2CW9A 1OHPA 2OTL3 2RSXA 3MG3A 1I0XA 1GOVA 4FMDA 3G8ZA 1GSPA 4HZ9B 3CU3A 1BU4A 1VQL3 1W01A 3S27A 2INXA 5BXQA 1QALA 1E97A 1U5OA 3BLZA 2W56A 2IA7A 3OV4A 2BMOB 1UI8A 3V99A 4Q53A 1GD3A 1K734 1BRKA 3F7XA 3LTAA 4HM6B 4RNTA 3CNXA 1YGEA 3RDEA 1D6ZA 1OGXA 4AEQA 1K28A 2JDIH 1S5AA 3BNDA 3LYGA 4FCJA 3B4OA 4PEJA 1B2SA
chains in the Genus database with same CATH topology
3DGNA 4RZMA 3NQYA 4J8TA 5IG3A 1D6UA 2YFLB 1M904 3BB9A 1EA2A 4EYCA 4RNZA 2E2VA 2GBXB 2UX0A 1JN5B 5KP1A 1VQ43 1M1XB 3FG1A 3UL6A 3CCR3 1ASKA 3S28A 3G0KA 1FA3A 3ALAA 4N6V0 5IG0A 3LTDA 3CMA3 2BMQB 3CNMA 1VQ53 3IMAB 1EQKA 1OHSA 2PZVA 8CHOA 1DVDA 1Y4KA 3OWUA 3DGMA 4ZM8A 1NJI4 1MNLA 2P38A 3KFQC 3PCSA 2YFJB 3KZTA 4L7KA 4R80A 3RGRA 4HM7B 2CWUA 1N9EA 2M7OA 3WODG 3H51A 4O3VA 2P09A 4HBRA 1IQXA 1WMOA 5AIFA 4BTYA 1RRHA 1OF5A 3MWZA 3JVCA 4JRFA 4RNYA 2GXFA 3JUNA 4U13A 3OWSA 1SQWA 3FH1A 3KN4A 2C10A 1JNQA 2XR8B 3VSYA 3WDGB 3BNCA 2IMJA 4EV5A 2E2UA 4HYZA 4EC6A 4R4KA 1W7CA 2BNGA 1FGOA 3KSED 3NM7A 4KVHA 3KE7A 3MPHA 3DUKA 3EN1B 3NBJA 1K41A 4N6LA 1NWWA 4HM4B 1OH0A 2Z76A 3F7SA 3Q90A 1N9JA 1UUWB 2C11A 1O7PB 1TUHA 2L4VA 2XGNA 3EBYA 4OVMA 5EVHA 4WWUC 2GEYA 5BVBA 3ECFA 1WQLB 1DYUA 3MG1A 1EKMA 5AI1A 4R9KA 2LQVA 1TFKA 3G6E3 5ELUA 2CWTA 2XEPA 3CCQ3 1EG9B 1WNHA 3FSDA 1O7GB 2FXTA 5G2GA 2BHMA 3TDGA 4X2OA 4R1KA 4QWTA 3FF2A 1IVUA 1Q40A 3DM8A 1W6YA 3WMDA 1A90A 1W6CA 1KC84 1JJ22 2PNCA 1OUNA 3NUVA 4IT7A 3GRDA 4HM0B 3VF1A 3HZPA 1QVF2 2WGOA 4XM4A 3SX1A 2K54A 3CPOA 5CF2A 3S5CA 1LXEA 2HMKB 3SVAA 5IERA 2XH9A 1RRLA 3NXJA 1IQYA 3IJEB 4KFEA 2GU1A 2KXGA 3WA3A 4XBXA 3Q2PA 1IDPA 1FUWA 3GZBA 1BUQA 2HMLB 3EF8A 3ER7A 3F8HA 3FCSB 1Q42A 3K7CA 1IK3A 3DXOA 5STDA 3STDA 3LT9A 1VQO3 2QA43 3NBRA 4O2HA 4WP5A 2OQEC 3S67A 3HI7A 3EB8A 3PXMA 1N5HA 2CH9A 2A15A 1FGTA 3FG4A 5A0OB 4STDA 1N8QA 4HM5B 2BT3A 1VZZA 3GAXA 2XF3A 3U1WA 3K5TA 5D83A 5JBSA 2HMMB 1ULIB 1US1A 3HK4A 5IEPA 4FMCA 1QVG2 5EEOA 3WA2X 4EXRA 2XFTA 3WOEB 1C7HA 1KWIA 3D9RA 3NBBA 4N6TA 1YJW3 2Y74A 5IG4A 4N3VA 2XSHB 1FGMA 1O7HB 2CKFB 4XBTA 2OOVC 5D81A 5AEUB 2CK3H 1E3RA 4MJDA 4NHFA 5CLKA 1IQ8A 4I4KA 3JUMA 5KP3A 2OOVA 3MYTA 1GY7A 3MKIA 3GZXB 3KIIA 3SOYA 1VQK3 3B4PA 4KFDA 1GS3A 4TX4A 3ROBA 1AVLA 1NU3A 2D42A 1QJGA 1TP6A 3X40A 2W04A 1IVXA 1KD14 2F86B 4LGQA 1JB4A 1O7WB 2GBWB 4G1MB 3CPW2 3DMCA 4BTXA 1M1K4 3EE1A 1N5PA 5CF1A 1S723 4BTWA 3B7CA 3N9HA 2XFSA 1W2B2 5DRVA 1W02A 3QK9A 1CYVA 5D82A 4CCVA 3PS8A 5EQLA 2HMJB 4HM3B 2V1LA 1JN5A 2CFGA 3F8XA 1GYBA 4FMBA 3SXXA 2W0QA 2CC3A 4H61A 5FGOA 3V92A 2JQ5A 1JKGB 4H3UA 4FMAA 1O7NB 4LMIA 3G16A 2Q07A 3X3YA 2F98A 5AYSC 3V98A 4HM1B 1JRQA 4WYKA 5DREA 3CCM3 1T5YA 1TU5A 3UJMA 2CFDA 1J2BA 4IIAA 1F8NA 1VQN3 1W5ZA 3IPTA 3HIGA 3PYJA 1ISKA 1STDA 2STDA 2W9PA 1OF5B 1VQ93 3JUQA 1Q824 5IENA 5CK6A 3EN8A 4R9LA 2QGUA 1ROAA 3CC23 1G96A 4HM8B 1TFOA 4EBGA 2MF7A 1D6YA 3PZWA 3CCV3 3F9SA 3I0YA 1IVWA 3N54B 2SBLA 3AMOA 3MSOA 3HIIA 1IT8A 2YFIB 3GZYB 3H3HA 3O8YA 3LZAA 3NV0B 3BNEA 5JPUA 1KQS2 3UB1A 1YIT3 2KRTA 1AVKA 1OACA 1IV9A 3DGLA 3E99A 2CWVA 4HM2B 3SLUA 3B8LA 5JPPA 1IT7A 4WHAA 3GWRA 3A76A 5AIHA 1Q40B 3F40A 1E3VA 1AV4A 3SOAA 5AIIA 2W6JH 4LZIA 3I563 4J9AA 4K1UA 3FLJA 4XBYA 1JV2B 2QIYA 2OCTA 1RKYA 2GEXA 5HGRA 2RCDA 3FZWA 1QAFA 2P05A 1A2VA 1JB5A 3X41A 2CFLA 4K90B 4OK0A 2F99A 3PGBA 2IUJA 3KSPA 4KZ1A 1NB3I 1Q7Y4 2FGTA 5IF6A 5FW5A 3X42A 1K9M4 3CCJ3 1SIIA 1VQ83 1VQ63 1GY5A 2W56B 3UNLA 5IW9A 1RJOA 1YIJ3 1KSIA 2CFKA 4HJLB 2ML5A 1QAKA 2ZDJA 3M8CA 3NHXA 2CG1A 4N6NB 2OQEA 2CG0A 2O9UX 4KFFA 3J7Yd 1YJ93 3CCE3 1NO3A 3RGAA 1FGQA 4AKYA 1IU7A 4FCZA 3CC73 1ZX2A 1VQM3 3JUOA 1NDOB 1O7MB 2CFWA 2RFRA 1LNHA 3K9MC 3L0RA 3LTBA 3OWYA 1PU4A 3NX0A 4O8SA 2ZL8A 2D1WA 4ORLA 1FGRA 1W6GA 1IV7A 2XRXB 1IVVA 3F14A 2E2TA 5AYRB 4WFOA 4MMZB 1DVCA 3FG3A 4LEHA 2Z6BA 3CCS3 2WO0A 2BO9B 1ROVA 1HU9A 3BNBA 2B1XB 4L8OA 3N8BA 1Z1SA 1CEWI 4LSOA 5I97A 5IG5A 4HZBB 1ZO2A 4K1VA 3LMLA 3EC9A 1STFI 1SPUA 1U8CB 4HVNA 1WMNA 4GB5A 1DMQA 3LXUX 3FGYA 4RBNA 3KKGA 3EHCA 4NREA 3SEDA 3LTCA 7STDA 1V74A 2IUKA 3JUPA 3CC43 3D3LA 2CHCA 3EJVA 3PCRA 2HMNB 2P0MA 2MC8A 4HKVB 1R4CA 3FKAA 3OW22 4XB5A 3X3XA 2XSOB 2K0MA 5KP4A 3T0UA 3X3ZA 3EQQB 3G713 1CQSA 1YVBI 1Q864 2W9QA 3U97A 3G4S3 3LT8A 4N6UA 3T8NA 3DZLA 4O02B 1ULJB 2WOHA 1JKGA 1UI7A 1WTHA 3K63A 2R4IA 2O3OA 3HX8A 2HMOB 2W03A 3FF0A 1DMNA 4WYKB 3DGOA 1UW1A 2CIUA 2KCDA 3CME3 2ML6A 5CXOA 1W4NA 3EX9A 5AIGA 1JB2A 1A2KA 4GL6A 4CDLA 4IPBA 2RGQA 3MG2A 1GY6A 3CCL3 1VQ73 1NB5I 2B24B 3CD63 1N8R4 1MOLA 2Z77A 3LH4A 1W2ZA 5IEOA 4XDVA 1YJN3 1LOXA 3S29A 6STDA 4XDWA 1CYUA 1A67A 2W2CA 1TIJA 3T8UA 4EV2A 2YX9A 3I553 3K0ZA 3AMOB 2WGQA 4FCMA 1VQP3 2OWPA 2Y73A 3DY5A 3EBTA 1OGZA 3NV0A 1QMAA 2OTJ3 4MMXB 1YHQ3 2QEX3 1LVNA 3NM2A 1SJWA 4AKZA 5TGNA 1YI23 4X2HA 5ELJA 2FNQA 1PFPA 3VGNA 2Z7AA 1M9GA 1OHOA 1SIHA 4L8PA 2LYXA 4FR9A 1OCVA 1HKXA 1RN7A 4N6MA 1WMPA 3OXAA 3CCU3 4N6OB 1DMMA 1W00A 2XGLA 4MEIA 3Q1CA 2BMRB 1UUVB 3NQZA 1L5GB 3GZRA 1Q814 1OPYA 3CXC2 3MHEA 3OX9A 3WOFB 4MMYB 3QRDA 4JF8A 5LC6A 2I9WA 2WOFA 1GD4A 1AR0A 4OUQA 2GU3A 3LOYA 5LC7A 4K61A 5AEWB 1K8A4 3UL5A 2P0XA 2CW9A 1OHPA 2OTL3 2RSXA 3MG3A 4FMDA 3G8ZA 4HZ9B 3CU3A 1VQL3 1W01A 3S27A 2INXA 5BXQA 1QALA 1E97A 1U5OA 3BLZA 2W56A 2IA7A 3OV4A 2BMOB 1UI8A 3V99A 4Q53A 1GD3A 1K734 4HM6B 3F7XA 3LTAA 3CNXA 1YGEA 3RDEA 1D6ZA 1OGXA 4AEQA 1K28A 2JDIH 1S5AA 3BNDA 3LYGA 4FCJA 3B4OA 4PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKA A;  5JPU A;  5BXQ A;  4RZM A;  2A15 A;  4J8T A;  4XB5 A;  2YFL B;  3E99 A;  2XSO B;  3BB9 A;  4STD A;  1EA2 A;  4HM5 B;  5IG3 A;  5KP4 A;  1VZZ A;  2GBX B;  1CQS A;  1JN5 B;  2UX0 A;  3EQQ B;  4HM2 B;  5KP1 A;  5D83 A;  3B8L A;  5JPP A;  1ASK A;  2HMM B;  3T8N A;  1ULI B;  3HK4 A;  3DZL A;  5IEP A;  3G0K A;  1ULJ B;  3GWR A;  5IG0 A;  1JKG A;  2BMQ B;  3A76 A;  3CNM A;  2R4I A;  1C7H A;  3D9R A;  5AIH A;  3HX8 A;  1Q40 B;  3F40 A;  1E3V A;  1OHS A;  2PZV A;  2HMO B;  3SOA A;  8CHO A;  5IG4 A;  3OWU A;  4N3V A;  2XSH B;  2CKF B;  1O7H B;  3FF0 A;  1DMN A;  4XBT A;  4WYK B;  5D81 A;  2YFJ B;  3KZT A;  4L7K A;  5AII A;  1E3R A;  5AEU B;  4MJD A;  3RGR A;  4HM7 B;  4J9A A;  4K1U A;  3FLJ A;  4XBY A;  5CLK A;  2QIY A;  5CXO A;  3H51 A;  4I4K A;  3JUM A;  3EX9 A;  5KP3 A;  5AIG A;  1JB2 A;  1A2K A;  4GB5 A;  2GEX A;  4CDL A;  5HGR A;  2RCD A;  3FZW A;  1GY7 A;  2RGQ A;  3GZX B;  1GY6 A;  3MG2 A;  3MKI A;  3MYT A;  1JB5 A;  1OF5 A;  5AIF A;  3SOY A;  2B24 B;  2GXF A;  1GS3 A;  3B4P A;  2F99 A;  2Z77 A;  3JUN A;  4U13 A;  3ROB A;  3OWS A;  3KSP A;  5IEO A;  4XDV A;  5IF6 A;  1NU3 A;  5FW5 A;  3FH1 A;  6STD A;  1QJG A;  4XDW A;  1TP6 A;  2W2C A;  2XR8 B;  3T8U A;  3VSY A;  2IMJ A;  1GY5 A;  2F86 B;  3K0Z A;  4FCM A;  4LGQ A;  3UNL A;  2GBW B;  1JB4 A;  1O7W B;  2BNG A;  2OWP A;  4HJL B;  4KVH A;  3DMC A;  3KE7 A;  3EBT A;  3DUK A;  3EN1 B;  3M8C A;  1OGZ A;  3NHX A;  5CF1 A;  1K41 A;  3B7C A;  3NV0 A;  1NWW A;  1QMA A;  4HM4 B;  1OH0 A;  2Z76 A;  5DRV A;  1W02 A;  3F7S A;  1UUW B;  1SJW A;  3NM2 A;  1O7P B;  1TUH A;  3EBY A;  3Q90 A;  4OVM A;  4X2H A;  5D82 A;  4WWU C;  2GEY A;  5TGN A;  3RGA A;  3ECF A;  5BVB A;  3VGN A;  2Z7A A;  1WQL B;  2HMJ B;  4HM3 B;  1OHO A;  1JN5 A;  1ZX2 A;  3MG1 A;  5AI1 A;  3JUO A;  3F8X A;  4R9K A;  1GYB A;  1NDO B;  1O7M B;  2RFR A;  3OWY A;  4L8P A;  1EG9 B;  4ORL A;  3FSD A;  1O7G B;  2JQ5 A;  2XRX B;  1JKG B;  1OCV A;  4H3U A;  5G2G A;  1HKX A;  3F14 A;  4X2O A;  4R1K A;  5EVH A;  3FF2 A;  3OXA A;  1Q40 A;  3DM8 A;  1W6Y A;  1DMM A;  3WMD A;  1O7N B;  4LMI A;  1W00 A;  3G16 A;  2F98 A;  4LEH A;  2BMR B;  4HM1 B;  1OUN A;  1UUV B;  4WYK A;  5DRE A;  3NUV A;  3GZR A;  3GRD A;  4HM0 B;  3UJM A;  3HZP A;  1OPY A;  2B1X B;  4L8O A;  4IIA A;  1Z1S A;  3MHE A;  3OX9 A;  2K54 A;  3CPO A;  4XM4 A;  5CF2 A;  3IPT A;  1ISK A;  3S5C A;  1STD A;  2I9W A;  2STD A;  2HMK B;  1AR0 A;  4OUQ A;  1OF5 B;  5IER A;  3NXJ A;  3JUQ A;  5IG5 A;  5AEW B;  4HZB B;  1ZO2 A;  5CK6 A;  5IEN A;  3EN8 A;  4R9L A;  4K1V A;  1OHP A;  2QGU A;  3MG3 A;  4HM8 B;  4XBX A;  1IDP A;  3EC9 A;  3G8Z A;  3GZB A;  3CU3 A;  4HZ9 B;  4HVN A;  1BUQ A;  2HML B;  3EF8 A;  1W01 A;  3ER7 A;  2INX A;  3F8H A;  1Q42 A;  3F9S A;  1DMQ A;  3I0Y A;  3FGY A;  3K7C A;  1E97 A;  1U5O A;  3BLZ A;  3DXO A;  3OV4 A;  3KKG A;  3MSO A;  5STD A;  2BMO B;  3EHC A;  3STD A;  3SED A;  4Q53 A;  4HM6 B;  3F7X A;  2YFI B;  3GZY B;  7STD A;  3CNX A;  3H3H A;  3JUP A;  3NBR A;  3LZA A;  4WP5 A;  1OGX A;  2CHC A;  3NV0 B;  3EJV A;  1S5A A;  2HMN B;  3LYG A;  4FCJ A;  3B4O A;  4PEJ A;  4HKV B; 
#chains in the Genus database with same CATH topology
 1B2M A;  3DGN A;  4RZM A;  3NQY A;  4J8T A;  5IG3 A;  1D6U A;  2YFL B;  1M90 4;  1ZGX A;  3BB9 A;  1EA2 A;  1BNE A;  4EYC A;  4RNZ A;  2E2V A;  2GBX B;  2UX0 A;  1JN5 B;  2SAR A;  5KP1 A;  1VQ4 3;  1M1X B;  3FG1 A;  3UL6 A;  1BRH A;  3CCR 3;  1ASK A;  3S28 A;  3G0K A;  1FA3 A;  3ALA A;  4N6V 0;  5IG0 A;  3LTD A;  3CMA 3;  2BMQ B;  1LOV A;  3CNM A;  1VQ5 3;  3IMA B;  1EQK A;  1DE3 A;  1OHS A;  2PZV A;  8CHO A;  1DVD A;  1Y4K A;  3OWU A;  3DGM A;  4ZM8 A;  1NJI 4;  1MNL A;  2P38 A;  3KFQ C;  1RGG A;  3PCS A;  2YFJ B;  3KZT A;  4L7K A;  4R80 A;  1RNB A;  1RGH A;  1BRI A;  3RGR A;  4HM7 B;  2CWU A;  3HOH A;  1BRN L;  1N9E A;  2M7O A;  1VQQ A;  3WOD G;  3H51 A;  4O3V A;  4HOH A;  1BAN A;  2P09 A;  1LOY A;  2F5M A;  4HBR A;  1IQX A;  1WMO A;  5AIF A;  4BTY A;  1RRH A;  1BSE A;  1OF5 A;  3ZG0 A;  3MWZ A;  3JVC A;  4JRF A;  4RNY A;  2GXF A;  4DKI A;  5RNT A;  1FUT A;  3JUN A;  4U13 A;  3OWS A;  1SQW A;  1BNI A;  1RCK A;  3FH1 A;  3KN4 A;  2C10 A;  1JNQ A;  2XR8 B;  3VSY A;  3WDG B;  1FZU A;  3BNC A;  2IMJ A;  3AHS A;  4EV5 A;  1ZS7 A;  2E2U A;  4HYZ A;  3ZG5 A;  4R4K A;  4EC6 A;  1W7C A;  2BNG A;  1FGO A;  3KSE D;  3NM7 A;  4KVH A;  3KE7 A;  1B21 A;  3MPH A;  3DUK A;  3EN1 B;  1BNF A;  3NBJ A;  1K41 A;  4N6L A;  1NWW A;  4HM4 B;  1OH0 A;  2Z76 A;  3F7S A;  3Q90 A;  1N9J A;  1UUW B;  2C11 A;  1O7P B;  1TUH A;  2L4V A;  2XGN A;  3EBY A;  4J5G A;  4OVM A;  4WWU C;  2GEY A;  5BVB A;  3ECF A;  1WQL B;  1DYU A;  3MG1 A;  1EKM A;  5AI1 A;  4R9K A;  1V58 A;  2LQV A;  1TFK A;  3G6E 3;  1EEJ A;  2CWT A;  5ELU A;  2XEP A;  3CCQ 3;  1EG9 B;  1WNH A;  3FSD A;  1O7G B;  2FXT A;  5G2G A;  2BHM A;  3TDG A;  4X2O A;  4R1K A;  4QWT A;  3FF2 A;  4CPK A;  1BOX A;  1IVU A;  1Q40 A;  3DM8 A;  1W6Y A;  3WMD A;  1A90 A;  1W6C A;  1KC8 4;  1JJ2 2;  2PNC A;  1OUN A;  6RNT A;  1X1U A;  3NUV A;  1UGH I;  4IT7 A;  4KT3 B;  3GRD A;  4HM0 B;  3VF1 A;  3HZP A;  1QVF 2;  2WGO A;  4XM4 A;  3SX1 A;  2K54 A;  3CPO A;  4NPB A;  5CF2 A;  3S5C A;  1LXE A;  2HMK B;  1PYL A;  3SVA A;  5IER A;  2XH9 A;  1RRL A;  3NXJ A;  1IQY A;  3IJE B;  4KFE A;  2GU1 A;  2KXG A;  3WA3 A;  4XBX A;  1JZD A;  3Q2P A;  1IDP A;  1FYS A;  1FUW A;  3GZB A;  1BUQ A;  2HML B;  3EF8 A;  3ER7 A;  3F8H A;  3FCS B;  1Q42 A;  4HAA A;  3K7C A;  1IK3 A;  3DXO A;  5STD A;  3STD A;  4BU4 A;  3LT9 A;  1YVS A;  1VQO 3;  2AAE A;  8RNT A;  2QA4 3;  3NBR A;  3WR2 A;  4O2H A;  4WP5 A;  2OQE C;  1RGK A;  3S67 A;  3HI7 A;  2RNT A;  1BNG A;  1I70 A;  3EB8 A;  3PXM A;  1N5H A;  2CH9 A;  2A15 A;  1B27 A;  1FGT A;  1T2I A;  3FG4 A;  3GSP A;  1LQG C;  4STD A;  5A0O B;  1N8Q A;  4HM5 B;  2BT3 A;  1VZZ A;  3GAX A;  2XF3 A;  1Q7H A;  3K5T A;  3U1W A;  5D83 A;  1RGF A;  1CH0 A;  5JBS A;  2HMM B;  2H0H A;  1ULI B;  1US1 A;  3HK4 A;  5IEP A;  4FMC A;  1QVG 2;  3AGN A;  1JBS A;  1LOW A;  5EEO A;  3WA2 X;  4EXR A;  2XFT A;  3WOE B;  1C7H A;  1KWI A;  3D9R A;  2KF3 A;  3NBB A;  4N6T A;  1YJW 3;  2Y74 A;  5IG4 A;  4N3V A;  5BIR A;  2XSH B;  1FGM A;  1O7H B;  2CKF B;  4XBT A;  1TRQ A;  2OOV C;  5D81 A;  5AEU B;  1LRA A;  1E3R A;  2CK3 H;  4MJD A;  4NHF A;  5CLK A;  1IQ8 A;  4I4K A;  3JUM A;  5KP3 A;  2OOV A;  1BRG A;  2KF6 A;  3MYT A;  1GY7 A;  3MKI A;  3BU4 A;  3GZX B;  3KII A;  3SOY A;  1VQK 3;  1BSD A;  6GSP A;  3B4P A;  4KFD A;  1GS3 A;  1X1W A;  4TX4 A;  3ROB A;  1I2G A;  1V57 A;  1BRS A;  1AVL A;  1NU3 A;  2D42 A;  1QJG A;  1TP6 A;  3X40 A;  2W04 A;  1IVX A;  1NNV A;  1KD1 4;  2BIR A;  2F86 B;  2IY2 A;  4LGQ A;  1JB4 A;  1O7W B;  2GBW B;  4G1M B;  3CPW 2;  3DMC A;  4BTX A;  1M1K 4;  1YGW A;  1N5P A;  1TJD A;  3EE1 A;  4BTW A;  5CF1 A;  1S72 3;  3B7C A;  3N9H A;  2XFS A;  1W2B 2;  5DRV A;  1W02 A;  3QK9 A;  1CYV A;  2R41 A;  5D82 A;  4CCV A;  3PS8 A;  5EQL A;  1MWT A;  2C4B A;  2HMJ B;  4HM3 B;  2V1L A;  1JN5 A;  2CFG A;  3F8X A;  1GYB A;  1RCL A;  4FMB A;  3SXX A;  1MWS A;  1RGC A;  2W0Q A;  1TTO A;  2CC3 A;  4H61 A;  5FGO A;  3V92 A;  2JQ5 A;  1JKG B;  4H3U A;  4FMA A;  5EVH A;  1O7N B;  4LMI A;  3G16 A;  1BUJ A;  2Q07 A;  3X3Y A;  2F98 A;  5AYS C;  3V98 A;  2RBI A;  1TRP A;  1JRQ A;  4HM1 B;  4WYK A;  5DRE A;  3CCM 3;  1T5Y A;  2F56 A;  2CX1 A;  1TU5 A;  3SYU A;  3UJM A;  2CFD A;  4GSP A;  1J2B A;  4IIA A;  1F8N A;  1VQN 3;  3DH2 A;  1W5Z A;  3IPT A;  3HIG A;  3PYJ A;  1ISK A;  1B2Z A;  1STD A;  2STD A;  1RTU A;  2W9P A;  1OF5 B;  1VQ9 3;  1BSA A;  3JUQ A;  1Q82 4;  3AGO A;  5IEN A;  5CK6 A;  3EN8 A;  4R9L A;  1MWU A;  2QGU A;  1ROA A;  3CC2 3;  1G96 A;  4HM8 B;  1TFO A;  5GSP A;  1GMR A;  1BNR A;  1AQZ A;  1UCJ A;  4EBG A;  2MF7 A;  1D6Y A;  3PZW A;  2HOH A;  3F9S A;  3CCV 3;  3I0Y A;  1IVW A;  1GMP A;  3N54 B;  1RGA A;  2SBL A;  1B2U A;  3AMO A;  3MSO A;  1UGI A;  3HII A;  1IT8 A;  2YFI B;  3GZY B;  3H3H A;  3O8Y A;  1RLS A;  3LZA A;  3NV0 B;  3BNE A;  5JPU A;  1KQS 2;  3UB1 A;  1YIT 3;  2KRT A;  1LQM B;  1AVK A;  1OAC A;  1IV9 A;  2H0I A;  3DGL A;  3E99 A;  2CWV A;  4HM2 B;  1RN4 A;  4J5K A;  3SLU A;  3B8L A;  5JPP A;  1IT7 A;  4WHA A;  3GWR A;  1BSC A;  1FUS A;  3A76 A;  5AIH A;  4CJN A;  1Q40 B;  3F40 A;  1E3V A;  1AV4 A;  1G02 A;  3SOA A;  1LNI A;  1X1Y A;  5AII A;  1A2P A;  2W6J H;  4LZI A;  1UCI A;  3I56 3;  4J9A A;  4K1U A;  9RNT A;  2AAD A;  3FLJ A;  4XBY A;  1JV2 B;  2QIY A;  2L1S A;  2OCT A;  1RKY A;  2BU4 A;  1HZ1 A;  2GEX A;  5HGR A;  2RCD A;  1JBT A;  3FZW A;  1G0T A;  1QAF A;  2P05 A;  1A2V A;  1JB5 A;  1I2F A;  3X41 A;  2CFL A;  4K90 B;  4OK0 A;  2F99 A;  3PGB A;  4GHO A;  2IUJ A;  3KSP A;  4KZ1 A;  1NB3 I;  1Q7Y 4;  2FGT A;  5IF6 A;  5FW5 A;  3X42 A;  5HOH A;  5M1A A;  1RHL A;  3CCJ 3;  1SII A;  1K9M 4;  1RSN A;  1BNS A;  1VQ8 3;  1JBR A;  1VQ6 3;  1GY5 A;  2W56 B;  3UNL A;  5IW9 A;  1RJO A;  1YIJ 3;  1KSI A;  2CFK A;  4HJL B;  2ML5 A;  1QAK A;  2ZDJ A;  3AHW A;  2CX0 A;  3M8C A;  3NHX A;  2CG1 A;  4N6N B;  2OQE A;  5BU4 A;  1BSB A;  5M18 A;  2CG0 A;  2O9U X;  4KFF A;  5G1L A;  3J7Y d;  1YJ9 3;  3CCE 3;  1R4Y A;  1NO3 A;  4BIR A;  3RGA A;  1FGQ A;  4AKY A;  2F5W A;  1IU7 A;  4FCZ A;  3CC7 3;  1ZX2 A;  1VQM 3;  3JUO A;  1NDO B;  1O7M B;  2CFW A;  2RFR A;  1LNH A;  3D5I A;  3K9M C;  3L0R A;  3LTB A;  3OWY A;  1PU4 A;  2KAA A;  3NX0 A;  4O8S A;  2ZL8 A;  2D1W A;  1X1X A;  1FGR A;  1W6G A;  1RGE A;  1IV7 A;  2XRX B;  1PY3 A;  4ORL A;  1IVV A;  3F14 A;  3URP A;  2E2T A;  1UDI I;  4WFO A;  5AYR B;  4MMZ B;  1UCL A;  1DVC A;  3FG3 A;  4LEH A;  2Z6B A;  3D4A A;  5M19 A;  3CCS 3;  2WO0 A;  1Q9E A;  2UGI A;  1RGL A;  2BO9 B;  1ROV A;  5G1K A;  4BL3 A;  1HU9 A;  1BIR A;  2B1X B;  3BNB A;  4L8O A;  1GOY A;  3N8B A;  1Z1S A;  1CEW I;  1I2E A;  4LSO A;  3WHO A;  1BRJ A;  5I97 A;  2K3D A;  1I8V A;  5IG5 A;  4HZB B;  1ZO2 A;  4K1V A;  1T2H A;  1I3I A;  3D5G A;  3LML A;  3EC9 A;  1STF I;  1SPU A;  1U8C B;  3Q3F A;  4HVN A;  1I0V A;  1WMN A;  4GB5 A;  1DMQ A;  3LXU X;  3FGY A;  4I5Q A;  1B2X A;  4RBN A;  3KKG A;  7RNT A;  3EHC A;  3BIR A;  4NRE A;  3SED A;  1RNT A;  3LTC A;  1RN1 A;  7STD A;  1V74 A;  2IUK A;  3JUP A;  3CC4 3;  4BL2 A;  3D3L A;  1SAR A;  2CHC A;  3EJV A;  3PCR A;  2HMN B;  2P0M A;  2MC8 A;  4HKV B;  2IYJ A;  1R4C A;  3FKA A;  3OW2 2;  4XB5 A;  3X3X A;  2XSO B;  2K0M A;  5KP4 A;  3T0U A;  3X3Z A;  3EQQ B;  3G71 3;  1CQS A;  4EW5 A;  1YVB I;  1Q86 4;  2W9Q A;  3U97 A;  3G4S 3;  3LT8 A;  1RMS A;  4N6U A;  3T8N A;  2ZHX B;  3DZL A;  4O02 B;  1ULJ B;  2WOH A;  1JKG A;  1UI7 A;  1WTH A;  3A5E A;  2R4I A;  3K63 A;  2O3O A;  1DET A;  3HX8 A;  2HMO B;  4LYL B;  2W03 A;  3FF0 A;  1DMN A;  1BVI A;  4WYK B;  3DGO A;  1UW1 A;  2CIU A;  2KCD A;  3CME 3;  1UUG B;  2ML6 A;  1W4N A;  5CXO A;  3EX9 A;  1YNV X;  5AIG A;  1JB2 A;  1A2K A;  4GL6 A;  4CDL A;  4IPB A;  2GSP A;  2RGQ A;  3MG2 A;  1GY6 A;  3CCL 3;  1VQ7 3;  1NB5 I;  3D79 A;  2B24 B;  1BNJ A;  1N8R 4;  1MOL A;  3CD6 3;  2Z77 A;  3LH4 A;  1W2Z A;  5IEO A;  1JZO A;  1EUI C;  4XDV A;  1YJN 3;  1I3F A;  1LOX A;  3S29 A;  6STD A;  4XDW A;  1CYU A;  3DGY A;  1A67 A;  1MWR A;  2UUG C;  2W2C A;  1TIJ A;  3T8U A;  4EV2 A;  2YX9 A;  1RDS A;  3I55 3;  2F4Y A;  3K0Z A;  3AMO B;  2WGQ A;  4FCM A;  1MGR A;  1VQP 3;  2OWP A;  2Y73 A;  2ZA4 A;  1IYY A;  1B3S A;  3DY5 A;  3EBT A;  1GMQ A;  1OGZ A;  1T3B A;  1B20 A;  3NV0 A;  1QMA A;  2OTJ 3;  4MMX B;  1YHQ 3;  2QEX 3;  1LVN A;  3NM2 A;  1SJW A;  4AKZ A;  5TGN A;  1YI2 3;  4X2H A;  4ILF A;  5ELJ A;  2FNQ A;  1PFP A;  3VGN A;  2Z7A A;  1M9G A;  1OHO A;  1UCK A;  1SIH A;  1AY7 A;  4L8P A;  2LYX A;  4FR9 A;  3RNT A;  1BGS A;  1OCV A;  1HKX A;  1RN7 A;  2KF4 A;  1WMP A;  4N6M A;  3ZFZ A;  7GSP A;  3OXA A;  3CCU 3;  1C54 A;  4N6O B;  1DMM A;  1FW7 A;  1MGW A;  1W00 A;  2H0G A;  2XGL A;  4MEI A;  3Q1C A;  2BMR B;  1UUV B;  2J8X B;  1GOU A;  3NQZ A;  1L5G B;  3GZR A;  1Q81 4;  1OPY A;  3CXC 2;  3KCH A;  3MHE A;  3OX9 A;  3WOF B;  4MMY B;  3QRD A;  4JF8 A;  5LC6 A;  2I9W A;  2KF5 A;  2WOF A;  1GD4 A;  1AR0 A;  4OUQ A;  2GU3 A;  3LOY A;  5LC7 A;  4K61 A;  1HYF A;  5AEW B;  1BAO A;  3UL5 A;  1K8A 4;  2P0X A;  2CW9 A;  1OHP A;  2OTL 3;  2RSX A;  3MG3 A;  1I0X A;  1GOV A;  4FMD A;  3G8Z A;  1GSP A;  4HZ9 B;  3CU3 A;  1BU4 A;  1VQL 3;  1W01 A;  3S27 A;  2INX A;  5BXQ A;  1QAL A;  1E97 A;  1U5O A;  3BLZ A;  2W56 A;  2IA7 A;  3OV4 A;  2BMO B;  1UI8 A;  3V99 A;  4Q53 A;  1GD3 A;  1K73 4;  1BRK A;  3F7X A;  3LTA A;  4HM6 B;  4RNT A;  3CNX A;  1YGE A;  3RDE A;  1D6Z A;  1OGX A;  4AEQ A;  1K28 A;  2JDI H;  1S5A A;  3BND A;  3LYG A;  4FCJ A;  3B4O A;  4PEJ A;  1B2S A; 
#chains in the Genus database with same CATH homology
 3DGN A;  4RZM A;  3NQY A;  4J8T A;  5IG3 A;  1D6U A;  2YFL B;  1M90 4;  3BB9 A;  1EA2 A;  4EYC A;  4RNZ A;  2E2V A;  2GBX B;  2UX0 A;  1JN5 B;  5KP1 A;  1VQ4 3;  1M1X B;  3FG1 A;  3UL6 A;  3CCR 3;  1ASK A;  3S28 A;  3G0K A;  1FA3 A;  3ALA A;  4N6V 0;  5IG0 A;  3LTD A;  3CMA 3;  2BMQ B;  3CNM A;  1VQ5 3;  3IMA B;  1EQK A;  1OHS A;  2PZV A;  8CHO A;  1DVD A;  1Y4K A;  3OWU A;  3DGM A;  4ZM8 A;  1NJI 4;  1MNL A;  2P38 A;  3KFQ C;  3PCS A;  2YFJ B;  3KZT A;  4L7K A;  4R80 A;  3RGR A;  4HM7 B;  2CWU A;  1N9E A;  2M7O A;  3WOD G;  3H51 A;  4O3V A;  2P09 A;  4HBR A;  1IQX A;  1WMO A;  5AIF A;  4BTY A;  1RRH A;  1OF5 A;  3MWZ A;  3JVC A;  4JRF A;  4RNY A;  2GXF A;  3JUN A;  4U13 A;  3OWS A;  1SQW A;  3FH1 A;  3KN4 A;  2C10 A;  1JNQ A;  2XR8 B;  3VSY A;  3WDG B;  3BNC A;  2IMJ A;  4EV5 A;  2E2U A;  4HYZ A;  4EC6 A;  4R4K A;  1W7C A;  2BNG A;  1FGO A;  3KSE D;  3NM7 A;  4KVH A;  3KE7 A;  3MPH A;  3DUK A;  3EN1 B;  3NBJ A;  1K41 A;  4N6L A;  1NWW A;  4HM4 B;  1OH0 A;  2Z76 A;  3F7S A;  3Q90 A;  1N9J A;  1UUW B;  2C11 A;  1O7P B;  1TUH A;  2L4V A;  2XGN A;  3EBY A;  4OVM A;  5EVH A;  4WWU C;  2GEY A;  5BVB A;  3ECF A;  1WQL B;  1DYU A;  3MG1 A;  1EKM A;  5AI1 A;  4R9K A;  2LQV A;  1TFK A;  3G6E 3;  5ELU A;  2CWT A;  2XEP A;  3CCQ 3;  1EG9 B;  1WNH A;  3FSD A;  1O7G B;  2FXT A;  5G2G A;  2BHM A;  3TDG A;  4X2O A;  4R1K A;  4QWT A;  3FF2 A;  1IVU A;  1Q40 A;  3DM8 A;  1W6Y A;  3WMD A;  1A90 A;  1W6C A;  1KC8 4;  1JJ2 2;  2PNC A;  1OUN A;  3NUV A;  4IT7 A;  3GRD A;  4HM0 B;  3VF1 A;  3HZP A;  1QVF 2;  2WGO A;  4XM4 A;  3SX1 A;  2K54 A;  3CPO A;  5CF2 A;  3S5C A;  1LXE A;  2HMK B;  3SVA A;  5IER A;  2XH9 A;  1RRL A;  3NXJ A;  1IQY A;  3IJE B;  4KFE A;  2GU1 A;  2KXG A;  3WA3 A;  4XBX A;  3Q2P A;  1IDP A;  1FUW A;  3GZB A;  1BUQ A;  2HML B;  3EF8 A;  3ER7 A;  3F8H A;  3FCS B;  1Q42 A;  3K7C A;  1IK3 A;  3DXO A;  5STD A;  3STD A;  3LT9 A;  1VQO 3;  2QA4 3;  3NBR A;  4O2H A;  4WP5 A;  2OQE C;  3S67 A;  3HI7 A;  3EB8 A;  3PXM A;  1N5H A;  2CH9 A;  2A15 A;  1FGT A;  3FG4 A;  5A0O B;  4STD A;  1N8Q A;  4HM5 B;  2BT3 A;  1VZZ A;  3GAX A;  2XF3 A;  3U1W A;  3K5T A;  5D83 A;  5JBS A;  2HMM B;  1ULI B;  1US1 A;  3HK4 A;  5IEP A;  4FMC A;  1QVG 2;  5EEO A;  3WA2 X;  4EXR A;  2XFT A;  3WOE B;  1C7H A;  1KWI A;  3D9R A;  3NBB A;  4N6T A;  1YJW 3;  2Y74 A;  5IG4 A;  4N3V A;  2XSH B;  1FGM A;  1O7H B;  2CKF B;  4XBT A;  2OOV C;  5D81 A;  5AEU B;  2CK3 H;  1E3R A;  4MJD A;  4NHF A;  5CLK A;  1IQ8 A;  4I4K A;  3JUM A;  5KP3 A;  2OOV A;  3MYT A;  1GY7 A;  3MKI A;  3GZX B;  3KII A;  3SOY A;  1VQK 3;  3B4P A;  4KFD A;  1GS3 A;  4TX4 A;  3ROB A;  1AVL A;  1NU3 A;  2D42 A;  1QJG A;  1TP6 A;  3X40 A;  2W04 A;  1IVX A;  1KD1 4;  2F86 B;  4LGQ A;  1JB4 A;  1O7W B;  2GBW B;  4G1M B;  3CPW 2;  3DMC A;  4BTX A;  1M1K 4;  3EE1 A;  1N5P A;  5CF1 A;  1S72 3;  4BTW A;  3B7C A;  3N9H A;  2XFS A;  1W2B 2;  5DRV A;  1W02 A;  3QK9 A;  1CYV A;  5D82 A;  4CCV A;  3PS8 A;  5EQL A;  2HMJ B;  4HM3 B;  2V1L A;  1JN5 A;  2CFG A;  3F8X A;  1GYB A;  4FMB A;  3SXX A;  2W0Q A;  2CC3 A;  4H61 A;  5FGO A;  3V92 A;  2JQ5 A;  1JKG B;  4H3U A;  4FMA A;  1O7N B;  4LMI A;  3G16 A;  2Q07 A;  3X3Y A;  2F98 A;  5AYS C;  3V98 A;  4HM1 B;  1JRQ A;  4WYK A;  5DRE A;  3CCM 3;  1T5Y A;  1TU5 A;  3UJM A;  2CFD A;  1J2B A;  4IIA A;  1F8N A;  1VQN 3;  1W5Z A;  3IPT A;  3HIG A;  3PYJ A;  1ISK A;  1STD A;  2STD A;  2W9P A;  1OF5 B;  1VQ9 3;  3JUQ A;  1Q82 4;  5IEN A;  5CK6 A;  3EN8 A;  4R9L A;  2QGU A;  1ROA A;  3CC2 3;  1G96 A;  4HM8 B;  1TFO A;  4EBG A;  2MF7 A;  1D6Y A;  3PZW A;  3CCV 3;  3F9S A;  3I0Y A;  1IVW A;  3N54 B;  2SBL A;  3AMO A;  3MSO A;  3HII A;  1IT8 A;  2YFI B;  3GZY B;  3H3H A;  3O8Y A;  3LZA A;  3NV0 B;  3BNE A;  5JPU A;  1KQS 2;  3UB1 A;  1YIT 3;  2KRT A;  1AVK A;  1OAC A;  1IV9 A;  3DGL A;  3E99 A;  2CWV A;  4HM2 B;  3SLU A;  3B8L A;  5JPP A;  1IT7 A;  4WHA A;  3GWR A;  3A76 A;  5AIH A;  1Q40 B;  3F40 A;  1E3V A;  1AV4 A;  3SOA A;  5AII A;  2W6J H;  4LZI A;  3I56 3;  4J9A A;  4K1U A;  3FLJ A;  4XBY A;  1JV2 B;  2QIY A;  2OCT A;  1RKY A;  2GEX A;  5HGR A;  2RCD A;  3FZW A;  1QAF A;  2P05 A;  1A2V A;  1JB5 A;  3X41 A;  2CFL A;  4K90 B;  4OK0 A;  2F99 A;  3PGB A;  2IUJ A;  3KSP A;  4KZ1 A;  1NB3 I;  1Q7Y 4;  2FGT A;  5IF6 A;  5FW5 A;  3X42 A;  1K9M 4;  3CCJ 3;  1SII A;  1VQ8 3;  1VQ6 3;  1GY5 A;  2W56 B;  3UNL A;  5IW9 A;  1RJO A;  1YIJ 3;  1KSI A;  2CFK A;  4HJL B;  2ML5 A;  1QAK A;  2ZDJ A;  3M8C A;  3NHX A;  2CG1 A;  4N6N B;  2OQE A;  2CG0 A;  2O9U X;  4KFF A;  3J7Y d;  1YJ9 3;  3CCE 3;  1NO3 A;  3RGA A;  1FGQ A;  4AKY A;  1IU7 A;  4FCZ A;  3CC7 3;  1ZX2 A;  1VQM 3;  3JUO A;  1NDO B;  1O7M B;  2CFW A;  2RFR A;  1LNH A;  3K9M C;  3L0R A;  3LTB A;  3OWY A;  1PU4 A;  3NX0 A;  4O8S A;  2ZL8 A;  2D1W A;  4ORL A;  1FGR A;  1W6G A;  1IV7 A;  2XRX B;  1IVV A;  3F14 A;  2E2T A;  5AYR B;  4WFO A;  4MMZ B;  1DVC A;  3FG3 A;  4LEH A;  2Z6B A;  3CCS 3;  2WO0 A;  2BO9 B;  1ROV A;  1HU9 A;  3BNB A;  2B1X B;  4L8O A;  3N8B A;  1Z1S A;  1CEW I;  4LSO A;  5I97 A;  5IG5 A;  4HZB B;  1ZO2 A;  4K1V A;  3LML A;  3EC9 A;  1STF I;  1SPU A;  1U8C B;  4HVN A;  1WMN A;  4GB5 A;  1DMQ A;  3LXU X;  3FGY A;  4RBN A;  3KKG A;  3EHC A;  4NRE A;  3SED A;  3LTC A;  7STD A;  1V74 A;  2IUK A;  3JUP A;  3CC4 3;  3D3L A;  2CHC A;  3EJV A;  3PCR A;  2HMN B;  2P0M A;  2MC8 A;  4HKV B;  1R4C A;  3FKA A;  3OW2 2;  4XB5 A;  3X3X A;  2XSO B;  2K0M A;  5KP4 A;  3T0U A;  3X3Z A;  3EQQ B;  3G71 3;  1CQS A;  1YVB I;  1Q86 4;  2W9Q A;  3U97 A;  3G4S 3;  3LT8 A;  4N6U A;  3T8N A;  3DZL A;  4O02 B;  1ULJ B;  2WOH A;  1JKG A;  1UI7 A;  1WTH A;  3K63 A;  2R4I A;  2O3O A;  3HX8 A;  2HMO B;  2W03 A;  3FF0 A;  1DMN A;  4WYK B;  3DGO A;  1UW1 A;  2CIU A;  2KCD A;  3CME 3;  2ML6 A;  5CXO A;  1W4N A;  3EX9 A;  5AIG A;  1JB2 A;  1A2K A;  4GL6 A;  4CDL A;  4IPB A;  2RGQ A;  3MG2 A;  1GY6 A;  3CCL 3;  1VQ7 3;  1NB5 I;  2B24 B;  3CD6 3;  1N8R 4;  1MOL A;  2Z77 A;  3LH4 A;  1W2Z A;  5IEO A;  4XDV A;  1YJN 3;  1LOX A;  3S29 A;  6STD A;  4XDW A;  1CYU A;  1A67 A;  2W2C A;  1TIJ A;  3T8U A;  4EV2 A;  2YX9 A;  3I55 3;  3K0Z A;  3AMO B;  2WGQ A;  4FCM A;  1VQP 3;  2OWP A;  2Y73 A;  3DY5 A;  3EBT A;  1OGZ A;  3NV0 A;  1QMA A;  2OTJ 3;  4MMX B;  1YHQ 3;  2QEX 3;  1LVN A;  3NM2 A;  1SJW A;  4AKZ A;  5TGN A;  1YI2 3;  4X2H A;  5ELJ A;  2FNQ A;  1PFP A;  3VGN A;  2Z7A A;  1M9G A;  1OHO A;  1SIH A;  4L8P A;  2LYX A;  4FR9 A;  1OCV A;  1HKX A;  1RN7 A;  4N6M A;  1WMP A;  3OXA A;  3CCU 3;  4N6O B;  1DMM A;  1W00 A;  2XGL A;  4MEI A;  3Q1C A;  2BMR B;  1UUV B;  3NQZ A;  1L5G B;  3GZR A;  1Q81 4;  1OPY A;  3CXC 2;  3MHE A;  3OX9 A;  3WOF B;  4MMY B;  3QRD A;  4JF8 A;  5LC6 A;  2I9W A;  2WOF A;  1GD4 A;  1AR0 A;  4OUQ A;  2GU3 A;  3LOY A;  5LC7 A;  4K61 A;  5AEW B;  1K8A 4;  3UL5 A;  2P0X A;  2CW9 A;  1OHP A;  2OTL 3;  2RSX A;  3MG3 A;  4FMD A;  3G8Z A;  4HZ9 B;  3CU3 A;  1VQL 3;  1W01 A;  3S27 A;  2INX A;  5BXQ A;  1QAL A;  1E97 A;  1U5O A;  3BLZ A;  2W56 A;  2IA7 A;  3OV4 A;  2BMO B;  1UI8 A;  3V99 A;  4Q53 A;  1GD3 A;  1K73 4;  4HM6 B;  3F7X A;  3LTA A;  3CNX A;  1YGE A;  3RDE A;  1D6Z A;  1OGX A;  4AEQ A;  1K28 A;  2JDI H;  1S5A A;  3BND A;  3LYG A;  4FCJ A;  3B4O A;  4PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...