3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
3NX0A 5A0OB 1CYUA 2W9QA 1EQKA 3PS8A 5ELUA 5LC6A 3SVAA 1A67A 3KSED 1A90A 1NB3I 2W9PA 3GAXA 1CEWI 1WNHA 4N6V0 4N6NB 1GD3A 3KFQC 4TX4A 3IMAB 3L0RA 1GD4A 1M9GA 1ROAA 1TIJA 3MWZA 3PYJA 1G96A 2BO9B 4EYCA 1FUWA 1FA3A 1R4CA 1IV7A 1YVBI 2OCTA 1IV9A 4N6OB 5ELJA 4N6MA 2KXGA 3LH4A 1MNLA 1KWIA 1STFI 3K9MC 1RN7A 4IT7A 1CYVA 3PXMA 3UL6A 4ZM8A 2CH9A 4N6TA 4CCVA 1DVCA 1LXEA 3Q2PA 4LZIA 1N9JA 1MOLA 1PFPA 4N6LA 1DVDA 3S67A 1N5HA 4N6UA 1NB5I 1N5PA 3UL5A 2O9UX 3QRDA 5EQLA 5LC7A
chains in the Genus database with same CATH superfamily
3AHSA 5BXQA 1K9M4 1ZS7A 2W9QA 2HMKB 3BNCA 3RGAA 4IPBA 1BRJA 2CFLA 3GZRA 3KSED 1FGRA 1PU4A 3KIIA 2P0XA 2ZL8A 3ZG5A 1BNIA 2C11A 5CF2A 1QMAA 2ZHXB 3FSDA 3MWZA 3NXJA 4EYCA 1FA3A 2CC3A 1GYBA 2RFRA 2SARA 5KP3A 1O7NB 1YJW3 1NU3A 2IY2A 2GEXA 1I2EA 1UGIA 3MPHA 4HAAA 4FCJA 4RZMA 1JBTA 4EV2A 1VQ83 2Q07A 1I2FA 3S67A 1NB5I 1IQ8A 1KSIA 1FYSA 2GBWB 2O9UX 3FGYA 3KKGA 2K3DA 1JZDA 3TDGA 1I8VA 3DM8A 4XBYA 1BSCA 1NB3I 3GAXA 4BU4A 1N8QA 1U5OA 2HMLB 2PNCA 1I0VA 4O3VA 5CXOA 2WGQA 5FW5A 1BRSA 2BMRB 4OK0A 1IQXA 1EA2A 2B24B 1NO3A 1TP6A 2BO9B 1CQSA 3IJEB 3NUVA 4QWTA 2OCTA 1IV9A 3D3LA 1RN4A 2KXGA 1DMMA 3F8XA 1STFI 4K61A 2BMQB 3EN8A 1IQYA 1Q824 2UUGC 6STDA 2GU1A 4JF8A 3CPOA 1QVG2 1VQ63 1C7HA 3WA2X 2RBIA 3N8BA 1NWWA 3QRDA 2D1WA 2A15A 1IVXA 8CHOA 1EUIC 2P38A 2WOFA 1N8R4 4RBNA 4K1VA 1PY3A 1W2B2 3MYTA 4BTWA 3ZFZA 1OACA 5AIIA 1GOYA 2HOHA 5EEOA 1JBSA 3BU4A 2KF4A 1W7CA 2ML5A 3LTCA 1X1YA 4L8PA 4U13A 4L8OA 2CHCA 3IMAB 3L0RA 1RGHA 2RNTA 2XSHB 3ECFA 4H3UA 5G1LA 4LSOA 3LMLA 1HZ1A 2KF3A 2YFJB 1EEJA 3NHXA 1YVSA 3QK9A 1DMNA 3Q3FA 2XH9A 3K63A 1FGQA 3SEDA 4FCZA 1DMQA 1JBRA 2KAAA 1YIT3 3WR2A 2OOVC 2I9WA 3PZWA 2D42A 1IDPA 2HMOB 1Q814 1YIJ3 5BU4A 1BNRA 1HKXA 1Q7Y4 4HM1B 2BNGA 4FMCA 4R4KA 3ZG0A 1O7PB 1WQLB 3N9HA 4ORLA 1O7GB 1CH0A 1K8A4 5HOHA 1RHLA 3UNLA 4Q53A 1LRAA 1RGEA 3GRDA 2CG1A 3LT8A 1ZO2A 5TGNA 1UGHI 2Z76A 4AKYA 1WTHA 3X40A 4FMAA 1A2KA 3H3HA 4CJNA 1R4YA 4R80A 1EKMA 1Z1SA 1E97A 4HVNA 9RNTA 1C54A 1VQL3 1RN1A 1MWRA 3CME3 2AAEA 3V92A 3UL6A 1OCVA 1Q9EA 4HM3B 1OF5A 1FGTA 1GMQA 2CH9A 1ULIB 3F7XA 5AEWB 2BT3A 2R4IA 5IG3A 1VQM3 1DVDA 1BSAA 1PFPA 4XBXA 1YJ93 3LT9A 4G1MB 4N6UA 1LVNA 1JB4A 1B2XA 2WGOA 3UL5A 1EG9B 2JDIH 3Q90A 1CYUA 1OUNA 3WMDA 1GY7A 3S27A 3URPA 4O02B 4WYKA 1GS3A 2W9PA 1YGWA 1CEWI 2KF5A 1X1WA 1BOXA 1X1UA 1FGMA 5D83A 3X3YA 1RKYA 1ROVA 3HIGA 1T5YA 2Z6BA 4HJLB 3X42A 2J8XB 2V1LA 3AMOB 1RCKA 5IEPA 1QALA 4HM0B 5IF6A 1VQN3 3S29A 4K90B 2F5WA 5DREA 2RCDA 3G713 2XF3A 3D79A 1RN7A 1FGOA 3OX9A 3WDGB 5KP4A 3A5EA 1AVKA 1N9JA 4J9AA 1BRNL 1RJOA 2W04A 3FG3A 1BSEA 3MG1A 2HMNB 2OTJ3 3U97A 1VQO3 1BNEA 1SQWA 4FR9A 3WOFB 3CNMA 3BLZA 3DUKA 1UW1A 3CCS3 3CCV3 2F4YA 3CC23 1ISKA 3NV0B 4XBTA 1TJDA 3OV4A 1G0TA 1M9GA 1TIJA 1B21A 3HZPA 4I5QA 1R4CA 5IENA 2W0QA 1GY5A 4JRFA 3GZYB 3LH4A 3PCSA 3SXXA 2RSXA 1MNLA 4EXRA 3G0KA 1BRIA 3DH2A 1Q40B 3LXUX 5JPPA 2ZA4A 1TTOA 3CCE3 1JB2A 3CCL3 4J5GA 5CLKA 1D6ZA 2CX1A 4FMDA 2P09A 1J2BA 1F8NA 3D9RA 5LC7A 4EC6A 3NBBA 1DE3A 5IEOA 1IVUA 2CFDA 2QIYA 3LTAA 1BRKA 1W01A 2WO0A 1STDA 4R9KA 4WP5A 3EX9A 1LOXA 1IYYA 3G8ZA 1T2HA 4K1UA 5JBSA 3BNDA 3H51A 1NNVA 1TFOA 2GXFA 3KN4A 1AVLA 6GSPA 2FGTA 1IV7A 1V58A 1SJWA 1RGLA 2C4BA 1I0XA 4N3VA 2M7OA 1BSDA 3JUQA 1AY7A 1RLSA 2QEX3 3LYGA 4N6TA 1UCKA 1LQMB 1VQ43 3HI7A 4N6LA 4KFFA 3WOEB 3BNEA 4EV5A 3CCQ3 1FW7A 1A2VA 5RNTA 1OHOA 3OWUA 1US1A 4HKVB 1E3RA 2Y74A 1GSPA 3FF2A 5AYSC 4RNYA 3V99A 2INXA 4HYZA 2O3OA 3DMCA 4HBRA 3F9SA 4BTXA 3LOYA 5BVBA 1BANA 1SIHA 2CG0A 5ELJA 1RCLA 1W4NA 5BIRA 3BIRA 3T8UA 3CC43 2F99A 1OGZA 3I553 2IA7A 3B7CA 3DGMA 3K9MC 4IT7A 1AR0A 1VQQA 3HK4A 3LTDA 3CC73 1IVWA 1ZX2A 2GBXB 1I2GA 2H0IA 3E99A 3NM7A 4LGQA 7GSPA 3FLJA 2R41A 5AYRB 1MWUA 1RGGA 1UCIA 1L5GB 2BU4A 5CK6A 8RNTA 3KCHA 3NV0A 4X2OA 5ELUA 3SVAA 1BVIA 1W6CA 4WFOA 1A90A 1GOVA 1QAKA 2CWVA 3FCSB 3MKIA 1V74A 2F98A 1UCLA 4R1KA 1YNVX 1RGKA 1D6YA 3G16A 4N6NB 1RSNA 1ROAA 5G1KA 4GB5A 3JVCA 1BAOA 1BUQA 2F86B 3CPW2 3NQZA 3WA3A 2XFSA 1Q40A 3ROBA 4IIAA 4KT3B 1Y4KA 1RGFA 1MWTA 1KQS2 1OGXA 3RGRA 2BMOB 3B4OA 2BHMA 4WWUC 4ZM8A 1BRGA 4O8SA 1LNIA 4DKIA 2H0GA 6RNTA 3JUNA 1WMOA 4LZIA 2KCDA 4LMIA 1IT7A 3CXC2 2CWTA 1K41A 3IPTA 1I3IA 1GY6A 1QAFA 3BB9A 1U8CB 1DYUA 1T3BA 5A0OB 5M1AA 5M18A 5JPUA 1MWSA 1K28A 2GU3A 3V98A 3JUOA 2QA43 1YJN3 1UCJA 1JRQA 4EW5A 3EC9A 2XSOB 2CFKA 2XEPA 1I70A 3CCR3 4BL3A 1JB5A 1RRHA 2W56A 3WODG 5AEUB 1SPUA 2FXTA 3NBRA 4LYLB 1SIIA 3FG1A 4WYKB 1W2ZA 1LNHA 3S5CA 4L7KA 4XDWA 1PYLA 2OTL3 3D4AA 4KVHA 4AKZA 2OQEC 4GHOA 4MMYB 1S723 4CCVA 2CW9A 1YHQ3 4OUQA 2MF7A 1S5AA 5FGOA 3FF0A 2XR8B 5AI1A 3X41A 2K0MA 3KE7A 4MEIA 1KC84 1W00A 4NREA 1B3SA 1BRHA 2CKFB 2UGIA 3MHEA 1OPYA 1TUHA 1VQ93 1JN5B 2WOHA 4ILFA 3EBTA 3NBJA 3RNTA 2ZDJA 3EN1B 3BNBA 2KRTA 3OXAA 4BTYA 2HMJB 2STDA 4RNZA 1VQK3 1VQ73 2LQVA 5STDA 1LOVA 4N6OB 1JKGB 3GSPA 1W02A 1BUJA 3AMOA 3OW22 1UDII 1JV2B 1BU4A 1N9EA 1UUGB 4H61A 3FG4A 3DGNA 3KSPA 2W2CA 1M1K4 4HM6B 4FMBA 1N5PA 5AIFA 2B1XB 4J5KA 4KFEA 5M19A 4X2HA 3T0UA 5AIGA 5I97A 5IW9A 1FUTA 2YFLB 2LYXA 2H0HA 1NDOB 1LOYA 4XM4A 1K734 3NQYA 3LTBA 1QVF2 1GD3A 3D5IA 2HMMB 3KFQC 4TX4A 3U1WA 3PYJA 1FUWA 3I563 5HGRA 2KF6A 1RGAA 2MC8A 1FUSA 2F56A 1RGCA 2E2VA 3DGLA 4HM5B 4HM7B 3B8LA 5GSPA 4LEHA 4NHFA 1CYVA 2W03A 2CX0A 2L1SA 5D82A 1WMNA 3F7SA 3Q2PA 1VQ53 1ASKA 2SBLA 3CMA3 1RMSA 1OHSA 2K54A 3DY5A 2YFIB 3Q1CA 3I0YA 1B2MA 3UB1A 2BIRA 1D6UA 2OWPA 3AGOA 4CDLA 4STDA 4KZ1A 3CD63 1V57A 1WNHA 1T2IA 2XGLA 7RNTA 3CCU3 1TRPA 2CFWA 1GOUA 4RNTA 5IG0A 1RTUA 5EVHA 1KD14 3D5GA 1UI8A 4OVMA 1GMRA 2P05A 4GSPA 3WHOA 4GL6A 4N6MA 3B4PA 3DZLA 4HM4B 2F5MA 5KP1A 3G4S3 2XRXB 3F40A 2P0MA 1TRQA 1TFKA 2OOVA 1QJGA 7STDA 1O7HB 1IU7A 1BSBA 4HM2B 1LXEA 1IVVA 3GZBA 3M8CA 3X3ZA 1Q7HA 3DGYA 4EBGA 1BNSA 3VF1A 2JQ5A 3PCRA 5EQLA 3NX0A 2Y73A 4MJDA 1B20A 1MGRA 2GEYA 3DGOA 2AADA 2QGUA 3EE1A 1HU9A 1RNTA 1A67A 3DXOA 3VSYA 2ML6A 2Z7AA 3K0ZA 1RDSA 4CPKA 4HOHA 1BNJA 4PEJA 3SOAA 3FZWA 3K7CA 3JUPA 1DETA 1SARA 1JKGA 3J7Yd 4I4KA 4NPBA 3UJMA 2IYJA 4WHAA 3JUMA 1YVBI 1FZUA 2IUJA 3S28A 3HX8A 5IG4A 3OWSA 1W5ZA 5D81A 1JJ22 3G6E3 2UX0A 1DVCA 4O2HA 4AEQA 5AIHA 1ZGXA 1A2PA 1B27A 4HM8B 3FKAA 1Q864 4BL2A 1OF5B 1W6GA 2Z77A 3EJVA 5CF1A 1LOWA 5LC6A 1EQKA 1BNGA 3EF8A 3GZXB 2CIUA 2C10A 3MG2A 3AGNA 3N54B 1E3VA 5DRVA 1OH0A 4HZ9B 2E2UA 1GMPA 1VZZA 4FCMA 3A76A 3T8NA 5IG5A 4R9LA 1IT8A 2RGQA 2L4VA 3HIIA 1B2ZA 4KFDA 2IUKA 1JNQA 1JN5A 1G96A 2E2TA 3CCJ3 4MMXB 3VGNA 3PGBA 3X3XA 1Q42A 2CFGA 3AHWA 3ER7A 2YX9A 1M904 3ALAA 1KWIA 2W56B 3LZAA 1LQGC 3GWRA 1MOLA 3SOYA 1NJI4 1N5HA 3EB8A 3MSOA 3O8YA 1YGEA 2XGNA 1O7MB 2W6JH 4MMZB 3EQQB 2IMJA 1TU5A 2XFTA 2GSPA 3PS8A 4BIRA 1O7WB 1RRLA 1B2UA 1BNFA 1M1XB 5IERA 4J8TA 3SX1A 3SYUA 3CNXA 1VQP3 1HYFA 1G02A 1JZOA 3OWYA 4N6V0 2OQEA 1BIRA 3CCM3 1OHPA 4XB5A 1WMPA 1AV4A 1UI7A 1GD4A 2CWUA 1UUWB 1IK3A 3HOHA 3F14A 2FNQA 3FH1A 4HZBB 1X1XA 3EHCA 3STDA 3EBYA 3NM2A 3K5TA 1B2SA 3KZTA 1I3FA 3PXMA 3F8HA 1ULJB 3MG3A 1UUVB 1BGSA 1YI23 1AQZA 4XDVA 3CU3A 5G2GA 1W6YA 1RNBA 3RDEA 2PZVA 1MGWA 2CK3H 3SLUA
chains in the Genus database with same CATH topology
5BXQA 1K9M4 2W9QA 2HMKB 3BNCA 3RGAA 4IPBA 2CFLA 3GZRA 3KSED 1PU4A 1FGRA 3KIIA 2P0XA 2ZL8A 2C11A 5CF2A 1QMAA 3FSDA 3MWZA 3NXJA 4EYCA 1FA3A 2CC3A 1GYBA 2RFRA 5KP3A 1O7NB 1YJW3 1NU3A 2GEXA 3MPHA 4FCJA 4RZMA 1VQ83 4EV2A 2Q07A 3S67A 1NB5I 1IQ8A 1KSIA 2GBWB 2O9UX 3FGYA 3KKGA 3TDGA 3DM8A 4XBYA 1NB3I 3GAXA 1N8QA 1U5OA 2HMLB 2PNCA 4O3VA 5CXOA 2WGQA 5FW5A 2BMRB 4OK0A 1IQXA 1EA2A 2B24B 1NO3A 1TP6A 2BO9B 1CQSA 3IJEB 3NUVA 4QWTA 2OCTA 1IV9A 3D3LA 2KXGA 1DMMA 3F8XA 1STFI 4K61A 2BMQB 3EN8A 1IQYA 1Q824 6STDA 2GU1A 4JF8A 3CPOA 1QVG2 1VQ63 1C7HA 3WA2X 3N8BA 1NWWA 3QRDA 2D1WA 2A15A 1IVXA 8CHOA 1N8R4 2P38A 2WOFA 4RBNA 4K1VA 1W2B2 3MYTA 4BTWA 1OACA 5AIIA 5EEOA 1W7CA 2ML5A 3LTCA 4L8PA 4U13A 4L8OA 2CHCA 3IMAB 3L0RA 4H3UA 2XSHB 3ECFA 4LSOA 3LMLA 2YFJB 3NHXA 3QK9A 1DMNA 2XH9A 3K63A 1FGQA 3SEDA 4FCZA 1DMQA 1YIT3 2OOVC 2I9WA 3PZWA 2D42A 1IDPA 2HMOB 1Q814 1YIJ3 1HKXA 1Q7Y4 4HM1B 2BNGA 4FMCA 4R4KA 1O7PB 1WQLB 3N9HA 4ORLA 1O7GB 1K8A4 3UNLA 4Q53A 3GRDA 2CG1A 3LT8A 1ZO2A 5TGNA 2Z76A 4AKYA 1WTHA 3X40A 4FMAA 1A2KA 3H3HA 4R80A 1EKMA 1Z1SA 1E97A 4HVNA 1VQL3 3CME3 3V92A 3UL6A 1OCVA 4HM3B 1OF5A 1FGTA 3F7XA 1ULIB 2CH9A 5AEWB 2BT3A 2R4IA 5IG3A 1VQM3 1DVDA 1PFPA 4XBXA 1YJ93 3LT9A 4G1MB 4N6UA 1LVNA 1JB4A 2WGOA 3UL5A 1EG9B 2JDIH 3Q90A 1CYUA 1OUNA 3WMDA 1GY7A 3S27A 4O02B 4WYKA 1GS3A 2W9PA 1CEWI 3X3YA 1FGMA 5D83A 1RKYA 1ROVA 3HIGA 1T5YA 2Z6BA 4HJLB 3X42A 2V1LA 3AMOB 5IEPA 1QALA 4HM0B 5IF6A 1VQN3 3S29A 4K90B 5DREA 2RCDA 3G713 2XF3A 1RN7A 1FGOA 3OX9A 3WDGB 5KP4A 1AVKA 1N9JA 4J9AA 1RJOA 2W04A 3FG3A 3MG1A 2HMNB 2OTJ3 3U97A 1VQO3 1SQWA 4FR9A 3WOFB 3CNMA 3BLZA 3DUKA 1UW1A 3CCS3 3CCV3 3CC23 1ISKA 3NV0B 4XBTA 3OV4A 1M9GA 1TIJA 3HZPA 5IENA 1R4CA 2W0QA 1GY5A 4JRFA 3GZYB 3LH4A 3PCSA 3SXXA 2RSXA 1MNLA 4EXRA 3G0KA 1Q40B 3LXUX 5JPPA 3CCE3 3CCL3 1JB2A 5CLKA 1D6ZA 4FMDA 2P09A 1J2BA 1F8NA 3D9RA 5LC7A 4EC6A 3NBBA 5IEOA 1IVUA 2CFDA 2QIYA 3LTAA 1W01A 2WO0A 1STDA 4R9KA 4WP5A 3EX9A 1LOXA 3G8ZA 4K1UA 5JBSA 3BNDA 3H51A 1TFOA 2GXFA 3KN4A 1AVLA 2FGTA 1IV7A 1SJWA 4N3VA 2M7OA 3JUQA 2QEX3 3LYGA 4N6TA 1VQ43 3HI7A 4N6LA 4KFFA 3WOEB 3BNEA 4EV5A 3CCQ3 1A2VA 1OHOA 3OWUA 1US1A 4HKVB 1E3RA 2Y74A 3FF2A 5AYSC 4RNYA 3V99A 2INXA 4HYZA 2O3OA 3DMCA 4HBRA 3F9SA 4BTXA 3LOYA 5BVBA 1SIHA 2CG0A 5ELJA 3CC43 1W4NA 3T8UA 2F99A 1OGZA 3I553 2IA7A 3B7CA 3DGMA 3K9MC 4IT7A 1AR0A 3HK4A 3LTDA 3CC73 1IVWA 1ZX2A 2GBXB 3NM7A 3E99A 4LGQA 3FLJA 5AYRB 1L5GB 5CK6A 3NV0A 4X2OA 5ELUA 3SVAA 1W6CA 4WFOA 1A90A 1QAKA 3FCSB 2CWVA 3MKIA 1V74A 2F98A 4R1KA 4N6NB 1D6YA 3G16A 1ROAA 4GB5A 3JVCA 1BUQA 2F86B 3CPW2 3NQZA 3WA3A 2XFSA 1Q40A 3ROBA 4IIAA 1Y4KA 1KQS2 1OGXA 3RGRA 2BMOB 3B4OA 2BHMA 4WWUC 4ZM8A 4O8SA 3JUNA 1WMOA 4LZIA 2KCDA 4LMIA 1IT7A 3CXC2 2CWTA 1K41A 3IPTA 1QAFA 1GY6A 3BB9A 1U8CB 1DYUA 5A0OB 5JPUA 3V98A 1K28A 2GU3A 3JUOA 2QA43 1YJN3 1JRQA 3EC9A 2XSOB 2CFKA 2XEPA 3CCR3 1JB5A 1RRHA 2W56A 3WODG 5AEUB 1SPUA 2FXTA 3NBRA 1SIIA 3FG1A 4WYKB 1W2ZA 1LNHA 3S5CA 4L7KA 4XDWA 2OTL3 4KVHA 4AKZA 2OQEC 4MMYB 1S723 4CCVA 2CW9A 1YHQ3 4OUQA 2MF7A 1S5AA 5FGOA 3FF0A 2XR8B 5AI1A 3X41A 2K0MA 3KE7A 4MEIA 1KC84 1W00A 4NREA 1VQ93 2CKFB 3MHEA 1OPYA 1TUHA 1JN5B 2WOHA 3EBTA 3NBJA 2ZDJA 3EN1B 3BNBA 2KRTA 3OXAA 4BTYA 2HMJB 2STDA 4RNZA 1VQK3 1VQ73 2LQVA 5STDA 4N6OB 1JKGB 1W02A 3AMOA 3OW22 4H61A 1JV2B 1N9EA 3FG4A 3DGNA 3KSPA 2W2CA 1M1K4 4HM6B 4FMBA 1N5PA 5AIFA 2B1XB 4KFEA 4X2HA 3T0UA 5AIGA 5I97A 5IW9A 2YFLB 2LYXA 1NDOB 4XM4A 1K734 3NQYA 3LTBA 1QVF2 1GD3A 3KFQC 2HMMB 4TX4A 3U1WA 3PYJA 1FUWA 3I563 5HGRA 2MC8A 4HM5B 3DGLA 2E2VA 4HM7B 3B8LA 4LEHA 4NHFA 1CYVA 2W03A 5D82A 1WMNA 3F7SA 3Q2PA 1VQ53 1ASKA 2SBLA 3CMA3 2K54A 1OHSA 3DY5A 2YFIB 3Q1CA 3I0YA 3UB1A 1D6UA 2OWPA 4CDLA 4STDA 4KZ1A 3CD63 1WNHA 2XGLA 3CCU3 2CFWA 5IG0A 5EVHA 1KD14 1UI8A 4OVMA 2P05A 4GL6A 4N6MA 3B4PA 3DZLA 4HM4B 5KP1A 3G4S3 2XRXB 3F40A 2P0MA 2OOVA 1TFKA 1QJGA 7STDA 1O7HB 1IU7A 4HM2B 1LXEA 1IVVA 3GZBA 3M8CA 3X3ZA 4EBGA 3VF1A 2JQ5A 3PCRA 5EQLA 3NX0A 2Y73A 4MJDA 2GEYA 3DGOA 2QGUA 3EE1A 1HU9A 1A67A 3DXOA 3VSYA 2ML6A 2Z7AA 3K0ZA 4PEJA 3SOAA 3FZWA 3K7CA 3JUPA 1JKGA 3J7Yd 4I4KA 3UJMA 4WHAA 3JUMA 1YVBI 2IUJA 3S28A 3HX8A 5IG4A 3OWSA 1W5ZA 5D81A 1JJ22 3G6E3 2UX0A 1DVCA 4O2HA 4AEQA 5AIHA 4HM8B 3FKAA 1Q864 1OF5B 1W6GA 2Z77A 3EJVA 5CF1A 1EQKA 5LC6A 3EF8A 3GZXB 2CIUA 2C10A 3MG2A 3N54B 1E3VA 5DRVA 1OH0A 4HZ9B 2E2UA 1VZZA 4FCMA 3A76A 3T8NA 5IG5A 4R9LA 1IT8A 2RGQA 2L4VA 3HIIA 4KFDA 2IUKA 1JNQA 1JN5A 1G96A 2E2TA 3CCJ3 4MMXB 3VGNA 3PGBA 3X3XA 1Q42A 2CFGA 3ER7A 2YX9A 1M904 3ALAA 1KWIA 2W56B 3LZAA 3GWRA 1MOLA 3SOYA 1NJI4 1N5HA 3EB8A 3MSOA 3O8YA 1YGEA 2XGNA 1O7MB 2W6JH 4MMZB 3EQQB 2IMJA 1TU5A 2XFTA 3PS8A 1O7WB 1RRLA 1M1XB 5IERA 4J8TA 3SX1A 3CNXA 1VQP3 2OQEA 3OWYA 4N6V0 3CCM3 1OHPA 4XB5A 1WMPA 1AV4A 1UI7A 1GD4A 2CWUA 1UUWB 1IK3A 3F14A 2FNQA 3FH1A 4HZBB 3STDA 3EHCA 3EBYA 3NM2A 3K5TA 3KZTA 3PXMA 3F8HA 1ULJB 3MG3A 1UUVB 1YI23 4XDVA 3CU3A 5G2GA 1W6YA 3RDEA 2PZVA 2CK3H 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NX0 A;  5A0O B;  1CYU A;  2W9Q A;  1EQK A;  3PS8 A;  5ELU A;  5LC6 A;  3SVA A;  1A67 A;  3KSE D;  1A90 A;  1NB3 I;  2W9P A;  3GAX A;  1CEW I;  1WNH A;  4N6V 0;  4N6N B;  1GD3 A;  3KFQ C;  4TX4 A;  3IMA B;  3L0R A;  1GD4 A;  1M9G A;  1ROA A;  1TIJ A;  3MWZ A;  3PYJ A;  1G96 A;  2BO9 B;  4EYC A;  1FUW A;  1FA3 A;  1R4C A;  1IV7 A;  1YVB I;  2OCT A;  1IV9 A;  4N6O B;  5ELJ A;  4N6M A;  2KXG A;  3LH4 A;  1MNL A;  1KWI A;  1STF I;  3K9M C;  1RN7 A;  4IT7 A;  1CYV A;  3PXM A;  3UL6 A;  4ZM8 A;  2CH9 A;  4N6T A;  4CCV A;  1DVC A;  1LXE A;  3Q2P A;  4LZI A;  1N9J A;  1MOL A;  1PFP A;  4N6L A;  1DVD A;  3S67 A;  1N5H A;  4N6U A;  1NB5 I;  1N5P A;  3UL5 A;  2O9U X;  3QRD A;  5EQL A;  5LC7 A; 
#chains in the Genus database with same CATH topology
 3AHS A;  5BXQ A;  1K9M 4;  1ZS7 A;  2W9Q A;  2HMK B;  3BNC A;  3RGA A;  4IPB A;  1BRJ A;  2CFL A;  3GZR A;  3KSE D;  1FGR A;  1PU4 A;  3KII A;  2P0X A;  2ZL8 A;  3ZG5 A;  1BNI A;  2C11 A;  5CF2 A;  1QMA A;  2ZHX B;  3FSD A;  3MWZ A;  3NXJ A;  4EYC A;  1FA3 A;  2CC3 A;  1GYB A;  2RFR A;  2SAR A;  5KP3 A;  1O7N B;  1YJW 3;  1NU3 A;  2IY2 A;  2GEX A;  1I2E A;  1UGI A;  3MPH A;  4HAA A;  4FCJ A;  4RZM A;  1JBT A;  4EV2 A;  1VQ8 3;  2Q07 A;  1I2F A;  3S67 A;  1NB5 I;  1IQ8 A;  1KSI A;  1FYS A;  2GBW B;  2O9U X;  3FGY A;  3KKG A;  2K3D A;  1JZD A;  3TDG A;  1I8V A;  3DM8 A;  4XBY A;  1BSC A;  1NB3 I;  3GAX A;  4BU4 A;  1N8Q A;  1U5O A;  2HML B;  2PNC A;  1I0V A;  4O3V A;  5CXO A;  2WGQ A;  5FW5 A;  1BRS A;  2BMR B;  4OK0 A;  1IQX A;  1EA2 A;  2B24 B;  1NO3 A;  1TP6 A;  2BO9 B;  1CQS A;  3IJE B;  3NUV A;  4QWT A;  2OCT A;  1IV9 A;  3D3L A;  1RN4 A;  2KXG A;  1DMM A;  3F8X A;  1STF I;  4K61 A;  2BMQ B;  3EN8 A;  1IQY A;  1Q82 4;  2UUG C;  6STD A;  2GU1 A;  4JF8 A;  3CPO A;  1QVG 2;  1VQ6 3;  1C7H A;  3WA2 X;  2RBI A;  3N8B A;  1NWW A;  3QRD A;  2D1W A;  2A15 A;  1IVX A;  8CHO A;  1EUI C;  2P38 A;  2WOF A;  1N8R 4;  4RBN A;  4K1V A;  1PY3 A;  1W2B 2;  3MYT A;  4BTW A;  3ZFZ A;  1OAC A;  5AII A;  1GOY A;  2HOH A;  5EEO A;  1JBS A;  3BU4 A;  2KF4 A;  1W7C A;  2ML5 A;  3LTC A;  1X1Y A;  4L8P A;  4U13 A;  4L8O A;  2CHC A;  3IMA B;  3L0R A;  1RGH A;  2RNT A;  2XSH B;  3ECF A;  4H3U A;  5G1L A;  4LSO A;  3LML A;  1HZ1 A;  2KF3 A;  2YFJ B;  1EEJ A;  3NHX A;  1YVS A;  3QK9 A;  1DMN A;  3Q3F A;  2XH9 A;  3K63 A;  1FGQ A;  3SED A;  4FCZ A;  1DMQ A;  1JBR A;  2KAA A;  1YIT 3;  3WR2 A;  2OOV C;  2I9W A;  3PZW A;  2D42 A;  1IDP A;  2HMO B;  1Q81 4;  1YIJ 3;  5BU4 A;  1BNR A;  1HKX A;  1Q7Y 4;  4HM1 B;  2BNG A;  4FMC A;  4R4K A;  3ZG0 A;  1O7P B;  1WQL B;  3N9H A;  4ORL A;  1O7G B;  1CH0 A;  1K8A 4;  5HOH A;  1RHL A;  3UNL A;  4Q53 A;  1LRA A;  1RGE A;  3GRD A;  2CG1 A;  3LT8 A;  1ZO2 A;  5TGN A;  1UGH I;  2Z76 A;  4AKY A;  1WTH A;  3X40 A;  4FMA A;  1A2K A;  3H3H A;  4CJN A;  1R4Y A;  4R80 A;  1EKM A;  1Z1S A;  1E97 A;  4HVN A;  9RNT A;  1C54 A;  1VQL 3;  1RN1 A;  1MWR A;  3CME 3;  2AAE A;  3V92 A;  3UL6 A;  1OCV A;  1Q9E A;  4HM3 B;  1OF5 A;  1FGT A;  1GMQ A;  2CH9 A;  1ULI B;  3F7X A;  5AEW B;  2BT3 A;  2R4I A;  5IG3 A;  1VQM 3;  1DVD A;  1BSA A;  1PFP A;  4XBX A;  1YJ9 3;  3LT9 A;  4G1M B;  4N6U A;  1LVN A;  1JB4 A;  1B2X A;  2WGO A;  3UL5 A;  1EG9 B;  2JDI H;  3Q90 A;  1CYU A;  1OUN A;  3WMD A;  1GY7 A;  3S27 A;  3URP A;  4O02 B;  4WYK A;  1GS3 A;  2W9P A;  1YGW A;  1CEW I;  2KF5 A;  1X1W A;  1BOX A;  1X1U A;  1FGM A;  5D83 A;  3X3Y A;  1RKY A;  1ROV A;  3HIG A;  1T5Y A;  2Z6B A;  4HJL B;  3X42 A;  2J8X B;  2V1L A;  3AMO B;  1RCK A;  5IEP A;  1QAL A;  4HM0 B;  5IF6 A;  1VQN 3;  3S29 A;  4K90 B;  2F5W A;  5DRE A;  2RCD A;  3G71 3;  2XF3 A;  3D79 A;  1RN7 A;  1FGO A;  3OX9 A;  3WDG B;  5KP4 A;  3A5E A;  1AVK A;  1N9J A;  4J9A A;  1BRN L;  1RJO A;  2W04 A;  3FG3 A;  1BSE A;  3MG1 A;  2HMN B;  2OTJ 3;  3U97 A;  1VQO 3;  1BNE A;  1SQW A;  4FR9 A;  3WOF B;  3CNM A;  3BLZ A;  3DUK A;  1UW1 A;  3CCS 3;  3CCV 3;  2F4Y A;  3CC2 3;  1ISK A;  3NV0 B;  4XBT A;  1TJD A;  3OV4 A;  1G0T A;  1M9G A;  1TIJ A;  1B21 A;  3HZP A;  4I5Q A;  1R4C A;  5IEN A;  2W0Q A;  1GY5 A;  4JRF A;  3GZY B;  3LH4 A;  3PCS A;  3SXX A;  2RSX A;  1MNL A;  4EXR A;  3G0K A;  1BRI A;  3DH2 A;  1Q40 B;  3LXU X;  5JPP A;  2ZA4 A;  1TTO A;  3CCE 3;  1JB2 A;  3CCL 3;  4J5G A;  5CLK A;  1D6Z A;  2CX1 A;  4FMD A;  2P09 A;  1J2B A;  1F8N A;  3D9R A;  5LC7 A;  4EC6 A;  3NBB A;  1DE3 A;  5IEO A;  1IVU A;  2CFD A;  2QIY A;  3LTA A;  1BRK A;  1W01 A;  2WO0 A;  1STD A;  4R9K A;  4WP5 A;  3EX9 A;  1LOX A;  1IYY A;  3G8Z A;  1T2H A;  4K1U A;  5JBS A;  3BND A;  3H51 A;  1NNV A;  1TFO A;  2GXF A;  3KN4 A;  1AVL A;  6GSP A;  2FGT A;  1IV7 A;  1V58 A;  1SJW A;  1RGL A;  2C4B A;  1I0X A;  4N3V A;  2M7O A;  1BSD A;  3JUQ A;  1AY7 A;  1RLS A;  2QEX 3;  3LYG A;  4N6T A;  1UCK A;  1LQM B;  1VQ4 3;  3HI7 A;  4N6L A;  4KFF A;  3WOE B;  3BNE A;  4EV5 A;  3CCQ 3;  1FW7 A;  1A2V A;  5RNT A;  1OHO A;  3OWU A;  1US1 A;  4HKV B;  1E3R A;  2Y74 A;  1GSP A;  3FF2 A;  5AYS C;  4RNY A;  3V99 A;  2INX A;  4HYZ A;  2O3O A;  3DMC A;  4HBR A;  3F9S A;  4BTX A;  3LOY A;  5BVB A;  1BAN A;  1SIH A;  2CG0 A;  5ELJ A;  1RCL A;  1W4N A;  5BIR A;  3BIR A;  3T8U A;  3CC4 3;  2F99 A;  1OGZ A;  3I55 3;  2IA7 A;  3B7C A;  3DGM A;  3K9M C;  4IT7 A;  1AR0 A;  1VQQ A;  3HK4 A;  3LTD A;  3CC7 3;  1IVW A;  1ZX2 A;  2GBX B;  1I2G A;  2H0I A;  3E99 A;  3NM7 A;  4LGQ A;  7GSP A;  3FLJ A;  2R41 A;  5AYR B;  1MWU A;  1RGG A;  1UCI A;  1L5G B;  2BU4 A;  5CK6 A;  8RNT A;  3KCH A;  3NV0 A;  4X2O A;  5ELU A;  3SVA A;  1BVI A;  1W6C A;  4WFO A;  1A90 A;  1GOV A;  1QAK A;  2CWV A;  3FCS B;  3MKI A;  1V74 A;  2F98 A;  1UCL A;  4R1K A;  1YNV X;  1RGK A;  1D6Y A;  3G16 A;  4N6N B;  1RSN A;  1ROA A;  5G1K A;  4GB5 A;  3JVC A;  1BAO A;  1BUQ A;  2F86 B;  3CPW 2;  3NQZ A;  3WA3 A;  2XFS A;  1Q40 A;  3ROB A;  4IIA A;  4KT3 B;  1Y4K A;  1RGF A;  1MWT A;  1KQS 2;  1OGX A;  3RGR A;  2BMO B;  3B4O A;  2BHM A;  4WWU C;  4ZM8 A;  1BRG A;  4O8S A;  1LNI A;  4DKI A;  2H0G A;  6RNT A;  3JUN A;  1WMO A;  4LZI A;  2KCD A;  4LMI A;  1IT7 A;  3CXC 2;  2CWT A;  1K41 A;  3IPT A;  1I3I A;  1GY6 A;  1QAF A;  3BB9 A;  1U8C B;  1DYU A;  1T3B A;  5A0O B;  5M1A A;  5M18 A;  5JPU A;  1MWS A;  1K28 A;  2GU3 A;  3V98 A;  3JUO A;  2QA4 3;  1YJN 3;  1UCJ A;  1JRQ A;  4EW5 A;  3EC9 A;  2XSO B;  2CFK A;  2XEP A;  1I70 A;  3CCR 3;  4BL3 A;  1JB5 A;  1RRH A;  2W56 A;  3WOD G;  5AEU B;  1SPU A;  2FXT A;  3NBR A;  4LYL B;  1SII A;  3FG1 A;  4WYK B;  1W2Z A;  1LNH A;  3S5C A;  4L7K A;  4XDW A;  1PYL A;  2OTL 3;  3D4A A;  4KVH A;  4AKZ A;  2OQE C;  4GHO A;  4MMY B;  1S72 3;  4CCV A;  2CW9 A;  1YHQ 3;  4OUQ A;  2MF7 A;  1S5A A;  5FGO A;  3FF0 A;  2XR8 B;  5AI1 A;  3X41 A;  2K0M A;  3KE7 A;  4MEI A;  1KC8 4;  1W00 A;  4NRE A;  1B3S A;  1BRH A;  2CKF B;  2UGI A;  3MHE A;  1OPY A;  1TUH A;  1VQ9 3;  1JN5 B;  2WOH A;  4ILF A;  3EBT A;  3NBJ A;  3RNT A;  2ZDJ A;  3EN1 B;  3BNB A;  2KRT A;  3OXA A;  4BTY A;  2HMJ B;  2STD A;  4RNZ A;  1VQK 3;  1VQ7 3;  2LQV A;  5STD A;  1LOV A;  4N6O B;  1JKG B;  3GSP A;  1W02 A;  1BUJ A;  3AMO A;  3OW2 2;  1UDI I;  1JV2 B;  1BU4 A;  1N9E A;  1UUG B;  4H61 A;  3FG4 A;  3DGN A;  3KSP A;  2W2C A;  1M1K 4;  4HM6 B;  4FMB A;  1N5P A;  5AIF A;  2B1X B;  4J5K A;  4KFE A;  5M19 A;  4X2H A;  3T0U A;  5AIG A;  5I97 A;  5IW9 A;  1FUT A;  2YFL B;  2LYX A;  2H0H A;  1NDO B;  1LOY A;  4XM4 A;  1K73 4;  3NQY A;  3LTB A;  1QVF 2;  1GD3 A;  3D5I A;  2HMM B;  3KFQ C;  4TX4 A;  3U1W A;  3PYJ A;  1FUW A;  3I56 3;  5HGR A;  2KF6 A;  1RGA A;  2MC8 A;  1FUS A;  2F56 A;  1RGC A;  2E2V A;  3DGL A;  4HM5 B;  4HM7 B;  3B8L A;  5GSP A;  4LEH A;  4NHF A;  1CYV A;  2W03 A;  2CX0 A;  2L1S A;  5D82 A;  1WMN A;  3F7S A;  3Q2P A;  1VQ5 3;  1ASK A;  2SBL A;  3CMA 3;  1RMS A;  1OHS A;  2K54 A;  3DY5 A;  2YFI B;  3Q1C A;  3I0Y A;  1B2M A;  3UB1 A;  2BIR A;  1D6U A;  2OWP A;  3AGO A;  4CDL A;  4STD A;  4KZ1 A;  3CD6 3;  1V57 A;  1WNH A;  1T2I A;  2XGL A;  7RNT A;  3CCU 3;  1TRP A;  2CFW A;  1GOU A;  4RNT A;  5IG0 A;  1RTU A;  5EVH A;  1KD1 4;  3D5G A;  1UI8 A;  4OVM A;  1GMR A;  2P05 A;  4GSP A;  3WHO A;  4GL6 A;  4N6M A;  3B4P A;  3DZL A;  4HM4 B;  2F5M A;  5KP1 A;  3G4S 3;  2XRX B;  3F40 A;  2P0M A;  1TRQ A;  1TFK A;  2OOV A;  1QJG A;  7STD A;  1O7H B;  1IU7 A;  1BSB A;  4HM2 B;  1LXE A;  1IVV A;  3GZB A;  3M8C A;  3X3Z A;  1Q7H A;  3DGY A;  4EBG A;  1BNS A;  3VF1 A;  2JQ5 A;  3PCR A;  5EQL A;  3NX0 A;  2Y73 A;  4MJD A;  1B20 A;  1MGR A;  2GEY A;  3DGO A;  2AAD A;  2QGU A;  3EE1 A;  1HU9 A;  1RNT A;  1A67 A;  3DXO A;  3VSY A;  2ML6 A;  2Z7A A;  3K0Z A;  1RDS A;  4CPK A;  4HOH A;  1BNJ A;  4PEJ A;  3SOA A;  3FZW A;  3K7C A;  3JUP A;  1DET A;  1SAR A;  1JKG A;  3J7Y d;  4I4K A;  4NPB A;  3UJM A;  2IYJ A;  4WHA A;  3JUM A;  1YVB I;  1FZU A;  2IUJ A;  3S28 A;  3HX8 A;  5IG4 A;  3OWS A;  1W5Z A;  5D81 A;  1JJ2 2;  3G6E 3;  2UX0 A;  1DVC A;  4O2H A;  4AEQ A;  5AIH A;  1ZGX A;  1A2P A;  1B27 A;  4HM8 B;  3FKA A;  1Q86 4;  4BL2 A;  1OF5 B;  1W6G A;  2Z77 A;  3EJV A;  5CF1 A;  1LOW A;  5LC6 A;  1EQK A;  1BNG A;  3EF8 A;  3GZX B;  2CIU A;  2C10 A;  3MG2 A;  3AGN A;  3N54 B;  1E3V A;  5DRV A;  1OH0 A;  4HZ9 B;  2E2U A;  1GMP A;  1VZZ A;  4FCM A;  3A76 A;  3T8N A;  5IG5 A;  4R9L A;  1IT8 A;  2RGQ A;  2L4V A;  3HII A;  1B2Z A;  4KFD A;  2IUK A;  1JNQ A;  1JN5 A;  1G96 A;  2E2T A;  3CCJ 3;  4MMX B;  3VGN A;  3PGB A;  3X3X A;  1Q42 A;  2CFG A;  3AHW A;  3ER7 A;  2YX9 A;  1M90 4;  3ALA A;  1KWI A;  2W56 B;  3LZA A;  1LQG C;  3GWR A;  1MOL A;  3SOY A;  1NJI 4;  1N5H A;  3EB8 A;  3MSO A;  3O8Y A;  1YGE A;  2XGN A;  1O7M B;  2W6J H;  4MMZ B;  3EQQ B;  2IMJ A;  1TU5 A;  2XFT A;  2GSP A;  3PS8 A;  4BIR A;  1O7W B;  1RRL A;  1B2U A;  1BNF A;  1M1X B;  5IER A;  4J8T A;  3SX1 A;  3SYU A;  3CNX A;  1VQP 3;  1HYF A;  1G02 A;  1JZO A;  3OWY A;  4N6V 0;  2OQE A;  1BIR A;  3CCM 3;  1OHP A;  4XB5 A;  1WMP A;  1AV4 A;  1UI7 A;  1GD4 A;  2CWU A;  1UUW B;  1IK3 A;  3HOH A;  3F14 A;  2FNQ A;  3FH1 A;  4HZB B;  1X1X A;  3EHC A;  3STD A;  3EBY A;  3NM2 A;  3K5T A;  1B2S A;  3KZT A;  1I3F A;  3PXM A;  3F8H A;  1ULJ B;  3MG3 A;  1UUV B;  1BGS A;  1YI2 3;  1AQZ A;  4XDV A;  3CU3 A;  5G2G A;  1W6Y A;  1RNB A;  3RDE A;  2PZV A;  1MGW A;  2CK3 H;  3SLU A; 
#chains in the Genus database with same CATH homology
 5BXQ A;  1K9M 4;  2W9Q A;  2HMK B;  3BNC A;  3RGA A;  4IPB A;  2CFL A;  3GZR A;  3KSE D;  1PU4 A;  1FGR A;  3KII A;  2P0X A;  2ZL8 A;  2C11 A;  5CF2 A;  1QMA A;  3FSD A;  3MWZ A;  3NXJ A;  4EYC A;  1FA3 A;  2CC3 A;  1GYB A;  2RFR A;  5KP3 A;  1O7N B;  1YJW 3;  1NU3 A;  2GEX A;  3MPH A;  4FCJ A;  4RZM A;  1VQ8 3;  4EV2 A;  2Q07 A;  3S67 A;  1NB5 I;  1IQ8 A;  1KSI A;  2GBW B;  2O9U X;  3FGY A;  3KKG A;  3TDG A;  3DM8 A;  4XBY A;  1NB3 I;  3GAX A;  1N8Q A;  1U5O A;  2HML B;  2PNC A;  4O3V A;  5CXO A;  2WGQ A;  5FW5 A;  2BMR B;  4OK0 A;  1IQX A;  1EA2 A;  2B24 B;  1NO3 A;  1TP6 A;  2BO9 B;  1CQS A;  3IJE B;  3NUV A;  4QWT A;  2OCT A;  1IV9 A;  3D3L A;  2KXG A;  1DMM A;  3F8X A;  1STF I;  4K61 A;  2BMQ B;  3EN8 A;  1IQY A;  1Q82 4;  6STD A;  2GU1 A;  4JF8 A;  3CPO A;  1QVG 2;  1VQ6 3;  1C7H A;  3WA2 X;  3N8B A;  1NWW A;  3QRD A;  2D1W A;  2A15 A;  1IVX A;  8CHO A;  1N8R 4;  2P38 A;  2WOF A;  4RBN A;  4K1V A;  1W2B 2;  3MYT A;  4BTW A;  1OAC A;  5AII A;  5EEO A;  1W7C A;  2ML5 A;  3LTC A;  4L8P A;  4U13 A;  4L8O A;  2CHC A;  3IMA B;  3L0R A;  4H3U A;  2XSH B;  3ECF A;  4LSO A;  3LML A;  2YFJ B;  3NHX A;  3QK9 A;  1DMN A;  2XH9 A;  3K63 A;  1FGQ A;  3SED A;  4FCZ A;  1DMQ A;  1YIT 3;  2OOV C;  2I9W A;  3PZW A;  2D42 A;  1IDP A;  2HMO B;  1Q81 4;  1YIJ 3;  1HKX A;  1Q7Y 4;  4HM1 B;  2BNG A;  4FMC A;  4R4K A;  1O7P B;  1WQL B;  3N9H A;  4ORL A;  1O7G B;  1K8A 4;  3UNL A;  4Q53 A;  3GRD A;  2CG1 A;  3LT8 A;  1ZO2 A;  5TGN A;  2Z76 A;  4AKY A;  1WTH A;  3X40 A;  4FMA A;  1A2K A;  3H3H A;  4R80 A;  1EKM A;  1Z1S A;  1E97 A;  4HVN A;  1VQL 3;  3CME 3;  3V92 A;  3UL6 A;  1OCV A;  4HM3 B;  1OF5 A;  1FGT A;  3F7X A;  1ULI B;  2CH9 A;  5AEW B;  2BT3 A;  2R4I A;  5IG3 A;  1VQM 3;  1DVD A;  1PFP A;  4XBX A;  1YJ9 3;  3LT9 A;  4G1M B;  4N6U A;  1LVN A;  1JB4 A;  2WGO A;  3UL5 A;  1EG9 B;  2JDI H;  3Q90 A;  1CYU A;  1OUN A;  3WMD A;  1GY7 A;  3S27 A;  4O02 B;  4WYK A;  1GS3 A;  2W9P A;  1CEW I;  3X3Y A;  1FGM A;  5D83 A;  1RKY A;  1ROV A;  3HIG A;  1T5Y A;  2Z6B A;  4HJL B;  3X42 A;  2V1L A;  3AMO B;  5IEP A;  1QAL A;  4HM0 B;  5IF6 A;  1VQN 3;  3S29 A;  4K90 B;  5DRE A;  2RCD A;  3G71 3;  2XF3 A;  1RN7 A;  1FGO A;  3OX9 A;  3WDG B;  5KP4 A;  1AVK A;  1N9J A;  4J9A A;  1RJO A;  2W04 A;  3FG3 A;  3MG1 A;  2HMN B;  2OTJ 3;  3U97 A;  1VQO 3;  1SQW A;  4FR9 A;  3WOF B;  3CNM A;  3BLZ A;  3DUK A;  1UW1 A;  3CCS 3;  3CCV 3;  3CC2 3;  1ISK A;  3NV0 B;  4XBT A;  3OV4 A;  1M9G A;  1TIJ A;  3HZP A;  5IEN A;  1R4C A;  2W0Q A;  1GY5 A;  4JRF A;  3GZY B;  3LH4 A;  3PCS A;  3SXX A;  2RSX A;  1MNL A;  4EXR A;  3G0K A;  1Q40 B;  3LXU X;  5JPP A;  3CCE 3;  3CCL 3;  1JB2 A;  5CLK A;  1D6Z A;  4FMD A;  2P09 A;  1J2B A;  1F8N A;  3D9R A;  5LC7 A;  4EC6 A;  3NBB A;  5IEO A;  1IVU A;  2CFD A;  2QIY A;  3LTA A;  1W01 A;  2WO0 A;  1STD A;  4R9K A;  4WP5 A;  3EX9 A;  1LOX A;  3G8Z A;  4K1U A;  5JBS A;  3BND A;  3H51 A;  1TFO A;  2GXF A;  3KN4 A;  1AVL A;  2FGT A;  1IV7 A;  1SJW A;  4N3V A;  2M7O A;  3JUQ A;  2QEX 3;  3LYG A;  4N6T A;  1VQ4 3;  3HI7 A;  4N6L A;  4KFF A;  3WOE B;  3BNE A;  4EV5 A;  3CCQ 3;  1A2V A;  1OHO A;  3OWU A;  1US1 A;  4HKV B;  1E3R A;  2Y74 A;  3FF2 A;  5AYS C;  4RNY A;  3V99 A;  2INX A;  4HYZ A;  2O3O A;  3DMC A;  4HBR A;  3F9S A;  4BTX A;  3LOY A;  5BVB A;  1SIH A;  2CG0 A;  5ELJ A;  3CC4 3;  1W4N A;  3T8U A;  2F99 A;  1OGZ A;  3I55 3;  2IA7 A;  3B7C A;  3DGM A;  3K9M C;  4IT7 A;  1AR0 A;  3HK4 A;  3LTD A;  3CC7 3;  1IVW A;  1ZX2 A;  2GBX B;  3NM7 A;  3E99 A;  4LGQ A;  3FLJ A;  5AYR B;  1L5G B;  5CK6 A;  3NV0 A;  4X2O A;  5ELU A;  3SVA A;  1W6C A;  4WFO A;  1A90 A;  1QAK A;  3FCS B;  2CWV A;  3MKI A;  1V74 A;  2F98 A;  4R1K A;  4N6N B;  1D6Y A;  3G16 A;  1ROA A;  4GB5 A;  3JVC A;  1BUQ A;  2F86 B;  3CPW 2;  3NQZ A;  3WA3 A;  2XFS A;  1Q40 A;  3ROB A;  4IIA A;  1Y4K A;  1KQS 2;  1OGX A;  3RGR A;  2BMO B;  3B4O A;  2BHM A;  4WWU C;  4ZM8 A;  4O8S A;  3JUN A;  1WMO A;  4LZI A;  2KCD A;  4LMI A;  1IT7 A;  3CXC 2;  2CWT A;  1K41 A;  3IPT A;  1QAF A;  1GY6 A;  3BB9 A;  1U8C B;  1DYU A;  5A0O B;  5JPU A;  3V98 A;  1K28 A;  2GU3 A;  3JUO A;  2QA4 3;  1YJN 3;  1JRQ A;  3EC9 A;  2XSO B;  2CFK A;  2XEP A;  3CCR 3;  1JB5 A;  1RRH A;  2W56 A;  3WOD G;  5AEU B;  1SPU A;  2FXT A;  3NBR A;  1SII A;  3FG1 A;  4WYK B;  1W2Z A;  1LNH A;  3S5C A;  4L7K A;  4XDW A;  2OTL 3;  4KVH A;  4AKZ A;  2OQE C;  4MMY B;  1S72 3;  4CCV A;  2CW9 A;  1YHQ 3;  4OUQ A;  2MF7 A;  1S5A A;  5FGO A;  3FF0 A;  2XR8 B;  5AI1 A;  3X41 A;  2K0M A;  3KE7 A;  4MEI A;  1KC8 4;  1W00 A;  4NRE A;  1VQ9 3;  2CKF B;  3MHE A;  1OPY A;  1TUH A;  1JN5 B;  2WOH A;  3EBT A;  3NBJ A;  2ZDJ A;  3EN1 B;  3BNB A;  2KRT A;  3OXA A;  4BTY A;  2HMJ B;  2STD A;  4RNZ A;  1VQK 3;  1VQ7 3;  2LQV A;  5STD A;  4N6O B;  1JKG B;  1W02 A;  3AMO A;  3OW2 2;  4H61 A;  1JV2 B;  1N9E A;  3FG4 A;  3DGN A;  3KSP A;  2W2C A;  1M1K 4;  4HM6 B;  4FMB A;  1N5P A;  5AIF A;  2B1X B;  4KFE A;  4X2H A;  3T0U A;  5AIG A;  5I97 A;  5IW9 A;  2YFL B;  2LYX A;  1NDO B;  4XM4 A;  1K73 4;  3NQY A;  3LTB A;  1QVF 2;  1GD3 A;  3KFQ C;  2HMM B;  4TX4 A;  3U1W A;  3PYJ A;  1FUW A;  3I56 3;  5HGR A;  2MC8 A;  4HM5 B;  3DGL A;  2E2V A;  4HM7 B;  3B8L A;  4LEH A;  4NHF A;  1CYV A;  2W03 A;  5D82 A;  1WMN A;  3F7S A;  3Q2P A;  1VQ5 3;  1ASK A;  2SBL A;  3CMA 3;  2K54 A;  1OHS A;  3DY5 A;  2YFI B;  3Q1C A;  3I0Y A;  3UB1 A;  1D6U A;  2OWP A;  4CDL A;  4STD A;  4KZ1 A;  3CD6 3;  1WNH A;  2XGL A;  3CCU 3;  2CFW A;  5IG0 A;  5EVH A;  1KD1 4;  1UI8 A;  4OVM A;  2P05 A;  4GL6 A;  4N6M A;  3B4P A;  3DZL A;  4HM4 B;  5KP1 A;  3G4S 3;  2XRX B;  3F40 A;  2P0M A;  2OOV A;  1TFK A;  1QJG A;  7STD A;  1O7H B;  1IU7 A;  4HM2 B;  1LXE A;  1IVV A;  3GZB A;  3M8C A;  3X3Z A;  4EBG A;  3VF1 A;  2JQ5 A;  3PCR A;  5EQL A;  3NX0 A;  2Y73 A;  4MJD A;  2GEY A;  3DGO A;  2QGU A;  3EE1 A;  1HU9 A;  1A67 A;  3DXO A;  3VSY A;  2ML6 A;  2Z7A A;  3K0Z A;  4PEJ A;  3SOA A;  3FZW A;  3K7C A;  3JUP A;  1JKG A;  3J7Y d;  4I4K A;  3UJM A;  4WHA A;  3JUM A;  1YVB I;  2IUJ A;  3S28 A;  3HX8 A;  5IG4 A;  3OWS A;  1W5Z A;  5D81 A;  1JJ2 2;  3G6E 3;  2UX0 A;  1DVC A;  4O2H A;  4AEQ A;  5AIH A;  4HM8 B;  3FKA A;  1Q86 4;  1OF5 B;  1W6G A;  2Z77 A;  3EJV A;  5CF1 A;  1EQK A;  5LC6 A;  3EF8 A;  3GZX B;  2CIU A;  2C10 A;  3MG2 A;  3N54 B;  1E3V A;  5DRV A;  1OH0 A;  4HZ9 B;  2E2U A;  1VZZ A;  4FCM A;  3A76 A;  3T8N A;  5IG5 A;  4R9L A;  1IT8 A;  2RGQ A;  2L4V A;  3HII A;  4KFD A;  2IUK A;  1JNQ A;  1JN5 A;  1G96 A;  2E2T A;  3CCJ 3;  4MMX B;  3VGN A;  3PGB A;  3X3X A;  1Q42 A;  2CFG A;  3ER7 A;  2YX9 A;  1M90 4;  3ALA A;  1KWI A;  2W56 B;  3LZA A;  3GWR A;  1MOL A;  3SOY A;  1NJI 4;  1N5H A;  3EB8 A;  3MSO A;  3O8Y A;  1YGE A;  2XGN A;  1O7M B;  2W6J H;  4MMZ B;  3EQQ B;  2IMJ A;  1TU5 A;  2XFT A;  3PS8 A;  1O7W B;  1RRL A;  1M1X B;  5IER A;  4J8T A;  3SX1 A;  3CNX A;  1VQP 3;  2OQE A;  3OWY A;  4N6V 0;  3CCM 3;  1OHP A;  4XB5 A;  1WMP A;  1AV4 A;  1UI7 A;  1GD4 A;  2CWU A;  1UUW B;  1IK3 A;  3F14 A;  2FNQ A;  3FH1 A;  4HZB B;  3STD A;  3EHC A;  3EBY A;  3NM2 A;  3K5T A;  3KZT A;  3PXM A;  3F8H A;  1ULJ B;  3MG3 A;  1UUV B;  1YI2 3;  4XDV A;  3CU3 A;  5G2G A;  1W6Y A;  3RDE A;  2PZV A;  2CK3 H;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...