3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
3K9MC 3UL6A 2CH9A 1EQKA 1DVCA 3PXMA 3NX0A 4LZIA 1NB3I 5LC7A 1LXEA 1TIJA 1M9GA 4TX4A 2W9QA 1GD4A 2KXGA 4N6LA 4ZM8A 1A67A 4N6NB 3GAXA 4CCVA 4EYCA 1A90A 1NB5I 5A0OB 3SVAA 1IV7A 4N6UA 2BO9B 1N9JA 1R4CA 5EQLA 4N6OB 3UL5A 3S67A 1ROAA 4N6MA 2OCTA 5LC6A 1MNLA 4IT7A 1GD3A 1PFPA 1FA3A 1CYVA 1IV9A 2W9PA 1MOLA 1N5PA 3L0RA 1YVBI 3KSED 5ELUA 1WNHA 1CYUA 1N5HA 2O9UX 3MWZA 3PYJA 1RN7A 3KFQC 5ELJA 1FUWA 1G96A 3Q2PA 1CEWI 1DVDA 3QRDA 4N6TA 3PS8A 4N6V0 3LH4A 1KWIA 3IMAB 1STFI
chains in the Genus database with same CATH superfamily
2W6JH 2CH9A 3NBBA 2PZVA 4LSOA 4HM7B 3I553 5KP1A 3CCE3 1E3VA 4LEHA 5D82A 2RGQA 2Y73A 1NB3I 2K0MA 2R4IA 3RDEA 1LXEA 3KCHA 1JB5A 1A2KA 2KF6A 1X1YA 5M1AA 1BNRA 4XBYA 2C4BA 3LXUX 4K90B 2RCDA 1U5OA 2M7OA 1IVVA 1RGHA 3PGBA 2RFRA 4LMIA 4N6LA 3S27A 1OGXA 1SARA 2CK3H 4HM6B 1B27A 3DY5A 1TP6A 4ZM8A 1JNQA 1A67A 2OOVC 3VGNA 3F8HA 1TRPA 3K5TA 4RNZA 4WHAA 4EYCA 3U97A 5G2GA 2CG0A 3X40A 2XFSA 2F56A 1BRHA 1VQP3 1FGMA 1Q9EA 1RDSA 1I3FA 2H0HA 2AADA 2IY2A 3F14A 1B2MA 1VQN3 3DGYA 2FGTA 1GS3A 1EG9B 1O7NB 3JUMA 2BMQB 4HM8B 4BU4A 3CC73 1N8R4 1QVF2 1BANA 4N6UA 1YJN3 2BO9B 3G8ZA 3B8LA 3BNDA 1Q7HA 4IIAA 2F5MA 3D3LA 2CX0A 3ECFA 1QMAA 4EW5A 1JV2B 3J7Yd 7STDA 1BRNL 3FZWA 1ULIB 3HI7A 5AYRB 4IPBA 3IPTA 2CWTA 1MGWA 4GB5A 3BNBA 1SPUA 2CG1A 2OWPA 1UUGB 2UX0A 3BLZA 2GU1A 4O8SA 1YJ93 2BNGA 2GEYA 3EB8A 3F40A 3MKIA 1BUQA 1MNLA 1RLSA 2OCTA 3RNTA 5IENA 1BNIA 1EKMA 3DGMA 3WA2X 1NWWA 1RRLA 2A15A 3NM2A 1FGRA 2ZA4A 1BSBA 2W03A 1B2XA 1RSNA 1IV9A 2XFTA 2JDIH 2W9PA 3FF2A 1JBSA 2HMLB 3LOYA 2HMJB 3EJVA 2WO0A 2FXTA 3SOAA 1EUIC 2Z7AA 3ROBA 1BGSA 2P09A 1V74A 1W6YA 1WMPA 1UCKA 1SJWA 4HM2B 4KZ1A 1ISKA 1VQ63 1S723 1STDA 2CC3A 5AIHA 1X1XA 2W2CA 4HBRA 5HGRA 3SYUA 4KFDA 3SEDA 4OUQA 2B24B 1JBRA 3EN8A 3PCSA 3GZRA 1FUWA 1T2HA 6STDA 2F5WA 2OQEA 3GWRA 3M8CA 5CF2A 2XGNA 4R1KA 1FZUA 1RTUA 1UI8A 1OCVA 5CXOA 1BRGA 3S5CA 2AAEA 3STDA 4H61A 1HYFA 3D5IA 3KSPA 1RGEA 1IU7A 1DVDA 5M18A 1GY5A 2HMMB 1ROVA 4N6TA 3PS8A 1RNTA 1YGEA 2ML6A 3G16A 1Q40B 2D1WA 1W5ZA 3X41A 2P05A 1GOYA 3KE7A 4HYZA 3LZAA 3X42A 1LRAA 1NO3A 2HMKB 2XSHB 2MC8A 1ZX2A 3FG1A 1RCKA 3EN1B 3SXXA 3GRDA 5IG0A 1UDII 3N54B 1VQO3 1O7HB 1B21A 3NBRA 4HOHA 4MJDA 1Q824 4L7KA 4PEJA 1TFKA 3BIRA 2XRXB 1L5GB 3WDGB 2WOFA 3CCL3 3NV0B 1I2FA 3GZBA 1NU3A 1W02A 2RSXA 1UW1A 1PU4A 1IYYA 2BMRB 1LVNA 3DXOA 4HM1B 5IG5A 2STDA 1RJOA 3RGAA 3K63A 4BL3A 1IQXA 1WMOA 1AY7A 1OHSA 3DM8A 1K41A 1N8QA 2CWUA 3D5GA 3FH1A 1KD14 1GMRA 4J5KA 1RNBA 2HOHA 3KKGA 1X1WA 1YIT3 4K1VA 1OF5B 1RN1A 3F7SA 1WQLB 1T5YA 4N6NB 2RBIA 4XM4A 4J8TA 5AYSC 4NHFA 4EC6A 4KT3B 2IUJA 3RGRA 1RRHA 3CPW2 3EBYA 2XH9A 1I8VA 7GSPA 1FGOA 4I5QA 1IVWA 1YNVX 2GBWB 1RGGA 3Q3FA 1A2VA 5GSPA 3SX1A 1I0XA 3JUNA 2K54A 3UNLA 3GZXB 3CCU3 1OGZA 1JB4A 2CFDA 4XDVA 1D6UA 2D42A 4OK0A 1JKGB 4GL6A 3FLJA 5RNTA 1LOXA 1C7HA 1MWSA 4EXRA 1AV4A 1G02A 3HX8A 4XBTA 4XB5A 3ALAA 3F8XA 3V92A 1Q40A 5IEPA 1RGLA 4MEIA 3AHSA 1JZOA 1CH0A 2UGIA 1UCIA 1UCJA 1PYLA 1ULJB 4IT7A 6GSPA 1VQ93 1QJGA 1LOVA 2CKFB 1PFPA 4N3VA 3X3XA 5CLKA 2XEPA 3U1WA 1CYVA 1I3IA 1TTOA 3NHXA 2I9WA 5CK6A 2E2UA 4WFOA 4K61A 4HZ9B 4BL2A 2YX9A 3NV0A 2IMJA 1VQ73 1BAOA 2IYJA 3LT8A 2F4YA 3OWYA 3EX9A 1YVBI 4G1MB 1BRIA 2LQVA 4Q53A 4QWTA 3CCR3 5ELUA 3CCM3 1BU4A 3E99A 1LNIA 2CW9A 1GY6A 9RNTA 1K734 2C10A 1FGQA 1M1XB 1BSAA 1N5HA 1QAFA 5D81A 1CYUA 3MWZA 1RN7A 4RNTA 4HM4B 3T0UA 1O7PB 3CMA3 3HIGA 1RN4A 1OF5A 3FG3A 1G96A 1I2EA 2ZDJA 3OWSA 1QAKA 4CJNA 1Z1SA 1M1K4 5BIRA 4RNYA 5M19A 3ZFZA 5BU4A 1IDPA 2B1XB 3QRDA 3UJMA 2P0XA 4FMCA 3CD63 3A76A 1K9M4 1S5AA 2L4VA 4HM5B 2PNCA 4J5GA 8CHOA 1GOVA 2R41A 3HIIA 4FMDA 1UGIA 3OW22 1JKGA 3EF8A 2GEXA 1JZDA 2SARA 1DYUA 2KCDA 1BNGA 2RNTA 2HMOB 1O7GB 1W7CA 3GSPA 3LH4A 5EEOA 1MWUA 4EBGA 1W00A 3CME3 4HKVB 1DETA 3VF1A 4XBXA 1DMQA 1ZO2A 4KFEA 2BT3A 2GU3A 2Q07A 4EV5A 4U13A 1BSDA 2K3DA 3T8UA 1B2SA 1OUNA 2F98A 3AGOA 2QEX3 3IJEB 2ML5A 1DVCA 1VQ83 3PXMA 3NX0A 1JN5B 4LZIA 3WOEB 4AEQA 3FGYA 4MMYB 1BRJA 1TIJA 1BUJA 1ZS7A 1IK3A 4BTWA 1UUWB 3B4OA 4TX4A 2QA43 3CCV3 4HJLB 5IF6A 1LNHA 2W9QA 1VQ43 2YFJB 3Q90A 1GD4A 2C11A 2KXGA 3KIIA 3JUQA 3KZTA 4R80A 1W6CA 2HMNB 3CU3A 1TU5A 5HOHA 5G1LA 4L8OA 3GAXA 2XF3A 3EHCA 2O3OA 3K7CA 5AEUB 1A90A 2LYXA 5A0OB 5KP4A 3CNXA 5BVBA 3LTDA 1RCLA 3JUPA 1SQWA 4LGQA 3SVAA 3AMOB 3B7CA 1W01A 2JQ5A 2OOVA 3VSYA 1JRQA 5AEWB 3O8YA 4RZMA 1GYBA 1B2UA 1LOYA 3HOHA 3LYGA 3H3HA 3EBTA 5I97A 2P0MA 2GBXB 2H0GA 3KN4A 4N6OB 3UL5A 4AKZA 1ASKA 1NJI4 3S67A 3MG3A 1F8NA 5LC6A 4MMZB 4X2HA 3H51A 1B20A 4KFFA 3S29A 2KF5A 1TFOA 2SBLA 1RGAA 2L1SA 3LT9A 3V99A 1BNEA 2CFKA 2UUGC 1BNFA 2XR8B 4OVMA 3WODG 4K1UA 1GSPA 1MWTA 1FUTA 3T8NA 3HZPA 3NQZA 1VQK3 1EEJA 4ORLA 3TDGA 1D6ZA 4L8PA 3B4PA 1JN5A 1MOLA 1O7WB 1RMSA 3BNEA 1N5PA 1RHLA 2BU4A 3G0KA 1CQSA 1I0VA 4MMXB 3X3ZA 3HK4A 3WR2A 2OQEC 3NM7A 5AIFA 1YJW3 1JB2A 3DGOA 3KSED 1B3SA 5FGOA 3UB1A 2WGQA 2Y74A 3CCQ3 3DUKA 1G0TA 3FCSB 3BB9A 2BIRA 1B2ZA 2O9UX 4GSPA 1T3BA 2GXFA 1VQQA 3DMCA 4RBNA 4BTYA 1W4NA 3PYJA 3CCJ3 5BXQA 4HVNA 3SOYA 4GHOA 1QALA 3D9RA 5ELJA 2XGLA 4AKYA 1TJDA 4WWUC 4BIRA 1EA2A 4EV2A 5IERA 1BRKA 3EE1A 5DREA 1KQS2 1SIHA 2Z77A 1BSEA 3JVCA 1RKYA 1LOWA 3PZWA 1CEWI 1AR0A 1IVUA 1IQYA 1N9EA 2CX1A 3MPHA 1W2B2 1BNJA 3AMOA 1AVLA 4FMBA 6RNTA 3FSDA 4CDLA 3DH2A 1JJ22 2FNQA 3FF0A 4N6V0 3G4S3 1Y4KA 1IVXA 2F86B 2INXA 3F7XA 5JBSA 1OACA 3F9SA 3FKAA 1DMMA 1KSIA 1BVIA 2KF3A 5AIGA 1IT7A 3AGNA 2P38A 1IQ8A 1STFI 3IMAB 3WOFB 1YGWA 3MG1A 1Q7Y4 3K9MC 1NDOB 3UL6A 2E2TA 2CFWA 1MGRA 3NXJA 1Q814 1EQKA 3I0YA 2CFLA 1FUSA 3A5EA 1FW7A 5LC7A 2XSOB 3ZG5A 2QIYA 5DRVA 1M9GA 2WOHA 1GY7A 1GOUA 2CIUA 4HM3B 2OTL3 2W04A 3URPA 3DZLA 2KRTA 1I70A 3EQQB 4DKIA 3DGNA 1BSCA 5STDA 2OTJ3 4WYKB 4FMAA 1BNSA 2F99A 3NUVA 4BTXA 3BU4A 2H0IA 1C54A 4O2HA 1HU9A 1O7MB 1V58A 4CCVA 4JRFA 3I563 1BOXA 4NPBA 1U8CB 1BRSA 1WTHA 7RNTA 1A2PA 4O3VA 1NB5I 2KAAA 1VQL3 1DMNA 3X3YA 1X1UA 3MHEA 1IV7A 1FGTA 2YFLB 1YHQ3 1E3RA 3LTBA 4HM0B 1N9JA 2BMOB 1W6GA 2QGUA 1R4CA 1NNVA 2W56B 4FCZA 5EQLA 5FW5A 1SIIA 3OX9A 1RGKA 1MWRA 2CFGA 2V1LA 4LYLB 1Q42A 3Q1CA 1BIRA 1ROAA 2MF7A 5TGNA 4N6MA 5IG3A 1JBTA 1TUHA 5JPPA 2W0QA 1US1A 1W2ZA 2CHCA 2ZL8A 2BHMA 4JF8A 5KP3A 1VZZA 3ER7A 3MG2A 1OPYA 1GD3A 4CPKA 3WA3A 3DGLA 1QVG2 1IT8A 5AI1A 1VQ53 4FR9A 1OH0A 2WGOA 2YFIB 4KVHA 1D6YA 4XDWA 3CPOA 2ZHXB 3N8BA 1YI23 3CXC2 1FA3A 3BNCA 1HKXA 2IA7A 4ILFA 2J8XB 5EVHA 3LMLA 1UCLA 1M904 4J9AA 1LQMB 3L0RA 5CF1A 2CWVA 3S28A 4R9KA 1FYSA 2KF4A 1RGCA 4FCMA 1DE3A 3CNMA 4WP5A 3G6E3 3ZG0A 3CCS3 3OWUA 3AHWA 1WNHA 4HZBB 2Z6BA 3EC9A 4X2OA 4WYKA 4FCJA 5IG4A 1GMPA 1TRQA 1OHOA 1ZGXA 4R9LA 5D83A 3KFQC 3K0ZA 3NQYA 1OHPA 3JUOA 3WMDA 1Q864 3G713 1GMQA 1LQGC 3Q2PA 3D79A 4STDA 3NBJA 1T2IA 3FG4A 3V98A 1UUVB 1V57A 4H3UA 1I2GA 1RGFA 3OXAA 1PY3A 1WMNA 1K8A4 4NREA 1J2BA 5JPUA 3D4AA 5AIIA 3LTCA 1UI7A 3GZYB 3QK9A 4HAAA 1KC84 1YVSA 2Z76A 3MYTA 1AVKA 3PCRA 1K28A 4O02B 5IEOA 3N9HA 3OV4A 1VQM3 8RNTA 3CC43 2E2VA 1AQZA 1KWIA 1HZ1A 2IUKA 2W56A 5G1KA 4R4KA 1YIJ3 1R4YA 2GSPA 3CC23 5IW9A 3MSOA 3WHOA 1UGHI 3LTAA 3SLUA 4I4KA 1E97A
chains in the Genus database with same CATH topology
2W6JH 2CH9A 3NBBA 2PZVA 4LSOA 4HM7B 3I553 5KP1A 3CCE3 1E3VA 4LEHA 5D82A 2RGQA 2Y73A 1NB3I 2K0MA 2R4IA 3RDEA 1LXEA 1JB5A 1A2KA 4XBYA 3LXUX 4K90B 2RCDA 1U5OA 2M7OA 1IVVA 3PGBA 2RFRA 4LMIA 4N6LA 3S27A 1OGXA 2CK3H 4HM6B 3DY5A 1TP6A 4ZM8A 1JNQA 1A67A 2OOVC 3VGNA 3F8HA 3K5TA 4RNZA 4WHAA 4EYCA 3U97A 5G2GA 2CG0A 3X40A 2XFSA 1VQP3 1FGMA 3F14A 1VQN3 2FGTA 1GS3A 1EG9B 1O7NB 3JUMA 2BMQB 4HM8B 3CC73 1QVF2 1N8R4 4N6UA 1YJN3 2BO9B 3G8ZA 3B8LA 4IIAA 3D3LA 3ECFA 1QMAA 1JV2B 3J7Yd 7STDA 3FZWA 1ULIB 3HI7A 5AYRB 4IPBA 3IPTA 2CWTA 4GB5A 3BNBA 1SPUA 2CG1A 2OWPA 2UX0A 3BLZA 2GU1A 4O8SA 1YJ93 2BNGA 2GEYA 3EB8A 3F40A 3MKIA 1BUQA 1MNLA 2OCTA 5IENA 1EKMA 3DGMA 3WA2X 1NWWA 1RRLA 2A15A 3NM2A 1FGRA 3BNDA 2W03A 1IV9A 2XFTA 2JDIH 2W9PA 3FF2A 2HMLB 3LOYA 2HMJB 3EJVA 2WO0A 2FXTA 3SOAA 3ROBA 2Z7AA 2P09A 1V74A 1W6YA 1WMPA 1SJWA 4HM2B 4KZ1A 1ISKA 1VQ63 1S723 1STDA 2CC3A 5AIHA 2W2CA 4HBRA 5HGRA 4KFDA 3SEDA 4OUQA 2B24B 3EN8A 3PCSA 3GZRA 1FUWA 6STDA 2OQEA 3GWRA 3M8CA 5CF2A 2XGNA 4R1KA 1UI8A 1OCVA 5CXOA 3S5CA 3STDA 4H61A 1DVDA 3KSPA 1IU7A 1GY5A 2HMMB 1ROVA 4N6TA 3PS8A 2ML6A 1YGEA 3G16A 1Q40B 2D1WA 1W5ZA 3X41A 2P05A 3KE7A 4HYZA 3LZAA 3X42A 2XSHB 1NO3A 2HMKB 2MC8A 1ZX2A 3FG1A 3EN1B 3SXXA 3GRDA 5IG0A 3N54B 1VQO3 1O7HB 3NBRA 4MJDA 1Q824 4L7KA 4PEJA 1TFKA 1L5GB 2XRXB 3WDGB 2WOFA 3CCL3 3NV0B 3GZBA 1NU3A 1W02A 2RSXA 1UW1A 1PU4A 2BMRB 1LVNA 3DXOA 4HM1B 5IG5A 2STDA 1RJOA 3RGAA 3K63A 1IQXA 1WMOA 1OHSA 3DM8A 1K41A 1N8QA 2CWUA 1KD14 3FH1A 3KKGA 1YIT3 4K1VA 1OF5B 3F7SA 4N6NB 1WQLB 1T5YA 4XM4A 5AYSC 4J8TA 3CPW2 4NHFA 4EC6A 2IUJA 3RGRA 1RRHA 3EBYA 2XH9A 1FGOA 3SX1A 1IVWA 2GBWB 1A2VA 3JUNA 2K54A 3UNLA 3GZXB 3CCU3 1OGZA 1JB4A 2CFDA 4XDVA 1D6UA 2D42A 4OK0A 1JKGB 4GL6A 3FLJA 1LOXA 1C7HA 4EXRA 1AV4A 3HX8A 4XB5A 4XBTA 3ALAA 3F8XA 3V92A 1Q40A 5IEPA 4MEIA 1ULJB 4IT7A 1VQ93 1QJGA 2CKFB 1PFPA 4N3VA 3X3XA 5CLKA 2XEPA 3U1WA 1CYVA 3NHXA 2I9WA 5CK6A 2E2UA 4WFOA 4K61A 4HZ9B 2YX9A 3NV0A 2IMJA 1VQ73 3LT8A 3OWYA 4QWTA 3EX9A 1YVBI 4G1MB 3CCR3 2LQVA 4Q53A 5ELUA 3CCM3 3E99A 2CW9A 1GY6A 1K734 2C10A 1FGQA 1M1XB 1N5HA 1QAFA 5D81A 1CYUA 3MWZA 1RN7A 3T0UA 4HM4B 3CMA3 1O7PB 3HIGA 1OF5A 3FG3A 1G96A 2ZDJA 3OWSA 1QAKA 1Z1SA 1M1K4 4RNYA 1IDPA 2B1XB 3QRDA 3UJMA 2P0XA 4FMCA 3CD63 3A76A 1K9M4 1S5AA 2L4VA 4HM5B 2PNCA 8CHOA 3HIIA 4FMDA 3OW22 1JKGA 3EF8A 2GEXA 1DYUA 2KCDA 3LH4A 2HMOB 1O7GB 1W7CA 5EEOA 4EBGA 1W00A 3CME3 4HKVB 3VF1A 4XBXA 1DMQA 1ZO2A 4KFEA 2BT3A 2GU3A 2Q07A 4EV5A 4U13A 3T8UA 1OUNA 2F98A 2QEX3 3IJEB 2ML5A 1DVCA 1VQ83 3PXMA 3NX0A 1JN5B 4LZIA 3WOEB 4AEQA 3FGYA 4MMYB 1TIJA 1IK3A 4BTWA 1UUWB 3B4OA 4TX4A 2QA43 3CCV3 4HJLB 5IF6A 1LNHA 2W9QA 1VQ43 2YFJB 3Q90A 1GD4A 2C11A 2KXGA 3KIIA 3JUQA 3KZTA 4R80A 1W6CA 2HMNB 3CU3A 1TU5A 4L8OA 3GAXA 2XF3A 3EHCA 2O3OA 3K7CA 5AEUB 1A90A 2LYXA 5A0OB 5KP4A 3CNXA 5BVBA 3LTDA 3JUPA 1SQWA 4LGQA 3SVAA 3AMOB 3B7CA 1W01A 2JQ5A 2OOVA 3VSYA 1JRQA 5AEWB 3O8YA 4RZMA 1GYBA 3LYGA 3H3HA 3EBTA 5I97A 2P0MA 2GBXB 3KN4A 4N6OB 3UL5A 4AKZA 1ASKA 1NJI4 3S67A 3MG3A 1F8NA 5LC6A 4MMZB 4X2HA 3H51A 4KFFA 3S29A 1TFOA 2SBLA 3LT9A 3V99A 2XR8B 2CFKA 4OVMA 3WODG 4K1UA 3T8NA 3HZPA 3NQZA 1VQK3 4ORLA 3TDGA 1D6ZA 4L8PA 3B4PA 1JN5A 1MOLA 1O7WB 3BNEA 1N5PA 3X3ZA 3G0KA 1CQSA 4MMXB 3HK4A 2OQEC 3NM7A 5AIFA 1YJW3 1JB2A 3DGOA 3KSED 5FGOA 3UB1A 2WGQA 2Y74A 3CCQ3 3DUKA 3FCSB 3BB9A 2O9UX 2GXFA 3DMCA 4RBNA 4BTYA 3CCJ3 1W4NA 3PYJA 5BXQA 4HVNA 3SOYA 1QALA 3D9RA 5ELJA 2XGLA 4AKYA 5IERA 4WWUC 4EV2A 1EA2A 3EE1A 5DREA 1KQS2 1SIHA 2Z77A 3JVCA 1RKYA 3PZWA 1CEWI 1AR0A 1IVUA 1IQYA 1N9EA 3MPHA 1W2B2 3AMOA 1AVLA 4FMBA 3FSDA 4CDLA 1JJ22 2FNQA 3FF0A 4N6V0 3G4S3 1Y4KA 1IVXA 2F86B 2INXA 3F7XA 5JBSA 1OACA 3F9SA 3FKAA 1DMMA 1KSIA 5AIGA 1IT7A 2P38A 1IQ8A 1STFI 3IMAB 3WOFB 3MG1A 1Q7Y4 3K9MC 1NDOB 3UL6A 2E2TA 2CFWA 3NXJA 1Q814 1EQKA 3I0YA 2CFLA 5LC7A 2XSOB 2QIYA 5DRVA 1M9GA 2WOHA 1GY7A 2CIUA 4HM3B 2OTL3 2W04A 3DZLA 2KRTA 3EQQB 3DGNA 5STDA 2OTJ3 4WYKB 4FMAA 2F99A 3NUVA 4BTXA 4O2HA 1HU9A 1O7MB 4CCVA 4JRFA 3I563 1U8CB 1WTHA 4O3VA 1NB5I 1VQL3 1DMNA 3X3YA 3MHEA 1IV7A 1FGTA 2YFLB 1YHQ3 1E3RA 3LTBA 4HM0B 1N9JA 2BMOB 1W6GA 2QGUA 1R4CA 2W56B 4FCZA 5EQLA 5FW5A 1SIIA 3OX9A 2CFGA 2V1LA 1Q42A 3Q1CA 1ROAA 2MF7A 5TGNA 4N6MA 5IG3A 1TUHA 5JPPA 2ZL8A 1US1A 1W2ZA 2CHCA 2W0QA 2BHMA 4JF8A 5KP3A 1VZZA 3ER7A 3MG2A 1OPYA 1GD3A 3WA3A 3DGLA 1QVG2 1IT8A 5AI1A 1VQ53 4FR9A 1OH0A 2WGOA 2YFIB 4KVHA 1D6YA 4XDWA 3CPOA 3N8BA 1YI23 1FA3A 3CXC2 3BNCA 1HKXA 2IA7A 5EVHA 3LMLA 1M904 4J9AA 3L0RA 5CF1A 2CWVA 3S28A 4R9KA 4FCMA 3CNMA 4WP5A 3G6E3 3CCS3 3OWUA 1WNHA 4HZBB 2Z6BA 3EC9A 4X2OA 4WYKA 4FCJA 5IG4A 1OHOA 5D83A 4R9LA 3KFQC 3K0ZA 3NQYA 1OHPA 3JUOA 3WMDA 1Q864 3G713 3Q2PA 4STDA 3NBJA 3FG4A 3V98A 1UUVB 4H3UA 3OXAA 1WMNA 1K8A4 4NREA 1J2BA 5JPUA 5AIIA 3LTCA 1UI7A 3GZYB 3QK9A 1KC84 2Z76A 3MYTA 1AVKA 3PCRA 1K28A 4O02B 5IEOA 3N9HA 3OV4A 1VQM3 3CC43 2E2VA 1KWIA 2IUKA 2W56A 4R4KA 1YIJ3 3CC23 5IW9A 3MSOA 3LTAA 3SLUA 4I4KA 1E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9M C;  3UL6 A;  2CH9 A;  1EQK A;  1DVC A;  3PXM A;  3NX0 A;  4LZI A;  1NB3 I;  5LC7 A;  1LXE A;  1TIJ A;  1M9G A;  4TX4 A;  2W9Q A;  1GD4 A;  2KXG A;  4N6L A;  4ZM8 A;  1A67 A;  4N6N B;  3GAX A;  4CCV A;  4EYC A;  1A90 A;  1NB5 I;  5A0O B;  3SVA A;  1IV7 A;  4N6U A;  2BO9 B;  1N9J A;  1R4C A;  5EQL A;  4N6O B;  3UL5 A;  3S67 A;  1ROA A;  4N6M A;  2OCT A;  5LC6 A;  1MNL A;  4IT7 A;  1GD3 A;  1PFP A;  1FA3 A;  1CYV A;  1IV9 A;  2W9P A;  1MOL A;  1N5P A;  3L0R A;  1YVB I;  3KSE D;  5ELU A;  1WNH A;  1CYU A;  1N5H A;  2O9U X;  3MWZ A;  3PYJ A;  1RN7 A;  3KFQ C;  5ELJ A;  1FUW A;  1G96 A;  3Q2P A;  1CEW I;  1DVD A;  3QRD A;  4N6T A;  3PS8 A;  4N6V 0;  3LH4 A;  1KWI A;  3IMA B;  1STF I; 
#chains in the Genus database with same CATH topology
 2W6J H;  2CH9 A;  3NBB A;  2PZV A;  4LSO A;  4HM7 B;  3I55 3;  5KP1 A;  3CCE 3;  1E3V A;  4LEH A;  5D82 A;  2RGQ A;  2Y73 A;  1NB3 I;  2K0M A;  2R4I A;  3RDE A;  1LXE A;  3KCH A;  1JB5 A;  1A2K A;  2KF6 A;  1X1Y A;  5M1A A;  1BNR A;  4XBY A;  2C4B A;  3LXU X;  4K90 B;  2RCD A;  1U5O A;  2M7O A;  1IVV A;  1RGH A;  3PGB A;  2RFR A;  4LMI A;  4N6L A;  3S27 A;  1OGX A;  1SAR A;  2CK3 H;  4HM6 B;  1B27 A;  3DY5 A;  1TP6 A;  4ZM8 A;  1JNQ A;  1A67 A;  2OOV C;  3VGN A;  3F8H A;  1TRP A;  3K5T A;  4RNZ A;  4WHA A;  4EYC A;  3U97 A;  5G2G A;  2CG0 A;  3X40 A;  2XFS A;  2F56 A;  1BRH A;  1VQP 3;  1FGM A;  1Q9E A;  1RDS A;  1I3F A;  2H0H A;  2AAD A;  2IY2 A;  3F14 A;  1B2M A;  1VQN 3;  3DGY A;  2FGT A;  1GS3 A;  1EG9 B;  1O7N B;  3JUM A;  2BMQ B;  4HM8 B;  4BU4 A;  3CC7 3;  1N8R 4;  1QVF 2;  1BAN A;  4N6U A;  1YJN 3;  2BO9 B;  3G8Z A;  3B8L A;  3BND A;  1Q7H A;  4IIA A;  2F5M A;  3D3L A;  2CX0 A;  3ECF A;  1QMA A;  4EW5 A;  1JV2 B;  3J7Y d;  7STD A;  1BRN L;  3FZW A;  1ULI B;  3HI7 A;  5AYR B;  4IPB A;  3IPT A;  2CWT A;  1MGW A;  4GB5 A;  3BNB A;  1SPU A;  2CG1 A;  2OWP A;  1UUG B;  2UX0 A;  3BLZ A;  2GU1 A;  4O8S A;  1YJ9 3;  2BNG A;  2GEY A;  3EB8 A;  3F40 A;  3MKI A;  1BUQ A;  1MNL A;  1RLS A;  2OCT A;  3RNT A;  5IEN A;  1BNI A;  1EKM A;  3DGM A;  3WA2 X;  1NWW A;  1RRL A;  2A15 A;  3NM2 A;  1FGR A;  2ZA4 A;  1BSB A;  2W03 A;  1B2X A;  1RSN A;  1IV9 A;  2XFT A;  2JDI H;  2W9P A;  3FF2 A;  1JBS A;  2HML B;  3LOY A;  2HMJ B;  3EJV A;  2WO0 A;  2FXT A;  3SOA A;  1EUI C;  2Z7A A;  3ROB A;  1BGS A;  2P09 A;  1V74 A;  1W6Y A;  1WMP A;  1UCK A;  1SJW A;  4HM2 B;  4KZ1 A;  1ISK A;  1VQ6 3;  1S72 3;  1STD A;  2CC3 A;  5AIH A;  1X1X A;  2W2C A;  4HBR A;  5HGR A;  3SYU A;  4KFD A;  3SED A;  4OUQ A;  2B24 B;  1JBR A;  3EN8 A;  3PCS A;  3GZR A;  1FUW A;  1T2H A;  6STD A;  2F5W A;  2OQE A;  3GWR A;  3M8C A;  5CF2 A;  2XGN A;  4R1K A;  1FZU A;  1RTU A;  1UI8 A;  1OCV A;  5CXO A;  1BRG A;  3S5C A;  2AAE A;  3STD A;  4H61 A;  1HYF A;  3D5I A;  3KSP A;  1RGE A;  1IU7 A;  1DVD A;  5M18 A;  1GY5 A;  2HMM B;  1ROV A;  4N6T A;  3PS8 A;  1RNT A;  1YGE A;  2ML6 A;  3G16 A;  1Q40 B;  2D1W A;  1W5Z A;  3X41 A;  2P05 A;  1GOY A;  3KE7 A;  4HYZ A;  3LZA A;  3X42 A;  1LRA A;  1NO3 A;  2HMK B;  2XSH B;  2MC8 A;  1ZX2 A;  3FG1 A;  1RCK A;  3EN1 B;  3SXX A;  3GRD A;  5IG0 A;  1UDI I;  3N54 B;  1VQO 3;  1O7H B;  1B21 A;  3NBR A;  4HOH A;  4MJD A;  1Q82 4;  4L7K A;  4PEJ A;  1TFK A;  3BIR A;  2XRX B;  1L5G B;  3WDG B;  2WOF A;  3CCL 3;  3NV0 B;  1I2F A;  3GZB A;  1NU3 A;  1W02 A;  2RSX A;  1UW1 A;  1PU4 A;  1IYY A;  2BMR B;  1LVN A;  3DXO A;  4HM1 B;  5IG5 A;  2STD A;  1RJO A;  3RGA A;  3K63 A;  4BL3 A;  1IQX A;  1WMO A;  1AY7 A;  1OHS A;  3DM8 A;  1K41 A;  1N8Q A;  2CWU A;  3D5G A;  3FH1 A;  1KD1 4;  1GMR A;  4J5K A;  1RNB A;  2HOH A;  3KKG A;  1X1W A;  1YIT 3;  4K1V A;  1OF5 B;  1RN1 A;  3F7S A;  1WQL B;  1T5Y A;  4N6N B;  2RBI A;  4XM4 A;  4J8T A;  5AYS C;  4NHF A;  4EC6 A;  4KT3 B;  2IUJ A;  3RGR A;  1RRH A;  3CPW 2;  3EBY A;  2XH9 A;  1I8V A;  7GSP A;  1FGO A;  4I5Q A;  1IVW A;  1YNV X;  2GBW B;  1RGG A;  3Q3F A;  1A2V A;  5GSP A;  3SX1 A;  1I0X A;  3JUN A;  2K54 A;  3UNL A;  3GZX B;  3CCU 3;  1OGZ A;  1JB4 A;  2CFD A;  4XDV A;  1D6U A;  2D42 A;  4OK0 A;  1JKG B;  4GL6 A;  3FLJ A;  5RNT A;  1LOX A;  1C7H A;  1MWS A;  4EXR A;  1AV4 A;  1G02 A;  3HX8 A;  4XBT A;  4XB5 A;  3ALA A;  3F8X A;  3V92 A;  1Q40 A;  5IEP A;  1RGL A;  4MEI A;  3AHS A;  1JZO A;  1CH0 A;  2UGI A;  1UCI A;  1UCJ A;  1PYL A;  1ULJ B;  4IT7 A;  6GSP A;  1VQ9 3;  1QJG A;  1LOV A;  2CKF B;  1PFP A;  4N3V A;  3X3X A;  5CLK A;  2XEP A;  3U1W A;  1CYV A;  1I3I A;  1TTO A;  3NHX A;  2I9W A;  5CK6 A;  2E2U A;  4WFO A;  4K61 A;  4HZ9 B;  4BL2 A;  2YX9 A;  3NV0 A;  2IMJ A;  1VQ7 3;  1BAO A;  2IYJ A;  3LT8 A;  2F4Y A;  3OWY A;  3EX9 A;  1YVB I;  4G1M B;  1BRI A;  2LQV A;  4Q53 A;  4QWT A;  3CCR 3;  5ELU A;  3CCM 3;  1BU4 A;  3E99 A;  1LNI A;  2CW9 A;  1GY6 A;  9RNT A;  1K73 4;  2C10 A;  1FGQ A;  1M1X B;  1BSA A;  1N5H A;  1QAF A;  5D81 A;  1CYU A;  3MWZ A;  1RN7 A;  4RNT A;  4HM4 B;  3T0U A;  1O7P B;  3CMA 3;  3HIG A;  1RN4 A;  1OF5 A;  3FG3 A;  1G96 A;  1I2E A;  2ZDJ A;  3OWS A;  1QAK A;  4CJN A;  1Z1S A;  1M1K 4;  5BIR A;  4RNY A;  5M19 A;  3ZFZ A;  5BU4 A;  1IDP A;  2B1X B;  3QRD A;  3UJM A;  2P0X A;  4FMC A;  3CD6 3;  3A76 A;  1K9M 4;  1S5A A;  2L4V A;  4HM5 B;  2PNC A;  4J5G A;  8CHO A;  1GOV A;  2R41 A;  3HII A;  4FMD A;  1UGI A;  3OW2 2;  1JKG A;  3EF8 A;  2GEX A;  1JZD A;  2SAR A;  1DYU A;  2KCD A;  1BNG A;  2RNT A;  2HMO B;  1O7G B;  1W7C A;  3GSP A;  3LH4 A;  5EEO A;  1MWU A;  4EBG A;  1W00 A;  3CME 3;  4HKV B;  1DET A;  3VF1 A;  4XBX A;  1DMQ A;  1ZO2 A;  4KFE A;  2BT3 A;  2GU3 A;  2Q07 A;  4EV5 A;  4U13 A;  1BSD A;  2K3D A;  3T8U A;  1B2S A;  1OUN A;  2F98 A;  3AGO A;  2QEX 3;  3IJE B;  2ML5 A;  1DVC A;  1VQ8 3;  3PXM A;  3NX0 A;  1JN5 B;  4LZI A;  3WOE B;  4AEQ A;  3FGY A;  4MMY B;  1BRJ A;  1TIJ A;  1BUJ A;  1ZS7 A;  1IK3 A;  4BTW A;  1UUW B;  3B4O A;  4TX4 A;  2QA4 3;  3CCV 3;  4HJL B;  5IF6 A;  1LNH A;  2W9Q A;  1VQ4 3;  2YFJ B;  3Q90 A;  1GD4 A;  2C11 A;  2KXG A;  3KII A;  3JUQ A;  3KZT A;  4R80 A;  1W6C A;  2HMN B;  3CU3 A;  1TU5 A;  5HOH A;  5G1L A;  4L8O A;  3GAX A;  2XF3 A;  3EHC A;  2O3O A;  3K7C A;  5AEU B;  1A90 A;  2LYX A;  5A0O B;  5KP4 A;  3CNX A;  5BVB A;  3LTD A;  1RCL A;  3JUP A;  1SQW A;  4LGQ A;  3SVA A;  3AMO B;  3B7C A;  1W01 A;  2JQ5 A;  2OOV A;  3VSY A;  1JRQ A;  5AEW B;  3O8Y A;  4RZM A;  1GYB A;  1B2U A;  1LOY A;  3HOH A;  3LYG A;  3H3H A;  3EBT A;  5I97 A;  2P0M A;  2GBX B;  2H0G A;  3KN4 A;  4N6O B;  3UL5 A;  4AKZ A;  1ASK A;  1NJI 4;  3S67 A;  3MG3 A;  1F8N A;  5LC6 A;  4MMZ B;  4X2H A;  3H51 A;  1B20 A;  4KFF A;  3S29 A;  2KF5 A;  1TFO A;  2SBL A;  1RGA A;  2L1S A;  3LT9 A;  3V99 A;  1BNE A;  2CFK A;  2UUG C;  1BNF A;  2XR8 B;  4OVM A;  3WOD G;  4K1U A;  1GSP A;  1MWT A;  1FUT A;  3T8N A;  3HZP A;  3NQZ A;  1VQK 3;  1EEJ A;  4ORL A;  3TDG A;  1D6Z A;  4L8P A;  3B4P A;  1JN5 A;  1MOL A;  1O7W B;  1RMS A;  3BNE A;  1N5P A;  1RHL A;  2BU4 A;  3G0K A;  1CQS A;  1I0V A;  4MMX B;  3X3Z A;  3HK4 A;  3WR2 A;  2OQE C;  3NM7 A;  5AIF A;  1YJW 3;  1JB2 A;  3DGO A;  3KSE D;  1B3S A;  5FGO A;  3UB1 A;  2WGQ A;  2Y74 A;  3CCQ 3;  3DUK A;  1G0T A;  3FCS B;  3BB9 A;  2BIR A;  1B2Z A;  2O9U X;  4GSP A;  1T3B A;  2GXF A;  1VQQ A;  3DMC A;  4RBN A;  4BTY A;  1W4N A;  3PYJ A;  3CCJ 3;  5BXQ A;  4HVN A;  3SOY A;  4GHO A;  1QAL A;  3D9R A;  5ELJ A;  2XGL A;  4AKY A;  1TJD A;  4WWU C;  4BIR A;  1EA2 A;  4EV2 A;  5IER A;  1BRK A;  3EE1 A;  5DRE A;  1KQS 2;  1SIH A;  2Z77 A;  1BSE A;  3JVC A;  1RKY A;  1LOW A;  3PZW A;  1CEW I;  1AR0 A;  1IVU A;  1IQY A;  1N9E A;  2CX1 A;  3MPH A;  1W2B 2;  1BNJ A;  3AMO A;  1AVL A;  4FMB A;  6RNT A;  3FSD A;  4CDL A;  3DH2 A;  1JJ2 2;  2FNQ A;  3FF0 A;  4N6V 0;  3G4S 3;  1Y4K A;  1IVX A;  2F86 B;  2INX A;  3F7X A;  5JBS A;  1OAC A;  3F9S A;  3FKA A;  1DMM A;  1KSI A;  1BVI A;  2KF3 A;  5AIG A;  1IT7 A;  3AGN A;  2P38 A;  1IQ8 A;  1STF I;  3IMA B;  3WOF B;  1YGW A;  3MG1 A;  1Q7Y 4;  3K9M C;  1NDO B;  3UL6 A;  2E2T A;  2CFW A;  1MGR A;  3NXJ A;  1Q81 4;  1EQK A;  3I0Y A;  2CFL A;  1FUS A;  3A5E A;  1FW7 A;  5LC7 A;  2XSO B;  3ZG5 A;  2QIY A;  5DRV A;  1M9G A;  2WOH A;  1GY7 A;  1GOU A;  2CIU A;  4HM3 B;  2OTL 3;  2W04 A;  3URP A;  3DZL A;  2KRT A;  1I70 A;  3EQQ B;  4DKI A;  3DGN A;  1BSC A;  5STD A;  2OTJ 3;  4WYK B;  4FMA A;  1BNS A;  2F99 A;  3NUV A;  4BTX A;  3BU4 A;  2H0I A;  1C54 A;  4O2H A;  1HU9 A;  1O7M B;  1V58 A;  4CCV A;  4JRF A;  3I56 3;  1BOX A;  4NPB A;  1U8C B;  1BRS A;  1WTH A;  7RNT A;  1A2P A;  4O3V A;  1NB5 I;  2KAA A;  1VQL 3;  1DMN A;  3X3Y A;  1X1U A;  3MHE A;  1IV7 A;  1FGT A;  2YFL B;  1YHQ 3;  1E3R A;  3LTB A;  4HM0 B;  1N9J A;  2BMO B;  1W6G A;  2QGU A;  1R4C A;  1NNV A;  2W56 B;  4FCZ A;  5EQL A;  5FW5 A;  1SII A;  3OX9 A;  1RGK A;  1MWR A;  2CFG A;  2V1L A;  4LYL B;  1Q42 A;  3Q1C A;  1BIR A;  1ROA A;  2MF7 A;  5TGN A;  4N6M A;  5IG3 A;  1JBT A;  1TUH A;  5JPP A;  2W0Q A;  1US1 A;  1W2Z A;  2CHC A;  2ZL8 A;  2BHM A;  4JF8 A;  5KP3 A;  1VZZ A;  3ER7 A;  3MG2 A;  1OPY A;  1GD3 A;  4CPK A;  3WA3 A;  3DGL A;  1QVG 2;  1IT8 A;  5AI1 A;  1VQ5 3;  4FR9 A;  1OH0 A;  2WGO A;  2YFI B;  4KVH A;  1D6Y A;  4XDW A;  3CPO A;  2ZHX B;  3N8B A;  1YI2 3;  3CXC 2;  1FA3 A;  3BNC A;  1HKX A;  2IA7 A;  4ILF A;  2J8X B;  5EVH A;  3LML A;  1UCL A;  1M90 4;  4J9A A;  1LQM B;  3L0R A;  5CF1 A;  2CWV A;  3S28 A;  4R9K A;  1FYS A;  2KF4 A;  1RGC A;  4FCM A;  1DE3 A;  3CNM A;  4WP5 A;  3G6E 3;  3ZG0 A;  3CCS 3;  3OWU A;  3AHW A;  1WNH A;  4HZB B;  2Z6B A;  3EC9 A;  4X2O A;  4WYK A;  4FCJ A;  5IG4 A;  1GMP A;  1TRQ A;  1OHO A;  1ZGX A;  4R9L A;  5D83 A;  3KFQ C;  3K0Z A;  3NQY A;  1OHP A;  3JUO A;  3WMD A;  1Q86 4;  3G71 3;  1GMQ A;  1LQG C;  3Q2P A;  3D79 A;  4STD A;  3NBJ A;  1T2I A;  3FG4 A;  3V98 A;  1UUV B;  1V57 A;  4H3U A;  1I2G A;  1RGF A;  3OXA A;  1PY3 A;  1WMN A;  1K8A 4;  4NRE A;  1J2B A;  5JPU A;  3D4A A;  5AII A;  3LTC A;  1UI7 A;  3GZY B;  3QK9 A;  4HAA A;  1KC8 4;  1YVS A;  2Z76 A;  3MYT A;  1AVK A;  3PCR A;  1K28 A;  4O02 B;  5IEO A;  3N9H A;  3OV4 A;  1VQM 3;  8RNT A;  3CC4 3;  2E2V A;  1AQZ A;  1KWI A;  1HZ1 A;  2IUK A;  2W56 A;  5G1K A;  4R4K A;  1YIJ 3;  1R4Y A;  2GSP A;  3CC2 3;  5IW9 A;  3MSO A;  3WHO A;  1UGH I;  3LTA A;  3SLU A;  4I4K A;  1E97 A; 
#chains in the Genus database with same CATH homology
 2W6J H;  2CH9 A;  3NBB A;  2PZV A;  4LSO A;  4HM7 B;  3I55 3;  5KP1 A;  3CCE 3;  1E3V A;  4LEH A;  5D82 A;  2RGQ A;  2Y73 A;  1NB3 I;  2K0M A;  2R4I A;  3RDE A;  1LXE A;  1JB5 A;  1A2K A;  4XBY A;  3LXU X;  4K90 B;  2RCD A;  1U5O A;  2M7O A;  1IVV A;  3PGB A;  2RFR A;  4LMI A;  4N6L A;  3S27 A;  1OGX A;  2CK3 H;  4HM6 B;  3DY5 A;  1TP6 A;  4ZM8 A;  1JNQ A;  1A67 A;  2OOV C;  3VGN A;  3F8H A;  3K5T A;  4RNZ A;  4WHA A;  4EYC A;  3U97 A;  5G2G A;  2CG0 A;  3X40 A;  2XFS A;  1VQP 3;  1FGM A;  3F14 A;  1VQN 3;  2FGT A;  1GS3 A;  1EG9 B;  1O7N B;  3JUM A;  2BMQ B;  4HM8 B;  3CC7 3;  1QVF 2;  1N8R 4;  4N6U A;  1YJN 3;  2BO9 B;  3G8Z A;  3B8L A;  4IIA A;  3D3L A;  3ECF A;  1QMA A;  1JV2 B;  3J7Y d;  7STD A;  3FZW A;  1ULI B;  3HI7 A;  5AYR B;  4IPB A;  3IPT A;  2CWT A;  4GB5 A;  3BNB A;  1SPU A;  2CG1 A;  2OWP A;  2UX0 A;  3BLZ A;  2GU1 A;  4O8S A;  1YJ9 3;  2BNG A;  2GEY A;  3EB8 A;  3F40 A;  3MKI A;  1BUQ A;  1MNL A;  2OCT A;  5IEN A;  1EKM A;  3DGM A;  3WA2 X;  1NWW A;  1RRL A;  2A15 A;  3NM2 A;  1FGR A;  3BND A;  2W03 A;  1IV9 A;  2XFT A;  2JDI H;  2W9P A;  3FF2 A;  2HML B;  3LOY A;  2HMJ B;  3EJV A;  2WO0 A;  2FXT A;  3SOA A;  3ROB A;  2Z7A A;  2P09 A;  1V74 A;  1W6Y A;  1WMP A;  1SJW A;  4HM2 B;  4KZ1 A;  1ISK A;  1VQ6 3;  1S72 3;  1STD A;  2CC3 A;  5AIH A;  2W2C A;  4HBR A;  5HGR A;  4KFD A;  3SED A;  4OUQ A;  2B24 B;  3EN8 A;  3PCS A;  3GZR A;  1FUW A;  6STD A;  2OQE A;  3GWR A;  3M8C A;  5CF2 A;  2XGN A;  4R1K A;  1UI8 A;  1OCV A;  5CXO A;  3S5C A;  3STD A;  4H61 A;  1DVD A;  3KSP A;  1IU7 A;  1GY5 A;  2HMM B;  1ROV A;  4N6T A;  3PS8 A;  2ML6 A;  1YGE A;  3G16 A;  1Q40 B;  2D1W A;  1W5Z A;  3X41 A;  2P05 A;  3KE7 A;  4HYZ A;  3LZA A;  3X42 A;  2XSH B;  1NO3 A;  2HMK B;  2MC8 A;  1ZX2 A;  3FG1 A;  3EN1 B;  3SXX A;  3GRD A;  5IG0 A;  3N54 B;  1VQO 3;  1O7H B;  3NBR A;  4MJD A;  1Q82 4;  4L7K A;  4PEJ A;  1TFK A;  1L5G B;  2XRX B;  3WDG B;  2WOF A;  3CCL 3;  3NV0 B;  3GZB A;  1NU3 A;  1W02 A;  2RSX A;  1UW1 A;  1PU4 A;  2BMR B;  1LVN A;  3DXO A;  4HM1 B;  5IG5 A;  2STD A;  1RJO A;  3RGA A;  3K63 A;  1IQX A;  1WMO A;  1OHS A;  3DM8 A;  1K41 A;  1N8Q A;  2CWU A;  1KD1 4;  3FH1 A;  3KKG A;  1YIT 3;  4K1V A;  1OF5 B;  3F7S A;  4N6N B;  1WQL B;  1T5Y A;  4XM4 A;  5AYS C;  4J8T A;  3CPW 2;  4NHF A;  4EC6 A;  2IUJ A;  3RGR A;  1RRH A;  3EBY A;  2XH9 A;  1FGO A;  3SX1 A;  1IVW A;  2GBW B;  1A2V A;  3JUN A;  2K54 A;  3UNL A;  3GZX B;  3CCU 3;  1OGZ A;  1JB4 A;  2CFD A;  4XDV A;  1D6U A;  2D42 A;  4OK0 A;  1JKG B;  4GL6 A;  3FLJ A;  1LOX A;  1C7H A;  4EXR A;  1AV4 A;  3HX8 A;  4XB5 A;  4XBT A;  3ALA A;  3F8X A;  3V92 A;  1Q40 A;  5IEP A;  4MEI A;  1ULJ B;  4IT7 A;  1VQ9 3;  1QJG A;  2CKF B;  1PFP A;  4N3V A;  3X3X A;  5CLK A;  2XEP A;  3U1W A;  1CYV A;  3NHX A;  2I9W A;  5CK6 A;  2E2U A;  4WFO A;  4K61 A;  4HZ9 B;  2YX9 A;  3NV0 A;  2IMJ A;  1VQ7 3;  3LT8 A;  3OWY A;  4QWT A;  3EX9 A;  1YVB I;  4G1M B;  3CCR 3;  2LQV A;  4Q53 A;  5ELU A;  3CCM 3;  3E99 A;  2CW9 A;  1GY6 A;  1K73 4;  2C10 A;  1FGQ A;  1M1X B;  1N5H A;  1QAF A;  5D81 A;  1CYU A;  3MWZ A;  1RN7 A;  3T0U A;  4HM4 B;  3CMA 3;  1O7P B;  3HIG A;  1OF5 A;  3FG3 A;  1G96 A;  2ZDJ A;  3OWS A;  1QAK A;  1Z1S A;  1M1K 4;  4RNY A;  1IDP A;  2B1X B;  3QRD A;  3UJM A;  2P0X A;  4FMC A;  3CD6 3;  3A76 A;  1K9M 4;  1S5A A;  2L4V A;  4HM5 B;  2PNC A;  8CHO A;  3HII A;  4FMD A;  3OW2 2;  1JKG A;  3EF8 A;  2GEX A;  1DYU A;  2KCD A;  3LH4 A;  2HMO B;  1O7G B;  1W7C A;  5EEO A;  4EBG A;  1W00 A;  3CME 3;  4HKV B;  3VF1 A;  4XBX A;  1DMQ A;  1ZO2 A;  4KFE A;  2BT3 A;  2GU3 A;  2Q07 A;  4EV5 A;  4U13 A;  3T8U A;  1OUN A;  2F98 A;  2QEX 3;  3IJE B;  2ML5 A;  1DVC A;  1VQ8 3;  3PXM A;  3NX0 A;  1JN5 B;  4LZI A;  3WOE B;  4AEQ A;  3FGY A;  4MMY B;  1TIJ A;  1IK3 A;  4BTW A;  1UUW B;  3B4O A;  4TX4 A;  2QA4 3;  3CCV 3;  4HJL B;  5IF6 A;  1LNH A;  2W9Q A;  1VQ4 3;  2YFJ B;  3Q90 A;  1GD4 A;  2C11 A;  2KXG A;  3KII A;  3JUQ A;  3KZT A;  4R80 A;  1W6C A;  2HMN B;  3CU3 A;  1TU5 A;  4L8O A;  3GAX A;  2XF3 A;  3EHC A;  2O3O A;  3K7C A;  5AEU B;  1A90 A;  2LYX A;  5A0O B;  5KP4 A;  3CNX A;  5BVB A;  3LTD A;  3JUP A;  1SQW A;  4LGQ A;  3SVA A;  3AMO B;  3B7C A;  1W01 A;  2JQ5 A;  2OOV A;  3VSY A;  1JRQ A;  5AEW B;  3O8Y A;  4RZM A;  1GYB A;  3LYG A;  3H3H A;  3EBT A;  5I97 A;  2P0M A;  2GBX B;  3KN4 A;  4N6O B;  3UL5 A;  4AKZ A;  1ASK A;  1NJI 4;  3S67 A;  3MG3 A;  1F8N A;  5LC6 A;  4MMZ B;  4X2H A;  3H51 A;  4KFF A;  3S29 A;  1TFO A;  2SBL A;  3LT9 A;  3V99 A;  2XR8 B;  2CFK A;  4OVM A;  3WOD G;  4K1U A;  3T8N A;  3HZP A;  3NQZ A;  1VQK 3;  4ORL A;  3TDG A;  1D6Z A;  4L8P A;  3B4P A;  1JN5 A;  1MOL A;  1O7W B;  3BNE A;  1N5P A;  3X3Z A;  3G0K A;  1CQS A;  4MMX B;  3HK4 A;  2OQE C;  3NM7 A;  5AIF A;  1YJW 3;  1JB2 A;  3DGO A;  3KSE D;  5FGO A;  3UB1 A;  2WGQ A;  2Y74 A;  3CCQ 3;  3DUK A;  3FCS B;  3BB9 A;  2O9U X;  2GXF A;  3DMC A;  4RBN A;  4BTY A;  3CCJ 3;  1W4N A;  3PYJ A;  5BXQ A;  4HVN A;  3SOY A;  1QAL A;  3D9R A;  5ELJ A;  2XGL A;  4AKY A;  5IER A;  4WWU C;  4EV2 A;  1EA2 A;  3EE1 A;  5DRE A;  1KQS 2;  1SIH A;  2Z77 A;  3JVC A;  1RKY A;  3PZW A;  1CEW I;  1AR0 A;  1IVU A;  1IQY A;  1N9E A;  3MPH A;  1W2B 2;  3AMO A;  1AVL A;  4FMB A;  3FSD A;  4CDL A;  1JJ2 2;  2FNQ A;  3FF0 A;  4N6V 0;  3G4S 3;  1Y4K A;  1IVX A;  2F86 B;  2INX A;  3F7X A;  5JBS A;  1OAC A;  3F9S A;  3FKA A;  1DMM A;  1KSI A;  5AIG A;  1IT7 A;  2P38 A;  1IQ8 A;  1STF I;  3IMA B;  3WOF B;  3MG1 A;  1Q7Y 4;  3K9M C;  1NDO B;  3UL6 A;  2E2T A;  2CFW A;  3NXJ A;  1Q81 4;  1EQK A;  3I0Y A;  2CFL A;  5LC7 A;  2XSO B;  2QIY A;  5DRV A;  1M9G A;  2WOH A;  1GY7 A;  2CIU A;  4HM3 B;  2OTL 3;  2W04 A;  3DZL A;  2KRT A;  3EQQ B;  3DGN A;  5STD A;  2OTJ 3;  4WYK B;  4FMA A;  2F99 A;  3NUV A;  4BTX A;  4O2H A;  1HU9 A;  1O7M B;  4CCV A;  4JRF A;  3I56 3;  1U8C B;  1WTH A;  4O3V A;  1NB5 I;  1VQL 3;  1DMN A;  3X3Y A;  3MHE A;  1IV7 A;  1FGT A;  2YFL B;  1YHQ 3;  1E3R A;  3LTB A;  4HM0 B;  1N9J A;  2BMO B;  1W6G A;  2QGU A;  1R4C A;  2W56 B;  4FCZ A;  5EQL A;  5FW5 A;  1SII A;  3OX9 A;  2CFG A;  2V1L A;  1Q42 A;  3Q1C A;  1ROA A;  2MF7 A;  5TGN A;  4N6M A;  5IG3 A;  1TUH A;  5JPP A;  2ZL8 A;  1US1 A;  1W2Z A;  2CHC A;  2W0Q A;  2BHM A;  4JF8 A;  5KP3 A;  1VZZ A;  3ER7 A;  3MG2 A;  1OPY A;  1GD3 A;  3WA3 A;  3DGL A;  1QVG 2;  1IT8 A;  5AI1 A;  1VQ5 3;  4FR9 A;  1OH0 A;  2WGO A;  2YFI B;  4KVH A;  1D6Y A;  4XDW A;  3CPO A;  3N8B A;  1YI2 3;  1FA3 A;  3CXC 2;  3BNC A;  1HKX A;  2IA7 A;  5EVH A;  3LML A;  1M90 4;  4J9A A;  3L0R A;  5CF1 A;  2CWV A;  3S28 A;  4R9K A;  4FCM A;  3CNM A;  4WP5 A;  3G6E 3;  3CCS 3;  3OWU A;  1WNH A;  4HZB B;  2Z6B A;  3EC9 A;  4X2O A;  4WYK A;  4FCJ A;  5IG4 A;  1OHO A;  5D83 A;  4R9L A;  3KFQ C;  3K0Z A;  3NQY A;  1OHP A;  3JUO A;  3WMD A;  1Q86 4;  3G71 3;  3Q2P A;  4STD A;  3NBJ A;  3FG4 A;  3V98 A;  1UUV B;  4H3U A;  3OXA A;  1WMN A;  1K8A 4;  4NRE A;  1J2B A;  5JPU A;  5AII A;  3LTC A;  1UI7 A;  3GZY B;  3QK9 A;  1KC8 4;  2Z76 A;  3MYT A;  1AVK A;  3PCR A;  1K28 A;  4O02 B;  5IEO A;  3N9H A;  3OV4 A;  1VQM 3;  3CC4 3;  2E2V A;  1KWI A;  2IUK A;  2W56 A;  4R4K A;  1YIJ 3;  3CC2 3;  5IW9 A;  3MSO A;  3LTA A;  3SLU A;  4I4K A;  1E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...