1ULJB

Biphenyl dioxygenase (bpha1a2) in complex with the substrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
177
structure length
177
Chain Sequence
b'FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biphenyl dioxygenase large subunit
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Oxidoreductase
total genus 51
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uljB00
4KVHA 1O7PB 3NHXA 3T8NA 1O7WB 3EF8A 1K41A 3T8UA 3MG3A 3SOYA 3OX9A 1ULJB 3NM2A 3OWUA 3FLJA 5TGNA 3WMDA 2R4IA 2HMLB 5KP4A 5HGRA 1ZX2A 3NXJA 3MSOA 3STDA 3JUNA 1OF5A 5AIGA 3G16A 1JN5A 3ROBA 1O7HB 2B24B 3CNMA 4HM2B 5AIIA 4N3VA 2BMRB 3F7SA 5AI1A 1OGZA 3JUMA 3DUKA 1Z1SA 2UX0A 4XM4A 4LGQA 4XBXA 3K7CA 1NDOB 1HKXA 3KE7A 1DMNA 3FF2A 5AIHA 3GRDA 4Q53A 2GXFA 3MYTA 4XBYA 3DXOA 1TUHA 3E99A 3FF0A 2XRXB 3FZWA 3MG1A 4XDWA 4XBTA 2BNGA 1E3VA 2QGUA 3OV4A 3GZYB 5EVHA 4WYKA 4FCMA 2GBXB 4HM8B 3LZAA 2GEXA 4ORLA 3KZTA 3JUQA 5D83A 2IMJA 2INXA 3NV0A 2XSOB 3BLZA 2GEYA 1QMAA 4J9AA 2XSHB 4HM7B 2CKFB 4OVMA 5CF2A 1OGXA 4K1UA 3CNXA 3ER7A 2F86B 1DMQA 1UUVB 4I4KA 2Z7AA 1QJGA 4HM6B 1ZO2A 5IG0A 1JKGB 3S5CA 3OXAA 4HVNA 1OHOA 1WQLB 1O7NB 3K0ZA 2I9WA 3EHCA 1E3RA 2JQ5A 2A15A 1A2KA 5DREA 3DM8A 4XB5A 5IENA 4R9LA 1U5OA 1TP6A 5KP1A 3EN8A 3F14A 4HJLB 3Q90A 4HM0B 3GZXB 5IG5A 1GY6A 5KP3A 5G2GA 3RGAA 5IEPA 2YFIB 1STDA 3FSDA 3MG2A 1ASKA 2STDA 3BB9A 3GZRA 4X2OA 4LMIA 3KSPA 3EC9A 7STDA 3EBYA 3F9SA 2YFJB 1NWWA 1VZZA 3B8LA 1Q40A 4FCJA 4PEJA 3EQQB 5FW5A 2XR8B 3UJMA 2HMOB 1AR0A 4STDA 1OF5B 5CF1A 4K1VA 2CHCA 5BXQA 1ISKA 4OUQA 3F7XA 5JPUA 4CDLA 1JN5B 3EX9A 3EBTA 2BMOB 3F8HA 1GS3A 6STDA 3B4OA 5AEUB 5CXOA 4XDVA 2YFLB 3JUOA 4WWUC 1JB4A 3NBRA 2K54A 5CLKA 2OWPA 4L8PA 5IERA 3VGNA 1E97A 1OCVA 4MJDA 3CPOA 3DZLA 1SJWA 1JB2A 5BVBA 4WYKB 1OPYA 5CK6A 3ECFA 3FKAA 2BMQB 2RCDA 3H51A 3HK4A 3F8XA 3NV0B 5D82A 3CU3A 3GZBA 3LYGA 2RGQA 4HZ9B 3EN1B 3KKGA 4HZBB 1CQSA 3SEDA 5IG4A 2W2CA 1BUQA 2B1XB 1W01A 5AEWB 3GWRA 3RGRA 3FH1A 2F98A 3MKIA 1EG9B 1W02A 5STDA 1OH0A 2HMMB 1C7HA 5AIFA 5IG3A 3EJVA 3B4PA 1DMMA 3G0KA 5D81A 3SOAA 1OUNA 3OWYA 3HX8A 1W00A 2GBWB 2QIYA 3VSYA 4WP5A 4R1KA 2Z77A 1GYBA 2Z76A 1Q42A 1GY5A 3DMCA 2HMJB 1ULIB 2HMNB 3JUPA 1EA2A 2F99A 4H3UA 1S5AA 4HM4B 4IIAA 1NU3A 4GB5A 4HM1B 4J8TA 3FGYA 1OHSA 3D9RA 1O7GB 3B7CA 4RZMA 3I0YA 3MHEA 2PZVA 4X2HA 3H3HA 4HKVB 1W6YA 5DRVA 8CHOA 3F40A 1UUWB 3G8ZA 1JKGA 4HM5B 3NUVA 1JB5A 1Q40B 3OWSA 4L7KA 1GY7A 3UNLA 3M8CA 4HM3B 2HMKB 1OHPA 1IDPA 5IEOA 1O7MB 5IF6A 4LEHA 4L8OA 3HZPA 3A76A 3IPTA 2RFRA 5JPPA 4R9KA 4U13A
chains in the Genus database with same CATH superfamily
4KVHA 1O7PB 2CX0A 1DETA 4FMDA 4FMAA 4RNTA 1RGEA 3NHXA 1A90A 4RNZA 3T8NA 1O7WB 1YGWA 3D4AA 1ROVA 3EF8A 3SX1A 1K41A 3S67A 1GOYA 1YVBI 3D3LA 2W56A 5LC7A 3SXXA 2ZDJA 4MMXB 3T8UA 3MG3A 3KSED 1JNQA 5GSPA 1BNEA 1FGMA 3SOYA 3OX9A 1ULJB 3NM2A 2CIUA 3OW22 3OWUA 1KC84 1BNIA 3DGYA 3FLJA 1MWUA 3DH2A 8RNTA 5TGNA 3WMDA 2R4IA 1UCKA 1RGAA 2HMLB 5KP4A 3PYJA 1ZX2A 3A5EA 5HGRA 2OCTA 2CK3H 3MSOA 3NXJA 3STDA 1BSDA 2Q07A 4N6UA 1RKYA 2L1SA 1M1XB 1T2HA 2UUGC 4J5GA 5G1KA 1FYSA 3JUNA 1A67A 4ILFA 1IV7A 1OF5A 4H61A 1RGCA 1FZUA 3JVCA 1B2MA 5AIGA 4KFEA 5FGOA 2OTJ3 3BNBA 3PGBA 3G16A 4NREA 4JRFA 1R4YA 1B3SA 1JN5A 1O7HB 2C11A 2B24B 2F4YA 3CNMA 4HM2B 5AIIA 3ROBA 3U97A 3WODG 1SIHA 2H0GA 3NBJA 4N3VA 1M1K4 2BMRB 2P0XA 2D42A 3F7SA 1UCJA 4K90B 5AI1A 1IK3A 1OGZA 1MGRA 2ML5A 1TTOA 3LOYA 1TU5A 3JUMA 3DUKA 3NQZA 1YI23 1Z1SA 2OQEC 4EC6A 1JZDA 2UX0A 3Q1CA 4AKZA 4XM4A 2W56B 3IMAB 4LGQA 4XBXA 1HYFA 3MPHA 3K7CA 1NDOB 1IU7A 1HKXA 1BAOA 3KE7A 4GL6A 1DMNA 1RTUA 3SYUA 2BO9B 2R41A 3FF2A 2SARA 2F5MA 2WGOA 5AIHA 1IVWA 1GOUA 3GRDA 3CCJ3 1ZGXA 1A2PA 2C10A 1K8A4 1UI7A 2W9PA 1YJ93 1YVSA 1X1YA 2CFWA 2UGIA 2IUKA 4Q53A 1VQK3 2GXFA 3MYTA 4XBYA 3DXOA 1TUHA 1G02A 4O02B 3E99A 4K61A 7RNTA 1BNSA 3FF0A 3DGMA 3V98A 3G4S3 1MWSA 1PYLA 2XRXB 3FZWA 3MG1A 2WGQA 4XDWA 4XBTA 1SARA 2BNGA 4GSPA 1SQWA 3CC43 1LVNA 3X41A 1E3VA 2QGUA 3OV4A 3GZYB 5M1AA 1IQXA 5EVHA 4WYKA 3D5GA 4FCMA 4GHOA 2GBXB 4HM8B 3LZAA 2GEXA 4ORLA 3KZTA 3JUQA 3GSPA 5D83A 1QVG2 2IMJA 2INXA 3NV0A 3K63A 2QEX3 4N6V0 1EUIC 2XSOB 3BLZA 1M904 1I3FA 2GEYA 4O2HA 1QMAA 3CCV3 1GMPA 4J9AA 2WOHA 1L5GB 1I2FA 2XSHB 1KD14 4HM7B 1M9GA 1GMQA 3KFQC 1FA3A 4EW5A 4BTYA 1W2ZA 1D6ZA 3NM7A 3LTAA 2CKFB 5A0OB 2CFLA 1LOXA 1W4NA 4HBRA 1B2XA 3CCE3 4OVMA 2J8XB 1FUSA 5CF2A 1AQZA 1OGXA 4K1UA 1Y4KA 3CNXA 3ER7A 3DY5A 3LTBA 1BGSA 2F86B 3N9HA 1FGTA 3D5IA 1DMQA 1UUVB 4I4KA 1A2VA 2XEPA 3WA3A 2Z7AA 3UL5A 1QJGA 4HM6B 2XGLA 2CG0A 4N6NB 3CXC2 4QWTA 1ZO2A 2LQVA 5IG0A 1JKGB 3S5CA 3OXAA 4HVNA 2AAEA 1OHOA 1WQLB 3I563 1Q864 1DYUA 1O7NB 2W9QA 2I9WA 3EHCA 1RLSA 1E3RA 3HIIA 3K0ZA 4JF8A 4N6TA 2CG1A 1DE3A 2QA43 1BSCA 3ZG0A 1NO3A 2JQ5A 1VQ73 3CCQ3 2A15A 3Q2PA 1RNBA 1BNRA 1AVLA 2P05A 1J2BA 1RCKA 1A2KA 2Y74A 1FUWA 5DREA 3DM8A 4XB5A 1VQL3 4I5QA 1GOVA 1LQMB 5IENA 1I0VA 4R9LA 6GSPA 1W6GA 1LOWA 1U5OA 4AEQA 2K0MA 1TP6A 1BIRA 5JBSA 1ROAA 4WHAA 1FGOA 2HOHA 1I8VA 1RGKA 2W0QA 5KP1A 3EN8A 2P0MA 3F14A 4HJLB 4MMZB 3Q90A 4N6LA 2WO0A 2OQEA 2CFDA 2KF4A 3WR2A 1BUJA 3URPA 3AGNA 4HM0B 1U8CB 3GZXB 5IG5A 1GY6A 1JZOA 5KP3A 1IT8A 5G2GA 3RGAA 1C54A 3MWZA 3G6E3 4LSOA 1RCLA 4HAAA 5EQLA 5IEPA 2YFIB 1STDA 1S723 1RGLA 3NQYA 4G1MB 1CYVA 2LYXA 1JBTA 1RHLA 1VQP3 4RNYA 1SIIA 3FSDA 1VQ83 1IQYA 1BSBA 3MG2A 1LRAA 1ASKA 1UUGB 1B2UA 2STDA 3BB9A 3WOFB 3GZRA 1YHQ3 3QK9A 2KAAA 3HIGA 1LNHA 1UGHI 2CWTA 3CCL3 1JBRA 1MWTA 1RN4A 1NB3I 2P38A 4X2OA 4LMIA 1LOVA 2P09A 3CC23 3AGOA 1I3IA 1YJW3 1BANA 1B2ZA 1WMPA 1Q824 3KSPA 1VQ63 3EC9A 2IA7A 2XH9A 7STDA 3FG4A 4EXRA 1BRGA 3EBYA 3SLUA 3F9SA 2KF5A 1D6YA 1Q7Y4 2YFJB 4TX4A 1N8QA 1NWWA 3J7Yd 3U1WA 5HOHA 1Q814 2BT3A 3WDGB 4BTWA 1FW7A 1VZZA 2CH9A 3B8LA 1Q40A 4FCJA 1K9M4 1BSAA 4PEJA 1TRPA 3EQQB 5FW5A 2XR8B 3UJMA 2HMOB 1K734 1AR0A 4EYCA 1QAKA 4STDA 1OF5B 5CF1A 4MEIA 1TFKA 4K1VA 1VQ53 2GU1A 2CHCA 1X1XA 1N5PA 4FCZA 3X40A 5BXQA 2BHMA 1ISKA 4OUQA 1GD3A 3F7XA 1BU4A 2KXGA 3DGLA 5JPUA 1G96A 3ZG5A 4CDLA 3CCU3 1JN5B 3EX9A 1BSEA 1HU9A 3EBTA 1VQM3 2E2VA 1Q9EA 1W7CA 1BVIA 1W5ZA 1QAFA 1RN1A 2BMOB 3F8HA 1BRJA 2F56A 1GS3A 1IVXA 2GU3A 4FR9A 6STDA 3CCR3 3VF1A 2MC8A 1VQ93 2O3OA 3I553 3V92A 3B4OA 5AEUB 2ZHXB 1B20A 4BL3A 3RDEA 4KFDA 1RMSA 5LC6A 1RNTA 5CXOA 1YIJ3 3AHSA 1V74A 3FCSB 2CWVA 2H0IA 2OOVA 3BIRA 2YFLB 4XDVA 1UI8A 3JUOA 1BNJA 2CW9A 3K5TA 3N8BA 1UGIA 4WWUC 1JB4A 3UL6A 3LMLA 3NBRA 2K54A 1FGQA 4FMBA 4HYZA 1KSIA 4KZ1A 2ZA4A 5CLKA 3X3XA 3NX0A 3KIIA 1BRSA 2CWUA 3ALAA 4CJNA 1PFPA 2OWPA 4L8PA 5IERA 3VGNA 2IYJA 1JJ22 1B2SA 1E97A 2RSXA 1OCVA 1WMNA 1YIT3 1ZS7A 2KF3A 2XGNA 2O9UX 1TJDA 4IPBA 4MJDA 4MMYB 3CPOA 3DZLA 2C4BA 5M19A 3UB1A 7GSPA 1RGHA 3LH4A 2OOVC 2ML6A 1SJWA 4KFFA 1JB2A 1VQ43 5BVBA 4WYKB 1OPYA 2KRTA 2L4VA 2XFTA 1RGFA 2CC3A 3ECFA 3FKAA 1QALA 5CK6A 3S27A 1STFI 2BMQB 2W6JH 2RCDA 4IT7A 4OK0A 4EV2A 3CCS3 4RBNA 2E2UA 1BOXA 2BU4A 2IUJA 1CYUA 1B27A 3H51A 3AMOA 3LTCA 3T0UA 4EBGA 1G0TA 2H0HA 3HK4A 3F8XA 3NV0B 5D82A 2OTL3 1B21A 1AVKA 3CU3A 3PCRA 3GZBA 3LYGA 3DGNA 2RGQA 4R80A 3CD63 4HZ9B 3EN1B 3LTDA 3KKGA 4HZBB 2FNQA 2M7OA 1CQSA 3SEDA 5IG4A 1N9JA 1VQQA 1WMOA 2W2CA 3DGOA 2Z6BA 1EEJA 3HI7A 4O8SA 1BUQA 3G713 9RNTA 2B1XB 4AKYA 1I70A 4NPBA 2FGTA 2YX9A 1W01A 5AEWB 5ELJA 1RGGA 2WOFA 3GWRA 3RGRA 1LXEA 1T3BA 3FH1A 2F98A 3MKIA 3N54B 3HOHA 1EG9B 1UW1A 3EE1A 5G1LA 4KT3B 3X42A 1W02A 5I97A 1T5YA 1YJN3 5STDA 1OH0A 2HMMB 3S29A 1C7HA 2KF6A 3O8YA 5AIFA 5RNTA 5IG3A 3EJVA 1SPUA 4CCVA 3B4PA 1DMMA 3CCM3 3G0KA 3BNCA 1FUTA 2CX1A 5D81A 1LNIA 3IJEB 3SOAA 1OUNA 3OWYA 2KCDA 1GSPA 1W6CA 1DVCA 3HX8A 1W00A 3D79A 3AMOB 3GAXA 2IY2A 2GBWB 3QRDA 2QIYA 4BTXA 3VSYA 1BNFA 1WNHA 3NBBA 4WP5A 4R1KA 2Z77A 2CFKA 3X3YA 3PS8A 1DVDA 1QVF2 2MF7A 2GSPA 3CME3 1AV4A 1GYBA 1UCLA 1GD4A 2Z76A 1Q42A 2FXTA 1GY5A 3Q3FA 4BIRA 1IYYA 3DMCA 4DKIA 2HMJB 1ULIB 2CFGA 1KWIA 1K28A 1NNVA 2HMNB 3JUPA 1JBSA 1EA2A 2W03A 2JDIH 1IVVA 2F99A 4H3UA 2PNCA 1S5AA 1EQKA 3CC73 3TDGA 1JRQA 4HM4B 4IIAA 2BIRA 4EV5A 1MNLA 4WFOA 1NU3A 1Q7HA 1YNVX 1I0XA 1BRIA 3FG3A 4GB5A 1RN7A 2RNTA 4HM1B 4J8TA 3S28A 1US1A 2SBLA 1X1UA 1TIJA 3FGYA 3WHOA 3K9MC 1AY7A 3LXUX 2RBIA 1OHSA 4CPKA 2Y73A 3D9RA 1O7GB 1UCIA 1OACA 1VQO3 3B7CA 3PCSA 3FG1A 4RZMA 1N9EA 3I0YA 1WTHA 3EB8A 3WOEB 4N6OB 1V57A 1BNGA 1MOLA 2PZVA 3MHEA 1KQS2 1R4CA 4X2HA 4BU4A 1D6UA 1BRNL 3V99A 1N5HA 3H3HA 3KCHA 1T2IA 4HKVB 1W6YA 1X1WA 5DRVA 3CPW2 3BU4A 1IV9A 5IW9A 8CHOA 1EKMA 3F40A 1UUWB 1RRLA 5BIRA 3G8ZA 1JKGA 4HM5B 3NUVA 1RJOA 1JV2B 1TRQA 1JB5A 1V58A 1Q40B 4O3VA 1VQN3 3WA2X 1PY3A 1PU4A 3PZWA 3OWSA 4FMCA 1W2B2 1I2GA 1YGEA 4R4KA 1RSNA 4L7KA 1LOYA 1MGWA 1GY7A 1GMRA 3UNLA 4BL2A 3M8CA 4HM3B 2HMKB 2V1LA 4NHFA 4HOHA 5BU4A 1OHPA 3BNDA 1NJI4 3L0RA 6RNTA 3KN4A 5AYRB 1IVUA 2AADA 2K3DA 3LT8A 4LZIA 1LQGC 1IDPA 5IEOA 4LYLB 1MWRA 2E2TA 3RNTA 1IT7A 3ZFZA 1HZ1A 1N8R4 1O7MB 3BNEA 4J5KA 1UDII 5IF6A 2W04A 4LEHA 3LT9A 3CMA3 5AYSC 1CH0A 4L8OA 3AHWA 3SVAA 1BRHA 1F8NA 3HZPA 3A76A 3IPTA 1I2EA 1IQ8A 1RDSA 3X3ZA 2D1WA 1BRKA 4ZM8A 2XFSA 2RFRA 5ELUA 1RRHA 2ZL8A 2F5WA 5JPPA 2XF3A 1TFOA 5M18A 1CEWI 1FGRA 4R9KA 4N6MA 3PXMA 4U13A 1NB5I 5EEOA
chains in the Genus database with same CATH topology
4KVHA 1O7PB 4FMDA 4FMAA 3NHXA 1A90A 4RNZA 3T8NA 1O7WB 1ROVA 3EF8A 3SX1A 1K41A 3S67A 1YVBI 3D3LA 2W56A 5LC7A 3SXXA 2ZDJA 4MMXB 3T8UA 3MG3A 3KSED 1JNQA 1FGMA 3SOYA 3OX9A 1ULJB 3NM2A 2CIUA 3OW22 3OWUA 1KC84 3FLJA 5TGNA 3WMDA 2R4IA 2HMLB 5KP4A 3PYJA 1ZX2A 5HGRA 2OCTA 2CK3H 3MSOA 3NXJA 3STDA 2Q07A 4N6UA 1RKYA 1M1XB 3JUNA 1A67A 1IV7A 1OF5A 4H61A 3JVCA 5AIGA 4KFEA 5FGOA 2OTJ3 3BNBA 3PGBA 3G16A 4NREA 4JRFA 1JN5A 1O7HB 2C11A 2B24B 3CNMA 4HM2B 5AIIA 3ROBA 3U97A 3WODG 1SIHA 4N3VA 3NBJA 1M1K4 2BMRB 2P0XA 2D42A 3F7SA 4K90B 5AI1A 1IK3A 1OGZA 2ML5A 3LOYA 1TU5A 3JUMA 3DUKA 3NQZA 1YI23 1Z1SA 2OQEC 4EC6A 2UX0A 4AKZA 3Q1CA 4XM4A 2W56B 3IMAB 4LGQA 4XBXA 3MPHA 3K7CA 1NDOB 1IU7A 1HKXA 3KE7A 4GL6A 1DMNA 2BO9B 3FF2A 2WGOA 5AIHA 1IVWA 3GRDA 3CCJ3 2C10A 1K8A4 1UI7A 2W9PA 1YJ93 2CFWA 2IUKA 4Q53A 1VQK3 2GXFA 3MYTA 4XBYA 3DXOA 1TUHA 4O02B 3E99A 4K61A 3FF0A 3DGMA 3V98A 3G4S3 2XRXB 3FZWA 3MG1A 2WGQA 4XDWA 4XBTA 2BNGA 3CC43 1SQWA 1LVNA 3X41A 1E3VA 2QGUA 3OV4A 3GZYB 1IQXA 5EVHA 4WYKA 4FCMA 2GBXB 4HM8B 3LZAA 2GEXA 4ORLA 3KZTA 3JUQA 5D83A 1QVG2 2IMJA 2INXA 3NV0A 3K63A 2QEX3 4N6V0 2XSOB 3BLZA 1M904 2GEYA 4O2HA 1QMAA 3CCV3 4J9AA 2WOHA 1L5GB 1KD14 2XSHB 4HM7B 1M9GA 3KFQC 1FA3A 1W2ZA 1D6ZA 3NM7A 3LTAA 2CKFB 5A0OB 2CFLA 1LOXA 1W4NA 4HBRA 3CCE3 4OVMA 5CF2A 1OGXA 4K1UA 1Y4KA 3CNXA 3ER7A 3DY5A 3LTBA 2F86B 3N9HA 1FGTA 1DMQA 1UUVB 4I4KA 1A2VA 2XEPA 3WA3A 2Z7AA 3UL5A 1QJGA 4HM6B 2XGLA 2CG0A 4N6NB 3CXC2 4QWTA 1ZO2A 2LQVA 5IG0A 1JKGB 3S5CA 3OXAA 4HVNA 1OHOA 1WQLB 3I563 1Q864 1DYUA 1O7NB 2W9QA 2I9WA 3EHCA 3HIIA 1E3RA 3K0ZA 4JF8A 4N6TA 2CG1A 4BTYA 2QA43 1NO3A 2JQ5A 1VQ73 3CCQ3 2A15A 3Q2PA 1AVLA 2P05A 1J2BA 1FUWA 1A2KA 2Y74A 5DREA 3DM8A 4XB5A 1VQL3 5IENA 4R9LA 1W6GA 1U5OA 4AEQA 2K0MA 1TP6A 5JBSA 1ROAA 4WHAA 1FGOA 2W0QA 5KP1A 3EN8A 2P0MA 3F14A 4HJLB 4MMZB 3Q90A 4N6LA 2WO0A 2OQEA 2CFDA 4HM0B 1U8CB 3GZXB 5IG5A 1GY6A 5KP3A 1IT8A 5G2GA 3RGAA 3MWZA 3G6E3 4LSOA 5EQLA 5IEPA 2YFIB 1STDA 1S723 3NQYA 4G1MB 1CYVA 2LYXA 1VQP3 4RNYA 1SIIA 3FSDA 1VQ83 1IQYA 3MG2A 1ASKA 2STDA 3BB9A 3WOFB 3GZRA 1YHQ3 3QK9A 3HIGA 1LNHA 2CWTA 3CCL3 1NB3I 2P38A 4X2OA 4LMIA 3CC23 2P09A 1YJW3 1WMPA 1Q824 3KSPA 1VQ63 3EC9A 2IA7A 2XH9A 7STDA 3FG4A 4EXRA 3EBYA 3SLUA 3F9SA 1D6YA 1Q7Y4 2YFJB 4TX4A 1N8QA 1NWWA 3J7Yd 3U1WA 1Q814 2BT3A 3WDGB 4BTWA 1VZZA 2CH9A 3B8LA 1Q40A 4FCJA 1K9M4 4PEJA 3EQQB 5FW5A 2XR8B 3UJMA 2HMOB 1K734 1AR0A 4EYCA 1QAKA 4STDA 1OF5B 5CF1A 4MEIA 1TFKA 4K1VA 1VQ53 2GU1A 2CHCA 1N5PA 4FCZA 3X40A 5BXQA 2BHMA 1ISKA 4OUQA 1GD3A 3F7XA 3DGLA 2KXGA 5JPUA 1G96A 4CDLA 3CCU3 1JN5B 3EX9A 1HU9A 3EBTA 1VQM3 2E2VA 1W7CA 1W5ZA 1QAFA 2BMOB 3F8HA 1GS3A 1IVXA 2GU3A 4FR9A 6STDA 3CCR3 3VF1A 2MC8A 1VQ93 2O3OA 3I553 3V92A 3B4OA 5AEUB 3RDEA 4KFDA 5LC6A 5CXOA 1YIJ3 3FCSB 1V74A 2CWVA 2OOVA 4XDVA 2YFLB 1UI8A 3JUOA 2CW9A 3K5TA 3N8BA 4WWUC 1JB4A 3UL6A 3LMLA 3NBRA 2K54A 1FGQA 4FMBA 4HYZA 1KSIA 4KZ1A 5CLKA 3X3XA 3NX0A 3KIIA 2CWUA 3ALAA 1PFPA 2OWPA 4L8PA 5IERA 3VGNA 1JJ22 1E97A 2RSXA 1OCVA 1WMNA 1YIT3 4MMYB 2XGNA 2O9UX 4IPBA 4MJDA 3CPOA 3DZLA 3UB1A 3LH4A 2OOVC 2ML6A 1SJWA 4KFFA 1JB2A 1VQ43 5BVBA 4WYKB 1OPYA 2KRTA 2L4VA 2XFTA 5CK6A 2CC3A 3ECFA 3FKAA 1QALA 3S27A 1STFI 2BMQB 2W6JH 2RCDA 4IT7A 4OK0A 4EV2A 3CCS3 4RBNA 2E2UA 2IUJA 1CYUA 3H51A 3AMOA 3LTCA 3T0UA 4EBGA 3HK4A 3F8XA 3NV0B 5D82A 2OTL3 3CU3A 1AVKA 3PCRA 3GZBA 3LYGA 3DGNA 2RGQA 4R80A 3CD63 4HZ9B 3EN1B 3LTDA 3KKGA 4HZBB 2FNQA 2M7OA 1CQSA 3SEDA 5IG4A 1N9JA 1WMOA 2W2CA 3DGOA 2Z6BA 3HI7A 4O8SA 1BUQA 3G713 2B1XB 4AKYA 2FGTA 2YX9A 1W01A 5AEWB 5ELJA 3GWRA 2WOFA 3RGRA 1LXEA 3FH1A 2F98A 3MKIA 3N54B 1EG9B 1UW1A 3EE1A 3X42A 1W02A 5I97A 1T5YA 1YJN3 5STDA 1OH0A 2HMMB 3S29A 1C7HA 5AIFA 3O8YA 5IG3A 3EJVA 1SPUA 4CCVA 3B4PA 1DMMA 3CCM3 3G0KA 3BNCA 5D81A 3IJEB 3SOAA 1OUNA 3OWYA 2KCDA 1W6CA 1DVCA 3HX8A 1W00A 3AMOB 3GAXA 2GBWB 3QRDA 2QIYA 4BTXA 3VSYA 1WNHA 3NBBA 4WP5A 4R1KA 2Z77A 2CFKA 3X3YA 3PS8A 1DVDA 1QVF2 2MF7A 3CME3 1AV4A 1GYBA 1GD4A 2Z76A 1Q42A 2FXTA 1GY5A 3DMCA 2HMJB 1ULIB 2CFGA 1KWIA 1K28A 2HMNB 3JUPA 1EA2A 2W03A 2JDIH 1IVVA 2F99A 4H3UA 2PNCA 1S5AA 1EQKA 3CC73 3TDGA 1JRQA 4HM4B 4IIAA 4EV5A 1MNLA 4WFOA 1NU3A 3FG3A 4GB5A 1RN7A 4HM1B 4J8TA 3S28A 1US1A 2SBLA 1TIJA 3FGYA 3K9MC 3LXUX 1OHSA 2Y73A 3D9RA 1O7GB 1OACA 1VQO3 3B7CA 3PCSA 3FG1A 4RZMA 1N9EA 3I0YA 1WTHA 3EB8A 3WOEB 4N6OB 1MOLA 2PZVA 3MHEA 1KQS2 1R4CA 4X2HA 1D6UA 3V99A 1N5HA 3H3HA 4HKVB 1W6YA 5DRVA 3CPW2 1IV9A 5IW9A 8CHOA 1EKMA 3F40A 1UUWB 1RRLA 3G8ZA 1JKGA 4HM5B 3NUVA 1RJOA 1JV2B 1JB5A 1Q40B 4O3VA 1VQN3 3WA2X 1PU4A 3PZWA 3OWSA 4FMCA 1W2B2 1YGEA 4R4KA 4L7KA 1GY7A 3UNLA 3M8CA 4HM3B 2HMKB 2V1LA 4NHFA 1NJI4 1OHPA 3BNDA 3L0RA 3KN4A 5AYRB 1IVUA 3LT8A 4LZIA 1IDPA 5IEOA 2E2TA 1IT7A 1N8R4 1O7MB 3BNEA 5IF6A 2W04A 4LEHA 3LT9A 3CMA3 5AYSC 4L8OA 3SVAA 1F8NA 3HZPA 3A76A 3IPTA 1IQ8A 3X3ZA 2D1WA 4ZM8A 2XFSA 2RFRA 5ELUA 1RRHA 2ZL8A 5JPPA 2XF3A 1TFOA 1CEWI 1FGRA 4R9KA 4N6MA 3PXMA 4U13A 1NB5I 5EEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVH A;  1O7P B;  3NHX A;  3T8N A;  1O7W B;  3EF8 A;  1K41 A;  3T8U A;  3MG3 A;  3SOY A;  3OX9 A;  1ULJ B;  3NM2 A;  3OWU A;  3FLJ A;  5TGN A;  3WMD A;  2R4I A;  2HML B;  5KP4 A;  5HGR A;  1ZX2 A;  3NXJ A;  3MSO A;  3STD A;  3JUN A;  1OF5 A;  5AIG A;  3G16 A;  1JN5 A;  3ROB A;  1O7H B;  2B24 B;  3CNM A;  4HM2 B;  5AII A;  4N3V A;  2BMR B;  3F7S A;  5AI1 A;  1OGZ A;  3JUM A;  3DUK A;  1Z1S A;  2UX0 A;  4XM4 A;  4LGQ A;  4XBX A;  3K7C A;  1NDO B;  1HKX A;  3KE7 A;  1DMN A;  3FF2 A;  5AIH A;  3GRD A;  4Q53 A;  2GXF A;  3MYT A;  4XBY A;  3DXO A;  1TUH A;  3E99 A;  3FF0 A;  2XRX B;  3FZW A;  3MG1 A;  4XDW A;  4XBT A;  2BNG A;  1E3V A;  2QGU A;  3OV4 A;  3GZY B;  5EVH A;  4WYK A;  4FCM A;  2GBX B;  4HM8 B;  3LZA A;  2GEX A;  4ORL A;  3KZT A;  3JUQ A;  5D83 A;  2IMJ A;  2INX A;  3NV0 A;  2XSO B;  3BLZ A;  2GEY A;  1QMA A;  4J9A A;  2XSH B;  4HM7 B;  2CKF B;  4OVM A;  5CF2 A;  1OGX A;  4K1U A;  3CNX A;  3ER7 A;  2F86 B;  1DMQ A;  1UUV B;  4I4K A;  2Z7A A;  1QJG A;  4HM6 B;  1ZO2 A;  5IG0 A;  1JKG B;  3S5C A;  3OXA A;  4HVN A;  1OHO A;  1WQL B;  1O7N B;  3K0Z A;  2I9W A;  3EHC A;  1E3R A;  2JQ5 A;  2A15 A;  1A2K A;  5DRE A;  3DM8 A;  4XB5 A;  5IEN A;  4R9L A;  1U5O A;  1TP6 A;  5KP1 A;  3EN8 A;  3F14 A;  4HJL B;  3Q90 A;  4HM0 B;  3GZX B;  5IG5 A;  1GY6 A;  5KP3 A;  5G2G A;  3RGA A;  5IEP A;  2YFI B;  1STD A;  3FSD A;  3MG2 A;  1ASK A;  2STD A;  3BB9 A;  3GZR A;  4X2O A;  4LMI A;  3KSP A;  3EC9 A;  7STD A;  3EBY A;  3F9S A;  2YFJ B;  1NWW A;  1VZZ A;  3B8L A;  1Q40 A;  4FCJ A;  4PEJ A;  3EQQ B;  5FW5 A;  2XR8 B;  3UJM A;  2HMO B;  1AR0 A;  4STD A;  1OF5 B;  5CF1 A;  4K1V A;  2CHC A;  5BXQ A;  1ISK A;  4OUQ A;  3F7X A;  5JPU A;  4CDL A;  1JN5 B;  3EX9 A;  3EBT A;  2BMO B;  3F8H A;  1GS3 A;  6STD A;  3B4O A;  5AEU B;  5CXO A;  4XDV A;  2YFL B;  3JUO A;  4WWU C;  1JB4 A;  3NBR A;  2K54 A;  5CLK A;  2OWP A;  4L8P A;  5IER A;  3VGN A;  1E97 A;  1OCV A;  4MJD A;  3CPO A;  3DZL A;  1SJW A;  1JB2 A;  5BVB A;  4WYK B;  1OPY A;  5CK6 A;  3ECF A;  3FKA A;  2BMQ B;  2RCD A;  3H51 A;  3HK4 A;  3F8X A;  3NV0 B;  5D82 A;  3CU3 A;  3GZB A;  3LYG A;  2RGQ A;  4HZ9 B;  3EN1 B;  3KKG A;  4HZB B;  1CQS A;  3SED A;  5IG4 A;  2W2C A;  1BUQ A;  2B1X B;  1W01 A;  5AEW B;  3GWR A;  3RGR A;  3FH1 A;  2F98 A;  3MKI A;  1EG9 B;  1W02 A;  5STD A;  1OH0 A;  2HMM B;  1C7H A;  5AIF A;  5IG3 A;  3EJV A;  3B4P A;  1DMM A;  3G0K A;  5D81 A;  3SOA A;  1OUN A;  3OWY A;  3HX8 A;  1W00 A;  2GBW B;  2QIY A;  3VSY A;  4WP5 A;  4R1K A;  2Z77 A;  1GYB A;  2Z76 A;  1Q42 A;  1GY5 A;  3DMC A;  2HMJ B;  1ULI B;  2HMN B;  3JUP A;  1EA2 A;  2F99 A;  4H3U A;  1S5A A;  4HM4 B;  4IIA A;  1NU3 A;  4GB5 A;  4HM1 B;  4J8T A;  3FGY A;  1OHS A;  3D9R A;  1O7G B;  3B7C A;  4RZM A;  3I0Y A;  3MHE A;  2PZV A;  4X2H A;  3H3H A;  4HKV B;  1W6Y A;  5DRV A;  8CHO A;  3F40 A;  1UUW B;  3G8Z A;  1JKG A;  4HM5 B;  3NUV A;  1JB5 A;  1Q40 B;  3OWS A;  4L7K A;  1GY7 A;  3UNL A;  3M8C A;  4HM3 B;  2HMK B;  1OHP A;  1IDP A;  5IEO A;  1O7M B;  5IF6 A;  4LEH A;  4L8O A;  3HZP A;  3A76 A;  3IPT A;  2RFR A;  5JPP A;  4R9K A;  4U13 A; 
#chains in the Genus database with same CATH topology
 4KVH A;  1O7P B;  2CX0 A;  1DET A;  4FMD A;  4FMA A;  4RNT A;  1RGE A;  3NHX A;  1A90 A;  4RNZ A;  3T8N A;  1O7W B;  1YGW A;  3D4A A;  1ROV A;  3EF8 A;  3SX1 A;  1K41 A;  3S67 A;  1GOY A;  1YVB I;  3D3L A;  2W56 A;  5LC7 A;  3SXX A;  2ZDJ A;  4MMX B;  3T8U A;  3MG3 A;  3KSE D;  1JNQ A;  5GSP A;  1BNE A;  1FGM A;  3SOY A;  3OX9 A;  1ULJ B;  3NM2 A;  2CIU A;  3OW2 2;  3OWU A;  1KC8 4;  1BNI A;  3DGY A;  3FLJ A;  1MWU A;  3DH2 A;  8RNT A;  5TGN A;  3WMD A;  2R4I A;  1UCK A;  1RGA A;  2HML B;  5KP4 A;  3PYJ A;  1ZX2 A;  3A5E A;  5HGR A;  2OCT A;  2CK3 H;  3MSO A;  3NXJ A;  3STD A;  1BSD A;  2Q07 A;  4N6U A;  1RKY A;  2L1S A;  1M1X B;  1T2H A;  2UUG C;  4J5G A;  5G1K A;  1FYS A;  3JUN A;  1A67 A;  4ILF A;  1IV7 A;  1OF5 A;  4H61 A;  1RGC A;  1FZU A;  3JVC A;  1B2M A;  5AIG A;  4KFE A;  5FGO A;  2OTJ 3;  3BNB A;  3PGB A;  3G16 A;  4NRE A;  4JRF A;  1R4Y A;  1B3S A;  1JN5 A;  1O7H B;  2C11 A;  2B24 B;  2F4Y A;  3CNM A;  4HM2 B;  5AII A;  3ROB A;  3U97 A;  3WOD G;  1SIH A;  2H0G A;  3NBJ A;  4N3V A;  1M1K 4;  2BMR B;  2P0X A;  2D42 A;  3F7S A;  1UCJ A;  4K90 B;  5AI1 A;  1IK3 A;  1OGZ A;  1MGR A;  2ML5 A;  1TTO A;  3LOY A;  1TU5 A;  3JUM A;  3DUK A;  3NQZ A;  1YI2 3;  1Z1S A;  2OQE C;  4EC6 A;  1JZD A;  2UX0 A;  3Q1C A;  4AKZ A;  4XM4 A;  2W56 B;  3IMA B;  4LGQ A;  4XBX A;  1HYF A;  3MPH A;  3K7C A;  1NDO B;  1IU7 A;  1HKX A;  1BAO A;  3KE7 A;  4GL6 A;  1DMN A;  1RTU A;  3SYU A;  2BO9 B;  2R41 A;  3FF2 A;  2SAR A;  2F5M A;  2WGO A;  5AIH A;  1IVW A;  1GOU A;  3GRD A;  3CCJ 3;  1ZGX A;  1A2P A;  2C10 A;  1K8A 4;  1UI7 A;  2W9P A;  1YJ9 3;  1YVS A;  1X1Y A;  2CFW A;  2UGI A;  2IUK A;  4Q53 A;  1VQK 3;  2GXF A;  3MYT A;  4XBY A;  3DXO A;  1TUH A;  1G02 A;  4O02 B;  3E99 A;  4K61 A;  7RNT A;  1BNS A;  3FF0 A;  3DGM A;  3V98 A;  3G4S 3;  1MWS A;  1PYL A;  2XRX B;  3FZW A;  3MG1 A;  2WGQ A;  4XDW A;  4XBT A;  1SAR A;  2BNG A;  4GSP A;  1SQW A;  3CC4 3;  1LVN A;  3X41 A;  1E3V A;  2QGU A;  3OV4 A;  3GZY B;  5M1A A;  1IQX A;  5EVH A;  4WYK A;  3D5G A;  4FCM A;  4GHO A;  2GBX B;  4HM8 B;  3LZA A;  2GEX A;  4ORL A;  3KZT A;  3JUQ A;  3GSP A;  5D83 A;  1QVG 2;  2IMJ A;  2INX A;  3NV0 A;  3K63 A;  2QEX 3;  4N6V 0;  1EUI C;  2XSO B;  3BLZ A;  1M90 4;  1I3F A;  2GEY A;  4O2H A;  1QMA A;  3CCV 3;  1GMP A;  4J9A A;  2WOH A;  1L5G B;  1I2F A;  2XSH B;  1KD1 4;  4HM7 B;  1M9G A;  1GMQ A;  3KFQ C;  1FA3 A;  4EW5 A;  4BTY A;  1W2Z A;  1D6Z A;  3NM7 A;  3LTA A;  2CKF B;  5A0O B;  2CFL A;  1LOX A;  1W4N A;  4HBR A;  1B2X A;  3CCE 3;  4OVM A;  2J8X B;  1FUS A;  5CF2 A;  1AQZ A;  1OGX A;  4K1U A;  1Y4K A;  3CNX A;  3ER7 A;  3DY5 A;  3LTB A;  1BGS A;  2F86 B;  3N9H A;  1FGT A;  3D5I A;  1DMQ A;  1UUV B;  4I4K A;  1A2V A;  2XEP A;  3WA3 A;  2Z7A A;  3UL5 A;  1QJG A;  4HM6 B;  2XGL A;  2CG0 A;  4N6N B;  3CXC 2;  4QWT A;  1ZO2 A;  2LQV A;  5IG0 A;  1JKG B;  3S5C A;  3OXA A;  4HVN A;  2AAE A;  1OHO A;  1WQL B;  3I56 3;  1Q86 4;  1DYU A;  1O7N B;  2W9Q A;  2I9W A;  3EHC A;  1RLS A;  1E3R A;  3HII A;  3K0Z A;  4JF8 A;  4N6T A;  2CG1 A;  1DE3 A;  2QA4 3;  1BSC A;  3ZG0 A;  1NO3 A;  2JQ5 A;  1VQ7 3;  3CCQ 3;  2A15 A;  3Q2P A;  1RNB A;  1BNR A;  1AVL A;  2P05 A;  1J2B A;  1RCK A;  1A2K A;  2Y74 A;  1FUW A;  5DRE A;  3DM8 A;  4XB5 A;  1VQL 3;  4I5Q A;  1GOV A;  1LQM B;  5IEN A;  1I0V A;  4R9L A;  6GSP A;  1W6G A;  1LOW A;  1U5O A;  4AEQ A;  2K0M A;  1TP6 A;  1BIR A;  5JBS A;  1ROA A;  4WHA A;  1FGO A;  2HOH A;  1I8V A;  1RGK A;  2W0Q A;  5KP1 A;  3EN8 A;  2P0M A;  3F14 A;  4HJL B;  4MMZ B;  3Q90 A;  4N6L A;  2WO0 A;  2OQE A;  2CFD A;  2KF4 A;  3WR2 A;  1BUJ A;  3URP A;  3AGN A;  4HM0 B;  1U8C B;  3GZX B;  5IG5 A;  1GY6 A;  1JZO A;  5KP3 A;  1IT8 A;  5G2G A;  3RGA A;  1C54 A;  3MWZ A;  3G6E 3;  4LSO A;  1RCL A;  4HAA A;  5EQL A;  5IEP A;  2YFI B;  1STD A;  1S72 3;  1RGL A;  3NQY A;  4G1M B;  1CYV A;  2LYX A;  1JBT A;  1RHL A;  1VQP 3;  4RNY A;  1SII A;  3FSD A;  1VQ8 3;  1IQY A;  1BSB A;  3MG2 A;  1LRA A;  1ASK A;  1UUG B;  1B2U A;  2STD A;  3BB9 A;  3WOF B;  3GZR A;  1YHQ 3;  3QK9 A;  2KAA A;  3HIG A;  1LNH A;  1UGH I;  2CWT A;  3CCL 3;  1JBR A;  1MWT A;  1RN4 A;  1NB3 I;  2P38 A;  4X2O A;  4LMI A;  1LOV A;  2P09 A;  3CC2 3;  3AGO A;  1I3I A;  1YJW 3;  1BAN A;  1B2Z A;  1WMP A;  1Q82 4;  3KSP A;  1VQ6 3;  3EC9 A;  2IA7 A;  2XH9 A;  7STD A;  3FG4 A;  4EXR A;  1BRG A;  3EBY A;  3SLU A;  3F9S A;  2KF5 A;  1D6Y A;  1Q7Y 4;  2YFJ B;  4TX4 A;  1N8Q A;  1NWW A;  3J7Y d;  3U1W A;  5HOH A;  1Q81 4;  2BT3 A;  3WDG B;  4BTW A;  1FW7 A;  1VZZ A;  2CH9 A;  3B8L A;  1Q40 A;  4FCJ A;  1K9M 4;  1BSA A;  4PEJ A;  1TRP A;  3EQQ B;  5FW5 A;  2XR8 B;  3UJM A;  2HMO B;  1K73 4;  1AR0 A;  4EYC A;  1QAK A;  4STD A;  1OF5 B;  5CF1 A;  4MEI A;  1TFK A;  4K1V A;  1VQ5 3;  2GU1 A;  2CHC A;  1X1X A;  1N5P A;  4FCZ A;  3X40 A;  5BXQ A;  2BHM A;  1ISK A;  4OUQ A;  1GD3 A;  3F7X A;  1BU4 A;  2KXG A;  3DGL A;  5JPU A;  1G96 A;  3ZG5 A;  4CDL A;  3CCU 3;  1JN5 B;  3EX9 A;  1BSE A;  1HU9 A;  3EBT A;  1VQM 3;  2E2V A;  1Q9E A;  1W7C A;  1BVI A;  1W5Z A;  1QAF A;  1RN1 A;  2BMO B;  3F8H A;  1BRJ A;  2F56 A;  1GS3 A;  1IVX A;  2GU3 A;  4FR9 A;  6STD A;  3CCR 3;  3VF1 A;  2MC8 A;  1VQ9 3;  2O3O A;  3I55 3;  3V92 A;  3B4O A;  5AEU B;  2ZHX B;  1B20 A;  4BL3 A;  3RDE A;  4KFD A;  1RMS A;  5LC6 A;  1RNT A;  5CXO A;  1YIJ 3;  3AHS A;  1V74 A;  3FCS B;  2CWV A;  2H0I A;  2OOV A;  3BIR A;  2YFL B;  4XDV A;  1UI8 A;  3JUO A;  1BNJ A;  2CW9 A;  3K5T A;  3N8B A;  1UGI A;  4WWU C;  1JB4 A;  3UL6 A;  3LML A;  3NBR A;  2K54 A;  1FGQ A;  4FMB A;  4HYZ A;  1KSI A;  4KZ1 A;  2ZA4 A;  5CLK A;  3X3X A;  3NX0 A;  3KII A;  1BRS A;  2CWU A;  3ALA A;  4CJN A;  1PFP A;  2OWP A;  4L8P A;  5IER A;  3VGN A;  2IYJ A;  1JJ2 2;  1B2S A;  1E97 A;  2RSX A;  1OCV A;  1WMN A;  1YIT 3;  1ZS7 A;  2KF3 A;  2XGN A;  2O9U X;  1TJD A;  4IPB A;  4MJD A;  4MMY B;  3CPO A;  3DZL A;  2C4B A;  5M19 A;  3UB1 A;  7GSP A;  1RGH A;  3LH4 A;  2OOV C;  2ML6 A;  1SJW A;  4KFF A;  1JB2 A;  1VQ4 3;  5BVB A;  4WYK B;  1OPY A;  2KRT A;  2L4V A;  2XFT A;  1RGF A;  2CC3 A;  3ECF A;  3FKA A;  1QAL A;  5CK6 A;  3S27 A;  1STF I;  2BMQ B;  2W6J H;  2RCD A;  4IT7 A;  4OK0 A;  4EV2 A;  3CCS 3;  4RBN A;  2E2U A;  1BOX A;  2BU4 A;  2IUJ A;  1CYU A;  1B27 A;  3H51 A;  3AMO A;  3LTC A;  3T0U A;  4EBG A;  1G0T A;  2H0H A;  3HK4 A;  3F8X A;  3NV0 B;  5D82 A;  2OTL 3;  1B21 A;  1AVK A;  3CU3 A;  3PCR A;  3GZB A;  3LYG A;  3DGN A;  2RGQ A;  4R80 A;  3CD6 3;  4HZ9 B;  3EN1 B;  3LTD A;  3KKG A;  4HZB B;  2FNQ A;  2M7O A;  1CQS A;  3SED A;  5IG4 A;  1N9J A;  1VQQ A;  1WMO A;  2W2C A;  3DGO A;  2Z6B A;  1EEJ A;  3HI7 A;  4O8S A;  1BUQ A;  3G71 3;  9RNT A;  2B1X B;  4AKY A;  1I70 A;  4NPB A;  2FGT A;  2YX9 A;  1W01 A;  5AEW B;  5ELJ A;  1RGG A;  2WOF A;  3GWR A;  3RGR A;  1LXE A;  1T3B A;  3FH1 A;  2F98 A;  3MKI A;  3N54 B;  3HOH A;  1EG9 B;  1UW1 A;  3EE1 A;  5G1L A;  4KT3 B;  3X42 A;  1W02 A;  5I97 A;  1T5Y A;  1YJN 3;  5STD A;  1OH0 A;  2HMM B;  3S29 A;  1C7H A;  2KF6 A;  3O8Y A;  5AIF A;  5RNT A;  5IG3 A;  3EJV A;  1SPU A;  4CCV A;  3B4P A;  1DMM A;  3CCM 3;  3G0K A;  3BNC A;  1FUT A;  2CX1 A;  5D81 A;  1LNI A;  3IJE B;  3SOA A;  1OUN A;  3OWY A;  2KCD A;  1GSP A;  1W6C A;  1DVC A;  3HX8 A;  1W00 A;  3D79 A;  3AMO B;  3GAX A;  2IY2 A;  2GBW B;  3QRD A;  2QIY A;  4BTX A;  3VSY A;  1BNF A;  1WNH A;  3NBB A;  4WP5 A;  4R1K A;  2Z77 A;  2CFK A;  3X3Y A;  3PS8 A;  1DVD A;  1QVF 2;  2MF7 A;  2GSP A;  3CME 3;  1AV4 A;  1GYB A;  1UCL A;  1GD4 A;  2Z76 A;  1Q42 A;  2FXT A;  1GY5 A;  3Q3F A;  4BIR A;  1IYY A;  3DMC A;  4DKI A;  2HMJ B;  1ULI B;  2CFG A;  1KWI A;  1K28 A;  1NNV A;  2HMN B;  3JUP A;  1JBS A;  1EA2 A;  2W03 A;  2JDI H;  1IVV A;  2F99 A;  4H3U A;  2PNC A;  1S5A A;  1EQK A;  3CC7 3;  3TDG A;  1JRQ A;  4HM4 B;  4IIA A;  2BIR A;  4EV5 A;  1MNL A;  4WFO A;  1NU3 A;  1Q7H A;  1YNV X;  1I0X A;  1BRI A;  3FG3 A;  4GB5 A;  1RN7 A;  2RNT A;  4HM1 B;  4J8T A;  3S28 A;  1US1 A;  2SBL A;  1X1U A;  1TIJ A;  3FGY A;  3WHO A;  3K9M C;  1AY7 A;  3LXU X;  2RBI A;  1OHS A;  4CPK A;  2Y73 A;  3D9R A;  1O7G B;  1UCI A;  1OAC A;  1VQO 3;  3B7C A;  3PCS A;  3FG1 A;  4RZM A;  1N9E A;  3I0Y A;  1WTH A;  3EB8 A;  3WOE B;  4N6O B;  1V57 A;  1BNG A;  1MOL A;  2PZV A;  3MHE A;  1KQS 2;  1R4C A;  4X2H A;  4BU4 A;  1D6U A;  1BRN L;  3V99 A;  1N5H A;  3H3H A;  3KCH A;  1T2I A;  4HKV B;  1W6Y A;  1X1W A;  5DRV A;  3CPW 2;  3BU4 A;  1IV9 A;  5IW9 A;  8CHO A;  1EKM A;  3F40 A;  1UUW B;  1RRL A;  5BIR A;  3G8Z A;  1JKG A;  4HM5 B;  3NUV A;  1RJO A;  1JV2 B;  1TRQ A;  1JB5 A;  1V58 A;  1Q40 B;  4O3V A;  1VQN 3;  3WA2 X;  1PY3 A;  1PU4 A;  3PZW A;  3OWS A;  4FMC A;  1W2B 2;  1I2G A;  1YGE A;  4R4K A;  1RSN A;  4L7K A;  1LOY A;  1MGW A;  1GY7 A;  1GMR A;  3UNL A;  4BL2 A;  3M8C A;  4HM3 B;  2HMK B;  2V1L A;  4NHF A;  4HOH A;  5BU4 A;  1OHP A;  3BND A;  1NJI 4;  3L0R A;  6RNT A;  3KN4 A;  5AYR B;  1IVU A;  2AAD A;  2K3D A;  3LT8 A;  4LZI A;  1LQG C;  1IDP A;  5IEO A;  4LYL B;  1MWR A;  2E2T A;  3RNT A;  1IT7 A;  3ZFZ A;  1HZ1 A;  1N8R 4;  1O7M B;  3BNE A;  4J5K A;  1UDI I;  5IF6 A;  2W04 A;  4LEH A;  3LT9 A;  3CMA 3;  5AYS C;  1CH0 A;  4L8O A;  3AHW A;  3SVA A;  1BRH A;  1F8N A;  3HZP A;  3A76 A;  3IPT A;  1I2E A;  1IQ8 A;  1RDS A;  3X3Z A;  2D1W A;  1BRK A;  4ZM8 A;  2XFS A;  2RFR A;  5ELU A;  1RRH A;  2ZL8 A;  2F5W A;  5JPP A;  2XF3 A;  1TFO A;  5M18 A;  1CEW I;  1FGR A;  4R9K A;  4N6M A;  3PXM A;  4U13 A;  1NB5 I;  5EEO A; 
#chains in the Genus database with same CATH homology
 4KVH A;  1O7P B;  4FMD A;  4FMA A;  3NHX A;  1A90 A;  4RNZ A;  3T8N A;  1O7W B;  1ROV A;  3EF8 A;  3SX1 A;  1K41 A;  3S67 A;  1YVB I;  3D3L A;  2W56 A;  5LC7 A;  3SXX A;  2ZDJ A;  4MMX B;  3T8U A;  3MG3 A;  3KSE D;  1JNQ A;  1FGM A;  3SOY A;  3OX9 A;  1ULJ B;  3NM2 A;  2CIU A;  3OW2 2;  3OWU A;  1KC8 4;  3FLJ A;  5TGN A;  3WMD A;  2R4I A;  2HML B;  5KP4 A;  3PYJ A;  1ZX2 A;  5HGR A;  2OCT A;  2CK3 H;  3MSO A;  3NXJ A;  3STD A;  2Q07 A;  4N6U A;  1RKY A;  1M1X B;  3JUN A;  1A67 A;  1IV7 A;  1OF5 A;  4H61 A;  3JVC A;  5AIG A;  4KFE A;  5FGO A;  2OTJ 3;  3BNB A;  3PGB A;  3G16 A;  4NRE A;  4JRF A;  1JN5 A;  1O7H B;  2C11 A;  2B24 B;  3CNM A;  4HM2 B;  5AII A;  3ROB A;  3U97 A;  3WOD G;  1SIH A;  4N3V A;  3NBJ A;  1M1K 4;  2BMR B;  2P0X A;  2D42 A;  3F7S A;  4K90 B;  5AI1 A;  1IK3 A;  1OGZ A;  2ML5 A;  3LOY A;  1TU5 A;  3JUM A;  3DUK A;  3NQZ A;  1YI2 3;  1Z1S A;  2OQE C;  4EC6 A;  2UX0 A;  4AKZ A;  3Q1C A;  4XM4 A;  2W56 B;  3IMA B;  4LGQ A;  4XBX A;  3MPH A;  3K7C A;  1NDO B;  1IU7 A;  1HKX A;  3KE7 A;  4GL6 A;  1DMN A;  2BO9 B;  3FF2 A;  2WGO A;  5AIH A;  1IVW A;  3GRD A;  3CCJ 3;  2C10 A;  1K8A 4;  1UI7 A;  2W9P A;  1YJ9 3;  2CFW A;  2IUK A;  4Q53 A;  1VQK 3;  2GXF A;  3MYT A;  4XBY A;  3DXO A;  1TUH A;  4O02 B;  3E99 A;  4K61 A;  3FF0 A;  3DGM A;  3V98 A;  3G4S 3;  2XRX B;  3FZW A;  3MG1 A;  2WGQ A;  4XDW A;  4XBT A;  2BNG A;  3CC4 3;  1SQW A;  1LVN A;  3X41 A;  1E3V A;  2QGU A;  3OV4 A;  3GZY B;  1IQX A;  5EVH A;  4WYK A;  4FCM A;  2GBX B;  4HM8 B;  3LZA A;  2GEX A;  4ORL A;  3KZT A;  3JUQ A;  5D83 A;  1QVG 2;  2IMJ A;  2INX A;  3NV0 A;  3K63 A;  2QEX 3;  4N6V 0;  2XSO B;  3BLZ A;  1M90 4;  2GEY A;  4O2H A;  1QMA A;  3CCV 3;  4J9A A;  2WOH A;  1L5G B;  1KD1 4;  2XSH B;  4HM7 B;  1M9G A;  3KFQ C;  1FA3 A;  1W2Z A;  1D6Z A;  3NM7 A;  3LTA A;  2CKF B;  5A0O B;  2CFL A;  1LOX A;  1W4N A;  4HBR A;  3CCE 3;  4OVM A;  5CF2 A;  1OGX A;  4K1U A;  1Y4K A;  3CNX A;  3ER7 A;  3DY5 A;  3LTB A;  2F86 B;  3N9H A;  1FGT A;  1DMQ A;  1UUV B;  4I4K A;  1A2V A;  2XEP A;  3WA3 A;  2Z7A A;  3UL5 A;  1QJG A;  4HM6 B;  2XGL A;  2CG0 A;  4N6N B;  3CXC 2;  4QWT A;  1ZO2 A;  2LQV A;  5IG0 A;  1JKG B;  3S5C A;  3OXA A;  4HVN A;  1OHO A;  1WQL B;  3I56 3;  1Q86 4;  1DYU A;  1O7N B;  2W9Q A;  2I9W A;  3EHC A;  3HII A;  1E3R A;  3K0Z A;  4JF8 A;  4N6T A;  2CG1 A;  4BTY A;  2QA4 3;  1NO3 A;  2JQ5 A;  1VQ7 3;  3CCQ 3;  2A15 A;  3Q2P A;  1AVL A;  2P05 A;  1J2B A;  1FUW A;  1A2K A;  2Y74 A;  5DRE A;  3DM8 A;  4XB5 A;  1VQL 3;  5IEN A;  4R9L A;  1W6G A;  1U5O A;  4AEQ A;  2K0M A;  1TP6 A;  5JBS A;  1ROA A;  4WHA A;  1FGO A;  2W0Q A;  5KP1 A;  3EN8 A;  2P0M A;  3F14 A;  4HJL B;  4MMZ B;  3Q90 A;  4N6L A;  2WO0 A;  2OQE A;  2CFD A;  4HM0 B;  1U8C B;  3GZX B;  5IG5 A;  1GY6 A;  5KP3 A;  1IT8 A;  5G2G A;  3RGA A;  3MWZ A;  3G6E 3;  4LSO A;  5EQL A;  5IEP A;  2YFI B;  1STD A;  1S72 3;  3NQY A;  4G1M B;  1CYV A;  2LYX A;  1VQP 3;  4RNY A;  1SII A;  3FSD A;  1VQ8 3;  1IQY A;  3MG2 A;  1ASK A;  2STD A;  3BB9 A;  3WOF B;  3GZR A;  1YHQ 3;  3QK9 A;  3HIG A;  1LNH A;  2CWT A;  3CCL 3;  1NB3 I;  2P38 A;  4X2O A;  4LMI A;  3CC2 3;  2P09 A;  1YJW 3;  1WMP A;  1Q82 4;  3KSP A;  1VQ6 3;  3EC9 A;  2IA7 A;  2XH9 A;  7STD A;  3FG4 A;  4EXR A;  3EBY A;  3SLU A;  3F9S A;  1D6Y A;  1Q7Y 4;  2YFJ B;  4TX4 A;  1N8Q A;  1NWW A;  3J7Y d;  3U1W A;  1Q81 4;  2BT3 A;  3WDG B;  4BTW A;  1VZZ A;  2CH9 A;  3B8L A;  1Q40 A;  4FCJ A;  1K9M 4;  4PEJ A;  3EQQ B;  5FW5 A;  2XR8 B;  3UJM A;  2HMO B;  1K73 4;  1AR0 A;  4EYC A;  1QAK A;  4STD A;  1OF5 B;  5CF1 A;  4MEI A;  1TFK A;  4K1V A;  1VQ5 3;  2GU1 A;  2CHC A;  1N5P A;  4FCZ A;  3X40 A;  5BXQ A;  2BHM A;  1ISK A;  4OUQ A;  1GD3 A;  3F7X A;  3DGL A;  2KXG A;  5JPU A;  1G96 A;  4CDL A;  3CCU 3;  1JN5 B;  3EX9 A;  1HU9 A;  3EBT A;  1VQM 3;  2E2V A;  1W7C A;  1W5Z A;  1QAF A;  2BMO B;  3F8H A;  1GS3 A;  1IVX A;  2GU3 A;  4FR9 A;  6STD A;  3CCR 3;  3VF1 A;  2MC8 A;  1VQ9 3;  2O3O A;  3I55 3;  3V92 A;  3B4O A;  5AEU B;  3RDE A;  4KFD A;  5LC6 A;  5CXO A;  1YIJ 3;  3FCS B;  1V74 A;  2CWV A;  2OOV A;  4XDV A;  2YFL B;  1UI8 A;  3JUO A;  2CW9 A;  3K5T A;  3N8B A;  4WWU C;  1JB4 A;  3UL6 A;  3LML A;  3NBR A;  2K54 A;  1FGQ A;  4FMB A;  4HYZ A;  1KSI A;  4KZ1 A;  5CLK A;  3X3X A;  3NX0 A;  3KII A;  2CWU A;  3ALA A;  1PFP A;  2OWP A;  4L8P A;  5IER A;  3VGN A;  1JJ2 2;  1E97 A;  2RSX A;  1OCV A;  1WMN A;  1YIT 3;  4MMY B;  2XGN A;  2O9U X;  4IPB A;  4MJD A;  3CPO A;  3DZL A;  3UB1 A;  3LH4 A;  2OOV C;  2ML6 A;  1SJW A;  4KFF A;  1JB2 A;  1VQ4 3;  5BVB A;  4WYK B;  1OPY A;  2KRT A;  2L4V A;  2XFT A;  5CK6 A;  2CC3 A;  3ECF A;  3FKA A;  1QAL A;  3S27 A;  1STF I;  2BMQ B;  2W6J H;  2RCD A;  4IT7 A;  4OK0 A;  4EV2 A;  3CCS 3;  4RBN A;  2E2U A;  2IUJ A;  1CYU A;  3H51 A;  3AMO A;  3LTC A;  3T0U A;  4EBG A;  3HK4 A;  3F8X A;  3NV0 B;  5D82 A;  2OTL 3;  3CU3 A;  1AVK A;  3PCR A;  3GZB A;  3LYG A;  3DGN A;  2RGQ A;  4R80 A;  3CD6 3;  4HZ9 B;  3EN1 B;  3LTD A;  3KKG A;  4HZB B;  2FNQ A;  2M7O A;  1CQS A;  3SED A;  5IG4 A;  1N9J A;  1WMO A;  2W2C A;  3DGO A;  2Z6B A;  3HI7 A;  4O8S A;  1BUQ A;  3G71 3;  2B1X B;  4AKY A;  2FGT A;  2YX9 A;  1W01 A;  5AEW B;  5ELJ A;  3GWR A;  2WOF A;  3RGR A;  1LXE A;  3FH1 A;  2F98 A;  3MKI A;  3N54 B;  1EG9 B;  1UW1 A;  3EE1 A;  3X42 A;  1W02 A;  5I97 A;  1T5Y A;  1YJN 3;  5STD A;  1OH0 A;  2HMM B;  3S29 A;  1C7H A;  5AIF A;  3O8Y A;  5IG3 A;  3EJV A;  1SPU A;  4CCV A;  3B4P A;  1DMM A;  3CCM 3;  3G0K A;  3BNC A;  5D81 A;  3IJE B;  3SOA A;  1OUN A;  3OWY A;  2KCD A;  1W6C A;  1DVC A;  3HX8 A;  1W00 A;  3AMO B;  3GAX A;  2GBW B;  3QRD A;  2QIY A;  4BTX A;  3VSY A;  1WNH A;  3NBB A;  4WP5 A;  4R1K A;  2Z77 A;  2CFK A;  3X3Y A;  3PS8 A;  1DVD A;  1QVF 2;  2MF7 A;  3CME 3;  1AV4 A;  1GYB A;  1GD4 A;  2Z76 A;  1Q42 A;  2FXT A;  1GY5 A;  3DMC A;  2HMJ B;  1ULI B;  2CFG A;  1KWI A;  1K28 A;  2HMN B;  3JUP A;  1EA2 A;  2W03 A;  2JDI H;  1IVV A;  2F99 A;  4H3U A;  2PNC A;  1S5A A;  1EQK A;  3CC7 3;  3TDG A;  1JRQ A;  4HM4 B;  4IIA A;  4EV5 A;  1MNL A;  4WFO A;  1NU3 A;  3FG3 A;  4GB5 A;  1RN7 A;  4HM1 B;  4J8T A;  3S28 A;  1US1 A;  2SBL A;  1TIJ A;  3FGY A;  3K9M C;  3LXU X;  1OHS A;  2Y73 A;  3D9R A;  1O7G B;  1OAC A;  1VQO 3;  3B7C A;  3PCS A;  3FG1 A;  4RZM A;  1N9E A;  3I0Y A;  1WTH A;  3EB8 A;  3WOE B;  4N6O B;  1MOL A;  2PZV A;  3MHE A;  1KQS 2;  1R4C A;  4X2H A;  1D6U A;  3V99 A;  1N5H A;  3H3H A;  4HKV B;  1W6Y A;  5DRV A;  3CPW 2;  1IV9 A;  5IW9 A;  8CHO A;  1EKM A;  3F40 A;  1UUW B;  1RRL A;  3G8Z A;  1JKG A;  4HM5 B;  3NUV A;  1RJO A;  1JV2 B;  1JB5 A;  1Q40 B;  4O3V A;  1VQN 3;  3WA2 X;  1PU4 A;  3PZW A;  3OWS A;  4FMC A;  1W2B 2;  1YGE A;  4R4K A;  4L7K A;  1GY7 A;  3UNL A;  3M8C A;  4HM3 B;  2HMK B;  2V1L A;  4NHF A;  1NJI 4;  1OHP A;  3BND A;  3L0R A;  3KN4 A;  5AYR B;  1IVU A;  3LT8 A;  4LZI A;  1IDP A;  5IEO A;  2E2T A;  1IT7 A;  1N8R 4;  1O7M B;  3BNE A;  5IF6 A;  2W04 A;  4LEH A;  3LT9 A;  3CMA 3;  5AYS C;  4L8O A;  3SVA A;  1F8N A;  3HZP A;  3A76 A;  3IPT A;  1IQ8 A;  3X3Z A;  2D1W A;  4ZM8 A;  2XFS A;  2RFR A;  5ELU A;  1RRH A;  2ZL8 A;  5JPP A;  2XF3 A;  1TFO A;  1CEW I;  1FGR A;  4R9K A;  4N6M A;  3PXM A;  4U13 A;  1NB5 I;  5EEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...