3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
b'GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
3UL6A 1GD3A 3KSED 4IT7A 4N6V0 1A90A 4N6OB 4CCVA 3S67A 5ELUA 1PFPA 1N5HA 3L0RA 1G96A 1TIJA 2KXGA 3PYJA 4LZIA 5LC6A 1IV9A 1ROAA 1GD4A 2BO9B 3UL5A 1DVCA 1MOLA 1M9GA 1EQKA 2W9PA 1N5PA 1STFI 1FUWA 3KFQC 3NX0A 1NB5I 1RN7A 1IV7A 2CH9A 3IMAB 2OCTA 5ELJA 5EQLA 1CEWI 1LXEA 4N6MA 4ZM8A 1FA3A 3SVAA 3LH4A 1N9JA 4N6TA 1R4CA 3PS8A 1KWIA 3QRDA 1NB3I 4TX4A 4N6NB 3K9MC 3PXMA 4N6LA 3Q2PA 1MNLA 1WNHA 1CYUA 3MWZA 1YVBI 5LC7A 3GAXA 1A67A 2O9UX 2W9QA 1CYVA 5A0OB 4EYCA 4N6UA 1DVDA
chains in the Genus database with same CATH superfamily
1GD3A 1HZ1A 2CG0A 4EXRA 2HMLB 4IT7A 5EEOA 4HVNA 1A90A 1T5YA 3Q90A 3CCJ3 4N6OB 5GSPA 3CCM3 2FXTA 3MHEA 1PFPA 1BVIA 1V58A 3CD63 3FG1A 3L0RA 1YIJ3 1NNVA 1RGGA 1SIIA 3FCSB 3DMCA 1I8VA 1VQK3 1LOWA 3ALAA 5JPPA 3CU3A 4I4KA 1IDPA 3URPA 1QJGA 1ULJB 4RBNA 1BRKA 4LZIA 1DETA 4EV2A 1RCLA 1K734 1ROAA 1VQO3 1TRQA 1ZO2A 3D5GA 1PY3A 2W03A 1W6GA 3WA3A 1VQ93 1YGWA 1RN1A 4O2HA 2BO9B 1L5GB 5G1LA 3UL5A 1MWUA 2H0IA 1BANA 1IU7A 2C10A 1DVCA 2XH9A 2HMMB 3BNCA 3EF8A 3OWUA 1M9GA 3NBJA 1FGRA 1FW7A 1BSBA 1EQKA 2CWTA 5AIFA 1JN5B 2GU3A 2ML6A 4HM6B 2XRXB 2XR8B 1UCJA 3N8BA 3NUVA 3CME3 3VGNA 1MWSA 3X3XA 1QMAA 2RCDA 3WR2A 2GSPA 3FF2A 1SJWA 2Q07A 2XGLA 1TJDA 3DGLA 1N5PA 1ZGXA 1SIHA 3A76A 3KN4A 4K1UA 3SX1A 1M1K4 5CF1A 1FGOA 1BUQA 1B27A 4HJLB 1MWTA 4L7KA 1PU4A 1IV7A 4AKYA 2CH9A 2AAEA 2IYJA 5ELJA 4XM4A 4JF8A 1UUWB 4J8TA 3KZTA 4KFDA 2P38A 4R4KA 4GB5A 1JB5A 3LTCA 2R41A 5BIRA 3DGNA 1CEWI 1I3FA 1LXEA 5AEUB 1YIT3 4WWUC 1I70A 1N8QA 1G0TA 2F98A 3T8UA 4N6TA 4FCJA 4NPBA 1R4YA 4O3VA 1T2IA 3WMDA 3GZRA 4CDLA 3DGYA 3U97A 3NQZA 3NHXA 4AEQA 2QA43 2HMKB 9RNTA 1BSEA 1VQ53 1D6YA 4BL2A 1OCVA 3QRDA 2W2CA 1Z1SA 1BUJA 4WFOA 1JKGA 1AQZA 1OPYA 3F9SA 4TX4A 1BSDA 3VSYA 3WOFB 1B2UA 2BMOB 3G8ZA 1M904 3SYUA 4N6NB 1MWRA 3LTBA 4O02B 3KKGA 2W04A 4N6LA 1J2BA 1WMOA 3HOHA 3HIIA 4K61A 1FZUA 1O7GB 3Q2PA 3BB9A 2IA7A 4LMIA 1HKXA 1UUVB 1K41A 3IPTA 3V98A 4MMYB 2FNQA 2H0GA 1BRSA 3UJMA 1IVUA 3GWRA 1VQQA 1YVBI 3WHOA 2D42A 1A67A 4U13A 1TRPA 6GSPA 3ZFZA 1CYVA 3F8HA 1UUGB 2KF5A 4HZBB 1GOYA 1GY7A 1BAOA 1EA2A 2V1LA 3EHCA 1DVDA 4EW5A 1AV4A 3G4S3 1O7MB 3ER7A 1FGTA 3FLJA 3NBBA 1W02A 4LSOA 5AEWB 3ZG0A 5IEPA 5RNTA 3CXC2 3FGYA 3CCR3 3LTAA 1JJ22 2ZA4A 5IENA 3EX9A 3F14A 3DXOA 3KIIA 1RJOA 1N5HA 7STDA 1Q40A 4Q53A 1B20A 1QVF2 2F86B 1LOYA 2KXGA 2OOVC 1TFOA 1MGWA 4XBXA 4I5QA 2F5WA 3PYJA 3GZYB 3FSDA 3FG4A 1YHQ3 2GEYA 1I2GA 3K7CA 4R80A 5D81A 5AYSC 2BMRB 1E3VA 1KQS2 1Q7HA 4WP5A 1TP6A 4FMDA 2CFWA 3UNLA 5IEOA 3MG3A 1LOXA 1AVKA 4ILFA 4KT3B 3WDGB 2XSOB 2F56A 2D1WA 1BOXA 1OHOA 1B2MA 5DRVA 5KP1A 1A2KA 4XDWA 3HI7A 5D83A 4XBYA 1E3RA 1W00A 2XGNA 1GSPA 1GS3A 1SQWA 3LXUX 1S723 1FYSA 3GZBA 3EQQB 3NM2A 1WQLB 3FH1A 2OTL3 3NV0A 1DMMA 2CWUA 2E2UA 3JUNA 3MKIA 3CNMA 4HZ9B 2IY2A 3DUKA 1B2SA 1RN4A 1X1WA 2LQVA 3MG2A 3EJVA 5STDA 3KFQC 2XF3A 1Q40B 1SARA 4RNYA 1TU5A 3D4AA 2W6JH 3IMAB 2K3DA 2RBIA 2Y74A 5D82A 1C54A 2KCDA 4L8OA 5EQLA 1OF5B 1B3SA 3S29A 2STDA 1T3BA 2ZL8A 2B24B 2QIYA 3AHSA 4ZM8A 1IK3A 1O7HB 1FA3A 1YVSA 1SPUA 3EC9A 1N9JA 3LH4A 4R9KA 5IERA 4X2HA 1RDSA 3FF0A 2C11A 4CPKA 1R4CA 1ZS7A 5IF6A 1BSAA 1BRIA 2E2TA 1BNGA 2F5MA 1YNVX 2CX1A 4WYKA 2B1XB 3FG3A 3BNDA 3OWYA 2CHCA 4NREA 1V74A 1FUSA 1NB3I 1OHPA 4EBGA 1Q42A 3JUOA 3RDEA 3G6E3 1B2XA 4CJNA 1RKYA 1LNIA 3WOEB 2WOHA 3H51A 2AADA 3BLZA 1I0XA 4O8SA 3RGAA 3PCSA 1ULIB 1A2PA 3PXMA 5AIHA 2A15A 1OUNA 1FGMA 3K5TA 3SEDA 2OWPA 1VQP3 1K9M4 4DKIA 1AVLA 1IQXA 1IT8A 4JRFA 1MNLA 3JVCA 5IW9A 2Z7AA 1RGAA 1W7CA 2GBWB 2BT3A 1I2FA 6RNTA 4OK0A 1RRLA 1Y4KA 2CWVA 2Z6BA 3HIGA 5TGNA 3F8XA 1Q7Y4 1RGKA 2MC8A 2K54A 1UGIA 3AGOA 2MF7A 1GY5A 1LRAA 3AGNA 2CX0A 3F7XA 5HOHA 3EBYA 4EYCA 2W56A 2GU1A 1NO3A 3K63A 4N6UA 4XBTA 5G1KA 3I553 1B2ZA 3QK9A 4MMZB 2OTJ3 1KD14 1F8NA 2BNGA 3SLUA 2BIRA 2PZVA 1YJ93 1JRQA 1JNQA 2LYXA 1Q824 3EB8A 4N6V0 2INXA 4HM2B 3D5IA 1GMQA 2GXFA 4CCVA 3CCL3 4G1MB 3AMOA 1OH0A 3S67A 1JV2B 1AY7A 1ISKA 1B21A 3M8CA 1JZOA 5CK6A 2GBXB 4HOHA 4STDA 5G2GA 2Z77A 1U8CB 3DZLA 4R1KA 2CK3H 1VZZA 1W01A 2CW9A 4WHAA 1JBSA 3ROBA 3CPW2 1W4NA 1VQM3 1UDII 2IUJA 3RGRA 1DYUA 2XFTA 2CFLA 3A5EA 3TDGA 5LC6A 2K0MA 1ZX2A 1BRNL 1IV9A 1PYLA 4PEJA 3D9RA 1RGCA 5AIIA 1GY6A 1FUTA 1GD4A 1RHLA 3PCRA 4BL3A 1OGXA 4XDVA 5M18A 3UB1A 4RZMA 1EG9B 4AKZA 1GOUA 1JKGB 3X42A 5AYRB 3HX8A 1ASKA 1GYBA 2YFIB 5FW5A 3E99A 3EN8A 4K1VA 1U5OA 1JB4A 4GHOA 5KP3A 5IG0A 4N3VA 1RSNA 2ZDJA 3B4OA 2W9PA 3NBRA 1IVVA 5HGRA 1YGEA 3B4PA 3Q3FA 3CCE3 1Q864 1STFI 1AR0A 4MJDA 5CLKA 3VF1A 3OXAA 1UI7A 3OWSA 1FUWA 1CQSA 3G16A 4BTXA 2GEXA 2F99A 3MPHA 3NX0A 2KRTA 4HAAA 1GMRA 3D3LA 1BNEA 1I2EA 1Q9EA 1BNJA 2BU4A 1LOVA 3G0KA 2O3OA 2QGUA 1STDA 1IT7A 3OV4A 5DREA 4GSPA 3DM8A 4HM0B 4R9LA 1D6UA 3S28A 1G02A 5BU4A 2P09A 1MGRA 1RNTA 3F7SA 4KVHA 2YFLB 2CG1A 1GMPA 2RFRA 3SVAA 1KC84 2L4VA 5AIGA 1T2HA 1QVG2 1ROVA 4J5GA 4HKVB 2ZHXB 4KFEA 3BU4A 3PS8A 4HM4B 1KWIA 5JBSA 5KP4A 1OGZA 3OW22 2M7OA 3CMA3 2HMJB 1HYFA 2CFDA 2E2VA 1UCKA 2WOFA 3I0YA 4KFFA 3X3YA 8RNTA 1NWWA 2WO0A 1K28A 1TUHA 4LEHA 3CC73 1JN5A 3MYTA 3NM7A 4XB5A 2OQEC 3STDA 3K9MC 4ORLA 2Y73A 4HM5B 4X2OA 1RTUA 2CKFB 4HM3B 3AHWA 2CIUA 2CFGA 1HU9A 1O7PB 2HMOB 2JQ5A 1LVNA 3EBTA 4MEIA 1UGHI 2RSXA 2W0QA 1CYUA 1E97A 4LYLB 1DE3A 4RNTA 4BTYA 3ECFA 1X1XA 4HYZA 3S27A 1X1UA 2FGTA 3GAXA 1RCKA 1GOVA 1N9EA 2CFKA 2F4YA 2KF4A 2O9UX 4FCMA 3RNTA 4HM1B 8CHOA 1UCLA 1RRHA 2Z76A 3GRDA 3LZAA 1D6ZA 3X41A 1BRHA 1W2ZA 2SBLA 4EC6A 5A0OB 3SOAA 1KSIA 1BNRA 5EVHA 3NXJA 4FR9A 4OUQA 1RNBA 3LMLA 3CC43 4FMAA 1WMNA 3NV0B 1X1YA 2KAAA 3UL6A 1QALA 3KSED 1NJI4 4EV5A 1M1XB 2YX9A 3PGBA 3WODG 4J9AA 3ZG5A 2IUKA 1OACA 3KE7A 1IVWA 2WGOA 1NDOB 3NQYA 1LNHA 1IQYA 1NU3A 2HOHA 5ELUA 5BVBA 5M19A 1RGHA 2UUGC 1EUIC 1A2VA 3B8LA 3EN1B 1IVXA 2BMQB 1S5AA 4BU4A 3T8NA 1CH0A 3FZWA 4NHFA 1G96A 1TIJA 5IG5A 3X40A 4HM8B 5CXOA 4HBRA 3D79A 3CPOA 1WTHA 1BNIA 2UGIA 3OX9A 1UI8A 3H3HA 4QWTA 2KF3A 2R4IA 1JZDA 4WYKB 2L1SA 2P05A 3DY5A 1US1A 3IJEB 3KCHA 3N54B 3DGMA 3DGOA 1DMNA 1MOLA 4BIRA 4LGQA 3CC23 2RGQA 1JBRA 2H0HA 1UW1A 2J8XB 2PNCA 4KZ1A 3SXXA 5IG3A 1TFKA 1BRJA 7RNTA 4OVMA 1LQGC 2P0MA 3FKAA 1Q814 1W2B2 3LT8A 2XSHB 6STDA 1O7NB 3CCS3 3K0ZA 1LQMB 3U1WA 3LYGA 1NB5I 1TTOA 3KSPA 4BTWA 1RGEA 1RN7A 1K8A4 1N8R4 2SARA 2IMJA 1C7HA 2OCTA 1UCIA 1W6YA 3V92A 4IPBA 3HK4A 1JBTA 3LTDA 2JDIH 2XFSA 3JUQA 4RNZA 1RGLA 2I9WA 1BNSA 1V57A 5IG4A 1VQ83 1BNFA 4N6MA 3LT9A 1JB2A 1O7WB 1RGFA 2W56B 4IIAA 3SOYA 1DMQA 2OOVA 5BXQA 5CF2A 2HMNB 1YJW3 3B7CA 3CCV3 1W6CA 3BNEA 3X3ZA 3DH2A 1VQ43 1BGSA 1RMSA 1QAFA 1I3IA 3N9HA 1BU4A 4FCZA 3MG1A 3CCU3 2P0XA 1VQN3 3AMOB 3BIRA 3T0UA 4H61A 2XEPA 3F40A 3V99A 2QEX3 1YJN3 4FMCA 2RNTA 5I97A 4HM7B 4K90B 4FMBA 2C4BA 2WGQA 1QAKA 1EEJA 1VQL3 3GSPA 1FGQA 1IQ8A 2CC3A 2YFJB 3I563 4MMXB 2UX0A 3PZWA 5JPUA 4H3UA 1RLSA 1WNHA 5FGOA 3Q1CA 3MWZA 4L8PA 3J7Yd 2KF6A 3BNBA 3G713 1I0VA 5LC7A 1IYYA 3LOYA 3CCQ3 1EKMA 1W5ZA 1BIRA 7GSPA 1BRGA 5M1AA 3S5CA 1OF5A 2OQEA 3WA2X 1VQ73 2W9QA 3MSOA 5AI1A 1OHSA 3HZPA 3GZXB 2ML5A 3JUPA 3JUMA 3CNXA 3O8YA 4J5KA 4GL6A 1YI23 1WMPA 2BHMA 3EE1A 1BSCA 1VQ63
chains in the Genus database with same CATH topology
1GD3A 2CG0A 4EXRA 2HMLB 4IT7A 5EEOA 4HVNA 1A90A 1T5YA 3Q90A 3CCJ3 4N6OB 3CCM3 2FXTA 3MHEA 1PFPA 3CD63 3FG1A 3L0RA 1YIJ3 1SIIA 3FCSB 3DMCA 1VQK3 3ALAA 5JPPA 3CU3A 4I4KA 1IDPA 1QJGA 1ULJB 4RBNA 4LZIA 4EV2A 1K734 1ROAA 1VQO3 1ZO2A 1VQ93 2W03A 1W6GA 3WA3A 4O2HA 2BO9B 1L5GB 3UL5A 2XH9A 1IU7A 2C10A 1DVCA 3BNCA 2HMMB 3EF8A 3OWUA 1M9GA 3NBJA 1FGRA 1EQKA 2CWTA 5AIFA 1JN5B 2GU3A 2ML6A 4HM6B 2XRXB 2XR8B 3NUVA 3N8BA 2OTJ3 3CME3 3VGNA 3X3XA 1QMAA 2RCDA 3FF2A 1SJWA 2Q07A 2XGLA 3DGLA 1N5PA 1SIHA 3A76A 3KN4A 4K1UA 3SX1A 1M1K4 5CF1A 1FGOA 1BUQA 4HJLB 1PU4A 4L7KA 1IV7A 4AKYA 2CH9A 5ELJA 4XM4A 4JF8A 1UUWB 4J8TA 3KZTA 4KFDA 2P38A 4R4KA 4GB5A 1JB5A 3LTCA 3DGNA 1CEWI 1LXEA 5AEUB 1YIT3 4WWUC 1N8QA 2F98A 3T8UA 4N6TA 4FCJA 4O3VA 3WMDA 3GZRA 4CDLA 3U97A 3NQZA 3NHXA 4AEQA 2QA43 2HMKB 1VQ53 1D6YA 1OCVA 3QRDA 2W2CA 1Z1SA 4WFOA 1JKGA 1OPYA 3F9SA 4TX4A 3VSYA 3WOFB 2BMOB 3G8ZA 1M904 4N6NB 3LTBA 4O02B 3KKGA 2W04A 4N6LA 1J2BA 1WMOA 3HIIA 4K61A 1O7GB 3Q2PA 3BB9A 2IA7A 4LMIA 1HKXA 1UUVB 1K41A 3IPTA 3V98A 4MMYB 2FNQA 3UJMA 1IVUA 3GWRA 1YVBI 2D42A 1A67A 4U13A 1CYVA 3F8HA 4HZBB 1GY7A 1EA2A 2V1LA 3EHCA 1DVDA 1AV4A 3G4S3 1O7MB 3ER7A 1FGTA 3FLJA 3NBBA 1W02A 4LSOA 5AEWB 5IEPA 3CXC2 3FGYA 3CCR3 3LTAA 1JJ22 5IENA 3EX9A 3F14A 3DXOA 3KIIA 1RJOA 1N5HA 7STDA 1Q40A 4Q53A 1QVF2 2F86B 2KXGA 2OOVC 1TFOA 4XBXA 3PYJA 3GZYB 3FSDA 3FG4A 1YHQ3 2GEYA 3K7CA 4R80A 5D81A 5AYSC 2BMRB 1E3VA 1KQS2 4WP5A 1TP6A 4FMDA 2CFWA 3UNLA 5IEOA 3MG3A 1LOXA 1AVKA 3WDGB 2XSOB 2D1WA 1OHOA 5DRVA 5KP1A 1A2KA 4XDWA 3HI7A 5D83A 4XBYA 1E3RA 1W00A 2XGNA 1GS3A 1SQWA 3LXUX 1S723 3GZBA 3EQQB 3NM2A 1WQLB 3FH1A 2OTL3 3NV0A 1DMMA 2CWUA 2E2UA 3JUNA 3MKIA 3CNMA 4HZ9B 3DUKA 2LQVA 3MG2A 3EJVA 5STDA 3KFQC 2XF3A 1Q40B 4RNYA 1TU5A 2W6JH 3IMAB 2Y74A 5D82A 2KCDA 4L8OA 5EQLA 1OF5B 3S29A 2STDA 2ZL8A 2B24B 2QIYA 4ZM8A 1IK3A 1O7HB 1FA3A 1SPUA 3EC9A 1N9JA 3LH4A 4R9KA 5IERA 4X2HA 3FF0A 5IF6A 2C11A 1R4CA 2E2TA 4WYKA 2B1XB 3FG3A 3BNDA 3OWYA 2CHCA 4NREA 1V74A 1OHPA 1NB3I 4EBGA 1Q42A 3JUOA 3RDEA 3G6E3 1RKYA 3WOEB 2WOHA 3H51A 3BLZA 4O8SA 3RGAA 3PCSA 1ULIB 3PXMA 5AIHA 2A15A 1OUNA 1FGMA 3K5TA 3SEDA 2OWPA 1VQP3 1K9M4 1AVLA 1IQXA 1IT8A 4JRFA 1MNLA 3JVCA 5IW9A 2Z7AA 1W7CA 2GBWB 2BT3A 4OK0A 1RRLA 1Y4KA 2CWVA 2Z6BA 3HIGA 5TGNA 3F8XA 1Q7Y4 2MC8A 2K54A 2MF7A 1GY5A 3F7XA 3EBYA 4EYCA 2W56A 2GU1A 1NO3A 3K63A 4N6UA 4XBTA 3I553 3QK9A 4MMZB 1KD14 1F8NA 2BNGA 3SLUA 2PZVA 1YJ93 1JRQA 1JNQA 2LYXA 1Q824 3EB8A 4N6V0 2INXA 4HM2B 4CCVA 2GXFA 3CCL3 4G1MB 3AMOA 1OH0A 3S67A 1JV2B 1ISKA 3M8CA 5CK6A 2GBXB 4STDA 5G2GA 2Z77A 1U8CB 3DZLA 4R1KA 2CK3H 1VZZA 1W01A 2CW9A 4WHAA 3ROBA 3CPW2 1W4NA 1VQM3 2IUJA 3RGRA 1DYUA 2XFTA 2CFLA 3TDGA 5LC6A 2K0MA 1ZX2A 1IV9A 4PEJA 3D9RA 5AIIA 1GY6A 1GD4A 3PCRA 1OGXA 4XDVA 3UB1A 4RZMA 1EG9B 4AKZA 1JKGB 3X42A 5AYRB 3HX8A 1ASKA 1GYBA 2YFIB 5FW5A 3E99A 3EN8A 4K1VA 1U5OA 1JB4A 5KP3A 5IG0A 4N3VA 2ZDJA 3B4OA 2W9PA 3NBRA 1IVVA 5HGRA 1YGEA 3B4PA 1Q864 3CCE3 1STFI 1AR0A 4MJDA 5CLKA 3VF1A 3OXAA 1UI7A 3OWSA 1FUWA 1CQSA 3G16A 4BTXA 2GEXA 2F99A 3MPHA 3NX0A 2KRTA 3D3LA 3G0KA 2O3OA 2QGUA 1STDA 1IT7A 3OV4A 5DREA 3DM8A 4HM0B 4R9LA 1D6UA 3S28A 2P09A 3F7SA 4KVHA 2YFLB 2CG1A 3SVAA 2RFRA 1KC84 2L4VA 5AIGA 1QVG2 1ROVA 4HKVB 4KFEA 3PS8A 4HM4B 1KWIA 5JBSA 5KP4A 1OGZA 3OW22 2M7OA 3CMA3 2HMJB 2CFDA 2E2VA 2WOFA 3I0YA 4KFFA 3X3YA 1NWWA 2WO0A 1K28A 1TUHA 4LEHA 3CC73 1JN5A 3MYTA 3NM7A 4XB5A 2OQEC 3STDA 3K9MC 4ORLA 2Y73A 4HM5B 4X2OA 4HM3B 2CKFB 2CIUA 2CFGA 1HU9A 1O7PB 2HMOB 2JQ5A 1LVNA 3EBTA 4MEIA 2RSXA 2W0QA 1CYUA 1E97A 4BTYA 3ECFA 4HYZA 3S27A 2FGTA 3GAXA 1N9EA 2CFKA 2O9UX 4FCMA 4HM1B 8CHOA 1RRHA 2Z76A 3GRDA 3LZAA 1D6ZA 3X41A 2SBLA 1W2ZA 4EC6A 5A0OB 3SOAA 1KSIA 5EVHA 3NXJA 4FR9A 4OUQA 3CC43 3LMLA 4FMAA 1WMNA 3NV0B 3UL6A 1QALA 3KSED 1NJI4 4EV5A 1M1XB 2YX9A 3PGBA 3WODG 4J9AA 2IUKA 1OACA 3KE7A 1IVWA 2WGOA 1NDOB 3NQYA 1LNHA 1IQYA 1NU3A 5ELUA 5BVBA 3EN1B 1A2VA 3B8LA 1IVXA 2BMQB 1S5AA 3T8NA 3FZWA 4NHFA 1G96A 1TIJA 5IG5A 3X40A 4HM8B 5CXOA 4HBRA 3CPOA 1WTHA 3OX9A 1UI8A 3H3HA 4QWTA 2R4IA 4WYKB 2P05A 3DY5A 1US1A 3IJEB 3N54B 3DGMA 3DGOA 1DMNA 1MOLA 4LGQA 3CC23 2RGQA 3SXXA 1UW1A 2PNCA 4KZ1A 5IG3A 1TFKA 4OVMA 2P0MA 3FKAA 1Q814 1W2B2 3LT8A 2XSHB 6STDA 1O7NB 3CCS3 3K0ZA 3U1WA 3LYGA 1NB5I 3KSPA 1K8A4 4BTWA 1RN7A 1N8R4 2IMJA 1C7HA 2OCTA 1W6YA 3V92A 4IPBA 3HK4A 3LTDA 2JDIH 2XFSA 3JUQA 4RNZA 2I9WA 1VQ83 5IG4A 4N6MA 3LT9A 1JB2A 1O7WB 2W56B 4IIAA 3SOYA 1DMQA 2OOVA 5BXQA 5CF2A 2HMNB 1YJW3 3B7CA 3CCV3 1W6CA 3BNEA 3X3ZA 1VQ43 1QAFA 3N9HA 4FCZA 3CCU3 3MG1A 2P0XA 1VQN3 3AMOB 3T0UA 4H61A 2XEPA 3F40A 3V99A 2QEX3 1YJN3 4FMCA 5I97A 4HM7B 4K90B 4FMBA 2WGQA 1QAKA 1VQL3 1FGQA 1IQ8A 2CC3A 2YFJB 3I563 4MMXB 2UX0A 3PZWA 5JPUA 4H3UA 1WNHA 5FGOA 3Q1CA 3MWZA 4L8PA 3J7Yd 3BNBA 3G713 5LC7A 3LOYA 3CCQ3 1EKMA 1W5ZA 3S5CA 1OF5A 2OQEA 3WA2X 1VQ73 2W9QA 3MSOA 5AI1A 1OHSA 3HZPA 3GZXB 2ML5A 3JUPA 3JUMA 3CNXA 3O8YA 4GL6A 1YI23 1WMPA 2BHMA 3EE1A 1VQ63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL6 A;  1GD3 A;  3KSE D;  4IT7 A;  4N6V 0;  1A90 A;  4N6O B;  4CCV A;  3S67 A;  5ELU A;  1PFP A;  1N5H A;  3L0R A;  1G96 A;  1TIJ A;  2KXG A;  3PYJ A;  4LZI A;  5LC6 A;  1IV9 A;  1ROA A;  1GD4 A;  2BO9 B;  3UL5 A;  1DVC A;  1MOL A;  1M9G A;  1EQK A;  2W9P A;  1N5P A;  1STF I;  1FUW A;  3KFQ C;  3NX0 A;  1NB5 I;  1RN7 A;  1IV7 A;  2CH9 A;  3IMA B;  2OCT A;  5ELJ A;  5EQL A;  1CEW I;  1LXE A;  4N6M A;  4ZM8 A;  1FA3 A;  3SVA A;  3LH4 A;  1N9J A;  4N6T A;  1R4C A;  3PS8 A;  1KWI A;  3QRD A;  1NB3 I;  4TX4 A;  4N6N B;  3K9M C;  3PXM A;  4N6L A;  3Q2P A;  1MNL A;  1WNH A;  1CYU A;  3MWZ A;  1YVB I;  5LC7 A;  3GAX A;  1A67 A;  2O9U X;  2W9Q A;  1CYV A;  5A0O B;  4EYC A;  4N6U A;  1DVD A; 
#chains in the Genus database with same CATH topology
 1GD3 A;  1HZ1 A;  2CG0 A;  4EXR A;  2HML B;  4IT7 A;  5EEO A;  4HVN A;  1A90 A;  1T5Y A;  3Q90 A;  3CCJ 3;  4N6O B;  5GSP A;  3CCM 3;  2FXT A;  3MHE A;  1PFP A;  1BVI A;  1V58 A;  3CD6 3;  3FG1 A;  3L0R A;  1YIJ 3;  1NNV A;  1RGG A;  1SII A;  3FCS B;  3DMC A;  1I8V A;  1VQK 3;  1LOW A;  3ALA A;  5JPP A;  3CU3 A;  4I4K A;  1IDP A;  3URP A;  1QJG A;  1ULJ B;  4RBN A;  1BRK A;  4LZI A;  1DET A;  4EV2 A;  1RCL A;  1K73 4;  1ROA A;  1VQO 3;  1TRQ A;  1ZO2 A;  3D5G A;  1PY3 A;  2W03 A;  1W6G A;  3WA3 A;  1VQ9 3;  1YGW A;  1RN1 A;  4O2H A;  2BO9 B;  1L5G B;  5G1L A;  3UL5 A;  1MWU A;  2H0I A;  1BAN A;  1IU7 A;  2C10 A;  1DVC A;  2XH9 A;  2HMM B;  3BNC A;  3EF8 A;  3OWU A;  1M9G A;  3NBJ A;  1FGR A;  1FW7 A;  1BSB A;  1EQK A;  2CWT A;  5AIF A;  1JN5 B;  2GU3 A;  2ML6 A;  4HM6 B;  2XRX B;  2XR8 B;  1UCJ A;  3N8B A;  3NUV A;  3CME 3;  3VGN A;  1MWS A;  3X3X A;  1QMA A;  2RCD A;  3WR2 A;  2GSP A;  3FF2 A;  1SJW A;  2Q07 A;  2XGL A;  1TJD A;  3DGL A;  1N5P A;  1ZGX A;  1SIH A;  3A76 A;  3KN4 A;  4K1U A;  3SX1 A;  1M1K 4;  5CF1 A;  1FGO A;  1BUQ A;  1B27 A;  4HJL B;  1MWT A;  4L7K A;  1PU4 A;  1IV7 A;  4AKY A;  2CH9 A;  2AAE A;  2IYJ A;  5ELJ A;  4XM4 A;  4JF8 A;  1UUW B;  4J8T A;  3KZT A;  4KFD A;  2P38 A;  4R4K A;  4GB5 A;  1JB5 A;  3LTC A;  2R41 A;  5BIR A;  3DGN A;  1CEW I;  1I3F A;  1LXE A;  5AEU B;  1YIT 3;  4WWU C;  1I70 A;  1N8Q A;  1G0T A;  2F98 A;  3T8U A;  4N6T A;  4FCJ A;  4NPB A;  1R4Y A;  4O3V A;  1T2I A;  3WMD A;  3GZR A;  4CDL A;  3DGY A;  3U97 A;  3NQZ A;  3NHX A;  4AEQ A;  2QA4 3;  2HMK B;  9RNT A;  1BSE A;  1VQ5 3;  1D6Y A;  4BL2 A;  1OCV A;  3QRD A;  2W2C A;  1Z1S A;  1BUJ A;  4WFO A;  1JKG A;  1AQZ A;  1OPY A;  3F9S A;  4TX4 A;  1BSD A;  3VSY A;  3WOF B;  1B2U A;  2BMO B;  3G8Z A;  1M90 4;  3SYU A;  4N6N B;  1MWR A;  3LTB A;  4O02 B;  3KKG A;  2W04 A;  4N6L A;  1J2B A;  1WMO A;  3HOH A;  3HII A;  4K61 A;  1FZU A;  1O7G B;  3Q2P A;  3BB9 A;  2IA7 A;  4LMI A;  1HKX A;  1UUV B;  1K41 A;  3IPT A;  3V98 A;  4MMY B;  2FNQ A;  2H0G A;  1BRS A;  3UJM A;  1IVU A;  3GWR A;  1VQQ A;  1YVB I;  3WHO A;  2D42 A;  1A67 A;  4U13 A;  1TRP A;  6GSP A;  3ZFZ A;  1CYV A;  3F8H A;  1UUG B;  2KF5 A;  4HZB B;  1GOY A;  1GY7 A;  1BAO A;  1EA2 A;  2V1L A;  3EHC A;  1DVD A;  4EW5 A;  1AV4 A;  3G4S 3;  1O7M B;  3ER7 A;  1FGT A;  3FLJ A;  3NBB A;  1W02 A;  4LSO A;  5AEW B;  3ZG0 A;  5IEP A;  5RNT A;  3CXC 2;  3FGY A;  3CCR 3;  3LTA A;  1JJ2 2;  2ZA4 A;  5IEN A;  3EX9 A;  3F14 A;  3DXO A;  3KII A;  1RJO A;  1N5H A;  7STD A;  1Q40 A;  4Q53 A;  1B20 A;  1QVF 2;  2F86 B;  1LOY A;  2KXG A;  2OOV C;  1TFO A;  1MGW A;  4XBX A;  4I5Q A;  2F5W A;  3PYJ A;  3GZY B;  3FSD A;  3FG4 A;  1YHQ 3;  2GEY A;  1I2G A;  3K7C A;  4R80 A;  5D81 A;  5AYS C;  2BMR B;  1E3V A;  1KQS 2;  1Q7H A;  4WP5 A;  1TP6 A;  4FMD A;  2CFW A;  3UNL A;  5IEO A;  3MG3 A;  1LOX A;  1AVK A;  4ILF A;  4KT3 B;  3WDG B;  2XSO B;  2F56 A;  2D1W A;  1BOX A;  1OHO A;  1B2M A;  5DRV A;  5KP1 A;  1A2K A;  4XDW A;  3HI7 A;  5D83 A;  4XBY A;  1E3R A;  1W00 A;  2XGN A;  1GSP A;  1GS3 A;  1SQW A;  3LXU X;  1S72 3;  1FYS A;  3GZB A;  3EQQ B;  3NM2 A;  1WQL B;  3FH1 A;  2OTL 3;  3NV0 A;  1DMM A;  2CWU A;  2E2U A;  3JUN A;  3MKI A;  3CNM A;  4HZ9 B;  2IY2 A;  3DUK A;  1B2S A;  1RN4 A;  1X1W A;  2LQV A;  3MG2 A;  3EJV A;  5STD A;  3KFQ C;  2XF3 A;  1Q40 B;  1SAR A;  4RNY A;  1TU5 A;  3D4A A;  2W6J H;  3IMA B;  2K3D A;  2RBI A;  2Y74 A;  5D82 A;  1C54 A;  2KCD A;  4L8O A;  5EQL A;  1OF5 B;  1B3S A;  3S29 A;  2STD A;  1T3B A;  2ZL8 A;  2B24 B;  2QIY A;  3AHS A;  4ZM8 A;  1IK3 A;  1O7H B;  1FA3 A;  1YVS A;  1SPU A;  3EC9 A;  1N9J A;  3LH4 A;  4R9K A;  5IER A;  4X2H A;  1RDS A;  3FF0 A;  2C11 A;  4CPK A;  1R4C A;  1ZS7 A;  5IF6 A;  1BSA A;  1BRI A;  2E2T A;  1BNG A;  2F5M A;  1YNV X;  2CX1 A;  4WYK A;  2B1X B;  3FG3 A;  3BND A;  3OWY A;  2CHC A;  4NRE A;  1V74 A;  1FUS A;  1NB3 I;  1OHP A;  4EBG A;  1Q42 A;  3JUO A;  3RDE A;  3G6E 3;  1B2X A;  4CJN A;  1RKY A;  1LNI A;  3WOE B;  2WOH A;  3H51 A;  2AAD A;  3BLZ A;  1I0X A;  4O8S A;  3RGA A;  3PCS A;  1ULI B;  1A2P A;  3PXM A;  5AIH A;  2A15 A;  1OUN A;  1FGM A;  3K5T A;  3SED A;  2OWP A;  1VQP 3;  1K9M 4;  4DKI A;  1AVL A;  1IQX A;  1IT8 A;  4JRF A;  1MNL A;  3JVC A;  5IW9 A;  2Z7A A;  1RGA A;  1W7C A;  2GBW B;  2BT3 A;  1I2F A;  6RNT A;  4OK0 A;  1RRL A;  1Y4K A;  2CWV A;  2Z6B A;  3HIG A;  5TGN A;  3F8X A;  1Q7Y 4;  1RGK A;  2MC8 A;  2K54 A;  1UGI A;  3AGO A;  2MF7 A;  1GY5 A;  1LRA A;  3AGN A;  2CX0 A;  3F7X A;  5HOH A;  3EBY A;  4EYC A;  2W56 A;  2GU1 A;  1NO3 A;  3K63 A;  4N6U A;  4XBT A;  5G1K A;  3I55 3;  1B2Z A;  3QK9 A;  4MMZ B;  2OTJ 3;  1KD1 4;  1F8N A;  2BNG A;  3SLU A;  2BIR A;  2PZV A;  1YJ9 3;  1JRQ A;  1JNQ A;  2LYX A;  1Q82 4;  3EB8 A;  4N6V 0;  2INX A;  4HM2 B;  3D5I A;  1GMQ A;  2GXF A;  4CCV A;  3CCL 3;  4G1M B;  3AMO A;  1OH0 A;  3S67 A;  1JV2 B;  1AY7 A;  1ISK A;  1B21 A;  3M8C A;  1JZO A;  5CK6 A;  2GBX B;  4HOH A;  4STD A;  5G2G A;  2Z77 A;  1U8C B;  3DZL A;  4R1K A;  2CK3 H;  1VZZ A;  1W01 A;  2CW9 A;  4WHA A;  1JBS A;  3ROB A;  3CPW 2;  1W4N A;  1VQM 3;  1UDI I;  2IUJ A;  3RGR A;  1DYU A;  2XFT A;  2CFL A;  3A5E A;  3TDG A;  5LC6 A;  2K0M A;  1ZX2 A;  1BRN L;  1IV9 A;  1PYL A;  4PEJ A;  3D9R A;  1RGC A;  5AII A;  1GY6 A;  1FUT A;  1GD4 A;  1RHL A;  3PCR A;  4BL3 A;  1OGX A;  4XDV A;  5M18 A;  3UB1 A;  4RZM A;  1EG9 B;  4AKZ A;  1GOU A;  1JKG B;  3X42 A;  5AYR B;  3HX8 A;  1ASK A;  1GYB A;  2YFI B;  5FW5 A;  3E99 A;  3EN8 A;  4K1V A;  1U5O A;  1JB4 A;  4GHO A;  5KP3 A;  5IG0 A;  4N3V A;  1RSN A;  2ZDJ A;  3B4O A;  2W9P A;  3NBR A;  1IVV A;  5HGR A;  1YGE A;  3B4P A;  3Q3F A;  3CCE 3;  1Q86 4;  1STF I;  1AR0 A;  4MJD A;  5CLK A;  3VF1 A;  3OXA A;  1UI7 A;  3OWS A;  1FUW A;  1CQS A;  3G16 A;  4BTX A;  2GEX A;  2F99 A;  3MPH A;  3NX0 A;  2KRT A;  4HAA A;  1GMR A;  3D3L A;  1BNE A;  1I2E A;  1Q9E A;  1BNJ A;  2BU4 A;  1LOV A;  3G0K A;  2O3O A;  2QGU A;  1STD A;  1IT7 A;  3OV4 A;  5DRE A;  4GSP A;  3DM8 A;  4HM0 B;  4R9L A;  1D6U A;  3S28 A;  1G02 A;  5BU4 A;  2P09 A;  1MGR A;  1RNT A;  3F7S A;  4KVH A;  2YFL B;  2CG1 A;  1GMP A;  2RFR A;  3SVA A;  1KC8 4;  2L4V A;  5AIG A;  1T2H A;  1QVG 2;  1ROV A;  4J5G A;  4HKV B;  2ZHX B;  4KFE A;  3BU4 A;  3PS8 A;  4HM4 B;  1KWI A;  5JBS A;  5KP4 A;  1OGZ A;  3OW2 2;  2M7O A;  3CMA 3;  2HMJ B;  1HYF A;  2CFD A;  2E2V A;  1UCK A;  2WOF A;  3I0Y A;  4KFF A;  3X3Y A;  8RNT A;  1NWW A;  2WO0 A;  1K28 A;  1TUH A;  4LEH A;  3CC7 3;  1JN5 A;  3MYT A;  3NM7 A;  4XB5 A;  2OQE C;  3STD A;  3K9M C;  4ORL A;  2Y73 A;  4HM5 B;  4X2O A;  1RTU A;  2CKF B;  4HM3 B;  3AHW A;  2CIU A;  2CFG A;  1HU9 A;  1O7P B;  2HMO B;  2JQ5 A;  1LVN A;  3EBT A;  4MEI A;  1UGH I;  2RSX A;  2W0Q A;  1CYU A;  1E97 A;  4LYL B;  1DE3 A;  4RNT A;  4BTY A;  3ECF A;  1X1X A;  4HYZ A;  3S27 A;  1X1U A;  2FGT A;  3GAX A;  1RCK A;  1GOV A;  1N9E A;  2CFK A;  2F4Y A;  2KF4 A;  2O9U X;  4FCM A;  3RNT A;  4HM1 B;  8CHO A;  1UCL A;  1RRH A;  2Z76 A;  3GRD A;  3LZA A;  1D6Z A;  3X41 A;  1BRH A;  1W2Z A;  2SBL A;  4EC6 A;  5A0O B;  3SOA A;  1KSI A;  1BNR A;  5EVH A;  3NXJ A;  4FR9 A;  4OUQ A;  1RNB A;  3LML A;  3CC4 3;  4FMA A;  1WMN A;  3NV0 B;  1X1Y A;  2KAA A;  3UL6 A;  1QAL A;  3KSE D;  1NJI 4;  4EV5 A;  1M1X B;  2YX9 A;  3PGB A;  3WOD G;  4J9A A;  3ZG5 A;  2IUK A;  1OAC A;  3KE7 A;  1IVW A;  2WGO A;  1NDO B;  3NQY A;  1LNH A;  1IQY A;  1NU3 A;  2HOH A;  5ELU A;  5BVB A;  5M19 A;  1RGH A;  2UUG C;  1EUI C;  1A2V A;  3B8L A;  3EN1 B;  1IVX A;  2BMQ B;  1S5A A;  4BU4 A;  3T8N A;  1CH0 A;  3FZW A;  4NHF A;  1G96 A;  1TIJ A;  5IG5 A;  3X40 A;  4HM8 B;  5CXO A;  4HBR A;  3D79 A;  3CPO A;  1WTH A;  1BNI A;  2UGI A;  3OX9 A;  1UI8 A;  3H3H A;  4QWT A;  2KF3 A;  2R4I A;  1JZD A;  4WYK B;  2L1S A;  2P05 A;  3DY5 A;  1US1 A;  3IJE B;  3KCH A;  3N54 B;  3DGM A;  3DGO A;  1DMN A;  1MOL A;  4BIR A;  4LGQ A;  3CC2 3;  2RGQ A;  1JBR A;  2H0H A;  1UW1 A;  2J8X B;  2PNC A;  4KZ1 A;  3SXX A;  5IG3 A;  1TFK A;  1BRJ A;  7RNT A;  4OVM A;  1LQG C;  2P0M A;  3FKA A;  1Q81 4;  1W2B 2;  3LT8 A;  2XSH B;  6STD A;  1O7N B;  3CCS 3;  3K0Z A;  1LQM B;  3U1W A;  3LYG A;  1NB5 I;  1TTO A;  3KSP A;  4BTW A;  1RGE A;  1RN7 A;  1K8A 4;  1N8R 4;  2SAR A;  2IMJ A;  1C7H A;  2OCT A;  1UCI A;  1W6Y A;  3V92 A;  4IPB A;  3HK4 A;  1JBT A;  3LTD A;  2JDI H;  2XFS A;  3JUQ A;  4RNZ A;  1RGL A;  2I9W A;  1BNS A;  1V57 A;  5IG4 A;  1VQ8 3;  1BNF A;  4N6M A;  3LT9 A;  1JB2 A;  1O7W B;  1RGF A;  2W56 B;  4IIA A;  3SOY A;  1DMQ A;  2OOV A;  5BXQ A;  5CF2 A;  2HMN B;  1YJW 3;  3B7C A;  3CCV 3;  1W6C A;  3BNE A;  3X3Z A;  3DH2 A;  1VQ4 3;  1BGS A;  1RMS A;  1QAF A;  1I3I A;  3N9H A;  1BU4 A;  4FCZ A;  3MG1 A;  3CCU 3;  2P0X A;  1VQN 3;  3AMO B;  3BIR A;  3T0U A;  4H61 A;  2XEP A;  3F40 A;  3V99 A;  2QEX 3;  1YJN 3;  4FMC A;  2RNT A;  5I97 A;  4HM7 B;  4K90 B;  4FMB A;  2C4B A;  2WGQ A;  1QAK A;  1EEJ A;  1VQL 3;  3GSP A;  1FGQ A;  1IQ8 A;  2CC3 A;  2YFJ B;  3I56 3;  4MMX B;  2UX0 A;  3PZW A;  5JPU A;  4H3U A;  1RLS A;  1WNH A;  5FGO A;  3Q1C A;  3MWZ A;  4L8P A;  3J7Y d;  2KF6 A;  3BNB A;  3G71 3;  1I0V A;  5LC7 A;  1IYY A;  3LOY A;  3CCQ 3;  1EKM A;  1W5Z A;  1BIR A;  7GSP A;  1BRG A;  5M1A A;  3S5C A;  1OF5 A;  2OQE A;  3WA2 X;  1VQ7 3;  2W9Q A;  3MSO A;  5AI1 A;  1OHS A;  3HZP A;  3GZX B;  2ML5 A;  3JUP A;  3JUM A;  3CNX A;  3O8Y A;  4J5K A;  4GL6 A;  1YI2 3;  1WMP A;  2BHM A;  3EE1 A;  1BSC A;  1VQ6 3; 
#chains in the Genus database with same CATH homology
 1GD3 A;  2CG0 A;  4EXR A;  2HML B;  4IT7 A;  5EEO A;  4HVN A;  1A90 A;  1T5Y A;  3Q90 A;  3CCJ 3;  4N6O B;  3CCM 3;  2FXT A;  3MHE A;  1PFP A;  3CD6 3;  3FG1 A;  3L0R A;  1YIJ 3;  1SII A;  3FCS B;  3DMC A;  1VQK 3;  3ALA A;  5JPP A;  3CU3 A;  4I4K A;  1IDP A;  1QJG A;  1ULJ B;  4RBN A;  4LZI A;  4EV2 A;  1K73 4;  1ROA A;  1VQO 3;  1ZO2 A;  1VQ9 3;  2W03 A;  1W6G A;  3WA3 A;  4O2H A;  2BO9 B;  1L5G B;  3UL5 A;  2XH9 A;  1IU7 A;  2C10 A;  1DVC A;  3BNC A;  2HMM B;  3EF8 A;  3OWU A;  1M9G A;  3NBJ A;  1FGR A;  1EQK A;  2CWT A;  5AIF A;  1JN5 B;  2GU3 A;  2ML6 A;  4HM6 B;  2XRX B;  2XR8 B;  3NUV A;  3N8B A;  2OTJ 3;  3CME 3;  3VGN A;  3X3X A;  1QMA A;  2RCD A;  3FF2 A;  1SJW A;  2Q07 A;  2XGL A;  3DGL A;  1N5P A;  1SIH A;  3A76 A;  3KN4 A;  4K1U A;  3SX1 A;  1M1K 4;  5CF1 A;  1FGO A;  1BUQ A;  4HJL B;  1PU4 A;  4L7K A;  1IV7 A;  4AKY A;  2CH9 A;  5ELJ A;  4XM4 A;  4JF8 A;  1UUW B;  4J8T A;  3KZT A;  4KFD A;  2P38 A;  4R4K A;  4GB5 A;  1JB5 A;  3LTC A;  3DGN A;  1CEW I;  1LXE A;  5AEU B;  1YIT 3;  4WWU C;  1N8Q A;  2F98 A;  3T8U A;  4N6T A;  4FCJ A;  4O3V A;  3WMD A;  3GZR A;  4CDL A;  3U97 A;  3NQZ A;  3NHX A;  4AEQ A;  2QA4 3;  2HMK B;  1VQ5 3;  1D6Y A;  1OCV A;  3QRD A;  2W2C A;  1Z1S A;  4WFO A;  1JKG A;  1OPY A;  3F9S A;  4TX4 A;  3VSY A;  3WOF B;  2BMO B;  3G8Z A;  1M90 4;  4N6N B;  3LTB A;  4O02 B;  3KKG A;  2W04 A;  4N6L A;  1J2B A;  1WMO A;  3HII A;  4K61 A;  1O7G B;  3Q2P A;  3BB9 A;  2IA7 A;  4LMI A;  1HKX A;  1UUV B;  1K41 A;  3IPT A;  3V98 A;  4MMY B;  2FNQ A;  3UJM A;  1IVU A;  3GWR A;  1YVB I;  2D42 A;  1A67 A;  4U13 A;  1CYV A;  3F8H A;  4HZB B;  1GY7 A;  1EA2 A;  2V1L A;  3EHC A;  1DVD A;  1AV4 A;  3G4S 3;  1O7M B;  3ER7 A;  1FGT A;  3FLJ A;  3NBB A;  1W02 A;  4LSO A;  5AEW B;  5IEP A;  3CXC 2;  3FGY A;  3CCR 3;  3LTA A;  1JJ2 2;  5IEN A;  3EX9 A;  3F14 A;  3DXO A;  3KII A;  1RJO A;  1N5H A;  7STD A;  1Q40 A;  4Q53 A;  1QVF 2;  2F86 B;  2KXG A;  2OOV C;  1TFO A;  4XBX A;  3PYJ A;  3GZY B;  3FSD A;  3FG4 A;  1YHQ 3;  2GEY A;  3K7C A;  4R80 A;  5D81 A;  5AYS C;  2BMR B;  1E3V A;  1KQS 2;  4WP5 A;  1TP6 A;  4FMD A;  2CFW A;  3UNL A;  5IEO A;  3MG3 A;  1LOX A;  1AVK A;  3WDG B;  2XSO B;  2D1W A;  1OHO A;  5DRV A;  5KP1 A;  1A2K A;  4XDW A;  3HI7 A;  5D83 A;  4XBY A;  1E3R A;  1W00 A;  2XGN A;  1GS3 A;  1SQW A;  3LXU X;  1S72 3;  3GZB A;  3EQQ B;  3NM2 A;  1WQL B;  3FH1 A;  2OTL 3;  3NV0 A;  1DMM A;  2CWU A;  2E2U A;  3JUN A;  3MKI A;  3CNM A;  4HZ9 B;  3DUK A;  2LQV A;  3MG2 A;  3EJV A;  5STD A;  3KFQ C;  2XF3 A;  1Q40 B;  4RNY A;  1TU5 A;  2W6J H;  3IMA B;  2Y74 A;  5D82 A;  2KCD A;  4L8O A;  5EQL A;  1OF5 B;  3S29 A;  2STD A;  2ZL8 A;  2B24 B;  2QIY A;  4ZM8 A;  1IK3 A;  1O7H B;  1FA3 A;  1SPU A;  3EC9 A;  1N9J A;  3LH4 A;  4R9K A;  5IER A;  4X2H A;  3FF0 A;  5IF6 A;  2C11 A;  1R4C A;  2E2T A;  4WYK A;  2B1X B;  3FG3 A;  3BND A;  3OWY A;  2CHC A;  4NRE A;  1V74 A;  1OHP A;  1NB3 I;  4EBG A;  1Q42 A;  3JUO A;  3RDE A;  3G6E 3;  1RKY A;  3WOE B;  2WOH A;  3H51 A;  3BLZ A;  4O8S A;  3RGA A;  3PCS A;  1ULI B;  3PXM A;  5AIH A;  2A15 A;  1OUN A;  1FGM A;  3K5T A;  3SED A;  2OWP A;  1VQP 3;  1K9M 4;  1AVL A;  1IQX A;  1IT8 A;  4JRF A;  1MNL A;  3JVC A;  5IW9 A;  2Z7A A;  1W7C A;  2GBW B;  2BT3 A;  4OK0 A;  1RRL A;  1Y4K A;  2CWV A;  2Z6B A;  3HIG A;  5TGN A;  3F8X A;  1Q7Y 4;  2MC8 A;  2K54 A;  2MF7 A;  1GY5 A;  3F7X A;  3EBY A;  4EYC A;  2W56 A;  2GU1 A;  1NO3 A;  3K63 A;  4N6U A;  4XBT A;  3I55 3;  3QK9 A;  4MMZ B;  1KD1 4;  1F8N A;  2BNG A;  3SLU A;  2PZV A;  1YJ9 3;  1JRQ A;  1JNQ A;  2LYX A;  1Q82 4;  3EB8 A;  4N6V 0;  2INX A;  4HM2 B;  4CCV A;  2GXF A;  3CCL 3;  4G1M B;  3AMO A;  1OH0 A;  3S67 A;  1JV2 B;  1ISK A;  3M8C A;  5CK6 A;  2GBX B;  4STD A;  5G2G A;  2Z77 A;  1U8C B;  3DZL A;  4R1K A;  2CK3 H;  1VZZ A;  1W01 A;  2CW9 A;  4WHA A;  3ROB A;  3CPW 2;  1W4N A;  1VQM 3;  2IUJ A;  3RGR A;  1DYU A;  2XFT A;  2CFL A;  3TDG A;  5LC6 A;  2K0M A;  1ZX2 A;  1IV9 A;  4PEJ A;  3D9R A;  5AII A;  1GY6 A;  1GD4 A;  3PCR A;  1OGX A;  4XDV A;  3UB1 A;  4RZM A;  1EG9 B;  4AKZ A;  1JKG B;  3X42 A;  5AYR B;  3HX8 A;  1ASK A;  1GYB A;  2YFI B;  5FW5 A;  3E99 A;  3EN8 A;  4K1V A;  1U5O A;  1JB4 A;  5KP3 A;  5IG0 A;  4N3V A;  2ZDJ A;  3B4O A;  2W9P A;  3NBR A;  1IVV A;  5HGR A;  1YGE A;  3B4P A;  1Q86 4;  3CCE 3;  1STF I;  1AR0 A;  4MJD A;  5CLK A;  3VF1 A;  3OXA A;  1UI7 A;  3OWS A;  1FUW A;  1CQS A;  3G16 A;  4BTX A;  2GEX A;  2F99 A;  3MPH A;  3NX0 A;  2KRT A;  3D3L A;  3G0K A;  2O3O A;  2QGU A;  1STD A;  1IT7 A;  3OV4 A;  5DRE A;  3DM8 A;  4HM0 B;  4R9L A;  1D6U A;  3S28 A;  2P09 A;  3F7S A;  4KVH A;  2YFL B;  2CG1 A;  3SVA A;  2RFR A;  1KC8 4;  2L4V A;  5AIG A;  1QVG 2;  1ROV A;  4HKV B;  4KFE A;  3PS8 A;  4HM4 B;  1KWI A;  5JBS A;  5KP4 A;  1OGZ A;  3OW2 2;  2M7O A;  3CMA 3;  2HMJ B;  2CFD A;  2E2V A;  2WOF A;  3I0Y A;  4KFF A;  3X3Y A;  1NWW A;  2WO0 A;  1K28 A;  1TUH A;  4LEH A;  3CC7 3;  1JN5 A;  3MYT A;  3NM7 A;  4XB5 A;  2OQE C;  3STD A;  3K9M C;  4ORL A;  2Y73 A;  4HM5 B;  4X2O A;  4HM3 B;  2CKF B;  2CIU A;  2CFG A;  1HU9 A;  1O7P B;  2HMO B;  2JQ5 A;  1LVN A;  3EBT A;  4MEI A;  2RSX A;  2W0Q A;  1CYU A;  1E97 A;  4BTY A;  3ECF A;  4HYZ A;  3S27 A;  2FGT A;  3GAX A;  1N9E A;  2CFK A;  2O9U X;  4FCM A;  4HM1 B;  8CHO A;  1RRH A;  2Z76 A;  3GRD A;  3LZA A;  1D6Z A;  3X41 A;  2SBL A;  1W2Z A;  4EC6 A;  5A0O B;  3SOA A;  1KSI A;  5EVH A;  3NXJ A;  4FR9 A;  4OUQ A;  3CC4 3;  3LML A;  4FMA A;  1WMN A;  3NV0 B;  3UL6 A;  1QAL A;  3KSE D;  1NJI 4;  4EV5 A;  1M1X B;  2YX9 A;  3PGB A;  3WOD G;  4J9A A;  2IUK A;  1OAC A;  3KE7 A;  1IVW A;  2WGO A;  1NDO B;  3NQY A;  1LNH A;  1IQY A;  1NU3 A;  5ELU A;  5BVB A;  3EN1 B;  1A2V A;  3B8L A;  1IVX A;  2BMQ B;  1S5A A;  3T8N A;  3FZW A;  4NHF A;  1G96 A;  1TIJ A;  5IG5 A;  3X40 A;  4HM8 B;  5CXO A;  4HBR A;  3CPO A;  1WTH A;  3OX9 A;  1UI8 A;  3H3H A;  4QWT A;  2R4I A;  4WYK B;  2P05 A;  3DY5 A;  1US1 A;  3IJE B;  3N54 B;  3DGM A;  3DGO A;  1DMN A;  1MOL A;  4LGQ A;  3CC2 3;  2RGQ A;  3SXX A;  1UW1 A;  2PNC A;  4KZ1 A;  5IG3 A;  1TFK A;  4OVM A;  2P0M A;  3FKA A;  1Q81 4;  1W2B 2;  3LT8 A;  2XSH B;  6STD A;  1O7N B;  3CCS 3;  3K0Z A;  3U1W A;  3LYG A;  1NB5 I;  3KSP A;  1K8A 4;  4BTW A;  1RN7 A;  1N8R 4;  2IMJ A;  1C7H A;  2OCT A;  1W6Y A;  3V92 A;  4IPB A;  3HK4 A;  3LTD A;  2JDI H;  2XFS A;  3JUQ A;  4RNZ A;  2I9W A;  1VQ8 3;  5IG4 A;  4N6M A;  3LT9 A;  1JB2 A;  1O7W B;  2W56 B;  4IIA A;  3SOY A;  1DMQ A;  2OOV A;  5BXQ A;  5CF2 A;  2HMN B;  1YJW 3;  3B7C A;  3CCV 3;  1W6C A;  3BNE A;  3X3Z A;  1VQ4 3;  1QAF A;  3N9H A;  4FCZ A;  3CCU 3;  3MG1 A;  2P0X A;  1VQN 3;  3AMO B;  3T0U A;  4H61 A;  2XEP A;  3F40 A;  3V99 A;  2QEX 3;  1YJN 3;  4FMC A;  5I97 A;  4HM7 B;  4K90 B;  4FMB A;  2WGQ A;  1QAK A;  1VQL 3;  1FGQ A;  1IQ8 A;  2CC3 A;  2YFJ B;  3I56 3;  4MMX B;  2UX0 A;  3PZW A;  5JPU A;  4H3U A;  1WNH A;  5FGO A;  3Q1C A;  3MWZ A;  4L8P A;  3J7Y d;  3BNB A;  3G71 3;  5LC7 A;  3LOY A;  3CCQ 3;  1EKM A;  1W5Z A;  3S5C A;  1OF5 A;  2OQE A;  3WA2 X;  1VQ7 3;  2W9Q A;  3MSO A;  5AI1 A;  1OHS A;  3HZP A;  3GZX B;  2ML5 A;  3JUP A;  3JUM A;  3CNX A;  3O8Y A;  4GL6 A;  1YI2 3;  1WMP A;  2BHM A;  3EE1 A;  1VQ6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...