3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
1A67A 3KSED 5A0OB 1PFPA 2O9UX 4N6V0 4N6TA 4N6UA 2OCTA 1TIJA 1DVDA 1N5HA 1FUWA 3PS8A 4N6MA 4N6OB 2KXGA 1STFI 2BO9B 5EQLA 1MNLA 3LH4A 3IMAB 3PXMA 1CEWI 3K9MC 4TX4A 3UL5A 1IV9A 1GD4A 1FA3A 3Q2PA 1CYVA 1N5PA 1A90A 3KFQC 4N6NB 1DVCA 2W9PA 1YVBI 4EYCA 1KWIA 1EQKA 3GAXA 3NX0A 1CYUA 5ELJA 4ZM8A 1N9JA 1GD3A 1NB3I 3QRDA 4N6LA 4LZIA 1LXEA 5ELUA 3L0RA 1RN7A 3UL6A 4IT7A 4CCVA 1ROAA 5LC7A 3MWZA 1NB5I 1MOLA 1IV7A 2W9QA 3SVAA 1WNHA 5LC6A 1M9GA 3S67A 1R4CA 3PYJA 1G96A 2CH9A
chains in the Genus database with same CATH superfamily
4LYLB 1C7HA 1Q7Y4 2IYJA 3KN4A 3AHSA 1JRQA 4HBRA 3SOAA 3DZLA 1S723 1VQL3 1ISKA 1DE3A 4LEHA 1ULJB 5DREA 2C11A 3S28A 2W56B 1HKXA 3H51A 3EN8A 4HZ9B 1Z1SA 2GU1A 2YFLB 4XBXA 1VQO3 3SOYA 4EBGA 1A2PA 4AEQA 5IG4A 2O3OA 1B2XA 3G4S3 4HM8B 4CPKA 3RDEA 2XFSA 3NM2A 2K0MA 4N6OB 1OF5B 1W4NA 4O2HA 1OPYA 2Y73A 4NREA 5D81A 8RNTA 2CK3H 7STDA 1GY5A 2KXGA 1STDA 3JUPA 3T8UA 1UI8A 3E99A 5AIIA 5AEWB 3T0UA 1BNRA 1W00A 3IMAB 3DH2A 4J9AA 2Z7AA 1CEWI 1SIIA 3GWRA 4R4KA 3CXC2 1BUQA 1B2UA 2CKFB 4HM7B 2IMJA 1PU4A 1OGZA 1BNIA 1Q864 1B3SA 2D1WA 3S5CA 3Q2PA 4O02B 3CC73 1CYVA 1N5PA 2GBWB 3F14A 1LRAA 1RKYA 1BRGA 2CFGA 2K3DA 3D3LA 1LOXA 3HX8A 3SXXA 4FMBA 5CLKA 2OTJ3 1IT8A 2R4IA 1JB5A 3KFQC 3DXOA 3ZG0A 4HZBB 5G1KA 3ECFA 1BSCA 1EUIC 1S5AA 1FGRA 1JZOA 4MEIA 3D5IA 4Q53A 2RBIA 4EV5A 5KP4A 3CCR3 1RCKA 1V74A 1VQ43 1BRIA 3LXUX 1RGEA 3EJVA 5AIHA 1EQKA 1RN1A 3N9HA 3NX0A 1OH0A 2Z76A 1TRQA 2E2TA 3GRDA 1F8NA 3F7XA 6GSPA 3Q3FA 3G6E3 1BOXA 3UB1A 1IVXA 1O7PB 1GY7A 2F5MA 3CC23 1BSEA 1VQ83 5JPPA 3FGYA 3CPOA 4K61A 4J8TA 5IG3A 1BUJA 4NPBA 3BB9A 3UJMA 1NO3A 3EC9A 1R4YA 1GOVA 3ALAA 3FG1A 2UGIA 4NHFA 2BU4A 3L0RA 4IIAA 3MG1A 1CQSA 1FYSA 3X3ZA 3KSPA 1IQYA 1LOWA 1YVSA 1EG9B 5G1LA 5IENA 3DUKA 4X2HA 1UCKA 3NV0A 3DGNA 3OWUA 4N3VA 4CCVA 1MWTA 1ROAA 2GSPA 4JRFA 3AMOA 5BXQA 3G713 4OVMA 4K1UA 1K8A4 3AGNA 5AIFA 3MWZA 4AKZA 1N8QA 3JUNA 1LNHA 2CFDA 4PEJA 3NHXA 3K63A 3LTCA 3MPHA 1KD14 1C54A 1QAFA 2SARA 5G2GA 2CC3A 1WMOA 1RRLA 3X3YA 3CCL3 2W9QA 3SVAA 2MF7A 4KFEA 4FR9A 4MMXB 1O7WB 4MMYB 2RCDA 1WNHA 2SBLA 4WYKA 4HM3B 3WHOA 1DMQA 1UUWB 1HZ1A 4K90B 5HGRA 3JVCA 5D83A 2IUKA 3DGLA 2B24B 1SJWA 4EC6A 2STDA 5JPUA 1R4CA 6RNTA 3CU3A 4O8SA 3G16A 1KC84 1AVKA 1RCLA 1A2KA 3BIRA 3CCQ3 8CHOA 2L1SA 1X1YA 1RSNA 2RNTA 1YGEA 2IA7A 2XRXB 3ZG5A 5A0OB 1OHSA 4HM1B 3OXAA 3PCSA 3U1WA 1VQ93 2P09A 3CCV3 1I70A 1D6ZA 2PNCA 1Q40A 1YGWA 2OCTA 5AI1A 5M18A 3CCJ3 1UCJA 3AHWA 2OQEA 4R1KA 3X42A 1W2B2 1BGSA 3AMOB 3K7CA 4RBNA 5EVHA 4N6MA 3JUOA 4EW5A 1JBTA 4BTXA 2QA43 1UUVB 4RZMA 2ZDJA 2GU3A 1YI23 5IG0A 1BRNL 1RNBA 1STFI 1TFKA 3B4OA 3F7SA 2BO9B 1O7HB 4J5GA 4CJNA 1JN5B 3J7Yd 2YX9A 5EQLA 2F56A 1OACA 1LQMB 3TDGA 3KIIA 3PGBA 3JUMA 4TX4A 3B4PA 3EF8A 4HOHA 3FH1A 4WYKB 1G0TA 1BU4A 4I4KA 4J5KA 1KSIA 3FZWA 3F9SA 1B2ZA 3DGOA 1IK3A 3NBBA 1FA3A 1LNIA 3EHCA 1TUHA 2Z77A 5AYRB 2OOVA 2E2UA 3CME3 1JBSA 1W02A 3LT9A 3CC43 1I2GA 1WMPA 4RNYA 1FGOA 2QEX3 2OWPA 1BNFA 2PZVA 1HU9A 4HM6B 1RJOA 2GXFA 2RGQA 1JNQA 2F86B 2ML5A 1YVBI 4ORLA 2J8XB 1AVLA 4LSOA 2BIRA 1Q40B 2BMQB 5AEUB 2H0GA 1SARA 5AIGA 4OUQA 2CFWA 3FG4A 3KKGA 2FGTA 1BRHA 1W6YA 1RGKA 2ZHXB 4ZM8A 1AR0A 1GD3A 1FGMA 2XR8B 1NB3I 1GOYA 1RHLA 3V92A 1D6YA 1X1XA 3KE7A 4N6LA 1JJ22 1MWRA 2R41A 3STDA 4BU4A 3UL6A 1IT7A 1SIHA 1QVG2 1T3BA 1D6UA 3CCE3 2UX0A 4BIRA 5CF2A 1LOVA 2F99A 2CX0A 3CMA3 1RGFA 4FCJA 4HAAA 1QJGA 1JB4A 4RNZA 1BVIA 1A2VA 1W2ZA 2F4YA 2F98A 4MJDA 3LYGA 3URPA 4H3UA 1GOUA 2AADA 2HMKB 1NB5I 2B1XB 1UI7A 1TTOA 1UCIA 3MKIA 1MGWA 1LVNA 2YFIB 1IV7A 2Q07A 1GYBA 2C4BA 5BVBA 1Y4KA 4WHAA 1N9EA 3D4AA 1Q42A 1VQN3 1FGTA 1EEJA 3S29A 1PY3A 1RGCA 1T2HA 1RLSA 4GHOA 3G0KA 4GB5A 1AV4A 2V1LA 3CNMA 2QGUA 5CK6A 2RFRA 4FMDA 3IPTA 1DMNA 3LTDA 3WODG 4QWTA 2CWUA 3F8XA 3ZFZA 3FF2A 3EBTA 3HOHA 3WR2A 1O7NB 2AAEA 1VQK3 3MSOA 2K54A 1OCVA 2KF4A 4KFDA 1QVF2 1A67A 1O7MB 2HOHA 3MYTA 5I97A 5IEPA 2XGLA 4AKYA 1Q814 5STDA 1PFPA 2O9UX 2W6JH 4HJLB 4I5QA 1V58A 1BSDA 4N6V0 5IF6A 4N6TA 1IQXA 1BRKA 5M1AA 1RN4A 1W6GA 1TIJA 1JN5A 1GS3A 2XEPA 1I0VA 3MG3A 5HOHA 2Y74A 1B2SA 2E2VA 3OX9A 4FCMA 4DKIA 4HM5B 1N5HA 2HMLB 1DVDA 3LMLA 5RNTA 3PZWA 4XBYA 1K9M4 1M1K4 1DYUA 3D9RA 3CCS3 3PS8A 5IW9A 1BNJA 2HMNB 1GSPA 2BMOB 3X41A 3NUVA 1IYYA 2D42A 3S27A 5IG5A 1IDPA 3F40A 1OHPA 3M8CA 2LQVA 4LGQA 3DGMA 1MNLA 3NBJA 3LH4A 3NXJA 1LQGC 2KF6A 2L4VA 3SYUA 1RNTA 2W04A 3EE1A 3BNEA 3GZRA 2CFKA 3UL5A 2W2CA 1VQ63 2HMJB 1B21A 3FKAA 3I0YA 4WP5A 1I2EA 3JUQA 2JDIH 1GMRA 1UDII 3HZPA 3QK9A 1K41A 4K1VA 3RGRA 2CWVA 1A90A 4HM2B 1EKMA 2YFJB 3GZBA 1VQ73 1WQLB 2P05A 4N6NB 1RGGA 5JBSA 2CG1A 2W9PA 1IU7A 2A15A 4WFOA 1UGIA 1W7CA 3VGNA 2F5WA 1YJW3 2FXTA 5BIRA 1VQM3 1VZZA 2QIYA 1E3VA 1UW1A 1MWUA 4FCZA 4FMCA 1EA2A 1T2IA 3WDGB 3WMDA 2CWTA 1ASKA 1CYUA 1ZO2A 1JKGA 2BMRB 4XDWA 1YJN3 3DGYA 3FLJA 2OTL3 1N9JA 3N54B 2CIUA 4HKVB 4OK0A 3SX1A 3MHEA 2XH9A 3QRDA 3X40A 4LZIA 2WOHA 4ILFA 5ELUA 2JQ5A 2CG0A 4L8OA 1TFOA 2UUGC 3RNTA 1WTHA 3A5EA 2XFTA 3CCU3 5FW5A 3CPW2 3WOFB 4HM0B 3BNBA 5KP3A 3GZXB 1RMSA 4KT3B 1RRHA 1J2BA 1UGHI 1ZS7A 2CW9A 4HM4B 3I563 4BL2A 1JB2A 2M7OA 1M904 3LOYA 3V99A 3VSYA 1TP6A 3NBRA 3CNXA 5CXOA 1FW7A 3EQQB 1FGQA 1MOLA 1NDOB 1QALA 3EN1B 4H61A 1BNGA 2KRTA 1DMMA 1G02A 3OWYA 5IEOA 1ULIB 5EEOA 1QAKA 3BNCA 3RGAA 2ZL8A 4XB5A 1KQS2 4JF8A 1JKGB 1RGLA 1YNVX 1M9GA 3S67A 4MMZB 1BNEA 1V57A 1G96A 4EV2A 5DRVA 1U5OA 5BU4A 2CHCA 7RNTA 3V98A 2HMMB 3KSED 1BANA 3ER7A 1U8CB 1B2MA 1M1XB 1HYFA 1AY7A 1SQWA 2ZA4A 4N6UA 1PYLA 3O8YA 3KCHA 3N8BA 1YHQ3 2XGNA 1GMQA 3FCSB 1RGHA 1I3FA 4X2OA 3X3XA 2WGOA 3A76A 3BLZA 2HMOB 3EBYA 3IJEB 3WOEB 1FUWA 1ZX2A 1L5GB 1I2FA 3GSPA 3G8ZA 2KF3A 3DY5A 2OQEC 9RNTA 4U13A 1Q9EA 4O3VA 2WOFA 2CFLA 1FZUA 3LT8A 3WA2X 2GEXA 4FMAA 1NJI4 4LMIA 1WMNA 2CX1A 2P38A 2WO0A 2RSXA 3HIGA 1N8R4 2P0MA 1UCLA 1K28A 3PXMA 1ROVA 4RNTA 4XM4A 1X1UA 2I9WA 3MG2A 3K9MC 4R80A 1ZGXA 2FNQA 2IY2A 5TGNA 4HVNA 4BTWA 1IV9A 3KZTA 3Q90A 1GD4A 3HK4A 1K734 1TRPA 2KF5A 1BIRA 2Z6BA 3HIIA 1IVVA 1MGRA 3DMCA 1TJDA 1VQ53 2GEYA 3GZYB 1X1WA 1NNVA 3EB8A 1CH0A 3DM8A 1BNSA 3SEDA 2IUJA 3HI7A 3I553 1IVWA 5GSPA 1IVUA 3NQZA 1GMPA 3ROBA 2OOVC 2P0XA 3K0ZA 1BRJA 4STDA 1BSBA 1I8VA 3LTBA 1YIJ3 1BRSA 1DVCA 4R9KA 1OGXA 5KP1A 1E97A 3FF0A 1T5YA 4EYCA 1KWIA 4WWUC 3GAXA 1OHOA 1RTUA 3D5GA 2BT3A 4R9LA 2W03A 2XSOB 3Q1CA 3H3HA 2GBXB 5ELJA 1I3IA 2KCDA 4KFFA 6STDA 1DETA 1O7GB 1QMAA 4HYZA 1SPUA 4IPBA 1JBRA 3BNDA 1LOYA 1RDSA 1BSAA 3F8HA 5D82A 4CDLA 1JV2B 4GL6A 1YIT3 1FUTA 3NM7A 3D79A 4XBTA 3BU4A 2ML6A 2WGQA 1IQ8A 1LXEA 4XDVA 4KVHA 1W5ZA 1RN7A 1MWSA 4IT7A 2C10A 1NWWA 1W01A 2KAAA 2LYXA 2W56A 3U97A 1Q824 1OUNA 4KZ1A 3T8NA 3OW22 3CD63 1B27A 3OWSA 4G1MB 1Q7HA 5AYSC 1TU5A 1AQZA 4EXRA 1VQQA 7GSPA 5LC7A 2BNGA 3PCRA 2XF3A 2MC8A 1OF5A 3WA3A 5IERA 5CF1A 3LZAA 1I0XA 4L7KA 3NV0B 1US1A 2XSHB 3FG3A 1NU3A 3VF1A 5FGOA 2W0QA 3AGOA 1VQP3 1W6CA 5M19A 2H0IA 4L8PA 3UNLA 1B20A 1RGAA 2INXA 3K5TA 3B8LA 1JZDA 3B7CA 3EX9A 1E3RA 1UUGB 2BHMA 3LTAA 4GSPA 5LC6A 4BL3A 1YJ93 1GY6A 1FUSA 4BTYA 3PYJA 3CCM3 3OV4A 2H0HA 3FSDA 2CH9A 3SLUA 3NQYA 1BAOA
chains in the Genus database with same CATH topology
1C7HA 1Q7Y4 3KN4A 1JRQA 4HBRA 3SOAA 3DZLA 1S723 1VQL3 1ISKA 4LEHA 1ULJB 5DREA 2C11A 3S28A 2W56B 1HKXA 3H51A 3EN8A 4HZ9B 1Z1SA 2GU1A 2YFLB 4XBXA 1VQO3 3SOYA 4EBGA 4AEQA 5IG4A 2O3OA 3G4S3 4HM8B 3RDEA 2XFSA 3NM2A 2K0MA 4N6OB 1OF5B 1W4NA 4O2HA 1OPYA 2Y73A 4NREA 5D81A 2CK3H 7STDA 1GY5A 2KXGA 1STDA 3JUPA 3T8UA 1UI8A 3E99A 5AIIA 5AEWB 3T0UA 1W00A 3IMAB 4J9AA 2Z7AA 1CEWI 1SIIA 3GWRA 4R4KA 1BUQA 2CKFB 4HM7B 2IMJA 1PU4A 1OGZA 1Q864 2D1WA 3S5CA 3Q2PA 4O02B 3CC73 1CYVA 1N5PA 2GBWB 3F14A 1RKYA 2CFGA 3SXXA 3D3LA 1LOXA 3HX8A 4FMBA 5CLKA 2OTJ3 1IT8A 2R4IA 1JB5A 3KFQC 3DXOA 4HZBB 3ECFA 1S5AA 1FGRA 5KP4A 4MEIA 4Q53A 3CCR3 4EV5A 1VQ43 1V74A 3LXUX 3EJVA 5AIHA 1EQKA 3N9HA 3NX0A 1OH0A 2Z76A 2E2TA 3GRDA 1F8NA 3F7XA 3G6E3 3UB1A 1IVXA 1O7PB 1GY7A 3CC23 1VQ83 5JPPA 3FGYA 3CPOA 4K61A 4J8TA 5IG3A 3BB9A 3UJMA 1NO3A 3EC9A 3ALAA 3FG1A 4NHFA 4IIAA 3L0RA 3MG1A 1CQSA 3X3ZA 3KSPA 1IQYA 1EG9B 5IENA 3DUKA 4X2HA 3NV0A 3DGNA 3OWUA 4N3VA 4CCVA 1ROAA 4JRFA 1K8A4 3AMOA 5BXQA 3G713 4OVMA 4K1UA 5AIFA 3MWZA 4AKZA 1N8QA 3JUNA 1LNHA 2CFDA 4PEJA 3NHXA 3K63A 3LTCA 3MPHA 1KD14 1QAFA 5G2GA 3CCL3 2CC3A 1WMOA 1RRLA 3X3YA 2W9QA 3SVAA 2MF7A 4KFEA 4FR9A 4MMXB 1O7WB 4MMYB 2RCDA 1WNHA 2SBLA 4WYKA 4HM3B 1DMQA 1UUWB 4K90B 5HGRA 3JVCA 5D83A 2IUKA 3DGLA 2B24B 1SJWA 4EC6A 2STDA 5JPUA 1R4CA 3CU3A 4O8SA 3G16A 1KC84 1AVKA 1A2KA 3CCQ3 8CHOA 1YGEA 2IA7A 2XRXB 5A0OB 1OHSA 4HM1B 3OXAA 3PCSA 3U1WA 1VQ93 2P09A 3CCV3 1D6ZA 2PNCA 1Q40A 2OCTA 5AI1A 3CCJ3 2OQEA 4R1KA 3X42A 1W2B2 3AMOB 3K7CA 4RBNA 5EVHA 4N6MA 3JUOA 4BTXA 2QA43 1UUVB 4RZMA 2ZDJA 2GU3A 1YI23 5IG0A 1STFI 1TFKA 3B4OA 3F7SA 2BO9B 1O7HB 3J7Yd 1JN5B 2YX9A 5EQLA 1OACA 3TDGA 3KIIA 3PGBA 3JUMA 4TX4A 3B4PA 3EF8A 4WYKB 3FH1A 4I4KA 1KSIA 3FZWA 3F9SA 1IK3A 3DGOA 1FA3A 3NBBA 3EHCA 1TUHA 2Z77A 5AYRB 2OOVA 2E2UA 3CME3 1W02A 3LT9A 3CC43 1WMPA 4RNYA 1FGOA 2QEX3 2OWPA 2PZVA 1HU9A 4HM6B 1RJOA 2RGQA 2GXFA 1JNQA 2F86B 2ML5A 1YVBI 4ORLA 1AVLA 4LSOA 1Q40B 2BMQB 5AEUB 5AIGA 4OUQA 2CFWA 3FG4A 3KKGA 2FGTA 1W6YA 4ZM8A 1AR0A 1GD3A 1FGMA 2XR8B 1NB3I 3V92A 1D6YA 3KE7A 4N6LA 1JJ22 3STDA 3UL6A 1IT7A 1SIHA 1QVG2 1D6UA 3CCE3 2UX0A 5CF2A 2F99A 3CMA3 4FCJA 1QJGA 1JB4A 4RNZA 1A2VA 1W2ZA 2F98A 4MJDA 3LYGA 4H3UA 2HMKB 1NB5I 2B1XB 1UI7A 3MKIA 1LVNA 2YFIB 1IV7A 2Q07A 1GYBA 5BVBA 1Y4KA 4WHAA 1N9EA 1Q42A 1VQN3 1FGTA 3S29A 3G0KA 4GB5A 1AV4A 2V1LA 3CNMA 2QGUA 5CK6A 2RFRA 4FMDA 3IPTA 1DMNA 3LTDA 3WODG 4QWTA 2CWUA 3F8XA 3FF2A 3EBTA 1O7NB 1VQK3 3MSOA 2K54A 1OCVA 4KFDA 1A67A 1QVF2 1O7MB 3MYTA 5IEPA 5I97A 2XGLA 4AKYA 1Q814 5STDA 1PFPA 2O9UX 2W6JH 4HJLB 3CXC2 4N6V0 5IF6A 4N6TA 1IQXA 1W6GA 1TIJA 1JN5A 1GS3A 2XEPA 3MG3A 2Y74A 2E2VA 3OX9A 1DVDA 4FCMA 4HM5B 1N5HA 2HMLB 3LMLA 3PZWA 4XBYA 1K9M4 1M1K4 1DYUA 3D9RA 3CCS3 3PS8A 5IW9A 2HMNB 2BMOB 3X41A 3NUVA 2D42A 3S27A 5IG5A 1IDPA 3F40A 1OHPA 3M8CA 2LQVA 4LGQA 3DGMA 1MNLA 3NBJA 3LH4A 3NXJA 2L4VA 2W04A 3EE1A 3BNEA 3GZRA 2CFKA 3UL5A 2W2CA 1VQ63 2HMJB 3I0YA 3FKAA 4WP5A 3JUQA 2JDIH 3HZPA 3QK9A 1K41A 4K1VA 3RGRA 2CWVA 1A90A 4HM2B 1EKMA 2YFJB 3GZBA 1VQ73 1WQLB 2P05A 4N6NB 5JBSA 2CG1A 2W9PA 1IU7A 2A15A 4WFOA 1W7CA 3VGNA 1YJW3 2FXTA 1VQM3 1VZZA 2QIYA 1E3VA 1UW1A 4FCZA 4FMCA 1EA2A 3WDGB 3WMDA 1CYUA 2CWTA 1ASKA 1ZO2A 1JKGA 2BMRB 4XDWA 1YJN3 3FLJA 2OTL3 1N9JA 3N54B 2CIUA 4HKVB 4OK0A 3SX1A 3MHEA 2XH9A 3QRDA 3X40A 4LZIA 2WOHA 5ELUA 2JQ5A 2CG0A 4L8OA 1TFOA 1WTHA 2XFTA 3CCU3 5FW5A 3CPW2 3WOFB 4HM0B 3BNBA 5KP3A 3GZXB 1RRHA 1J2BA 2CW9A 4HM4B 3I563 1JB2A 2M7OA 1M904 3LOYA 3V99A 3VSYA 1TP6A 3NBRA 3CNXA 5CXOA 3EQQB 1FGQA 1MOLA 1NDOB 1QALA 3EN1B 4H61A 2KRTA 1DMMA 3OWYA 5IEOA 1ULIB 1QAKA 3BNCA 3RGAA 2ZL8A 4XB5A 1KQS2 4JF8A 1JKGB 1M9GA 3S67A 4MMZB 1G96A 4EV2A 5DRVA 1U5OA 2CHCA 3V98A 2HMMB 3KSED 3ER7A 1U8CB 1M1XB 1SQWA 4N6UA 3O8YA 3N8BA 1YHQ3 2XGNA 3FCSB 4X2OA 3X3XA 2WGOA 3A76A 3BLZA 2HMOB 3EBYA 3IJEB 3WOEB 1FUWA 1ZX2A 1L5GB 3G8ZA 3DY5A 2OQEC 4U13A 4O3VA 2WOFA 2CFLA 3LT8A 3WA2X 2GEXA 4FMAA 1NJI4 4LMIA 1WMNA 2P38A 2WO0A 1N8R4 2RSXA 3HIGA 2P0MA 1K28A 3PXMA 1ROVA 4XM4A 5TGNA 2I9WA 3MG2A 3K9MC 4R80A 2FNQA 4BTWA 4HVNA 1IV9A 3KZTA 3Q90A 1GD4A 3HK4A 1K734 2Z6BA 3HIIA 1IVVA 1VQ53 3DMCA 2GEYA 3GZYB 3EB8A 3DM8A 3SEDA 2IUJA 3HI7A 3I553 1IVWA 1IVUA 3NQZA 3ROBA 2OOVC 2P0XA 3K0ZA 4STDA 3LTBA 1YIJ3 1DVCA 4R9KA 1OGXA 5KP1A 1E97A 3FF0A 1T5YA 4EYCA 1KWIA 4WWUC 3GAXA 1OHOA 2BT3A 4R9LA 2W03A 2XSOB 3Q1CA 3H3HA 2GBXB 5ELJA 2KCDA 4KFFA 6STDA 1QMAA 1O7GB 4HYZA 4IPBA 1SPUA 3BNDA 3F8HA 5D82A 4CDLA 1JV2B 4GL6A 1YIT3 3NM7A 4XBTA 2ML6A 2WGQA 1IQ8A 1LXEA 4XDVA 4KVHA 1W5ZA 1RN7A 4IT7A 2C10A 1NWWA 1W01A 2LYXA 2W56A 3U97A 1Q824 1OUNA 4KZ1A 3T8NA 3OW22 3CD63 3OWSA 4G1MB 5AYSC 1TU5A 4EXRA 5LC7A 2BNGA 3PCRA 2XF3A 2MC8A 1OF5A 3WA3A 5IERA 5CF1A 3LZAA 4L7KA 3NV0B 1US1A 2XSHB 3FG3A 1NU3A 3VF1A 5FGOA 2W0QA 1VQP3 1W6CA 4L8PA 3UNLA 2INXA 3K5TA 3B8LA 3EX9A 3B7CA 3LTAA 1E3RA 2BHMA 5LC6A 4BTYA 1YJ93 1GY6A 3PYJA 3CCM3 3OV4A 3FSDA 2CH9A 3SLUA 3NQYA 5EEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A67 A;  3KSE D;  5A0O B;  1PFP A;  2O9U X;  4N6V 0;  4N6T A;  4N6U A;  2OCT A;  1TIJ A;  1DVD A;  1N5H A;  1FUW A;  3PS8 A;  4N6M A;  4N6O B;  2KXG A;  1STF I;  2BO9 B;  5EQL A;  1MNL A;  3LH4 A;  3IMA B;  3PXM A;  1CEW I;  3K9M C;  4TX4 A;  3UL5 A;  1IV9 A;  1GD4 A;  1FA3 A;  3Q2P A;  1CYV A;  1N5P A;  1A90 A;  3KFQ C;  4N6N B;  1DVC A;  2W9P A;  1YVB I;  4EYC A;  1KWI A;  1EQK A;  3GAX A;  3NX0 A;  1CYU A;  5ELJ A;  4ZM8 A;  1N9J A;  1GD3 A;  1NB3 I;  3QRD A;  4N6L A;  4LZI A;  1LXE A;  5ELU A;  3L0R A;  1RN7 A;  3UL6 A;  4IT7 A;  4CCV A;  1ROA A;  5LC7 A;  3MWZ A;  1NB5 I;  1MOL A;  1IV7 A;  2W9Q A;  3SVA A;  1WNH A;  5LC6 A;  1M9G A;  3S67 A;  1R4C A;  3PYJ A;  1G96 A;  2CH9 A; 
#chains in the Genus database with same CATH topology
 4LYL B;  1C7H A;  1Q7Y 4;  2IYJ A;  3KN4 A;  3AHS A;  1JRQ A;  4HBR A;  3SOA A;  3DZL A;  1S72 3;  1VQL 3;  1ISK A;  1DE3 A;  4LEH A;  1ULJ B;  5DRE A;  2C11 A;  3S28 A;  2W56 B;  1HKX A;  3H51 A;  3EN8 A;  4HZ9 B;  1Z1S A;  2GU1 A;  2YFL B;  4XBX A;  1VQO 3;  3SOY A;  4EBG A;  1A2P A;  4AEQ A;  5IG4 A;  2O3O A;  1B2X A;  3G4S 3;  4HM8 B;  4CPK A;  3RDE A;  2XFS A;  3NM2 A;  2K0M A;  4N6O B;  1OF5 B;  1W4N A;  4O2H A;  1OPY A;  2Y73 A;  4NRE A;  5D81 A;  8RNT A;  2CK3 H;  7STD A;  1GY5 A;  2KXG A;  1STD A;  3JUP A;  3T8U A;  1UI8 A;  3E99 A;  5AII A;  5AEW B;  3T0U A;  1BNR A;  1W00 A;  3IMA B;  3DH2 A;  4J9A A;  2Z7A A;  1CEW I;  1SII A;  3GWR A;  4R4K A;  3CXC 2;  1BUQ A;  1B2U A;  2CKF B;  4HM7 B;  2IMJ A;  1PU4 A;  1OGZ A;  1BNI A;  1Q86 4;  1B3S A;  2D1W A;  3S5C A;  3Q2P A;  4O02 B;  3CC7 3;  1CYV A;  1N5P A;  2GBW B;  3F14 A;  1LRA A;  1RKY A;  1BRG A;  2CFG A;  2K3D A;  3D3L A;  1LOX A;  3HX8 A;  3SXX A;  4FMB A;  5CLK A;  2OTJ 3;  1IT8 A;  2R4I A;  1JB5 A;  3KFQ C;  3DXO A;  3ZG0 A;  4HZB B;  5G1K A;  3ECF A;  1BSC A;  1EUI C;  1S5A A;  1FGR A;  1JZO A;  4MEI A;  3D5I A;  4Q53 A;  2RBI A;  4EV5 A;  5KP4 A;  3CCR 3;  1RCK A;  1V74 A;  1VQ4 3;  1BRI A;  3LXU X;  1RGE A;  3EJV A;  5AIH A;  1EQK A;  1RN1 A;  3N9H A;  3NX0 A;  1OH0 A;  2Z76 A;  1TRQ A;  2E2T A;  3GRD A;  1F8N A;  3F7X A;  6GSP A;  3Q3F A;  3G6E 3;  1BOX A;  3UB1 A;  1IVX A;  1O7P B;  1GY7 A;  2F5M A;  3CC2 3;  1BSE A;  1VQ8 3;  5JPP A;  3FGY A;  3CPO A;  4K61 A;  4J8T A;  5IG3 A;  1BUJ A;  4NPB A;  3BB9 A;  3UJM A;  1NO3 A;  3EC9 A;  1R4Y A;  1GOV A;  3ALA A;  3FG1 A;  2UGI A;  4NHF A;  2BU4 A;  3L0R A;  4IIA A;  3MG1 A;  1CQS A;  1FYS A;  3X3Z A;  3KSP A;  1IQY A;  1LOW A;  1YVS A;  1EG9 B;  5G1L A;  5IEN A;  3DUK A;  4X2H A;  1UCK A;  3NV0 A;  3DGN A;  3OWU A;  4N3V A;  4CCV A;  1MWT A;  1ROA A;  2GSP A;  4JRF A;  3AMO A;  5BXQ A;  3G71 3;  4OVM A;  4K1U A;  1K8A 4;  3AGN A;  5AIF A;  3MWZ A;  4AKZ A;  1N8Q A;  3JUN A;  1LNH A;  2CFD A;  4PEJ A;  3NHX A;  3K63 A;  3LTC A;  3MPH A;  1KD1 4;  1C54 A;  1QAF A;  2SAR A;  5G2G A;  2CC3 A;  1WMO A;  1RRL A;  3X3Y A;  3CCL 3;  2W9Q A;  3SVA A;  2MF7 A;  4KFE A;  4FR9 A;  4MMX B;  1O7W B;  4MMY B;  2RCD A;  1WNH A;  2SBL A;  4WYK A;  4HM3 B;  3WHO A;  1DMQ A;  1UUW B;  1HZ1 A;  4K90 B;  5HGR A;  3JVC A;  5D83 A;  2IUK A;  3DGL A;  2B24 B;  1SJW A;  4EC6 A;  2STD A;  5JPU A;  1R4C A;  6RNT A;  3CU3 A;  4O8S A;  3G16 A;  1KC8 4;  1AVK A;  1RCL A;  1A2K A;  3BIR A;  3CCQ 3;  8CHO A;  2L1S A;  1X1Y A;  1RSN A;  2RNT A;  1YGE A;  2IA7 A;  2XRX B;  3ZG5 A;  5A0O B;  1OHS A;  4HM1 B;  3OXA A;  3PCS A;  3U1W A;  1VQ9 3;  2P09 A;  3CCV 3;  1I70 A;  1D6Z A;  2PNC A;  1Q40 A;  1YGW A;  2OCT A;  5AI1 A;  5M18 A;  3CCJ 3;  1UCJ A;  3AHW A;  2OQE A;  4R1K A;  3X42 A;  1W2B 2;  1BGS A;  3AMO B;  3K7C A;  4RBN A;  5EVH A;  4N6M A;  3JUO A;  4EW5 A;  1JBT A;  4BTX A;  2QA4 3;  1UUV B;  4RZM A;  2ZDJ A;  2GU3 A;  1YI2 3;  5IG0 A;  1BRN L;  1RNB A;  1STF I;  1TFK A;  3B4O A;  3F7S A;  2BO9 B;  1O7H B;  4J5G A;  4CJN A;  1JN5 B;  3J7Y d;  2YX9 A;  5EQL A;  2F56 A;  1OAC A;  1LQM B;  3TDG A;  3KII A;  3PGB A;  3JUM A;  4TX4 A;  3B4P A;  3EF8 A;  4HOH A;  3FH1 A;  4WYK B;  1G0T A;  1BU4 A;  4I4K A;  4J5K A;  1KSI A;  3FZW A;  3F9S A;  1B2Z A;  3DGO A;  1IK3 A;  3NBB A;  1FA3 A;  1LNI A;  3EHC A;  1TUH A;  2Z77 A;  5AYR B;  2OOV A;  2E2U A;  3CME 3;  1JBS A;  1W02 A;  3LT9 A;  3CC4 3;  1I2G A;  1WMP A;  4RNY A;  1FGO A;  2QEX 3;  2OWP A;  1BNF A;  2PZV A;  1HU9 A;  4HM6 B;  1RJO A;  2GXF A;  2RGQ A;  1JNQ A;  2F86 B;  2ML5 A;  1YVB I;  4ORL A;  2J8X B;  1AVL A;  4LSO A;  2BIR A;  1Q40 B;  2BMQ B;  5AEU B;  2H0G A;  1SAR A;  5AIG A;  4OUQ A;  2CFW A;  3FG4 A;  3KKG A;  2FGT A;  1BRH A;  1W6Y A;  1RGK A;  2ZHX B;  4ZM8 A;  1AR0 A;  1GD3 A;  1FGM A;  2XR8 B;  1NB3 I;  1GOY A;  1RHL A;  3V92 A;  1D6Y A;  1X1X A;  3KE7 A;  4N6L A;  1JJ2 2;  1MWR A;  2R41 A;  3STD A;  4BU4 A;  3UL6 A;  1IT7 A;  1SIH A;  1QVG 2;  1T3B A;  1D6U A;  3CCE 3;  2UX0 A;  4BIR A;  5CF2 A;  1LOV A;  2F99 A;  2CX0 A;  3CMA 3;  1RGF A;  4FCJ A;  4HAA A;  1QJG A;  1JB4 A;  4RNZ A;  1BVI A;  1A2V A;  1W2Z A;  2F4Y A;  2F98 A;  4MJD A;  3LYG A;  3URP A;  4H3U A;  1GOU A;  2AAD A;  2HMK B;  1NB5 I;  2B1X B;  1UI7 A;  1TTO A;  1UCI A;  3MKI A;  1MGW A;  1LVN A;  2YFI B;  1IV7 A;  2Q07 A;  1GYB A;  2C4B A;  5BVB A;  1Y4K A;  4WHA A;  1N9E A;  3D4A A;  1Q42 A;  1VQN 3;  1FGT A;  1EEJ A;  3S29 A;  1PY3 A;  1RGC A;  1T2H A;  1RLS A;  4GHO A;  3G0K A;  4GB5 A;  1AV4 A;  2V1L A;  3CNM A;  2QGU A;  5CK6 A;  2RFR A;  4FMD A;  3IPT A;  1DMN A;  3LTD A;  3WOD G;  4QWT A;  2CWU A;  3F8X A;  3ZFZ A;  3FF2 A;  3EBT A;  3HOH A;  3WR2 A;  1O7N B;  2AAE A;  1VQK 3;  3MSO A;  2K54 A;  1OCV A;  2KF4 A;  4KFD A;  1QVF 2;  1A67 A;  1O7M B;  2HOH A;  3MYT A;  5I97 A;  5IEP A;  2XGL A;  4AKY A;  1Q81 4;  5STD A;  1PFP A;  2O9U X;  2W6J H;  4HJL B;  4I5Q A;  1V58 A;  1BSD A;  4N6V 0;  5IF6 A;  4N6T A;  1IQX A;  1BRK A;  5M1A A;  1RN4 A;  1W6G A;  1TIJ A;  1JN5 A;  1GS3 A;  2XEP A;  1I0V A;  3MG3 A;  5HOH A;  2Y74 A;  1B2S A;  2E2V A;  3OX9 A;  4FCM A;  4DKI A;  4HM5 B;  1N5H A;  2HML B;  1DVD A;  3LML A;  5RNT A;  3PZW A;  4XBY A;  1K9M 4;  1M1K 4;  1DYU A;  3D9R A;  3CCS 3;  3PS8 A;  5IW9 A;  1BNJ A;  2HMN B;  1GSP A;  2BMO B;  3X41 A;  3NUV A;  1IYY A;  2D42 A;  3S27 A;  5IG5 A;  1IDP A;  3F40 A;  1OHP A;  3M8C A;  2LQV A;  4LGQ A;  3DGM A;  1MNL A;  3NBJ A;  3LH4 A;  3NXJ A;  1LQG C;  2KF6 A;  2L4V A;  3SYU A;  1RNT A;  2W04 A;  3EE1 A;  3BNE A;  3GZR A;  2CFK A;  3UL5 A;  2W2C A;  1VQ6 3;  2HMJ B;  1B21 A;  3FKA A;  3I0Y A;  4WP5 A;  1I2E A;  3JUQ A;  2JDI H;  1GMR A;  1UDI I;  3HZP A;  3QK9 A;  1K41 A;  4K1V A;  3RGR A;  2CWV A;  1A90 A;  4HM2 B;  1EKM A;  2YFJ B;  3GZB A;  1VQ7 3;  1WQL B;  2P05 A;  4N6N B;  1RGG A;  5JBS A;  2CG1 A;  2W9P A;  1IU7 A;  2A15 A;  4WFO A;  1UGI A;  1W7C A;  3VGN A;  2F5W A;  1YJW 3;  2FXT A;  5BIR A;  1VQM 3;  1VZZ A;  2QIY A;  1E3V A;  1UW1 A;  1MWU A;  4FCZ A;  4FMC A;  1EA2 A;  1T2I A;  3WDG B;  3WMD A;  2CWT A;  1ASK A;  1CYU A;  1ZO2 A;  1JKG A;  2BMR B;  4XDW A;  1YJN 3;  3DGY A;  3FLJ A;  2OTL 3;  1N9J A;  3N54 B;  2CIU A;  4HKV B;  4OK0 A;  3SX1 A;  3MHE A;  2XH9 A;  3QRD A;  3X40 A;  4LZI A;  2WOH A;  4ILF A;  5ELU A;  2JQ5 A;  2CG0 A;  4L8O A;  1TFO A;  2UUG C;  3RNT A;  1WTH A;  3A5E A;  2XFT A;  3CCU 3;  5FW5 A;  3CPW 2;  3WOF B;  4HM0 B;  3BNB A;  5KP3 A;  3GZX B;  1RMS A;  4KT3 B;  1RRH A;  1J2B A;  1UGH I;  1ZS7 A;  2CW9 A;  4HM4 B;  3I56 3;  4BL2 A;  1JB2 A;  2M7O A;  1M90 4;  3LOY A;  3V99 A;  3VSY A;  1TP6 A;  3NBR A;  3CNX A;  5CXO A;  1FW7 A;  3EQQ B;  1FGQ A;  1MOL A;  1NDO B;  1QAL A;  3EN1 B;  4H61 A;  1BNG A;  2KRT A;  1DMM A;  1G02 A;  3OWY A;  5IEO A;  1ULI B;  5EEO A;  1QAK A;  3BNC A;  3RGA A;  2ZL8 A;  4XB5 A;  1KQS 2;  4JF8 A;  1JKG B;  1RGL A;  1YNV X;  1M9G A;  3S67 A;  4MMZ B;  1BNE A;  1V57 A;  1G96 A;  4EV2 A;  5DRV A;  1U5O A;  5BU4 A;  2CHC A;  7RNT A;  3V98 A;  2HMM B;  3KSE D;  1BAN A;  3ER7 A;  1U8C B;  1B2M A;  1M1X B;  1HYF A;  1AY7 A;  1SQW A;  2ZA4 A;  4N6U A;  1PYL A;  3O8Y A;  3KCH A;  3N8B A;  1YHQ 3;  2XGN A;  1GMQ A;  3FCS B;  1RGH A;  1I3F A;  4X2O A;  3X3X A;  2WGO A;  3A76 A;  3BLZ A;  2HMO B;  3EBY A;  3IJE B;  3WOE B;  1FUW A;  1ZX2 A;  1L5G B;  1I2F A;  3GSP A;  3G8Z A;  2KF3 A;  3DY5 A;  2OQE C;  9RNT A;  4U13 A;  1Q9E A;  4O3V A;  2WOF A;  2CFL A;  1FZU A;  3LT8 A;  3WA2 X;  2GEX A;  4FMA A;  1NJI 4;  4LMI A;  1WMN A;  2CX1 A;  2P38 A;  2WO0 A;  2RSX A;  3HIG A;  1N8R 4;  2P0M A;  1UCL A;  1K28 A;  3PXM A;  1ROV A;  4RNT A;  4XM4 A;  1X1U A;  2I9W A;  3MG2 A;  3K9M C;  4R80 A;  1ZGX A;  2FNQ A;  2IY2 A;  5TGN A;  4HVN A;  4BTW A;  1IV9 A;  3KZT A;  3Q90 A;  1GD4 A;  3HK4 A;  1K73 4;  1TRP A;  2KF5 A;  1BIR A;  2Z6B A;  3HII A;  1IVV A;  1MGR A;  3DMC A;  1TJD A;  1VQ5 3;  2GEY A;  3GZY B;  1X1W A;  1NNV A;  3EB8 A;  1CH0 A;  3DM8 A;  1BNS A;  3SED A;  2IUJ A;  3HI7 A;  3I55 3;  1IVW A;  5GSP A;  1IVU A;  3NQZ A;  1GMP A;  3ROB A;  2OOV C;  2P0X A;  3K0Z A;  1BRJ A;  4STD A;  1BSB A;  1I8V A;  3LTB A;  1YIJ 3;  1BRS A;  1DVC A;  4R9K A;  1OGX A;  5KP1 A;  1E97 A;  3FF0 A;  1T5Y A;  4EYC A;  1KWI A;  4WWU C;  3GAX A;  1OHO A;  1RTU A;  3D5G A;  2BT3 A;  4R9L A;  2W03 A;  2XSO B;  3Q1C A;  3H3H A;  2GBX B;  5ELJ A;  1I3I A;  2KCD A;  4KFF A;  6STD A;  1DET A;  1O7G B;  1QMA A;  4HYZ A;  1SPU A;  4IPB A;  1JBR A;  3BND A;  1LOY A;  1RDS A;  1BSA A;  3F8H A;  5D82 A;  4CDL A;  1JV2 B;  4GL6 A;  1YIT 3;  1FUT A;  3NM7 A;  3D79 A;  4XBT A;  3BU4 A;  2ML6 A;  2WGQ A;  1IQ8 A;  1LXE A;  4XDV A;  4KVH A;  1W5Z A;  1RN7 A;  1MWS A;  4IT7 A;  2C10 A;  1NWW A;  1W01 A;  2KAA A;  2LYX A;  2W56 A;  3U97 A;  1Q82 4;  1OUN A;  4KZ1 A;  3T8N A;  3OW2 2;  3CD6 3;  1B27 A;  3OWS A;  4G1M B;  1Q7H A;  5AYS C;  1TU5 A;  1AQZ A;  4EXR A;  1VQQ A;  7GSP A;  5LC7 A;  2BNG A;  3PCR A;  2XF3 A;  2MC8 A;  1OF5 A;  3WA3 A;  5IER A;  5CF1 A;  3LZA A;  1I0X A;  4L7K A;  3NV0 B;  1US1 A;  2XSH B;  3FG3 A;  1NU3 A;  3VF1 A;  5FGO A;  2W0Q A;  3AGO A;  1VQP 3;  1W6C A;  5M19 A;  2H0I A;  4L8P A;  3UNL A;  1B20 A;  1RGA A;  2INX A;  3K5T A;  3B8L A;  1JZD A;  3B7C A;  3EX9 A;  1E3R A;  1UUG B;  2BHM A;  3LTA A;  4GSP A;  5LC6 A;  4BL3 A;  1YJ9 3;  1GY6 A;  1FUS A;  4BTY A;  3PYJ A;  3CCM 3;  3OV4 A;  2H0H A;  3FSD A;  2CH9 A;  3SLU A;  3NQY A;  1BAO A; 
#chains in the Genus database with same CATH homology
 1C7H A;  1Q7Y 4;  3KN4 A;  1JRQ A;  4HBR A;  3SOA A;  3DZL A;  1S72 3;  1VQL 3;  1ISK A;  4LEH A;  1ULJ B;  5DRE A;  2C11 A;  3S28 A;  2W56 B;  1HKX A;  3H51 A;  3EN8 A;  4HZ9 B;  1Z1S A;  2GU1 A;  2YFL B;  4XBX A;  1VQO 3;  3SOY A;  4EBG A;  4AEQ A;  5IG4 A;  2O3O A;  3G4S 3;  4HM8 B;  3RDE A;  2XFS A;  3NM2 A;  2K0M A;  4N6O B;  1OF5 B;  1W4N A;  4O2H A;  1OPY A;  2Y73 A;  4NRE A;  5D81 A;  2CK3 H;  7STD A;  1GY5 A;  2KXG A;  1STD A;  3JUP A;  3T8U A;  1UI8 A;  3E99 A;  5AII A;  5AEW B;  3T0U A;  1W00 A;  3IMA B;  4J9A A;  2Z7A A;  1CEW I;  1SII A;  3GWR A;  4R4K A;  1BUQ A;  2CKF B;  4HM7 B;  2IMJ A;  1PU4 A;  1OGZ A;  1Q86 4;  2D1W A;  3S5C A;  3Q2P A;  4O02 B;  3CC7 3;  1CYV A;  1N5P A;  2GBW B;  3F14 A;  1RKY A;  2CFG A;  3SXX A;  3D3L A;  1LOX A;  3HX8 A;  4FMB A;  5CLK A;  2OTJ 3;  1IT8 A;  2R4I A;  1JB5 A;  3KFQ C;  3DXO A;  4HZB B;  3ECF A;  1S5A A;  1FGR A;  5KP4 A;  4MEI A;  4Q53 A;  3CCR 3;  4EV5 A;  1VQ4 3;  1V74 A;  3LXU X;  3EJV A;  5AIH A;  1EQK A;  3N9H A;  3NX0 A;  1OH0 A;  2Z76 A;  2E2T A;  3GRD A;  1F8N A;  3F7X A;  3G6E 3;  3UB1 A;  1IVX A;  1O7P B;  1GY7 A;  3CC2 3;  1VQ8 3;  5JPP A;  3FGY A;  3CPO A;  4K61 A;  4J8T A;  5IG3 A;  3BB9 A;  3UJM A;  1NO3 A;  3EC9 A;  3ALA A;  3FG1 A;  4NHF A;  4IIA A;  3L0R A;  3MG1 A;  1CQS A;  3X3Z A;  3KSP A;  1IQY A;  1EG9 B;  5IEN A;  3DUK A;  4X2H A;  3NV0 A;  3DGN A;  3OWU A;  4N3V A;  4CCV A;  1ROA A;  4JRF A;  1K8A 4;  3AMO A;  5BXQ A;  3G71 3;  4OVM A;  4K1U A;  5AIF A;  3MWZ A;  4AKZ A;  1N8Q A;  3JUN A;  1LNH A;  2CFD A;  4PEJ A;  3NHX A;  3K63 A;  3LTC A;  3MPH A;  1KD1 4;  1QAF A;  5G2G A;  3CCL 3;  2CC3 A;  1WMO A;  1RRL A;  3X3Y A;  2W9Q A;  3SVA A;  2MF7 A;  4KFE A;  4FR9 A;  4MMX B;  1O7W B;  4MMY B;  2RCD A;  1WNH A;  2SBL A;  4WYK A;  4HM3 B;  1DMQ A;  1UUW B;  4K90 B;  5HGR A;  3JVC A;  5D83 A;  2IUK A;  3DGL A;  2B24 B;  1SJW A;  4EC6 A;  2STD A;  5JPU A;  1R4C A;  3CU3 A;  4O8S A;  3G16 A;  1KC8 4;  1AVK A;  1A2K A;  3CCQ 3;  8CHO A;  1YGE A;  2IA7 A;  2XRX B;  5A0O B;  1OHS A;  4HM1 B;  3OXA A;  3PCS A;  3U1W A;  1VQ9 3;  2P09 A;  3CCV 3;  1D6Z A;  2PNC A;  1Q40 A;  2OCT A;  5AI1 A;  3CCJ 3;  2OQE A;  4R1K A;  3X42 A;  1W2B 2;  3AMO B;  3K7C A;  4RBN A;  5EVH A;  4N6M A;  3JUO A;  4BTX A;  2QA4 3;  1UUV B;  4RZM A;  2ZDJ A;  2GU3 A;  1YI2 3;  5IG0 A;  1STF I;  1TFK A;  3B4O A;  3F7S A;  2BO9 B;  1O7H B;  3J7Y d;  1JN5 B;  2YX9 A;  5EQL A;  1OAC A;  3TDG A;  3KII A;  3PGB A;  3JUM A;  4TX4 A;  3B4P A;  3EF8 A;  4WYK B;  3FH1 A;  4I4K A;  1KSI A;  3FZW A;  3F9S A;  1IK3 A;  3DGO A;  1FA3 A;  3NBB A;  3EHC A;  1TUH A;  2Z77 A;  5AYR B;  2OOV A;  2E2U A;  3CME 3;  1W02 A;  3LT9 A;  3CC4 3;  1WMP A;  4RNY A;  1FGO A;  2QEX 3;  2OWP A;  2PZV A;  1HU9 A;  4HM6 B;  1RJO A;  2RGQ A;  2GXF A;  1JNQ A;  2F86 B;  2ML5 A;  1YVB I;  4ORL A;  1AVL A;  4LSO A;  1Q40 B;  2BMQ B;  5AEU B;  5AIG A;  4OUQ A;  2CFW A;  3FG4 A;  3KKG A;  2FGT A;  1W6Y A;  4ZM8 A;  1AR0 A;  1GD3 A;  1FGM A;  2XR8 B;  1NB3 I;  3V92 A;  1D6Y A;  3KE7 A;  4N6L A;  1JJ2 2;  3STD A;  3UL6 A;  1IT7 A;  1SIH A;  1QVG 2;  1D6U A;  3CCE 3;  2UX0 A;  5CF2 A;  2F99 A;  3CMA 3;  4FCJ A;  1QJG A;  1JB4 A;  4RNZ A;  1A2V A;  1W2Z A;  2F98 A;  4MJD A;  3LYG A;  4H3U A;  2HMK B;  1NB5 I;  2B1X B;  1UI7 A;  3MKI A;  1LVN A;  2YFI B;  1IV7 A;  2Q07 A;  1GYB A;  5BVB A;  1Y4K A;  4WHA A;  1N9E A;  1Q42 A;  1VQN 3;  1FGT A;  3S29 A;  3G0K A;  4GB5 A;  1AV4 A;  2V1L A;  3CNM A;  2QGU A;  5CK6 A;  2RFR A;  4FMD A;  3IPT A;  1DMN A;  3LTD A;  3WOD G;  4QWT A;  2CWU A;  3F8X A;  3FF2 A;  3EBT A;  1O7N B;  1VQK 3;  3MSO A;  2K54 A;  1OCV A;  4KFD A;  1A67 A;  1QVF 2;  1O7M B;  3MYT A;  5IEP A;  5I97 A;  2XGL A;  4AKY A;  1Q81 4;  5STD A;  1PFP A;  2O9U X;  2W6J H;  4HJL B;  3CXC 2;  4N6V 0;  5IF6 A;  4N6T A;  1IQX A;  1W6G A;  1TIJ A;  1JN5 A;  1GS3 A;  2XEP A;  3MG3 A;  2Y74 A;  2E2V A;  3OX9 A;  1DVD A;  4FCM A;  4HM5 B;  1N5H A;  2HML B;  3LML A;  3PZW A;  4XBY A;  1K9M 4;  1M1K 4;  1DYU A;  3D9R A;  3CCS 3;  3PS8 A;  5IW9 A;  2HMN B;  2BMO B;  3X41 A;  3NUV A;  2D42 A;  3S27 A;  5IG5 A;  1IDP A;  3F40 A;  1OHP A;  3M8C A;  2LQV A;  4LGQ A;  3DGM A;  1MNL A;  3NBJ A;  3LH4 A;  3NXJ A;  2L4V A;  2W04 A;  3EE1 A;  3BNE A;  3GZR A;  2CFK A;  3UL5 A;  2W2C A;  1VQ6 3;  2HMJ B;  3I0Y A;  3FKA A;  4WP5 A;  3JUQ A;  2JDI H;  3HZP A;  3QK9 A;  1K41 A;  4K1V A;  3RGR A;  2CWV A;  1A90 A;  4HM2 B;  1EKM A;  2YFJ B;  3GZB A;  1VQ7 3;  1WQL B;  2P05 A;  4N6N B;  5JBS A;  2CG1 A;  2W9P A;  1IU7 A;  2A15 A;  4WFO A;  1W7C A;  3VGN A;  1YJW 3;  2FXT A;  1VQM 3;  1VZZ A;  2QIY A;  1E3V A;  1UW1 A;  4FCZ A;  4FMC A;  1EA2 A;  3WDG B;  3WMD A;  1CYU A;  2CWT A;  1ASK A;  1ZO2 A;  1JKG A;  2BMR B;  4XDW A;  1YJN 3;  3FLJ A;  2OTL 3;  1N9J A;  3N54 B;  2CIU A;  4HKV B;  4OK0 A;  3SX1 A;  3MHE A;  2XH9 A;  3QRD A;  3X40 A;  4LZI A;  2WOH A;  5ELU A;  2JQ5 A;  2CG0 A;  4L8O A;  1TFO A;  1WTH A;  2XFT A;  3CCU 3;  5FW5 A;  3CPW 2;  3WOF B;  4HM0 B;  3BNB A;  5KP3 A;  3GZX B;  1RRH A;  1J2B A;  2CW9 A;  4HM4 B;  3I56 3;  1JB2 A;  2M7O A;  1M90 4;  3LOY A;  3V99 A;  3VSY A;  1TP6 A;  3NBR A;  3CNX A;  5CXO A;  3EQQ B;  1FGQ A;  1MOL A;  1NDO B;  1QAL A;  3EN1 B;  4H61 A;  2KRT A;  1DMM A;  3OWY A;  5IEO A;  1ULI B;  1QAK A;  3BNC A;  3RGA A;  2ZL8 A;  4XB5 A;  1KQS 2;  4JF8 A;  1JKG B;  1M9G A;  3S67 A;  4MMZ B;  1G96 A;  4EV2 A;  5DRV A;  1U5O A;  2CHC A;  3V98 A;  2HMM B;  3KSE D;  3ER7 A;  1U8C B;  1M1X B;  1SQW A;  4N6U A;  3O8Y A;  3N8B A;  1YHQ 3;  2XGN A;  3FCS B;  4X2O A;  3X3X A;  2WGO A;  3A76 A;  3BLZ A;  2HMO B;  3EBY A;  3IJE B;  3WOE B;  1FUW A;  1ZX2 A;  1L5G B;  3G8Z A;  3DY5 A;  2OQE C;  4U13 A;  4O3V A;  2WOF A;  2CFL A;  3LT8 A;  3WA2 X;  2GEX A;  4FMA A;  1NJI 4;  4LMI A;  1WMN A;  2P38 A;  2WO0 A;  1N8R 4;  2RSX A;  3HIG A;  2P0M A;  1K28 A;  3PXM A;  1ROV A;  4XM4 A;  5TGN A;  2I9W A;  3MG2 A;  3K9M C;  4R80 A;  2FNQ A;  4BTW A;  4HVN A;  1IV9 A;  3KZT A;  3Q90 A;  1GD4 A;  3HK4 A;  1K73 4;  2Z6B A;  3HII A;  1IVV A;  1VQ5 3;  3DMC A;  2GEY A;  3GZY B;  3EB8 A;  3DM8 A;  3SED A;  2IUJ A;  3HI7 A;  3I55 3;  1IVW A;  1IVU A;  3NQZ A;  3ROB A;  2OOV C;  2P0X A;  3K0Z A;  4STD A;  3LTB A;  1YIJ 3;  1DVC A;  4R9K A;  1OGX A;  5KP1 A;  1E97 A;  3FF0 A;  1T5Y A;  4EYC A;  1KWI A;  4WWU C;  3GAX A;  1OHO A;  2BT3 A;  4R9L A;  2W03 A;  2XSO B;  3Q1C A;  3H3H A;  2GBX B;  5ELJ A;  2KCD A;  4KFF A;  6STD A;  1QMA A;  1O7G B;  4HYZ A;  4IPB A;  1SPU A;  3BND A;  3F8H A;  5D82 A;  4CDL A;  1JV2 B;  4GL6 A;  1YIT 3;  3NM7 A;  4XBT A;  2ML6 A;  2WGQ A;  1IQ8 A;  1LXE A;  4XDV A;  4KVH A;  1W5Z A;  1RN7 A;  4IT7 A;  2C10 A;  1NWW A;  1W01 A;  2LYX A;  2W56 A;  3U97 A;  1Q82 4;  1OUN A;  4KZ1 A;  3T8N A;  3OW2 2;  3CD6 3;  3OWS A;  4G1M B;  5AYS C;  1TU5 A;  4EXR A;  5LC7 A;  2BNG A;  3PCR A;  2XF3 A;  2MC8 A;  1OF5 A;  3WA3 A;  5IER A;  5CF1 A;  3LZA A;  4L7K A;  3NV0 B;  1US1 A;  2XSH B;  3FG3 A;  1NU3 A;  3VF1 A;  5FGO A;  2W0Q A;  1VQP 3;  1W6C A;  4L8P A;  3UNL A;  2INX A;  3K5T A;  3B8L A;  3EX9 A;  3B7C A;  3LTA A;  1E3R A;  2BHM A;  5LC6 A;  4BTY A;  1YJ9 3;  1GY6 A;  3PYJ A;  3CCM 3;  3OV4 A;  3FSD A;  2CH9 A;  3SLU A;  3NQY A;  5EEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...