1ULJB

Biphenyl dioxygenase (bpha1a2) in complex with the substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
177
structure length
177
Chain Sequence
FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords biphenyl dioxygenase large subunit
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
source organism Rhodococcus sp.
total genus 51
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uljB00
4J8TA 4H3UA 2BNGA 1ISKA 3F9SA 3OX9A 2W2CA 3B8LA 5BVBA 3VGNA 7STDA 3Q90A 1OHPA 1ULJB 5AIIA 3VSYA 2GBXB 3EQQB 2HMKB 1OGZA 1STDA 3ROBA 4HM6B 1OHSA 4STDA 5EVHA 1OCVA 5IEOA 1EG9B 3RGRA 3DM8A 3EN8A 5DREA 2OWPA 1IDPA 3G16A 5IG0A 1GYBA 4HM5B 6STDA 4L8OA 3KSPA 4HM8B 2XSHB 3H3HA 1JB5A 1ZO2A 3EHCA 3WMDA 1OF5A 4GB5A 3F7XA 1U5OA 3F40A 1GY7A 3EN1B 5KP1A 2XR8B 1O7HB 2A15A 3BB9A 3EC9A 5KP3A 1NU3A 5JPUA 5KP4A 3GWRA 1K41A 4Q53A 1O7GB 3EX9A 3CNXA 3FKAA 1QJGA 2BMQB 3JUOA 4XDVA 3KZTA 4MJDA 3MKIA 4I4KA 3NUVA 2YFLB 1Z1SA 3EBTA 3MSOA 4XB5A 4FCMA 2YFIB 1UUVB 1WQLB 3JUMA 1C7HA 4K1VA 3EJVA 5IENA 2QIYA 1W02A 4HM1B 3D9RA 1NWWA 3KE7A 4LGQA 3F8HA 1JB2A 4X2OA 4R9LA 1JKGA 5D81A 4PEJA 1VZZA 1UUWB 3I0YA 2F98A 4WP5A 3OWYA 2F99A 2BMOB 4HZBB 2HMOB 1S5AA 5AEWB 4HJLB 3F8XA 1ASKA 3GZXB 1GY5A 3GZBA 8CHOA 4OVMA 4XDWA 5IG3A 4R9KA 3NM2A 4HVNA 3HX8A 4FCJA 1AR0A 3G8ZA 3STDA 3MG2A 5TGNA 3A76A 2GBWB 3FLJA 3DUKA 3LZAA 1OGXA 3HK4A 3FGYA 5AIGA 1E3VA 3OWUA 3E99A 1DMQA 3T8NA 3B4PA 1E3RA 1ULIB 4LEHA 1E97A 2PZVA 1A2KA 1BUQA 1EA2A 3DXOA 4XBXA 3EBYA 4R1KA 2I9WA 4XBTA 5CLKA 3MYTA 3UNLA 2HMLB 4HM2B 1GS3A 1TUHA 1OF5B 3M8CA 3S5CA 5IG5A 1OH0A 1OHOA 3SOAA 5BXQA 4XBYA 3H51A 5FW5A 1DMNA 3T8UA 2Z76A 3FF2A 4HM0B 1O7MB 3K7CA 3JUQA 4J9AA 2R4IA 5AI1A 5AIHA 1DMMA 2QGUA 4KVHA 3FF0A 3NHXA 4L8PA 3B4OA 3HZPA 4L7KA 3F14A 4OUQA 5G2GA 1O7WB 3MG3A 3FZWA 2YFJB 3CNMA 5IF6A 3GZYB 3DZLA 2F86B 4XM4A 3OV4A 5IEPA 1GY6A 5DRVA 1OUNA 2RGQA 1SJWA 1NDOB 1O7NB 1ZX2A 2IMJA 5CK6A 3NBRA 4K1UA 3JUPA 1JKGB 2XRXB 5IG4A 5CF1A 1W01A 1Q40A 1OPYA 4ORLA 2BMRB 5D83A 2Z7AA 2INXA 4X2HA 4HZ9B 3KKGA 4IIAA 3G0KA 5D82A 4HM3B 1JN5A 3UJMA 5HGRA 1W6YA 3GRDA 4RZMA 1TP6A 3ER7A 1O7PB 3RGAA 2CHCA 4HM4B 1QMAA 2HMNB 4HKVB 3MHEA 1Q40B 5CF2A 2STDA 2RCDA 2GEYA 1W00A 3F7SA 2HMJB 3DMCA 4U13A 2XSOB 2Z77A 3NV0A 1JN5B 5AIFA 3SOYA 2GEXA 3CPOA 4WWUC 3LYGA 3SEDA 3JUNA 3NXJA 5JPPA 3OXAA 3BLZA 3EF8A 5CXOA 3GZRA 5AEUB 2CKFB 3K0ZA 4HM7B 4WYKA 2RFRA 4CDLA 3FH1A 2GXFA 2B24B 5IERA 1CQSA 3FSDA 2B1XB 3NV0B 5STDA 3IPTA 3OWSA 3B7CA 3CU3A 2JQ5A 1JB4A 2HMMB 2UX0A 1HKXA 4LMIA 3MG1A 2K54A 4N3VA 1Q42A 4WYKB 3ECFA
chains in the Genus database with same CATH superfamily
2IUJA 3Q1CA 4J8TA 4H3UA 2BNGA 2CFLA 1ISKA 1SARA 2HOHA 3D79A 3AGOA 3F9SA 1RJOA 3OX9A 2W2CA 3B8LA 4KT3B 1QAKA 1SQWA 5BVBA 1IV7A 3S29A 4R80A 1RHLA 3VGNA 5M19A 2CIUA 3FG4A 7STDA 1Q9EA 3Q90A 1OHPA 1ULJB 5AIIA 3VSYA 3BNCA 2GBXB 5M18A 1VQ63 3Q2PA 3WR2A 3RNTA 2YX9A 3EQQB 3PCRA 3CCQ3 1VQL3 5IW9A 1JZOA 5LC7A 2HMKB 1STDA 1OGZA 1FUTA 4HM6B 1OHSA 3ROBA 2KF5A 4STDA 5EVHA 1LOVA 1FGMA 2D1WA 2ZA4A 1B21A 2H0GA 1BANA 4FMAA 1OCVA 5IEOA 1EG9B 2KF3A 1PFPA 1MWSA 1I0VA 1TRPA 4R4KA 3X3XA 2CC3A 5G1LA 3RGRA 3DM8A 4N6UA 1IYYA 3EN8A 3UL6A 2CX1A 5DREA 1BVIA 1STFI 3DGNA 3URPA 2OWPA 1IDPA 2FGTA 1RN7A 2CW9A 1EEJA 1ZGXA 2H0IA 3G16A 4RNTA 1RCKA 1EQKA 5IG0A 1GYBA 4HM5B 4EXRA 1RGAA 1WMOA 1YI23 4N6LA 6STDA 5IF6A 1IT8A 1WNHA 4L8OA 3CXC2 2BIRA 1W5ZA 1FA3A 1BNFA 2CFDA 5LC6A 1BSAA 1A2VA 2MC8A 4RNZA 2P09A 3KSPA 3X42A 1X1XA 2P0XA 3MWZA 6GSPA 4OK0A 2XF3A 7GSPA 2L4VA 2O9UX 4HM8B 3NQYA 1TFOA 2XSHB 1UGHI 1YGWA 4AEQA 1UI7A 3GAXA 3SXXA 3H3HA 1UGIA 8RNTA 1LXEA 3NM7A 1JB5A 1ZO2A 1YIJ3 3EHCA 3WMDA 1OF5A 4GB5A 1TFKA 3PZWA 3DGMA 3SX1A 4LSOA 3F7XA 1R4YA 1U5OA 2OOVA 2P05A 1IQ8A 3CME3 3F40A 3X3YA 3KFQC 1GY7A 1GSPA 3EN1B 5KP1A 1QVG2 1JV2B 2XR8B 3KCHA 5G1KA 4ILFA 1O7HB 2A15A 2LQVA 2XGNA 3LTAA 3BB9A 3LTDA 3EC9A 3PXMA 1RDSA 4FCZA 5KP3A 1NU3A 5JPUA 4GL6A 5KP4A 1RMSA 2BO9B 1MGWA 2XFTA 1GMQA 1M9GA 1Q864 2F56A 1RNBA 3GWRA 3AMOA 1K41A 2RSXA 1BNGA 2E2UA 1YIT3 1ROVA 1HYFA 1UI8A 4Q53A 1O7GB 2GU3A 5A0OB 3CCU3 1Q7Y4 6RNTA 4DKIA 3EX9A 3CNXA 3FKAA 4N6TA 1QJGA 1RGCA 2BMQB 3JUOA 1KC84 1AQZA 4XDVA 3CCV3 3KZTA 1RRLA 4MJDA 3MKIA 1BSBA 1BRNL 1SPUA 2RNTA 1I3FA 5ELUA 4I4KA 3NUVA 2XFSA 2YFLB 1Z1SA 3QK9A 3EBTA 3MSOA 4ZM8A 1JBSA 4XB5A 1QVF2 4FCMA 3Q3FA 1M904 2YFIB 2E2TA 1ZS7A 2V1LA 1UUVB 1RGKA 1B2ZA 1C7HA 1WQLB 2D42A 3JUMA 4K1VA 2OOVC 5EQLA 3EJVA 3K5TA 4CCVA 5IENA 2QIYA 2QA43 3AMOB 3UL5A 4AKZA 1W02A 7RNTA 3UB1A 4HM1B 4JF8A 1QALA 1NWWA 1D6YA 1WMNA 2M7OA 3D9RA 3KE7A 3CCL3 4LGQA 1IVVA 2OCTA 1JB2A 3F8HA 3N8BA 3NX0A 4NPBA 1JKGA 4R9LA 1BSCA 4X2OA 5D81A 3TDGA 1VQN3 3NBJA 1Q814 1T5YA 1JNQA 1C54A 4PEJA 1VZZA 1Y4KA 1X1WA 3LH4A 1UUWB 1D6UA 1UCIA 2Y74A 2MF7A 3I0YA 2F98A 2KF4A 1RKYA 1K734 2IYJA 4GSPA 4WP5A 4CJNA 1I3IA 3OWYA 4LZIA 5GSPA 2F99A 2ML5A 4WFOA 2BMOB 4HZBB 1G02A 2HMOB 2CG1A 1S5AA 3NQZA 5AEWB 4HJLB 4K90B 2Z6BA 3F8XA 1NB5I 1UUGB 1ASKA 1IVUA 1YNVX 2L1SA 3GZXB 1GY5A 3CCS3 3GZBA 3JVCA 8CHOA 4OVMA 3WA3A 2ZDJA 1MGRA 4XDWA 5IG3A 3LOYA 1N9JA 4R9KA 1L5GB 2WGQA 2UGIA 3NM2A 2OTL3 3CC43 1RLSA 3AGNA 3ZG0A 4HVNA 1VQP3 4BTXA 1S723 4N6V0 1TU5A 2C10A 3HX8A 2XGLA 3G6E3 1R4CA 1AY7A 4FCJA 1AR0A 3LTCA 1JJ22 1LRAA 3G8ZA 1BRJA 1BNJA 4FMBA 3WA2X 3ZFZA 1BU4A 3STDA 2P38A 1BRIA 1RGHA 3MG2A 2BT3A 4FR9A 5TGNA 1MWUA 1N5PA 3A76A 1FW7A 2GBWB 3FLJA 3DUKA 4O02B 5EEOA 1TTOA 3VF1A 1BRGA 3LZAA 1OGXA 1NJI4 3HK4A 3FGYA 1FGQA 1GMPA 1IT7A 1FGTA 2W9QA 1E3VA 3OWUA 3E99A 5AIGA 1US1A 1M1K4 1LOXA 1RSNA 1DMQA 2W6JH 1LQMB 1LVNA 2GSPA 3DGYA 3EE1A 3WHOA 3T8NA 1FGRA 1GOVA 1TIJA 4MMZB 3B4PA 5AYRB 3BU4A 1E3RA 1N8QA 4JRFA 1ULIB 1K8A4 1YHQ3 1IU7A 4LEHA 1E97A 4IT7A 3CC23 1T2HA 1RCLA 1W6GA 2JDIH 2PZVA 4N6MA 2CK3H 2OTJ3 1A2KA 1IQYA 1W6CA 1BUQA 1EA2A 3WDGB 3DXOA 4XBXA 3LTBA 1BIRA 1W2B2 1DE3A 2KCDA 3EBYA 1VQQA 3K63A 3D5GA 1RGGA 1UDII 1YVBI 1BNIA 1LOWA 2CFGA 4EBGA 4J5GA 4R1KA 2I9WA 4XBTA 2F5WA 4HBRA 3LXUX 4KFFA 1QAFA 5CLKA 1K28A 2KAAA 3MYTA 2CFWA 3UNLA 2HMLB 1JBTA 5HOHA 3HI7A 4HM2B 3WOFB 1GS3A 1VQ43 1IVXA 1V58A 3V99A 4QWTA 1TUHA 3N54B 1VQ93 1GOYA 1OF5B 3M8CA 4FMCA 2XH9A 3S5CA 5IG5A 3J7Yd 1WMPA 1OH0A 1OHOA 3HIGA 1DETA 1LNHA 1W4NA 3N9HA 3SOAA 3SYUA 5BXQA 3G713 4XBYA 2K3DA 1MNLA 1OACA 1FZUA 3H51A 1CYVA 4WHAA 5FW5A 1DMNA 1GMRA 1RGLA 2J8XB 3T8UA 2Z76A 4BL3A 4EC6A 3FF2A 4HM0B 4O8SA 3S27A 9RNTA 1KWIA 2W56A 1O7MB 3K7CA 1M1XB 1VQO3 1K9M4 2CH9A 3AHSA 3JUQA 4J9AA 2R4IA 2WOHA 3EB8A 1DMMA 5AI1A 5AIHA 3LT9A 3L0RA 5RNTA 1N8R4 4HOHA 4MMYB 1F8NA 3S28A 4G1MB 2QGUA 4RBNA 4BTWA 3LMLA 4IPBA 4KVHA 2CWUA 1B20A 1UCKA 2W03A 3FF0A 3WOEB 3PCSA 1UCJA 3NHXA 2CWVA 3SLUA 1RNTA 2QEX3 1I2EA 4L8PA 3B4OA 3HZPA 4L7KA 1Q7HA 1SIIA 3F14A 4OUQA 1A90A 1W7CA 1YJW3 3O8YA 5G2GA 1O7WB 1I2FA 1VQ83 2KXGA 3GSPA 1IQXA 3MG3A 1B2SA 4N6OB 5BU4A 3S67A 2KRTA 3FZWA 4BTYA 3DGLA 3FG3A 1PU4A 2YFJB 3CNMA 1MOLA 1EKMA 4AKYA 1GOUA 4KFDA 1WTHA 1TRQA 1ROAA 3GZYB 3DZLA 4O2HA 2F86B 4XM4A 3V92A 4KZ1A 2W56B 2K0MA 3D4AA 2FNQA 2WGOA 2C11A 3ALAA 3ZG5A 2SARA 1FGOA 3OV4A 5IEPA 1GY6A 3IJEB 1MWRA 4NREA 5DRVA 1OUNA 1B27A 1HU9A 2RGQA 1SJWA 1NDOB 1O7NB 1ZX2A 2W04A 2IMJA 3HIIA 5CK6A 1FYSA 2WOFA 1SIHA 3OW22 1BSDA 3NBRA 1BRHA 5ELJA 1B2MA 4K1UA 1N9EA 3JUPA 3U1WA 1JKGB 3LT8A 1YJ93 2XRXB 2CG0A 1I0XA 5IG4A 1Q824 3RDEA 3MPHA 3FG1A 5CF1A 1W01A 1NB3I 1Q40A 4TX4A 1UCLA 1V74A 1OPYA 2CWTA 2GU1A 3DGOA 4ORLA 2BMRB 3X40A 4EW5A 3FCSB 5D83A 2Z7AA 1BRSA 2INXA 4HZ9B 4X2HA 1LOYA 3CCR3 1RTUA 3KKGA 3X3ZA 3CD63 3PS8A 4N6NB 4H61A 1VQM3 4IIAA 1B2UA 1CEWI 3BNDA 2KF6A 1YJN3 3G0KA 3D3LA 1NNVA 5AYSC 1PYLA 1BGSA 2CFKA 2ML6A 5D82A 4HM3B 3V98A 4O3VA 3BNEA 3KSED 2F4YA 1JN5A 1G96A 2LYXA 2CX0A 3UJMA 5HGRA 1W6YA 2FXTA 3U97A 3AHWA 3HOHA 1D6ZA 3GRDA 1N5HA 1TP6A 2ZHXB 3ER7A 4J5KA 4RZMA 1KQS2 3KIIA 1CH0A 1O7PB 3IMAB 3PYJA 3G4S3 3RGAA 3CC73 4EV5A 1YVSA 2CHCA 1I8VA 4HM4B 1QMAA 2HMNB 3DY5A 3CCE3 1IVWA 3CCJ3 1X1YA 1YGEA 4HKVB 1BSEA 3MHEA 4HYZA 1VQ73 1U8CB 3BIRA 1Q40B 1J2BA 5CF2A 1DYUA 1V57A 2STDA 4HAAA 4GHOA 1IV9A 3CPW2 2RCDA 2C4BA 2GEYA 1W00A 2E2VA 3F7SA 3X41A 3WODG 1VQK3 1JRQA 1FUWA 2HMJB 4I5QA 3DMCA 2SBLA 2W9PA 1G0TA 2ZL8A 1AVKA 1A67A 4U13A 2IUKA 2XSOB 2OQEA 2Z77A 3KN4A 3NV0A 4BL2A 2RBIA 1JN5B 1AV4A 5AIFA 4BU4A 3SOYA 2GEXA 3CPOA 2AADA 3I563 4WWUC 3BNBA 3LYGA 1VQ53 1NO3A 3D5IA 3SEDA 3JUNA 3NXJA 2AAEA 5JPPA 3OXAA 1RN4A 2O3OA 3BLZA 5BIRA 1HZ1A 4BIRA 3EF8A 1W2ZA 1T2IA 3GZRA 2CKFB 5CXOA 5AEUB 4K61A 1BUJA 3K0ZA 4MEIA 4HM7B 2R41A 2F5MA 1I70A 3QRDA 1X1UA 1GD4A 5M1AA 1TJDA 4WYKA 2RFRA 2W0QA 1I2GA 4CDLA 3I553 1BAOA 3FH1A 2GXFA 1A2PA 1MWTA 1GD3A 2B24B 1BNRA 3K9MC 1AVLA 5IERA 2Y73A 1PY3A 2Q07A 2XEPA 1DVDA 1CQSA 3FSDA 1UW1A 2B1XB 3NV0B 5STDA 1KSIA 3IPTA 1RGEA 4CPKA 3OWSA 1BOXA 2IY2A 1BNEA 1BRKA 1JZDA 3B7CA 3CCM3 1CYUA 3CU3A 1KD14 1DVCA 2JQ5A 4EV2A 1JB4A 2HMMB 2UX0A 3DH2A 4RNYA 1JBRA 1EUIC 1LQGC 1HKXA 1RRHA 1LNIA 4LMIA 4FMDA 2OQEC 5JBSA 3A5EA 1FUSA 1RN1A 1IK3A 3MG1A 2H0HA 2WO0A 4NHFA 2K54A 4EYCA 1RGFA 2PNCA 5I97A 4MMXB 2P0MA 4LYLB 3SVAA 1BNSA 3T0UA 3PGBA 2BU4A 4N3VA 1Q42A 2BHMA 4WYKB 1T3BA 1B2XA 2UUGC 2IA7A 5FGOA 3ECFA 3CMA3 3NBBA 1B3SA 4KFEA
chains in the Genus database with same CATH topology
2IUJA 3Q1CA 4J8TA 4H3UA 2BNGA 2CFLA 1ISKA 3F9SA 1RJOA 3OX9A 2W2CA 3B8LA 1QAKA 1SQWA 5BVBA 1IV7A 3S29A 4R80A 3VGNA 2CIUA 3FG4A 7STDA 3Q90A 1OHPA 1ULJB 5AIIA 3VSYA 3BNCA 2GBXB 1VQ63 3Q2PA 2YX9A 3EQQB 3PCRA 3CCQ3 1VQL3 5IW9A 5LC7A 2HMKB 1OGZA 1STDA 4HM6B 3ROBA 1OHSA 4STDA 5EVHA 2D1WA 1FGMA 4FMAA 1OCVA 5IEOA 1EG9B 1PFPA 4R4KA 3X3XA 2CC3A 3RGRA 3DM8A 4N6UA 3EN8A 3UL6A 5DREA 1STFI 3DGNA 2OWPA 1IDPA 2FGTA 1RN7A 2CW9A 3G16A 1EQKA 5IG0A 1GYBA 4HM5B 4EXRA 1WMOA 1YI23 4N6LA 6STDA 1IT8A 1WNHA 4L8OA 3CXC2 1W5ZA 1FA3A 2CFDA 5LC6A 1A2VA 2MC8A 4RNZA 2P09A 3KSPA 3X42A 2P0XA 3MWZA 4OK0A 2XF3A 2L4VA 2O9UX 4HM8B 3NQYA 1TFOA 2XSHB 4AEQA 1UI7A 3GAXA 3SXXA 3H3HA 1LXEA 3NM7A 1JB5A 1ZO2A 1YIJ3 3EHCA 3WMDA 1OF5A 4GB5A 1TFKA 3PZWA 3DGMA 3SX1A 4LSOA 3F7XA 1U5OA 2OOVA 2P05A 1IQ8A 3CME3 3F40A 3X3YA 3KFQC 1GY7A 3EN1B 5KP1A 1QVG2 1JV2B 2XR8B 2XGNA 1O7HB 2A15A 2LQVA 3LTAA 3BB9A 3LTDA 3EC9A 3PXMA 4FCZA 4KFEA 5KP3A 1NU3A 5JPUA 4GL6A 5KP4A 2BO9B 2XFTA 1M9GA 1Q864 3GWRA 3AMOA 1K41A 2RSXA 2E2UA 1YIT3 1ROVA 1UI8A 4Q53A 1O7GB 2GU3A 5A0OB 3CCU3 1Q7Y4 3EX9A 3CNXA 3FKAA 4N6TA 1QJGA 2BMQB 3JUOA 1KC84 4XDVA 3CCV3 3KZTA 1RRLA 4MJDA 3MKIA 1SPUA 5ELUA 4I4KA 3NUVA 2XFSA 2YFLB 1Z1SA 3QK9A 3EBTA 3MSOA 4ZM8A 4XB5A 1QVF2 4FCMA 1M904 2YFIB 2E2TA 2V1LA 1UUVB 1WQLB 2D42A 1C7HA 3JUMA 4K1VA 2OOVC 5EQLA 3EJVA 3K5TA 4CCVA 5IENA 2QIYA 2QA43 3AMOB 3UL5A 4AKZA 1W02A 3UB1A 4HM1B 4JF8A 1QALA 1NWWA 1D6YA 1WMNA 2M7OA 3D9RA 3KE7A 3CCL3 4LGQA 1IVVA 2OCTA 1JB2A 3F8HA 3N8BA 3NX0A 4R9LA 1JKGA 4X2OA 3TDGA 5D81A 1VQN3 3NBJA 1Q814 1T5YA 1JNQA 4PEJA 1VZZA 1Y4KA 3LH4A 1UUWB 1D6UA 3I0YA 2Y74A 2MF7A 1RKYA 2F98A 1K734 4WP5A 3OWYA 4LZIA 2F99A 2ML5A 4WFOA 2BMOB 4HZBB 2HMOB 2CG1A 1S5AA 3NQZA 5AEWB 4HJLB 4K90B 2Z6BA 3F8XA 1NB5I 1ASKA 1IVUA 3GZXB 1GY5A 3CCS3 3GZBA 3JVCA 8CHOA 4OVMA 3WA3A 2ZDJA 4XDWA 5IG3A 3LOYA 1N9JA 4R9KA 1L5GB 2WGQA 3NM2A 2OTL3 3CC43 1VQP3 4HVNA 4BTXA 1S723 4N6V0 1TU5A 2C10A 3HX8A 2XGLA 3G6E3 1R4CA 4FCJA 1AR0A 3LTCA 1JJ22 3G8ZA 4FMBA 3WA2X 3STDA 2P38A 3MG2A 2BT3A 4FR9A 5TGNA 1N5PA 3A76A 2GBWB 3FLJA 3DUKA 4O02B 5EEOA 3VF1A 3LZAA 1OGXA 1NJI4 3HK4A 3FGYA 1FGQA 2W9QA 1IT7A 1FGTA 5AIGA 1E3VA 3OWUA 3E99A 1US1A 1M1K4 1LOXA 1DMQA 2W6JH 1LVNA 3EE1A 3T8NA 1FGRA 4MMZB 1TIJA 3B4PA 5AYRB 1E3RA 1N8QA 4JRFA 1ULIB 1K8A4 1YHQ3 1IU7A 4LEHA 1E97A 4IT7A 3CC23 1W6GA 2JDIH 2PZVA 4N6MA 2OTJ3 2CK3H 1A2KA 1IQYA 1W6CA 1BUQA 1EA2A 3WDGB 3DXOA 4XBXA 3LTBA 1W2B2 2KCDA 3EBYA 3K63A 2CFGA 1YVBI 4EBGA 4R1KA 2I9WA 4XBTA 4HBRA 3LXUX 4KFFA 1QAFA 5CLKA 1K28A 3MYTA 2CFWA 3UNLA 2HMLB 3HI7A 4HM2B 3WOFB 1GS3A 1VQ43 1IVXA 3V99A 4QWTA 1TUHA 3N54B 1VQ93 1OF5B 3M8CA 4FMCA 2XH9A 3S5CA 5IG5A 3J7Yd 1WMPA 1OH0A 1OHOA 3HIGA 1LNHA 1W4NA 3N9HA 3SOAA 5BXQA 3G713 4XBYA 1MNLA 1OACA 3H51A 1CYVA 5FW5A 1DMNA 3T8UA 4EC6A 2Z76A 3FF2A 4HM0B 4O8SA 3S27A 1KWIA 2W56A 1O7MB 3K7CA 1M1XB 1VQO3 1K9M4 2CH9A 3JUQA 4J9AA 2R4IA 2WOHA 3EB8A 1DMMA 5AI1A 5AIHA 3LT9A 3L0RA 1N8R4 4MMYB 1F8NA 3S28A 4G1MB 2QGUA 4RBNA 3LMLA 4IPBA 4KVHA 2CWUA 2W03A 3FF0A 3WOEB 3PCSA 3NHXA 2CWVA 3SLUA 2QEX3 4L8PA 3B4OA 3HZPA 4L7KA 1SIIA 3F14A 4OUQA 1A90A 1W7CA 1YJW3 3O8YA 5G2GA 1O7WB 1VQ83 2KXGA 1IQXA 3MG3A 4N6OB 3S67A 2KRTA 3FZWA 4BTYA 3DGLA 3FG3A 1PU4A 2YFJB 3CNMA 1MOLA 1EKMA 4AKYA 4KFDA 5IF6A 1WTHA 3GZYB 1ROAA 4O2HA 3DZLA 3V92A 2F86B 4XM4A 4KZ1A 2W56B 2K0MA 2FNQA 2WGOA 2C11A 3ALAA 1FGOA 3OV4A 5IEPA 1GY6A 3IJEB 5DRVA 4NREA 1OUNA 2RGQA 1HU9A 4WHAA 1SJWA 1NDOB 1O7NB 1ZX2A 2W04A 2IMJA 3HIIA 5CK6A 2WOFA 1SIHA 3OW22 3NBRA 5ELJA 4K1UA 1N9EA 3JUPA 3U1WA 1JKGB 3LT8A 1YJ93 2XRXB 2CG0A 5IG4A 1Q824 3RDEA 3MPHA 3FG1A 5CF1A 1W01A 1NB3I 1Q40A 4TX4A 3X40A 1V74A 1OPYA 2CWTA 2GU1A 3DGOA 4ORLA 2BMRB 3FCSB 5D83A 2Z7AA 2INXA 4HZ9B 4X2HA 3CCR3 3KKGA 3X3ZA 3CD63 3PS8A 4N6NB 4H61A 1VQM3 4IIAA 1CEWI 3BNDA 1YJN3 3G0KA 3D3LA 3V98A 5AYSC 2CFKA 2ML6A 5D82A 4HM3B 4O3VA 3BNEA 3KSED 1JN5A 1G96A 2LYXA 3UJMA 5HGRA 1W6YA 2FXTA 3U97A 1D6ZA 3GRDA 1N5HA 1TP6A 3ER7A 4RZMA 1KQS2 3KIIA 1O7PB 3IMAB 3PYJA 3G4S3 3RGAA 3CC73 4EV5A 2CHCA 4HM4B 1QMAA 2HMNB 3DY5A 3CCE3 1IVWA 3CCJ3 1YGEA 4HKVB 3MHEA 4HYZA 1VQ73 1U8CB 1Q40B 1J2BA 5CF2A 1DYUA 2STDA 1IV9A 3CPW2 2RCDA 2GEYA 1W00A 2E2VA 3F7SA 3X41A 3WODG 1VQK3 1JRQA 1FUWA 2HMJB 3DMCA 2SBLA 2W9PA 2ZL8A 1A67A 1AVKA 4U13A 2IUKA 2XSOB 2OQEA 2Z77A 3KN4A 3NV0A 1JN5B 1AV4A 5AIFA 3SOYA 2GEXA 3CPOA 3I563 1VQ53 4WWUC 3BNBA 3LYGA 1NO3A 3SEDA 3JUNA 3NXJA 5JPPA 3OXAA 2O3OA 3BLZA 3EF8A 1W2ZA 3GZRA 5CXOA 2CKFB 5AEUB 4K61A 3K0ZA 4MEIA 4HM7B 3QRDA 1GD4A 4WYKA 2RFRA 2W0QA 4CDLA 3I553 3FH1A 2GXFA 1GD3A 2B24B 3K9MC 1AVLA 5IERA 2Y73A 2Q07A 2XEPA 1DVDA 1CQSA 3FSDA 1UW1A 2B1XB 3NV0B 5STDA 1KSIA 3IPTA 3OWSA 3B7CA 3CCM3 1CYUA 3CU3A 1KD14 1DVCA 2JQ5A 4EV2A 1JB4A 2HMMB 2UX0A 4RNYA 1HKXA 1RRHA 4LMIA 4FMDA 2OQEC 5JBSA 1IK3A 3MG1A 2WO0A 4NHFA 5I97A 2K54A 4EYCA 2PNCA 4MMXB 2P0MA 3SVAA 3T0UA 3PGBA 4N3VA 1Q42A 2BHMA 4WYKB 2IA7A 5FGOA 3ECFA 3CMA3 3NBBA 4BTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8T A;  4H3U A;  2BNG A;  1ISK A;  3F9S A;  3OX9 A;  2W2C A;  3B8L A;  5BVB A;  3VGN A;  7STD A;  3Q90 A;  1OHP A;  1ULJ B;  5AII A;  3VSY A;  2GBX B;  3EQQ B;  2HMK B;  1OGZ A;  1STD A;  3ROB A;  4HM6 B;  1OHS A;  4STD A;  5EVH A;  1OCV A;  5IEO A;  1EG9 B;  3RGR A;  3DM8 A;  3EN8 A;  5DRE A;  2OWP A;  1IDP A;  3G16 A;  5IG0 A;  1GYB A;  4HM5 B;  6STD A;  4L8O A;  3KSP A;  4HM8 B;  2XSH B;  3H3H A;  1JB5 A;  1ZO2 A;  3EHC A;  3WMD A;  1OF5 A;  4GB5 A;  3F7X A;  1U5O A;  3F40 A;  1GY7 A;  3EN1 B;  5KP1 A;  2XR8 B;  1O7H B;  2A15 A;  3BB9 A;  3EC9 A;  5KP3 A;  1NU3 A;  5JPU A;  5KP4 A;  3GWR A;  1K41 A;  4Q53 A;  1O7G B;  3EX9 A;  3CNX A;  3FKA A;  1QJG A;  2BMQ B;  3JUO A;  4XDV A;  3KZT A;  4MJD A;  3MKI A;  4I4K A;  3NUV A;  2YFL B;  1Z1S A;  3EBT A;  3MSO A;  4XB5 A;  4FCM A;  2YFI B;  1UUV B;  1WQL B;  3JUM A;  1C7H A;  4K1V A;  3EJV A;  5IEN A;  2QIY A;  1W02 A;  4HM1 B;  3D9R A;  1NWW A;  3KE7 A;  4LGQ A;  3F8H A;  1JB2 A;  4X2O A;  4R9L A;  1JKG A;  5D81 A;  4PEJ A;  1VZZ A;  1UUW B;  3I0Y A;  2F98 A;  4WP5 A;  3OWY A;  2F99 A;  2BMO B;  4HZB B;  2HMO B;  1S5A A;  5AEW B;  4HJL B;  3F8X A;  1ASK A;  3GZX B;  1GY5 A;  3GZB A;  8CHO A;  4OVM A;  4XDW A;  5IG3 A;  4R9K A;  3NM2 A;  4HVN A;  3HX8 A;  4FCJ A;  1AR0 A;  3G8Z A;  3STD A;  3MG2 A;  5TGN A;  3A76 A;  2GBW B;  3FLJ A;  3DUK A;  3LZA A;  1OGX A;  3HK4 A;  3FGY A;  5AIG A;  1E3V A;  3OWU A;  3E99 A;  1DMQ A;  3T8N A;  3B4P A;  1E3R A;  1ULI B;  4LEH A;  1E97 A;  2PZV A;  1A2K A;  1BUQ A;  1EA2 A;  3DXO A;  4XBX A;  3EBY A;  4R1K A;  2I9W A;  4XBT A;  5CLK A;  3MYT A;  3UNL A;  2HML B;  4HM2 B;  1GS3 A;  1TUH A;  1OF5 B;  3M8C A;  3S5C A;  5IG5 A;  1OH0 A;  1OHO A;  3SOA A;  5BXQ A;  4XBY A;  3H51 A;  5FW5 A;  1DMN A;  3T8U A;  2Z76 A;  3FF2 A;  4HM0 B;  1O7M B;  3K7C A;  3JUQ A;  4J9A A;  2R4I A;  5AI1 A;  5AIH A;  1DMM A;  2QGU A;  4KVH A;  3FF0 A;  3NHX A;  4L8P A;  3B4O A;  3HZP A;  4L7K A;  3F14 A;  4OUQ A;  5G2G A;  1O7W B;  3MG3 A;  3FZW A;  2YFJ B;  3CNM A;  5IF6 A;  3GZY B;  3DZL A;  2F86 B;  4XM4 A;  3OV4 A;  5IEP A;  1GY6 A;  5DRV A;  1OUN A;  2RGQ A;  1SJW A;  1NDO B;  1O7N B;  1ZX2 A;  2IMJ A;  5CK6 A;  3NBR A;  4K1U A;  3JUP A;  1JKG B;  2XRX B;  5IG4 A;  5CF1 A;  1W01 A;  1Q40 A;  1OPY A;  4ORL A;  2BMR B;  5D83 A;  2Z7A A;  2INX A;  4X2H A;  4HZ9 B;  3KKG A;  4IIA A;  3G0K A;  5D82 A;  4HM3 B;  1JN5 A;  3UJM A;  5HGR A;  1W6Y A;  3GRD A;  4RZM A;  1TP6 A;  3ER7 A;  1O7P B;  3RGA A;  2CHC A;  4HM4 B;  1QMA A;  2HMN B;  4HKV B;  3MHE A;  1Q40 B;  5CF2 A;  2STD A;  2RCD A;  2GEY A;  1W00 A;  3F7S A;  2HMJ B;  3DMC A;  4U13 A;  2XSO B;  2Z77 A;  3NV0 A;  1JN5 B;  5AIF A;  3SOY A;  2GEX A;  3CPO A;  4WWU C;  3LYG A;  3SED A;  3JUN A;  3NXJ A;  5JPP A;  3OXA A;  3BLZ A;  3EF8 A;  5CXO A;  3GZR A;  5AEU B;  2CKF B;  3K0Z A;  4HM7 B;  4WYK A;  2RFR A;  4CDL A;  3FH1 A;  2GXF A;  2B24 B;  5IER A;  1CQS A;  3FSD A;  2B1X B;  3NV0 B;  5STD A;  3IPT A;  3OWS A;  3B7C A;  3CU3 A;  2JQ5 A;  1JB4 A;  2HMM B;  2UX0 A;  1HKX A;  4LMI A;  3MG1 A;  2K54 A;  4N3V A;  1Q42 A;  4WYK B;  3ECF A; 
#chains in the Genus database with same CATH topology
 2IUJ A;  3Q1C A;  4J8T A;  4H3U A;  2BNG A;  2CFL A;  1ISK A;  1SAR A;  2HOH A;  3D79 A;  3AGO A;  3F9S A;  1RJO A;  3OX9 A;  2W2C A;  3B8L A;  4KT3 B;  1QAK A;  1SQW A;  5BVB A;  1IV7 A;  3S29 A;  4R80 A;  1RHL A;  3VGN A;  5M19 A;  2CIU A;  3FG4 A;  7STD A;  1Q9E A;  3Q90 A;  1OHP A;  1ULJ B;  5AII A;  3VSY A;  3BNC A;  2GBX B;  5M18 A;  1VQ6 3;  3Q2P A;  3WR2 A;  3RNT A;  2YX9 A;  3EQQ B;  3PCR A;  3CCQ 3;  1VQL 3;  5IW9 A;  1JZO A;  5LC7 A;  2HMK B;  1STD A;  1OGZ A;  1FUT A;  4HM6 B;  1OHS A;  3ROB A;  2KF5 A;  4STD A;  5EVH A;  1LOV A;  1FGM A;  2D1W A;  2ZA4 A;  1B21 A;  2H0G A;  1BAN A;  4FMA A;  1OCV A;  5IEO A;  1EG9 B;  2KF3 A;  1PFP A;  1MWS A;  1I0V A;  1TRP A;  4R4K A;  3X3X A;  2CC3 A;  5G1L A;  3RGR A;  3DM8 A;  4N6U A;  1IYY A;  3EN8 A;  3UL6 A;  2CX1 A;  5DRE A;  1BVI A;  1STF I;  3DGN A;  3URP A;  2OWP A;  1IDP A;  2FGT A;  1RN7 A;  2CW9 A;  1EEJ A;  1ZGX A;  2H0I A;  3G16 A;  4RNT A;  1RCK A;  1EQK A;  5IG0 A;  1GYB A;  4HM5 B;  4EXR A;  1RGA A;  1WMO A;  1YI2 3;  4N6L A;  6STD A;  5IF6 A;  1IT8 A;  1WNH A;  4L8O A;  3CXC 2;  2BIR A;  1W5Z A;  1FA3 A;  1BNF A;  2CFD A;  5LC6 A;  1BSA A;  1A2V A;  2MC8 A;  4RNZ A;  2P09 A;  3KSP A;  3X42 A;  1X1X A;  2P0X A;  3MWZ A;  6GSP A;  4OK0 A;  2XF3 A;  7GSP A;  2L4V A;  2O9U X;  4HM8 B;  3NQY A;  1TFO A;  2XSH B;  1UGH I;  1YGW A;  4AEQ A;  1UI7 A;  3GAX A;  3SXX A;  3H3H A;  1UGI A;  8RNT A;  1LXE A;  3NM7 A;  1JB5 A;  1ZO2 A;  1YIJ 3;  3EHC A;  3WMD A;  1OF5 A;  4GB5 A;  1TFK A;  3PZW A;  3DGM A;  3SX1 A;  4LSO A;  3F7X A;  1R4Y A;  1U5O A;  2OOV A;  2P05 A;  1IQ8 A;  3CME 3;  3F40 A;  3X3Y A;  3KFQ C;  1GY7 A;  1GSP A;  3EN1 B;  5KP1 A;  1QVG 2;  1JV2 B;  2XR8 B;  3KCH A;  5G1K A;  4ILF A;  1O7H B;  2A15 A;  2LQV A;  2XGN A;  3LTA A;  3BB9 A;  3LTD A;  3EC9 A;  3PXM A;  1RDS A;  4FCZ A;  5KP3 A;  1NU3 A;  5JPU A;  4GL6 A;  5KP4 A;  1RMS A;  2BO9 B;  1MGW A;  2XFT A;  1GMQ A;  1M9G A;  1Q86 4;  2F56 A;  1RNB A;  3GWR A;  3AMO A;  1K41 A;  2RSX A;  1BNG A;  2E2U A;  1YIT 3;  1ROV A;  1HYF A;  1UI8 A;  4Q53 A;  1O7G B;  2GU3 A;  5A0O B;  3CCU 3;  1Q7Y 4;  6RNT A;  4DKI A;  3EX9 A;  3CNX A;  3FKA A;  4N6T A;  1QJG A;  1RGC A;  2BMQ B;  3JUO A;  1KC8 4;  1AQZ A;  4XDV A;  3CCV 3;  3KZT A;  1RRL A;  4MJD A;  3MKI A;  1BSB A;  1BRN L;  1SPU A;  2RNT A;  1I3F A;  5ELU A;  4I4K A;  3NUV A;  2XFS A;  2YFL B;  1Z1S A;  3QK9 A;  3EBT A;  3MSO A;  4ZM8 A;  1JBS A;  4XB5 A;  1QVF 2;  4FCM A;  3Q3F A;  1M90 4;  2YFI B;  2E2T A;  1ZS7 A;  2V1L A;  1UUV B;  1RGK A;  1B2Z A;  1C7H A;  1WQL B;  2D42 A;  3JUM A;  4K1V A;  2OOV C;  5EQL A;  3EJV A;  3K5T A;  4CCV A;  5IEN A;  2QIY A;  2QA4 3;  3AMO B;  3UL5 A;  4AKZ A;  1W02 A;  7RNT A;  3UB1 A;  4HM1 B;  4JF8 A;  1QAL A;  1NWW A;  1D6Y A;  1WMN A;  2M7O A;  3D9R A;  3KE7 A;  3CCL 3;  4LGQ A;  1IVV A;  2OCT A;  1JB2 A;  3F8H A;  3N8B A;  3NX0 A;  4NPB A;  1JKG A;  4R9L A;  1BSC A;  4X2O A;  5D81 A;  3TDG A;  1VQN 3;  3NBJ A;  1Q81 4;  1T5Y A;  1JNQ A;  1C54 A;  4PEJ A;  1VZZ A;  1Y4K A;  1X1W A;  3LH4 A;  1UUW B;  1D6U A;  1UCI A;  2Y74 A;  2MF7 A;  3I0Y A;  2F98 A;  2KF4 A;  1RKY A;  1K73 4;  2IYJ A;  4GSP A;  4WP5 A;  4CJN A;  1I3I A;  3OWY A;  4LZI A;  5GSP A;  2F99 A;  2ML5 A;  4WFO A;  2BMO B;  4HZB B;  1G02 A;  2HMO B;  2CG1 A;  1S5A A;  3NQZ A;  5AEW B;  4HJL B;  4K90 B;  2Z6B A;  3F8X A;  1NB5 I;  1UUG B;  1ASK A;  1IVU A;  1YNV X;  2L1S A;  3GZX B;  1GY5 A;  3CCS 3;  3GZB A;  3JVC A;  8CHO A;  4OVM A;  3WA3 A;  2ZDJ A;  1MGR A;  4XDW A;  5IG3 A;  3LOY A;  1N9J A;  4R9K A;  1L5G B;  2WGQ A;  2UGI A;  3NM2 A;  2OTL 3;  3CC4 3;  1RLS A;  3AGN A;  3ZG0 A;  4HVN A;  1VQP 3;  4BTX A;  1S72 3;  4N6V 0;  1TU5 A;  2C10 A;  3HX8 A;  2XGL A;  3G6E 3;  1R4C A;  1AY7 A;  4FCJ A;  1AR0 A;  3LTC A;  1JJ2 2;  1LRA A;  3G8Z A;  1BRJ A;  1BNJ A;  4FMB A;  3WA2 X;  3ZFZ A;  1BU4 A;  3STD A;  2P38 A;  1BRI A;  1RGH A;  3MG2 A;  2BT3 A;  4FR9 A;  5TGN A;  1MWU A;  1N5P A;  3A76 A;  1FW7 A;  2GBW B;  3FLJ A;  3DUK A;  4O02 B;  5EEO A;  1TTO A;  3VF1 A;  1BRG A;  3LZA A;  1OGX A;  1NJI 4;  3HK4 A;  3FGY A;  1FGQ A;  1GMP A;  1IT7 A;  1FGT A;  2W9Q A;  1E3V A;  3OWU A;  3E99 A;  5AIG A;  1US1 A;  1M1K 4;  1LOX A;  1RSN A;  1DMQ A;  2W6J H;  1LQM B;  1LVN A;  2GSP A;  3DGY A;  3EE1 A;  3WHO A;  3T8N A;  1FGR A;  1GOV A;  1TIJ A;  4MMZ B;  3B4P A;  5AYR B;  3BU4 A;  1E3R A;  1N8Q A;  4JRF A;  1ULI B;  1K8A 4;  1YHQ 3;  1IU7 A;  4LEH A;  1E97 A;  4IT7 A;  3CC2 3;  1T2H A;  1RCL A;  1W6G A;  2JDI H;  2PZV A;  4N6M A;  2CK3 H;  2OTJ 3;  1A2K A;  1IQY A;  1W6C A;  1BUQ A;  1EA2 A;  3WDG B;  3DXO A;  4XBX A;  3LTB A;  1BIR A;  1W2B 2;  1DE3 A;  2KCD A;  3EBY A;  1VQQ A;  3K63 A;  3D5G A;  1RGG A;  1UDI I;  1YVB I;  1BNI A;  1LOW A;  2CFG A;  4EBG A;  4J5G A;  4R1K A;  2I9W A;  4XBT A;  2F5W A;  4HBR A;  3LXU X;  4KFF A;  1QAF A;  5CLK A;  1K28 A;  2KAA A;  3MYT A;  2CFW A;  3UNL A;  2HML B;  1JBT A;  5HOH A;  3HI7 A;  4HM2 B;  3WOF B;  1GS3 A;  1VQ4 3;  1IVX A;  1V58 A;  3V99 A;  4QWT A;  1TUH A;  3N54 B;  1VQ9 3;  1GOY A;  1OF5 B;  3M8C A;  4FMC A;  2XH9 A;  3S5C A;  5IG5 A;  3J7Y d;  1WMP A;  1OH0 A;  1OHO A;  3HIG A;  1DET A;  1LNH A;  1W4N A;  3N9H A;  3SOA A;  3SYU A;  5BXQ A;  3G71 3;  4XBY A;  2K3D A;  1MNL A;  1OAC A;  1FZU A;  3H51 A;  1CYV A;  4WHA A;  5FW5 A;  1DMN A;  1GMR A;  1RGL A;  2J8X B;  3T8U A;  2Z76 A;  4BL3 A;  4EC6 A;  3FF2 A;  4HM0 B;  4O8S A;  3S27 A;  9RNT A;  1KWI A;  2W56 A;  1O7M B;  3K7C A;  1M1X B;  1VQO 3;  1K9M 4;  2CH9 A;  3AHS A;  3JUQ A;  4J9A A;  2R4I A;  2WOH A;  3EB8 A;  1DMM A;  5AI1 A;  5AIH A;  3LT9 A;  3L0R A;  5RNT A;  1N8R 4;  4HOH A;  4MMY B;  1F8N A;  3S28 A;  4G1M B;  2QGU A;  4RBN A;  4BTW A;  3LML A;  4IPB A;  4KVH A;  2CWU A;  1B20 A;  1UCK A;  2W03 A;  3FF0 A;  3WOE B;  3PCS A;  1UCJ A;  3NHX A;  2CWV A;  3SLU A;  1RNT A;  2QEX 3;  1I2E A;  4L8P A;  3B4O A;  3HZP A;  4L7K A;  1Q7H A;  1SII A;  3F14 A;  4OUQ A;  1A90 A;  1W7C A;  1YJW 3;  3O8Y A;  5G2G A;  1O7W B;  1I2F A;  1VQ8 3;  2KXG A;  3GSP A;  1IQX A;  3MG3 A;  1B2S A;  4N6O B;  5BU4 A;  3S67 A;  2KRT A;  3FZW A;  4BTY A;  3DGL A;  3FG3 A;  1PU4 A;  2YFJ B;  3CNM A;  1MOL A;  1EKM A;  4AKY A;  1GOU A;  4KFD A;  1WTH A;  1TRQ A;  1ROA A;  3GZY B;  3DZL A;  4O2H A;  2F86 B;  4XM4 A;  3V92 A;  4KZ1 A;  2W56 B;  2K0M A;  3D4A A;  2FNQ A;  2WGO A;  2C11 A;  3ALA A;  3ZG5 A;  2SAR A;  1FGO A;  3OV4 A;  5IEP A;  1GY6 A;  3IJE B;  1MWR A;  4NRE A;  5DRV A;  1OUN A;  1B27 A;  1HU9 A;  2RGQ A;  1SJW A;  1NDO B;  1O7N B;  1ZX2 A;  2W04 A;  2IMJ A;  3HII A;  5CK6 A;  1FYS A;  2WOF A;  1SIH A;  3OW2 2;  1BSD A;  3NBR A;  1BRH A;  5ELJ A;  1B2M A;  4K1U A;  1N9E A;  3JUP A;  3U1W A;  1JKG B;  3LT8 A;  1YJ9 3;  2XRX B;  2CG0 A;  1I0X A;  5IG4 A;  1Q82 4;  3RDE A;  3MPH A;  3FG1 A;  5CF1 A;  1W01 A;  1NB3 I;  1Q40 A;  4TX4 A;  1UCL A;  1V74 A;  1OPY A;  2CWT A;  2GU1 A;  3DGO A;  4ORL A;  2BMR B;  3X40 A;  4EW5 A;  3FCS B;  5D83 A;  2Z7A A;  1BRS A;  2INX A;  4HZ9 B;  4X2H A;  1LOY A;  3CCR 3;  1RTU A;  3KKG A;  3X3Z A;  3CD6 3;  3PS8 A;  4N6N B;  4H61 A;  1VQM 3;  4IIA A;  1B2U A;  1CEW I;  3BND A;  2KF6 A;  1YJN 3;  3G0K A;  3D3L A;  1NNV A;  5AYS C;  1PYL A;  1BGS A;  2CFK A;  2ML6 A;  5D82 A;  4HM3 B;  3V98 A;  4O3V A;  3BNE A;  3KSE D;  2F4Y A;  1JN5 A;  1G96 A;  2LYX A;  2CX0 A;  3UJM A;  5HGR A;  1W6Y A;  2FXT A;  3U97 A;  3AHW A;  3HOH A;  1D6Z A;  3GRD A;  1N5H A;  1TP6 A;  2ZHX B;  3ER7 A;  4J5K A;  4RZM A;  1KQS 2;  3KII A;  1CH0 A;  1O7P B;  3IMA B;  3PYJ A;  3G4S 3;  3RGA A;  3CC7 3;  4EV5 A;  1YVS A;  2CHC A;  1I8V A;  4HM4 B;  1QMA A;  2HMN B;  3DY5 A;  3CCE 3;  1IVW A;  3CCJ 3;  1X1Y A;  1YGE A;  4HKV B;  1BSE A;  3MHE A;  4HYZ A;  1VQ7 3;  1U8C B;  3BIR A;  1Q40 B;  1J2B A;  5CF2 A;  1DYU A;  1V57 A;  2STD A;  4HAA A;  4GHO A;  1IV9 A;  3CPW 2;  2RCD A;  2C4B A;  2GEY A;  1W00 A;  2E2V A;  3F7S A;  3X41 A;  3WOD G;  1VQK 3;  1JRQ A;  1FUW A;  2HMJ B;  4I5Q A;  3DMC A;  2SBL A;  2W9P A;  1G0T A;  2ZL8 A;  1AVK A;  1A67 A;  4U13 A;  2IUK A;  2XSO B;  2OQE A;  2Z77 A;  3KN4 A;  3NV0 A;  4BL2 A;  2RBI A;  1JN5 B;  1AV4 A;  5AIF A;  4BU4 A;  3SOY A;  2GEX A;  3CPO A;  2AAD A;  3I56 3;  4WWU C;  3BNB A;  3LYG A;  1VQ5 3;  1NO3 A;  3D5I A;  3SED A;  3JUN A;  3NXJ A;  2AAE A;  5JPP A;  3OXA A;  1RN4 A;  2O3O A;  3BLZ A;  5BIR A;  1HZ1 A;  4BIR A;  3EF8 A;  1W2Z A;  1T2I A;  3GZR A;  2CKF B;  5CXO A;  5AEU B;  4K61 A;  1BUJ A;  3K0Z A;  4MEI A;  4HM7 B;  2R41 A;  2F5M A;  1I70 A;  3QRD A;  1X1U A;  1GD4 A;  5M1A A;  1TJD A;  4WYK A;  2RFR A;  2W0Q A;  1I2G A;  4CDL A;  3I55 3;  1BAO A;  3FH1 A;  2GXF A;  1A2P A;  1MWT A;  1GD3 A;  2B24 B;  1BNR A;  3K9M C;  1AVL A;  5IER A;  2Y73 A;  1PY3 A;  2Q07 A;  2XEP A;  1DVD A;  1CQS A;  3FSD A;  1UW1 A;  2B1X B;  3NV0 B;  5STD A;  1KSI A;  3IPT A;  1RGE A;  4CPK A;  3OWS A;  1BOX A;  2IY2 A;  1BNE A;  1BRK A;  1JZD A;  3B7C A;  3CCM 3;  1CYU A;  3CU3 A;  1KD1 4;  1DVC A;  2JQ5 A;  4EV2 A;  1JB4 A;  2HMM B;  2UX0 A;  3DH2 A;  4RNY A;  1JBR A;  1EUI C;  1LQG C;  1HKX A;  1RRH A;  1LNI A;  4LMI A;  4FMD A;  2OQE C;  5JBS A;  3A5E A;  1FUS A;  1RN1 A;  1IK3 A;  3MG1 A;  2H0H A;  2WO0 A;  4NHF A;  2K54 A;  4EYC A;  1RGF A;  2PNC A;  5I97 A;  4MMX B;  2P0M A;  4LYL B;  3SVA A;  1BNS A;  3T0U A;  3PGB A;  2BU4 A;  4N3V A;  1Q42 A;  2BHM A;  4WYK B;  1T3B A;  1B2X A;  2UUG C;  2IA7 A;  5FGO A;  3ECF A;  3CMA 3;  3NBB A;  1B3S A;  4KFE A; 
#chains in the Genus database with same CATH homology
 2IUJ A;  3Q1C A;  4J8T A;  4H3U A;  2BNG A;  2CFL A;  1ISK A;  3F9S A;  1RJO A;  3OX9 A;  2W2C A;  3B8L A;  1QAK A;  1SQW A;  5BVB A;  1IV7 A;  3S29 A;  4R80 A;  3VGN A;  2CIU A;  3FG4 A;  7STD A;  3Q90 A;  1OHP A;  1ULJ B;  5AII A;  3VSY A;  3BNC A;  2GBX B;  1VQ6 3;  3Q2P A;  2YX9 A;  3EQQ B;  3PCR A;  3CCQ 3;  1VQL 3;  5IW9 A;  5LC7 A;  2HMK B;  1OGZ A;  1STD A;  4HM6 B;  3ROB A;  1OHS A;  4STD A;  5EVH A;  2D1W A;  1FGM A;  4FMA A;  1OCV A;  5IEO A;  1EG9 B;  1PFP A;  4R4K A;  3X3X A;  2CC3 A;  3RGR A;  3DM8 A;  4N6U A;  3EN8 A;  3UL6 A;  5DRE A;  1STF I;  3DGN A;  2OWP A;  1IDP A;  2FGT A;  1RN7 A;  2CW9 A;  3G16 A;  1EQK A;  5IG0 A;  1GYB A;  4HM5 B;  4EXR A;  1WMO A;  1YI2 3;  4N6L A;  6STD A;  1IT8 A;  1WNH A;  4L8O A;  3CXC 2;  1W5Z A;  1FA3 A;  2CFD A;  5LC6 A;  1A2V A;  2MC8 A;  4RNZ A;  2P09 A;  3KSP A;  3X42 A;  2P0X A;  3MWZ A;  4OK0 A;  2XF3 A;  2L4V A;  2O9U X;  4HM8 B;  3NQY A;  1TFO A;  2XSH B;  4AEQ A;  1UI7 A;  3GAX A;  3SXX A;  3H3H A;  1LXE A;  3NM7 A;  1JB5 A;  1ZO2 A;  1YIJ 3;  3EHC A;  3WMD A;  1OF5 A;  4GB5 A;  1TFK A;  3PZW A;  3DGM A;  3SX1 A;  4LSO A;  3F7X A;  1U5O A;  2OOV A;  2P05 A;  1IQ8 A;  3CME 3;  3F40 A;  3X3Y A;  3KFQ C;  1GY7 A;  3EN1 B;  5KP1 A;  1QVG 2;  1JV2 B;  2XR8 B;  2XGN A;  1O7H B;  2A15 A;  2LQV A;  3LTA A;  3BB9 A;  3LTD A;  3EC9 A;  3PXM A;  4FCZ A;  4KFE A;  5KP3 A;  1NU3 A;  5JPU A;  4GL6 A;  5KP4 A;  2BO9 B;  2XFT A;  1M9G A;  1Q86 4;  3GWR A;  3AMO A;  1K41 A;  2RSX A;  2E2U A;  1YIT 3;  1ROV A;  1UI8 A;  4Q53 A;  1O7G B;  2GU3 A;  5A0O B;  3CCU 3;  1Q7Y 4;  3EX9 A;  3CNX A;  3FKA A;  4N6T A;  1QJG A;  2BMQ B;  3JUO A;  1KC8 4;  4XDV A;  3CCV 3;  3KZT A;  1RRL A;  4MJD A;  3MKI A;  1SPU A;  5ELU A;  4I4K A;  3NUV A;  2XFS A;  2YFL B;  1Z1S A;  3QK9 A;  3EBT A;  3MSO A;  4ZM8 A;  4XB5 A;  1QVF 2;  4FCM A;  1M90 4;  2YFI B;  2E2T A;  2V1L A;  1UUV B;  1WQL B;  2D42 A;  1C7H A;  3JUM A;  4K1V A;  2OOV C;  5EQL A;  3EJV A;  3K5T A;  4CCV A;  5IEN A;  2QIY A;  2QA4 3;  3AMO B;  3UL5 A;  4AKZ A;  1W02 A;  3UB1 A;  4HM1 B;  4JF8 A;  1QAL A;  1NWW A;  1D6Y A;  1WMN A;  2M7O A;  3D9R A;  3KE7 A;  3CCL 3;  4LGQ A;  1IVV A;  2OCT A;  1JB2 A;  3F8H A;  3N8B A;  3NX0 A;  4R9L A;  1JKG A;  4X2O A;  3TDG A;  5D81 A;  1VQN 3;  3NBJ A;  1Q81 4;  1T5Y A;  1JNQ A;  4PEJ A;  1VZZ A;  1Y4K A;  3LH4 A;  1UUW B;  1D6U A;  3I0Y A;  2Y74 A;  2MF7 A;  1RKY A;  2F98 A;  1K73 4;  4WP5 A;  3OWY A;  4LZI A;  2F99 A;  2ML5 A;  4WFO A;  2BMO B;  4HZB B;  2HMO B;  2CG1 A;  1S5A A;  3NQZ A;  5AEW B;  4HJL B;  4K90 B;  2Z6B A;  3F8X A;  1NB5 I;  1ASK A;  1IVU A;  3GZX B;  1GY5 A;  3CCS 3;  3GZB A;  3JVC A;  8CHO A;  4OVM A;  3WA3 A;  2ZDJ A;  4XDW A;  5IG3 A;  3LOY A;  1N9J A;  4R9K A;  1L5G B;  2WGQ A;  3NM2 A;  2OTL 3;  3CC4 3;  1VQP 3;  4HVN A;  4BTX A;  1S72 3;  4N6V 0;  1TU5 A;  2C10 A;  3HX8 A;  2XGL A;  3G6E 3;  1R4C A;  4FCJ A;  1AR0 A;  3LTC A;  1JJ2 2;  3G8Z A;  4FMB A;  3WA2 X;  3STD A;  2P38 A;  3MG2 A;  2BT3 A;  4FR9 A;  5TGN A;  1N5P A;  3A76 A;  2GBW B;  3FLJ A;  3DUK A;  4O02 B;  5EEO A;  3VF1 A;  3LZA A;  1OGX A;  1NJI 4;  3HK4 A;  3FGY A;  1FGQ A;  2W9Q A;  1IT7 A;  1FGT A;  5AIG A;  1E3V A;  3OWU A;  3E99 A;  1US1 A;  1M1K 4;  1LOX A;  1DMQ A;  2W6J H;  1LVN A;  3EE1 A;  3T8N A;  1FGR A;  4MMZ B;  1TIJ A;  3B4P A;  5AYR B;  1E3R A;  1N8Q A;  4JRF A;  1ULI B;  1K8A 4;  1YHQ 3;  1IU7 A;  4LEH A;  1E97 A;  4IT7 A;  3CC2 3;  1W6G A;  2JDI H;  2PZV A;  4N6M A;  2OTJ 3;  2CK3 H;  1A2K A;  1IQY A;  1W6C A;  1BUQ A;  1EA2 A;  3WDG B;  3DXO A;  4XBX A;  3LTB A;  1W2B 2;  2KCD A;  3EBY A;  3K63 A;  2CFG A;  1YVB I;  4EBG A;  4R1K A;  2I9W A;  4XBT A;  4HBR A;  3LXU X;  4KFF A;  1QAF A;  5CLK A;  1K28 A;  3MYT A;  2CFW A;  3UNL A;  2HML B;  3HI7 A;  4HM2 B;  3WOF B;  1GS3 A;  1VQ4 3;  1IVX A;  3V99 A;  4QWT A;  1TUH A;  3N54 B;  1VQ9 3;  1OF5 B;  3M8C A;  4FMC A;  2XH9 A;  3S5C A;  5IG5 A;  3J7Y d;  1WMP A;  1OH0 A;  1OHO A;  3HIG A;  1LNH A;  1W4N A;  3N9H A;  3SOA A;  5BXQ A;  3G71 3;  4XBY A;  1MNL A;  1OAC A;  3H51 A;  1CYV A;  5FW5 A;  1DMN A;  3T8U A;  4EC6 A;  2Z76 A;  3FF2 A;  4HM0 B;  4O8S A;  3S27 A;  1KWI A;  2W56 A;  1O7M B;  3K7C A;  1M1X B;  1VQO 3;  1K9M 4;  2CH9 A;  3JUQ A;  4J9A A;  2R4I A;  2WOH A;  3EB8 A;  1DMM A;  5AI1 A;  5AIH A;  3LT9 A;  3L0R A;  1N8R 4;  4MMY B;  1F8N A;  3S28 A;  4G1M B;  2QGU A;  4RBN A;  3LML A;  4IPB A;  4KVH A;  2CWU A;  2W03 A;  3FF0 A;  3WOE B;  3PCS A;  3NHX A;  2CWV A;  3SLU A;  2QEX 3;  4L8P A;  3B4O A;  3HZP A;  4L7K A;  1SII A;  3F14 A;  4OUQ A;  1A90 A;  1W7C A;  1YJW 3;  3O8Y A;  5G2G A;  1O7W B;  1VQ8 3;  2KXG A;  1IQX A;  3MG3 A;  4N6O B;  3S67 A;  2KRT A;  3FZW A;  4BTY A;  3DGL A;  3FG3 A;  1PU4 A;  2YFJ B;  3CNM A;  1MOL A;  1EKM A;  4AKY A;  4KFD A;  5IF6 A;  1WTH A;  3GZY B;  1ROA A;  4O2H A;  3DZL A;  3V92 A;  2F86 B;  4XM4 A;  4KZ1 A;  2W56 B;  2K0M A;  2FNQ A;  2WGO A;  2C11 A;  3ALA A;  1FGO A;  3OV4 A;  5IEP A;  1GY6 A;  3IJE B;  5DRV A;  4NRE A;  1OUN A;  2RGQ A;  1HU9 A;  4WHA A;  1SJW A;  1NDO B;  1O7N B;  1ZX2 A;  2W04 A;  2IMJ A;  3HII A;  5CK6 A;  2WOF A;  1SIH A;  3OW2 2;  3NBR A;  5ELJ A;  4K1U A;  1N9E A;  3JUP A;  3U1W A;  1JKG B;  3LT8 A;  1YJ9 3;  2XRX B;  2CG0 A;  5IG4 A;  1Q82 4;  3RDE A;  3MPH A;  3FG1 A;  5CF1 A;  1W01 A;  1NB3 I;  1Q40 A;  4TX4 A;  3X40 A;  1V74 A;  1OPY A;  2CWT A;  2GU1 A;  3DGO A;  4ORL A;  2BMR B;  3FCS B;  5D83 A;  2Z7A A;  2INX A;  4HZ9 B;  4X2H A;  3CCR 3;  3KKG A;  3X3Z A;  3CD6 3;  3PS8 A;  4N6N B;  4H61 A;  1VQM 3;  4IIA A;  1CEW I;  3BND A;  1YJN 3;  3G0K A;  3D3L A;  3V98 A;  5AYS C;  2CFK A;  2ML6 A;  5D82 A;  4HM3 B;  4O3V A;  3BNE A;  3KSE D;  1JN5 A;  1G96 A;  2LYX A;  3UJM A;  5HGR A;  1W6Y A;  2FXT A;  3U97 A;  1D6Z A;  3GRD A;  1N5H A;  1TP6 A;  3ER7 A;  4RZM A;  1KQS 2;  3KII A;  1O7P B;  3IMA B;  3PYJ A;  3G4S 3;  3RGA A;  3CC7 3;  4EV5 A;  2CHC A;  4HM4 B;  1QMA A;  2HMN B;  3DY5 A;  3CCE 3;  1IVW A;  3CCJ 3;  1YGE A;  4HKV B;  3MHE A;  4HYZ A;  1VQ7 3;  1U8C B;  1Q40 B;  1J2B A;  5CF2 A;  1DYU A;  2STD A;  1IV9 A;  3CPW 2;  2RCD A;  2GEY A;  1W00 A;  2E2V A;  3F7S A;  3X41 A;  3WOD G;  1VQK 3;  1JRQ A;  1FUW A;  2HMJ B;  3DMC A;  2SBL A;  2W9P A;  2ZL8 A;  1A67 A;  1AVK A;  4U13 A;  2IUK A;  2XSO B;  2OQE A;  2Z77 A;  3KN4 A;  3NV0 A;  1JN5 B;  1AV4 A;  5AIF A;  3SOY A;  2GEX A;  3CPO A;  3I56 3;  1VQ5 3;  4WWU C;  3BNB A;  3LYG A;  1NO3 A;  3SED A;  3JUN A;  3NXJ A;  5JPP A;  3OXA A;  2O3O A;  3BLZ A;  3EF8 A;  1W2Z A;  3GZR A;  5CXO A;  2CKF B;  5AEU B;  4K61 A;  3K0Z A;  4MEI A;  4HM7 B;  3QRD A;  1GD4 A;  4WYK A;  2RFR A;  2W0Q A;  4CDL A;  3I55 3;  3FH1 A;  2GXF A;  1GD3 A;  2B24 B;  3K9M C;  1AVL A;  5IER A;  2Y73 A;  2Q07 A;  2XEP A;  1DVD A;  1CQS A;  3FSD A;  1UW1 A;  2B1X B;  3NV0 B;  5STD A;  1KSI A;  3IPT A;  3OWS A;  3B7C A;  3CCM 3;  1CYU A;  3CU3 A;  1KD1 4;  1DVC A;  2JQ5 A;  4EV2 A;  1JB4 A;  2HMM B;  2UX0 A;  4RNY A;  1HKX A;  1RRH A;  4LMI A;  4FMD A;  2OQE C;  5JBS A;  1IK3 A;  3MG1 A;  2WO0 A;  4NHF A;  5I97 A;  2K54 A;  4EYC A;  2PNC A;  4MMX B;  2P0M A;  3SVA A;  3T0U A;  3PGB A;  4N3V A;  1Q42 A;  2BHM A;  4WYK B;  2IA7 A;  5FGO A;  3ECF A;  3CMA 3;  3NBB A;  4BTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...