3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
4ZM8A 1CEWI 1M9GA 1CYVA 1CYUA 4CCVA 4LZIA 1A90A 3PS8A 3UL6A 5LC6A 1NB5I 3L0RA 4N6NB 5ELUA 1IV7A 3K9MC 3QRDA 3KSED 3PYJA 4N6OB 1PFPA 2W9PA 4EYCA 1R4CA 1N5PA 1GD4A 1WNHA 2O9UX 1TIJA 3MWZA 4TX4A 2CH9A 3NX0A 4N6LA 4IT7A 1KWIA 1MNLA 4N6V0 5A0OB 2W9QA 1LXEA 4N6MA 3Q2PA 5LC7A 1N9JA 1STFI 4N6TA 1N5HA 1FUWA 2BO9B 3PXMA 3S67A 1A67A 1FA3A 1NB3I 1G96A 4N6UA 1DVCA 2OCTA 1MOLA 1GD3A 1YVBI 2KXGA 1ROAA 1RN7A 3KFQC 5ELJA 5EQLA 3UL5A 3GAXA 3IMAB 1EQKA 3SVAA 1IV9A 3LH4A 1DVDA
chains in the Genus database with same CATH superfamily
3JUPA 3SYUA 1DETA 1IQXA 1CYUA 2A15A 2UGIA 3NQZA 4RNTA 3FZWA 4AEQA 1RGKA 3PCSA 2ML6A 3G16A 1TFOA 4R4KA 1VQM3 1OF5A 5ELUA 1ASKA 1UCIA 4WYKA 4K61A 5IG5A 4BTXA 3GZYB 3Q1CA 1C7HA 2CK3H 5M1AA 1BRGA 1GD4A 2P05A 3MKIA 3ZG5A 1WTHA 3IPTA 1ZS7A 4HZ9B 1LOWA 1VQN3 2W9QA 2R4IA 1VQQA 1Q7Y4 4CPKA 3URPA 1EUIC 4L8PA 3WA2X 1ISKA 2QA43 3STDA 1BSDA 1MOLA 1RN4A 2WGQA 1GOUA 1RN7A 2CW9A 3K63A 1ZO2A 2XR8B 5ELJA 1K9M4 3OWUA 3QK9A 3AMOB 1K734 3BNEA 4HYZA 4AKZA 5DRVA 1IK3A 1MWTA 3EBYA 1MWRA 7RNTA 3KKGA 3VF1A 3CME3 3CC73 3MSOA 2KAAA 2KF5A 3X40A 3CC23 3G6E3 4WWUC 1W5ZA 1FGOA 1B2UA 1MWSA 5IG0A 5JPUA 1BRNL 4NREA 4N6V0 1STDA 2L1SA 2H0GA 2KF6A 3Q2PA 1I2EA 2C11A 1STFI 5JPPA 3I0YA 4HZBB 1JB2A 1OHOA 1RTUA 1GYBA 2PNCA 3MG3A 2QEX3 5CXOA 3CCJ3 2CFKA 1FGTA 3WR2A 1FA3A 4BL3A 2GEYA 4O2HA 3ER7A 3UL5A 4NPBA 1YNVX 1WMOA 4U13A 3H51A 1DYUA 1W4NA 2XSOB 1BSEA 2OQEC 2XEPA 1BU4A 3NHXA 2UUGC 1UCLA 3G713 1NWWA 3WMDA 3KCHA 2IUKA 2WGOA 2IUJA 1RRLA 4BTWA 1W2ZA 2RCDA 1UDII 3T0UA 1HKXA 3FH1A 4KFEA 1EEJA 3DY5A 3BNDA 2RNTA 1LXEA 3DMCA 3FG3A 1G02A 4HM0B 1SQWA 1FZUA 3ZG0A 1KD14 3X42A 5RNTA 2BIRA 2QIYA 1BANA 1VQ63 5IF6A 3D3LA 1RKYA 1FGMA 1MGRA 4QWTA 4HM3B 1Q814 1SIIA 2XSHB 4GL6A 2BT3A 3RDEA 2Z7AA 4HJLB 1HU9A 4ZM8A 1M904 3MG2A 1BNEA 1CQSA 5IW9A 3O8YA 3HIIA 3CCL3 4R1KA 4MMZB 1B2ZA 3GRDA 2XGLA 2HMKB 4PEJA 4I5QA 2Y73A 3FCSB 1SIHA 3J7Yd 1SJWA 2GSPA 3AGNA 1YIT3 1RGHA 2CH9A 4OVMA 4K1UA 1Z1SA 4R80A 1UUGB 3JUOA 2K54A 3LTDA 2XH9A 4JF8A 4FCMA 3SOYA 3CCU3 3CCE3 1RDSA 3DXOA 1BGSA 1QVF2 2CKFB 4N6UA 4DKIA 1DVCA 4KZ1A 3LTAA 1RJOA 1IT7A 3T8UA 3DGOA 3EN1B 1D6YA 1W6GA 4K1VA 5AIFA 1LQGC 3MG1A 4HKVB 3BIRA 1RHLA 4XBXA 3EBTA 1SARA 1PU4A 1DE3A 1GY7A 3FGYA 2FGTA 5G1KA 3DGNA 2YFJB 3EB8A 3NBJA 2K0MA 1BSAA 5D81A 1T2IA 2CX0A 2OOVA 1GOVA 4HBRA 3DH2A 4HAAA 1JRQA 4EYCA 4KFFA 1ULIB 1AY7A 3NX0A 4IT7A 1BOXA 1MNLA 2AAEA 1RCLA 3CCM3 4N6MA 3U97A 2SBLA 1GOYA 2CIUA 3Q3FA 1MWUA 3VSYA 1YJN3 4FMAA 1A67A 4O02B 1RSNA 2HMOB 5IG4A 3EHCA 1ROAA 1AVLA 2P09A 1QAFA 3LTBA 3ALAA 1AVKA 3IMAB 4J9AA 3VGNA 1Q864 2MF7A 3MYTA 1YI23 3NQYA 1OHSA 2P0MA 1GMQA 1OCVA 1RGEA 1WMNA 3AHSA 1CEWI 3KIIA 2OWPA 4LZIA 1IQYA 2HOHA 3B4OA 3KE7A 3L0RA 5BU4A 1W02A 2BMRB 3CNMA 4O8SA 3CCQ3 3KSED 3SOAA 1Q40B 2BMOB 2W9PA 2GU1A 1N5PA 3F9SA 4BIRA 1W2B2 1TIJA 1TRQA 1R4YA 1V74A 1C54A 3UJMA 3ZFZA 3F8HA 1I0XA 1LOVA 1VQ83 1OH0A 2F56A 1VQ53 4HM1B 1G96A 1YVBI 1I3FA 4G1MB 4WP5A 2CWUA 1QMAA 2JDIH 1JBRA 1WMPA 2OQEA 1SPUA 2ML5A 1IVWA 1OF5B 2CFLA 1FUSA 1US1A 2WOFA 3WOFB 1RGCA 4H61A 1W01A 2D42A 2WO0A 3FKAA 3IJEB 2OTL3 5CLKA 1UUWB 4JRFA 2SARA 2AADA 2CC3A 3OWYA 3JUNA 1IV7A 1I8VA 1FGRA 3PYJA 1PFPA 4HM8B 3UNLA 1RNTA 1O7WB 2KCDA 1A2PA 4BL2A 1X1YA 2W6JH 4N6LA 5BXQA 3F40A 3NBRA 3WA3A 3FG1A 1N8R4 1T3BA 2W56A 4N6TA 5GSPA 3U1WA 5CF1A 1RNBA 1WQLB 3S5CA 2ZL8A 3F14A 3HIGA 3UB1A 3KSPA 3KFQC 5CK6A 3V98A 2I9WA 3CCR3 1FW7A 6GSPA 1RGFA 4IIAA 1BRJA 4WYKB 1BNIA 2LYXA 4EBGA 1BSBA 1RLSA 3F7SA 3GWRA 3MPHA 3LZAA 2F86B 2RGQA 3PS8A 3B4PA 3NUVA 1Q824 3K9MC 5AIHA 1YIJ3 1W6CA 2V1LA 1JN5A 1WNHA 1G0TA 3FF0A 4LEHA 2YFIB 3HX8A 1BRHA 2PZVA 2F5MA 3X3XA 3CNXA 4HVNA 3N9HA 1I2FA 1JKGB 5IENA 3HOHA 5LC7A 1YJ93 2E2UA 1PY3A 2GXFA 2F99A 1T5YA 4K90B 1IVVA 2CX1A 1X1UA 1VQ43 2XF3A 4AKYA 1ULJB 1DMNA 2RSXA 3JVCA 1LOXA 3PZWA 5BIRA 3PGBA 1TU5A 3RNTA 1AQZA 1FYSA 2GEXA 3CCS3 3EQQB 2D1WA 1OUNA 2OOVC 4BU4A 3D9RA 1B2XA 1UI8A 5IG3A 5D82A 3A5EA 1NB5I 1V58A 1NNVA 5EEOA 2BHMA 4HM5B 3T8NA 4HM6B 3Q90A 2E2TA 4XDVA 1KSIA 3B7CA 3OV4A 1Q7HA 1NO3A 1O7MB 3FG4A 5A0OB 1BSCA 2YX9A 2W0QA 3RGAA 5BVBA 1KC84 3LYGA 1JZDA 1B20A 5AI1A 1EG9B 1FUWA 1VQL3 4WHAA 1NB3I 4FMDA 2XFTA 5EQLA 3X3ZA 1UI7A 3CU3A 4EXRA 2W04A 3LT8A 3JUMA 4KVHA 1VQK3 3G0KA 1BIRA 1O7PB 2O3OA 1E3VA 3GZXB 1HYFA 3NV0A 1LRAA 4HOHA 2IMJA 4IPBA 1BNGA 2MC8A 1BNRA 1S5AA 4GHOA 3QRDA 1IQ8A 1B27A 1BNFA 1MGWA 4L7KA 2YFLB 2K3DA 3EE1A 5KP3A 3DGYA 2GU3A 1TFKA 2E2VA 1RGGA 2J8XB 1E3RA 4LSOA 4J5KA 1YGEA 4H3UA 1YVSA 3GSPA 1B21A 1N5HA 3K7CA 2UX0A 1U5OA 3BNCA 3FLJA 4MMYB 1X1WA 3K0ZA 2M7OA 3BU4A 1QAKA 2KXGA 4LGQA 3D4AA 3A76A 1KQS2 3CPW2 4STDA 1BNSA 2Z76A 1T2HA 3PXMA 1YJW3 1BRKA 1VQP3 1UCJA 4FMCA 1RN1A 3AMOA 1UUVB 1GS3A 1B2MA 4MMXB 2GBXB 2CFGA 2R41A 3S27A 1IVUA 1DMMA 2B24B 3S29A 1LNIA 2Y74A 1YGWA 1Y4KA 1FUTA 1QJGA 3K5TA 1RCKA 5IEOA 8RNTA 2BO9B 2KRTA 3B8LA 3CCV3 1JBSA 3D5IA 1L5GB 1JB4A 2OCTA 4WFOA 1EA2A 2RBIA 2W56B 3GAXA 6RNTA 8CHOA 2INXA 1IYYA 4XB5A 5AEWB 2HMNB 3EJVA 5DREA 1J2BA 4CCVA 3MHEA 5AEUB 2LQVA 3OWSA 5CF2A 3NM2A 2KF4A 2WOHA 3EN8A 1IU7A 1RGAA 3SEDA 2Z6BA 1RMSA 3DGMA 4TX4A 4OUQA 1JZOA 1OHPA 1I70A 2CG1A 1VZZA 3M8CA 3OW22 5M18A 4FMBA 5FGOA 3AHWA 3NBBA 1JN5B 3LMLA 4CJNA 1NDOB 4ORLA 1B3SA 4XM4A 4FCJA 2H0IA 1VQ93 5AYSC 1W00A 6STDA 1VQO3 4XBYA 3TDGA 4EW5A 1ZX2A 3KN4A 4O3VA 1A2KA 1D6UA 1IV9A 1NU3A 4FCZA 1EQKA 2CWVA 3NM7A 1CYVA 1JNQA 2HMMB 1TJDA 1TTOA 3BB9A 1VQ73 4FR9A 4N3VA 4I4KA 1CH0A 2F98A 3G8ZA 3WDGB 5M19A 1F8NA 1LQMB 4N6OB 4X2HA 3MWZA 1UGHI 5KP1A 3BLZA 1UW1A 1V57A 2BNGA 3WODG 1KWIA 3N54B 1I3IA 3H3HA 1W7CA 3EF8A 4KFDA 3SXXA 1BVIA 1Q42A 4RBNA 3CXC2 1N9JA 3HZPA 5D83A 4CDLA 3AGOA 3WOEB 1I0VA 4EV2A 9RNTA 3LT9A 2IA7A 2P0XA 2BU4A 1JV2B 1UGIA 3ECFA 1IDPA 4EV5A 4MJDA 3WHOA 4RZMA 3DUKA 3EX9A 4HM4B 4HM7B 1DVDA 1M9GA 2XFSA 3HK4A 1IT8A 1RGLA 1B2SA 4MEIA 1Q40A 1BAOA 2HMLB 1X1XA 4N6NB 1TUHA 2FNQA 1OGXA 3G4S3 1ROVA 2C4BA 5AIGA 3NV0B 3V99A 4BTYA 1O7HB 4EC6A 7GSPA 3KZTA 1TRPA 2JQ5A 3OXAA 3DZLA 4HM2B 4GB5A 4ILFA 4R9KA 2B1XB 3SX1A 1LOYA 1D6ZA 4J5GA 4X2OA 5EVHA 1O7GB 3S28A 3DM8A 1JBTA 2CWTA 3ROBA 2XGNA 1NJI4 3OX9A 2F5WA 1BUQA 1GSPA 1Q9EA 1GD3A 3X3YA 1M1K4 2CG0A 1GMRA 2STDA 4KT3B 3CMA3 1K28A 3FSDA 3RGRA 4R9LA 1LVNA 2QGUA 1BRSA 3LH4A 2H0HA 3X41A 1GY6A 2KF3A 3LTCA 3V92A 1RRHA 4GSPA 3CPOA 2OTJ3 1A90A 2ZA4A 1JJ22 3E99A 3UL6A 3LXUX 3FF2A 2CFDA 3LOYA 4Q53A 3F8XA 2CFWA 1JB5A 1IVXA 1OACA 1R4CA 2O9UX 3BNBA 2CHCA 2Q07A 5JBSA 4LMIA 1QALA 2F4YA 2W2CA 5TGNA 5AYRB 3N8BA 1K41A 3JUQA 3GZRA 1OPYA 3S67A 1BRIA 1HZ1A 3CC43 3I563 1S723 1YHQ3 3F7XA 5G2GA 4RNZA 2P38A 2W03A 3D5GA 3SLUA 2XRXB 3GZBA 1BNJA 4OK0A 2L4VA 3NXJA 3CD63 1PYLA 5AIIA 1UCKA 1GY5A 2FXTA 2GBWB 1N8QA 1BUJA 1AV4A 1EKMA 1DMQA 3PCRA 2BMQB 1E97A 4LYLB 4NHFA 4XDWA 7STDA 3I553 1I2GA 5IEPA 5STDA 3HI7A 5HGRA 5I97A 5KP4A 1FGQA 1LNHA 1A2VA 2IYJA 2ZDJA 4J8TA 1O7NB 4L8OA 1GMPA 5FW5A 5IERA 5G1LA 2ZHXB 2IY2A 3D79A 5HOHA 1K8A4 1AR0A 2Z77A 3DGLA 2RFRA 1JKGA 4XBTA 5LC6A 1OGZA 1QVG2 2HMJB 1U8CB 2C10A 3EC9A 4RNYA 1TP6A 1M1XB 3SVAA 1ZGXA 1W6YA 1N9EA
chains in the Genus database with same CATH topology
3JUPA 1CYUA 1IQXA 2A15A 3NQZA 4AEQA 3FZWA 3PCSA 2ML6A 3G16A 1TFOA 4R4KA 1VQM3 1OF5A 5ELUA 1ASKA 4WYKA 4K61A 5IG5A 4BTXA 3GZYB 3Q1CA 1C7HA 2CK3H 1GD4A 2P05A 3MKIA 1WTHA 3IPTA 4HZ9B 1VQN3 2W9QA 2R4IA 1Q7Y4 3WA2X 4L8PA 1ISKA 2QA43 3STDA 1MOLA 2WGQA 1RN7A 3K63A 2CW9A 5ELJA 1ZO2A 2XR8B 1K9M4 3OWUA 3QK9A 3AMOB 1K734 3BNEA 4HYZA 4AKZA 5DRVA 1IK3A 3EBYA 3KKGA 3VF1A 3CME3 3CC73 3MSOA 3X40A 3CC23 3G6E3 4WWUC 1W5ZA 1FGOA 5IG0A 5JPUA 4NREA 4N6V0 1STDA 3Q2PA 2C11A 1STFI 5JPPA 3I0YA 4HZBB 1JB2A 1OHOA 2PNCA 1GYBA 2QEX3 3MG3A 1FA3A 5CXOA 3CCJ3 2CFKA 1FGTA 2GEYA 4O2HA 3ER7A 3UL5A 1WMOA 4U13A 3H51A 1DYUA 1W4NA 2XSOB 2OQEC 2XEPA 3NHXA 3G713 1NWWA 3WMDA 2IUKA 2WGOA 2IUJA 1RRLA 4BTWA 1W2ZA 2RCDA 3T0UA 1HKXA 3FH1A 4KFEA 3DY5A 3BNDA 3DMCA 1LXEA 3FG3A 4HM0B 1SQWA 1KD14 3X42A 2QIYA 1VQ63 5IF6A 3D3LA 1RKYA 1FGMA 4QWTA 1Q814 4HM3B 1SIIA 2XSHB 4GL6A 2BT3A 3RDEA 2Z7AA 4HJLB 1HU9A 4ZM8A 1M904 3MG2A 1CQSA 5IW9A 3O8YA 3HIIA 3CCL3 4R1KA 4MMZB 3GRDA 2XGLA 2HMKB 4PEJA 3J7Yd 2Y73A 3FCSB 1SIHA 1SJWA 1YIT3 2CH9A 4OVMA 4K1UA 1Z1SA 4R80A 3JUOA 2K54A 3LTDA 2XH9A 4JF8A 4FCMA 3SOYA 3CCU3 3CCE3 3DXOA 1QVF2 2CKFB 4N6UA 1DVCA 4KZ1A 3LTAA 1RJOA 1IT7A 3T8UA 3EN1B 3DGOA 1D6YA 1W6GA 4K1VA 5AIFA 3MG1A 4HKVB 4XBXA 3EBTA 1PU4A 1GY7A 3FGYA 2FGTA 3DGNA 2YFJB 3EB8A 3NBJA 2K0MA 5D81A 2OOVA 4HBRA 1JRQA 4EYCA 4KFFA 1ULIB 3NX0A 4IT7A 1MNLA 3CCM3 4N6MA 3U97A 2SBLA 2CIUA 3VSYA 1YJN3 4FMAA 1A67A 4O02B 2HMOB 5IG4A 3EHCA 1ROAA 1AVLA 2P09A 1QAFA 3LTBA 3ALAA 1AVKA 3IMAB 4J9AA 3VGNA 1Q864 2MF7A 3MYTA 1YI23 3NQYA 1OHSA 2P0MA 1OCVA 1WMNA 1CEWI 3KIIA 2OWPA 4LZIA 1IQYA 3B4OA 3KE7A 3L0RA 3CNMA 1W02A 2BMRB 4O8SA 3CCQ3 3KSED 3SOAA 1Q40B 2BMOB 2W9PA 2GU1A 1N5PA 3F9SA 1W2B2 1TIJA 1V74A 3UJMA 3F8HA 1VQ83 1OH0A 1VQ53 4HM1B 1G96A 1YVBI 4G1MB 4WP5A 2CWUA 1QMAA 2JDIH 1WMPA 2OQEA 1SPUA 2ML5A 1IVWA 1OF5B 2CFLA 1US1A 2WOFA 3WOFB 4H61A 1W01A 2D42A 2WO0A 3FKAA 3IJEB 2OTL3 5CLKA 1UUWB 4JRFA 2CC3A 3OWYA 3JUNA 1IV7A 1FGRA 3PYJA 1PFPA 4HM8B 3UNLA 1O7WB 2KCDA 2W6JH 4N6LA 5BXQA 3F40A 3NBRA 3WA3A 3FG1A 1N8R4 2W56A 3U1WA 4N6TA 5CF1A 1WQLB 3S5CA 2ZL8A 3F14A 3HIGA 3UB1A 3KSPA 3KFQC 5CK6A 3V98A 2I9WA 3CCR3 4IIAA 4WYKB 2LYXA 4EBGA 3F7SA 3GWRA 3MPHA 3LZAA 2F86B 2RGQA 3PS8A 3B4PA 3NUVA 1Q824 3K9MC 5AIHA 1YIJ3 1W6CA 2V1LA 1JN5A 1WNHA 3FF0A 4LEHA 2YFIB 3HX8A 2PZVA 3X3XA 3CNXA 4HVNA 3N9HA 5IENA 1JKGB 5LC7A 1YJ93 2E2UA 2GXFA 2F99A 1T5YA 4K90B 1IVVA 1VQ43 2XF3A 4AKYA 1ULJB 1DMNA 2RSXA 3JVCA 1LOXA 3PZWA 1TU5A 3PGBA 2GEXA 3CCS3 3EQQB 2D1WA 1OUNA 2OOVC 3D9RA 5IG3A 1UI8A 5D82A 1NB5I 5EEOA 2BHMA 4HM5B 4HM6B 3Q90A 2E2TA 4XDVA 1KSIA 3B7CA 3OV4A 1NO3A 1O7MB 3FG4A 5A0OB 2YX9A 2W0QA 3RGAA 5BVBA 1KC84 3LYGA 5AI1A 1EG9B 1FUWA 1VQL3 4WHAA 1NB3I 4FMDA 2XFTA 5EQLA 3X3ZA 1UI7A 3CU3A 4EXRA 2W04A 3LT8A 3JUMA 4KVHA 1VQK3 3G0KA 1O7PB 2O3OA 1E3VA 3GZXB 3NV0A 2IMJA 4IPBA 2MC8A 1S5AA 3QRDA 1IQ8A 4L7KA 2YFLB 3EE1A 5KP3A 2GU3A 1TFKA 2E2VA 1E3RA 4LSOA 1YGEA 4H3UA 1N5HA 3K7CA 2UX0A 1U5OA 3BNCA 3FLJA 4MMYB 3K0ZA 2M7OA 1QAKA 2KXGA 4LGQA 1KQS2 3A76A 3CPW2 4STDA 2Z76A 3PXMA 1YJW3 1VQP3 4FMCA 3AMOA 1UUVB 1GS3A 4MMXB 2GBXB 2CFGA 3S27A 1IVUA 1DMMA 2B24B 3S29A 2Y74A 1Y4KA 1QJGA 5IEOA 3K5TA 2BO9B 2KRTA 3B8LA 3CCV3 1L5GB 1JB4A 2OCTA 4WFOA 1EA2A 2W56B 3GAXA 8CHOA 2INXA 4XB5A 5AEWB 2HMNB 3EJVA 5DREA 1J2BA 4CCVA 3MHEA 5AEUB 2LQVA 3OWSA 5CF2A 3NM2A 2WOHA 3EN8A 1IU7A 3SEDA 2Z6BA 3T8NA 3DGMA 4TX4A 4OUQA 1OHPA 2CG1A 1VZZA 3M8CA 3OW22 4FMBA 5FGOA 3NBBA 1JN5B 3LMLA 1NDOB 4ORLA 4XM4A 4FCJA 1VQ93 5AYSC 1W00A 6STDA 1VQO3 4XBYA 3TDGA 1ZX2A 3KN4A 4O3VA 1A2KA 1D6UA 1IV9A 1NU3A 4FCZA 1EQKA 2CWVA 3NM7A 1CYVA 1JNQA 2HMMB 1VQ73 3BB9A 4FR9A 4N3VA 4I4KA 2F98A 3G8ZA 3WDGB 1F8NA 4N6OB 4X2HA 3MWZA 5KP1A 3BLZA 1UW1A 2BNGA 3WODG 1KWIA 3N54B 3H3HA 1W7CA 3EF8A 4KFDA 3SXXA 1Q42A 4RBNA 3CXC2 1N9JA 3HZPA 5D83A 4CDLA 3WOEB 4EV2A 3LT9A 2IA7A 2P0XA 1JV2B 3ECFA 1IDPA 4EV5A 4MJDA 4RZMA 3DUKA 3EX9A 4HM4B 4HM7B 1DVDA 1M9GA 2XFSA 3HK4A 1IT8A 4MEIA 1Q40A 2HMLB 4N6NB 1TUHA 2FNQA 1OGXA 3G4S3 1ROVA 5AIGA 3NV0B 3V99A 4BTYA 1O7HB 4EC6A 3KZTA 2JQ5A 4R9KA 3OXAA 3DZLA 4HM2B 4GB5A 2B1XB 3SX1A 1D6ZA 4X2OA 5EVHA 1O7GB 3S28A 3DM8A 2CWTA 3ROBA 2XGNA 1NJI4 3OX9A 1BUQA 1M1K4 3X3YA 1GD3A 2CG0A 2STDA 3CMA3 1K28A 3FSDA 3RGRA 4R9LA 1LVNA 2QGUA 3LH4A 3X41A 1GY6A 3LTCA 3V92A 1RRHA 2OTJ3 3CPOA 1A90A 1JJ22 3E99A 3UL6A 3LXUX 3FF2A 2CFDA 3LOYA 4Q53A 3F8XA 2CFWA 1JB5A 1IVXA 1OACA 3BNBA 1R4CA 2O9UX 2CHCA 2Q07A 5JBSA 4LMIA 1QALA 2W2CA 5TGNA 5AYRB 3N8BA 1K41A 3JUQA 3GZRA 1OPYA 3S67A 3CC43 3I563 1S723 1YHQ3 3F7XA 5G2GA 4RNZA 2P38A 2W03A 3SLUA 2XRXB 3GZBA 4OK0A 2L4VA 3NXJA 3CD63 5AIIA 1GY5A 2FXTA 2GBWB 1N8QA 1AV4A 1EKMA 1DMQA 3PCRA 2BMQB 1E97A 4NHFA 4XDWA 7STDA 3I553 5IEPA 5STDA 3HI7A 5HGRA 5I97A 5KP4A 1FGQA 1LNHA 1A2VA 2ZDJA 4L8OA 4J8TA 1O7NB 5FW5A 5IERA 1K8A4 1AR0A 2Z77A 3DGLA 2RFRA 1JKGA 4XBTA 5LC6A 1OGZA 1QVG2 2HMJB 1U8CB 2C10A 3EC9A 4RNYA 1TP6A 1M1XB 3SVAA 1W6YA 1N9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZM8 A;  1CEW I;  1M9G A;  1CYV A;  1CYU A;  4CCV A;  4LZI A;  1A90 A;  3PS8 A;  3UL6 A;  5LC6 A;  1NB5 I;  3L0R A;  4N6N B;  5ELU A;  1IV7 A;  3K9M C;  3QRD A;  3KSE D;  3PYJ A;  4N6O B;  1PFP A;  2W9P A;  4EYC A;  1R4C A;  1N5P A;  1GD4 A;  1WNH A;  2O9U X;  1TIJ A;  3MWZ A;  4TX4 A;  2CH9 A;  3NX0 A;  4N6L A;  4IT7 A;  1KWI A;  1MNL A;  4N6V 0;  5A0O B;  2W9Q A;  1LXE A;  4N6M A;  3Q2P A;  5LC7 A;  1N9J A;  1STF I;  4N6T A;  1N5H A;  1FUW A;  2BO9 B;  3PXM A;  3S67 A;  1A67 A;  1FA3 A;  1NB3 I;  1G96 A;  4N6U A;  1DVC A;  2OCT A;  1MOL A;  1GD3 A;  1YVB I;  2KXG A;  1ROA A;  1RN7 A;  3KFQ C;  5ELJ A;  5EQL A;  3UL5 A;  3GAX A;  3IMA B;  1EQK A;  3SVA A;  1IV9 A;  3LH4 A;  1DVD A; 
#chains in the Genus database with same CATH topology
 3JUP A;  3SYU A;  1DET A;  1IQX A;  1CYU A;  2A15 A;  2UGI A;  3NQZ A;  4RNT A;  3FZW A;  4AEQ A;  1RGK A;  3PCS A;  2ML6 A;  3G16 A;  1TFO A;  4R4K A;  1VQM 3;  1OF5 A;  5ELU A;  1ASK A;  1UCI A;  4WYK A;  4K61 A;  5IG5 A;  4BTX A;  3GZY B;  3Q1C A;  1C7H A;  2CK3 H;  5M1A A;  1BRG A;  1GD4 A;  2P05 A;  3MKI A;  3ZG5 A;  1WTH A;  3IPT A;  1ZS7 A;  4HZ9 B;  1LOW A;  1VQN 3;  2W9Q A;  2R4I A;  1VQQ A;  1Q7Y 4;  4CPK A;  3URP A;  1EUI C;  4L8P A;  3WA2 X;  1ISK A;  2QA4 3;  3STD A;  1BSD A;  1MOL A;  1RN4 A;  2WGQ A;  1GOU A;  1RN7 A;  2CW9 A;  3K63 A;  1ZO2 A;  2XR8 B;  5ELJ A;  1K9M 4;  3OWU A;  3QK9 A;  3AMO B;  1K73 4;  3BNE A;  4HYZ A;  4AKZ A;  5DRV A;  1IK3 A;  1MWT A;  3EBY A;  1MWR A;  7RNT A;  3KKG A;  3VF1 A;  3CME 3;  3CC7 3;  3MSO A;  2KAA A;  2KF5 A;  3X40 A;  3CC2 3;  3G6E 3;  4WWU C;  1W5Z A;  1FGO A;  1B2U A;  1MWS A;  5IG0 A;  5JPU A;  1BRN L;  4NRE A;  4N6V 0;  1STD A;  2L1S A;  2H0G A;  2KF6 A;  3Q2P A;  1I2E A;  2C11 A;  1STF I;  5JPP A;  3I0Y A;  4HZB B;  1JB2 A;  1OHO A;  1RTU A;  1GYB A;  2PNC A;  3MG3 A;  2QEX 3;  5CXO A;  3CCJ 3;  2CFK A;  1FGT A;  3WR2 A;  1FA3 A;  4BL3 A;  2GEY A;  4O2H A;  3ER7 A;  3UL5 A;  4NPB A;  1YNV X;  1WMO A;  4U13 A;  3H51 A;  1DYU A;  1W4N A;  2XSO B;  1BSE A;  2OQE C;  2XEP A;  1BU4 A;  3NHX A;  2UUG C;  1UCL A;  3G71 3;  1NWW A;  3WMD A;  3KCH A;  2IUK A;  2WGO A;  2IUJ A;  1RRL A;  4BTW A;  1W2Z A;  2RCD A;  1UDI I;  3T0U A;  1HKX A;  3FH1 A;  4KFE A;  1EEJ A;  3DY5 A;  3BND A;  2RNT A;  1LXE A;  3DMC A;  3FG3 A;  1G02 A;  4HM0 B;  1SQW A;  1FZU A;  3ZG0 A;  1KD1 4;  3X42 A;  5RNT A;  2BIR A;  2QIY A;  1BAN A;  1VQ6 3;  5IF6 A;  3D3L A;  1RKY A;  1FGM A;  1MGR A;  4QWT A;  4HM3 B;  1Q81 4;  1SII A;  2XSH B;  4GL6 A;  2BT3 A;  3RDE A;  2Z7A A;  4HJL B;  1HU9 A;  4ZM8 A;  1M90 4;  3MG2 A;  1BNE A;  1CQS A;  5IW9 A;  3O8Y A;  3HII A;  3CCL 3;  4R1K A;  4MMZ B;  1B2Z A;  3GRD A;  2XGL A;  2HMK B;  4PEJ A;  4I5Q A;  2Y73 A;  3FCS B;  1SIH A;  3J7Y d;  1SJW A;  2GSP A;  3AGN A;  1YIT 3;  1RGH A;  2CH9 A;  4OVM A;  4K1U A;  1Z1S A;  4R80 A;  1UUG B;  3JUO A;  2K54 A;  3LTD A;  2XH9 A;  4JF8 A;  4FCM A;  3SOY A;  3CCU 3;  3CCE 3;  1RDS A;  3DXO A;  1BGS A;  1QVF 2;  2CKF B;  4N6U A;  4DKI A;  1DVC A;  4KZ1 A;  3LTA A;  1RJO A;  1IT7 A;  3T8U A;  3DGO A;  3EN1 B;  1D6Y A;  1W6G A;  4K1V A;  5AIF A;  1LQG C;  3MG1 A;  4HKV B;  3BIR A;  1RHL A;  4XBX A;  3EBT A;  1SAR A;  1PU4 A;  1DE3 A;  1GY7 A;  3FGY A;  2FGT A;  5G1K A;  3DGN A;  2YFJ B;  3EB8 A;  3NBJ A;  2K0M A;  1BSA A;  5D81 A;  1T2I A;  2CX0 A;  2OOV A;  1GOV A;  4HBR A;  3DH2 A;  4HAA A;  1JRQ A;  4EYC A;  4KFF A;  1ULI B;  1AY7 A;  3NX0 A;  4IT7 A;  1BOX A;  1MNL A;  2AAE A;  1RCL A;  3CCM 3;  4N6M A;  3U97 A;  2SBL A;  1GOY A;  2CIU A;  3Q3F A;  1MWU A;  3VSY A;  1YJN 3;  4FMA A;  1A67 A;  4O02 B;  1RSN A;  2HMO B;  5IG4 A;  3EHC A;  1ROA A;  1AVL A;  2P09 A;  1QAF A;  3LTB A;  3ALA A;  1AVK A;  3IMA B;  4J9A A;  3VGN A;  1Q86 4;  2MF7 A;  3MYT A;  1YI2 3;  3NQY A;  1OHS A;  2P0M A;  1GMQ A;  1OCV A;  1RGE A;  1WMN A;  3AHS A;  1CEW I;  3KII A;  2OWP A;  4LZI A;  1IQY A;  2HOH A;  3B4O A;  3KE7 A;  3L0R A;  5BU4 A;  1W02 A;  2BMR B;  3CNM A;  4O8S A;  3CCQ 3;  3KSE D;  3SOA A;  1Q40 B;  2BMO B;  2W9P A;  2GU1 A;  1N5P A;  3F9S A;  4BIR A;  1W2B 2;  1TIJ A;  1TRQ A;  1R4Y A;  1V74 A;  1C54 A;  3UJM A;  3ZFZ A;  3F8H A;  1I0X A;  1LOV A;  1VQ8 3;  1OH0 A;  2F56 A;  1VQ5 3;  4HM1 B;  1G96 A;  1YVB I;  1I3F A;  4G1M B;  4WP5 A;  2CWU A;  1QMA A;  2JDI H;  1JBR A;  1WMP A;  2OQE A;  1SPU A;  2ML5 A;  1IVW A;  1OF5 B;  2CFL A;  1FUS A;  1US1 A;  2WOF A;  3WOF B;  1RGC A;  4H61 A;  1W01 A;  2D42 A;  2WO0 A;  3FKA A;  3IJE B;  2OTL 3;  5CLK A;  1UUW B;  4JRF A;  2SAR A;  2AAD A;  2CC3 A;  3OWY A;  3JUN A;  1IV7 A;  1I8V A;  1FGR A;  3PYJ A;  1PFP A;  4HM8 B;  3UNL A;  1RNT A;  1O7W B;  2KCD A;  1A2P A;  4BL2 A;  1X1Y A;  2W6J H;  4N6L A;  5BXQ A;  3F40 A;  3NBR A;  3WA3 A;  3FG1 A;  1N8R 4;  1T3B A;  2W56 A;  4N6T A;  5GSP A;  3U1W A;  5CF1 A;  1RNB A;  1WQL B;  3S5C A;  2ZL8 A;  3F14 A;  3HIG A;  3UB1 A;  3KSP A;  3KFQ C;  5CK6 A;  3V98 A;  2I9W A;  3CCR 3;  1FW7 A;  6GSP A;  1RGF A;  4IIA A;  1BRJ A;  4WYK B;  1BNI A;  2LYX A;  4EBG A;  1BSB A;  1RLS A;  3F7S A;  3GWR A;  3MPH A;  3LZA A;  2F86 B;  2RGQ A;  3PS8 A;  3B4P A;  3NUV A;  1Q82 4;  3K9M C;  5AIH A;  1YIJ 3;  1W6C A;  2V1L A;  1JN5 A;  1WNH A;  1G0T A;  3FF0 A;  4LEH A;  2YFI B;  3HX8 A;  1BRH A;  2PZV A;  2F5M A;  3X3X A;  3CNX A;  4HVN A;  3N9H A;  1I2F A;  1JKG B;  5IEN A;  3HOH A;  5LC7 A;  1YJ9 3;  2E2U A;  1PY3 A;  2GXF A;  2F99 A;  1T5Y A;  4K90 B;  1IVV A;  2CX1 A;  1X1U A;  1VQ4 3;  2XF3 A;  4AKY A;  1ULJ B;  1DMN A;  2RSX A;  3JVC A;  1LOX A;  3PZW A;  5BIR A;  3PGB A;  1TU5 A;  3RNT A;  1AQZ A;  1FYS A;  2GEX A;  3CCS 3;  3EQQ B;  2D1W A;  1OUN A;  2OOV C;  4BU4 A;  3D9R A;  1B2X A;  1UI8 A;  5IG3 A;  5D82 A;  3A5E A;  1NB5 I;  1V58 A;  1NNV A;  5EEO A;  2BHM A;  4HM5 B;  3T8N A;  4HM6 B;  3Q90 A;  2E2T A;  4XDV A;  1KSI A;  3B7C A;  3OV4 A;  1Q7H A;  1NO3 A;  1O7M B;  3FG4 A;  5A0O B;  1BSC A;  2YX9 A;  2W0Q A;  3RGA A;  5BVB A;  1KC8 4;  3LYG A;  1JZD A;  1B20 A;  5AI1 A;  1EG9 B;  1FUW A;  1VQL 3;  4WHA A;  1NB3 I;  4FMD A;  2XFT A;  5EQL A;  3X3Z A;  1UI7 A;  3CU3 A;  4EXR A;  2W04 A;  3LT8 A;  3JUM A;  4KVH A;  1VQK 3;  3G0K A;  1BIR A;  1O7P B;  2O3O A;  1E3V A;  3GZX B;  1HYF A;  3NV0 A;  1LRA A;  4HOH A;  2IMJ A;  4IPB A;  1BNG A;  2MC8 A;  1BNR A;  1S5A A;  4GHO A;  3QRD A;  1IQ8 A;  1B27 A;  1BNF A;  1MGW A;  4L7K A;  2YFL B;  2K3D A;  3EE1 A;  5KP3 A;  3DGY A;  2GU3 A;  1TFK A;  2E2V A;  1RGG A;  2J8X B;  1E3R A;  4LSO A;  4J5K A;  1YGE A;  4H3U A;  1YVS A;  3GSP A;  1B21 A;  1N5H A;  3K7C A;  2UX0 A;  1U5O A;  3BNC A;  3FLJ A;  4MMY B;  1X1W A;  3K0Z A;  2M7O A;  3BU4 A;  1QAK A;  2KXG A;  4LGQ A;  3D4A A;  3A76 A;  1KQS 2;  3CPW 2;  4STD A;  1BNS A;  2Z76 A;  1T2H A;  3PXM A;  1YJW 3;  1BRK A;  1VQP 3;  1UCJ A;  4FMC A;  1RN1 A;  3AMO A;  1UUV B;  1GS3 A;  1B2M A;  4MMX B;  2GBX B;  2CFG A;  2R41 A;  3S27 A;  1IVU A;  1DMM A;  2B24 B;  3S29 A;  1LNI A;  2Y74 A;  1YGW A;  1Y4K A;  1FUT A;  1QJG A;  3K5T A;  1RCK A;  5IEO A;  8RNT A;  2BO9 B;  2KRT A;  3B8L A;  3CCV 3;  1JBS A;  3D5I A;  1L5G B;  1JB4 A;  2OCT A;  4WFO A;  1EA2 A;  2RBI A;  2W56 B;  3GAX A;  6RNT A;  8CHO A;  2INX A;  1IYY A;  4XB5 A;  5AEW B;  2HMN B;  3EJV A;  5DRE A;  1J2B A;  4CCV A;  3MHE A;  5AEU B;  2LQV A;  3OWS A;  5CF2 A;  3NM2 A;  2KF4 A;  2WOH A;  3EN8 A;  1IU7 A;  1RGA A;  3SED A;  2Z6B A;  1RMS A;  3DGM A;  4TX4 A;  4OUQ A;  1JZO A;  1OHP A;  1I70 A;  2CG1 A;  1VZZ A;  3M8C A;  3OW2 2;  5M18 A;  4FMB A;  5FGO A;  3AHW A;  3NBB A;  1JN5 B;  3LML A;  4CJN A;  1NDO B;  4ORL A;  1B3S A;  4XM4 A;  4FCJ A;  2H0I A;  1VQ9 3;  5AYS C;  1W00 A;  6STD A;  1VQO 3;  4XBY A;  3TDG A;  4EW5 A;  1ZX2 A;  3KN4 A;  4O3V A;  1A2K A;  1D6U A;  1IV9 A;  1NU3 A;  4FCZ A;  1EQK A;  2CWV A;  3NM7 A;  1CYV A;  1JNQ A;  2HMM B;  1TJD A;  1TTO A;  3BB9 A;  1VQ7 3;  4FR9 A;  4N3V A;  4I4K A;  1CH0 A;  2F98 A;  3G8Z A;  3WDG B;  5M19 A;  1F8N A;  1LQM B;  4N6O B;  4X2H A;  3MWZ A;  1UGH I;  5KP1 A;  3BLZ A;  1UW1 A;  1V57 A;  2BNG A;  3WOD G;  1KWI A;  3N54 B;  1I3I A;  3H3H A;  1W7C A;  3EF8 A;  4KFD A;  3SXX A;  1BVI A;  1Q42 A;  4RBN A;  3CXC 2;  1N9J A;  3HZP A;  5D83 A;  4CDL A;  3AGO A;  3WOE B;  1I0V A;  4EV2 A;  9RNT A;  3LT9 A;  2IA7 A;  2P0X A;  2BU4 A;  1JV2 B;  1UGI A;  3ECF A;  1IDP A;  4EV5 A;  4MJD A;  3WHO A;  4RZM A;  3DUK A;  3EX9 A;  4HM4 B;  4HM7 B;  1DVD A;  1M9G A;  2XFS A;  3HK4 A;  1IT8 A;  1RGL A;  1B2S A;  4MEI A;  1Q40 A;  1BAO A;  2HML B;  1X1X A;  4N6N B;  1TUH A;  2FNQ A;  1OGX A;  3G4S 3;  1ROV A;  2C4B A;  5AIG A;  3NV0 B;  3V99 A;  4BTY A;  1O7H B;  4EC6 A;  7GSP A;  3KZT A;  1TRP A;  2JQ5 A;  3OXA A;  3DZL A;  4HM2 B;  4GB5 A;  4ILF A;  4R9K A;  2B1X B;  3SX1 A;  1LOY A;  1D6Z A;  4J5G A;  4X2O A;  5EVH A;  1O7G B;  3S28 A;  3DM8 A;  1JBT A;  2CWT A;  3ROB A;  2XGN A;  1NJI 4;  3OX9 A;  2F5W A;  1BUQ A;  1GSP A;  1Q9E A;  1GD3 A;  3X3Y A;  1M1K 4;  2CG0 A;  1GMR A;  2STD A;  4KT3 B;  3CMA 3;  1K28 A;  3FSD A;  3RGR A;  4R9L A;  1LVN A;  2QGU A;  1BRS A;  3LH4 A;  2H0H A;  3X41 A;  1GY6 A;  2KF3 A;  3LTC A;  3V92 A;  1RRH A;  4GSP A;  3CPO A;  2OTJ 3;  1A90 A;  2ZA4 A;  1JJ2 2;  3E99 A;  3UL6 A;  3LXU X;  3FF2 A;  2CFD A;  3LOY A;  4Q53 A;  3F8X A;  2CFW A;  1JB5 A;  1IVX A;  1OAC A;  1R4C A;  2O9U X;  3BNB A;  2CHC A;  2Q07 A;  5JBS A;  4LMI A;  1QAL A;  2F4Y A;  2W2C A;  5TGN A;  5AYR B;  3N8B A;  1K41 A;  3JUQ A;  3GZR A;  1OPY A;  3S67 A;  1BRI A;  1HZ1 A;  3CC4 3;  3I56 3;  1S72 3;  1YHQ 3;  3F7X A;  5G2G A;  4RNZ A;  2P38 A;  2W03 A;  3D5G A;  3SLU A;  2XRX B;  3GZB A;  1BNJ A;  4OK0 A;  2L4V A;  3NXJ A;  3CD6 3;  1PYL A;  5AII A;  1UCK A;  1GY5 A;  2FXT A;  2GBW B;  1N8Q A;  1BUJ A;  1AV4 A;  1EKM A;  1DMQ A;  3PCR A;  2BMQ B;  1E97 A;  4LYL B;  4NHF A;  4XDW A;  7STD A;  3I55 3;  1I2G A;  5IEP A;  5STD A;  3HI7 A;  5HGR A;  5I97 A;  5KP4 A;  1FGQ A;  1LNH A;  1A2V A;  2IYJ A;  2ZDJ A;  4J8T A;  1O7N B;  4L8O A;  1GMP A;  5FW5 A;  5IER A;  5G1L A;  2ZHX B;  2IY2 A;  3D79 A;  5HOH A;  1K8A 4;  1AR0 A;  2Z77 A;  3DGL A;  2RFR A;  1JKG A;  4XBT A;  5LC6 A;  1OGZ A;  1QVG 2;  2HMJ B;  1U8C B;  2C10 A;  3EC9 A;  4RNY A;  1TP6 A;  1M1X B;  3SVA A;  1ZGX A;  1W6Y A;  1N9E A; 
#chains in the Genus database with same CATH homology
 3JUP A;  1CYU A;  1IQX A;  2A15 A;  3NQZ A;  4AEQ A;  3FZW A;  3PCS A;  2ML6 A;  3G16 A;  1TFO A;  4R4K A;  1VQM 3;  1OF5 A;  5ELU A;  1ASK A;  4WYK A;  4K61 A;  5IG5 A;  4BTX A;  3GZY B;  3Q1C A;  1C7H A;  2CK3 H;  1GD4 A;  2P05 A;  3MKI A;  1WTH A;  3IPT A;  4HZ9 B;  1VQN 3;  2W9Q A;  2R4I A;  1Q7Y 4;  3WA2 X;  4L8P A;  1ISK A;  2QA4 3;  3STD A;  1MOL A;  2WGQ A;  1RN7 A;  3K63 A;  2CW9 A;  5ELJ A;  1ZO2 A;  2XR8 B;  1K9M 4;  3OWU A;  3QK9 A;  3AMO B;  1K73 4;  3BNE A;  4HYZ A;  4AKZ A;  5DRV A;  1IK3 A;  3EBY A;  3KKG A;  3VF1 A;  3CME 3;  3CC7 3;  3MSO A;  3X40 A;  3CC2 3;  3G6E 3;  4WWU C;  1W5Z A;  1FGO A;  5IG0 A;  5JPU A;  4NRE A;  4N6V 0;  1STD A;  3Q2P A;  2C11 A;  1STF I;  5JPP A;  3I0Y A;  4HZB B;  1JB2 A;  1OHO A;  2PNC A;  1GYB A;  2QEX 3;  3MG3 A;  1FA3 A;  5CXO A;  3CCJ 3;  2CFK A;  1FGT A;  2GEY A;  4O2H A;  3ER7 A;  3UL5 A;  1WMO A;  4U13 A;  3H51 A;  1DYU A;  1W4N A;  2XSO B;  2OQE C;  2XEP A;  3NHX A;  3G71 3;  1NWW A;  3WMD A;  2IUK A;  2WGO A;  2IUJ A;  1RRL A;  4BTW A;  1W2Z A;  2RCD A;  3T0U A;  1HKX A;  3FH1 A;  4KFE A;  3DY5 A;  3BND A;  3DMC A;  1LXE A;  3FG3 A;  4HM0 B;  1SQW A;  1KD1 4;  3X42 A;  2QIY A;  1VQ6 3;  5IF6 A;  3D3L A;  1RKY A;  1FGM A;  4QWT A;  1Q81 4;  4HM3 B;  1SII A;  2XSH B;  4GL6 A;  2BT3 A;  3RDE A;  2Z7A A;  4HJL B;  1HU9 A;  4ZM8 A;  1M90 4;  3MG2 A;  1CQS A;  5IW9 A;  3O8Y A;  3HII A;  3CCL 3;  4R1K A;  4MMZ B;  3GRD A;  2XGL A;  2HMK B;  4PEJ A;  3J7Y d;  2Y73 A;  3FCS B;  1SIH A;  1SJW A;  1YIT 3;  2CH9 A;  4OVM A;  4K1U A;  1Z1S A;  4R80 A;  3JUO A;  2K54 A;  3LTD A;  2XH9 A;  4JF8 A;  4FCM A;  3SOY A;  3CCU 3;  3CCE 3;  3DXO A;  1QVF 2;  2CKF B;  4N6U A;  1DVC A;  4KZ1 A;  3LTA A;  1RJO A;  1IT7 A;  3T8U A;  3EN1 B;  3DGO A;  1D6Y A;  1W6G A;  4K1V A;  5AIF A;  3MG1 A;  4HKV B;  4XBX A;  3EBT A;  1PU4 A;  1GY7 A;  3FGY A;  2FGT A;  3DGN A;  2YFJ B;  3EB8 A;  3NBJ A;  2K0M A;  5D81 A;  2OOV A;  4HBR A;  1JRQ A;  4EYC A;  4KFF A;  1ULI B;  3NX0 A;  4IT7 A;  1MNL A;  3CCM 3;  4N6M A;  3U97 A;  2SBL A;  2CIU A;  3VSY A;  1YJN 3;  4FMA A;  1A67 A;  4O02 B;  2HMO B;  5IG4 A;  3EHC A;  1ROA A;  1AVL A;  2P09 A;  1QAF A;  3LTB A;  3ALA A;  1AVK A;  3IMA B;  4J9A A;  3VGN A;  1Q86 4;  2MF7 A;  3MYT A;  1YI2 3;  3NQY A;  1OHS A;  2P0M A;  1OCV A;  1WMN A;  1CEW I;  3KII A;  2OWP A;  4LZI A;  1IQY A;  3B4O A;  3KE7 A;  3L0R A;  3CNM A;  1W02 A;  2BMR B;  4O8S A;  3CCQ 3;  3KSE D;  3SOA A;  1Q40 B;  2BMO B;  2W9P A;  2GU1 A;  1N5P A;  3F9S A;  1W2B 2;  1TIJ A;  1V74 A;  3UJM A;  3F8H A;  1VQ8 3;  1OH0 A;  1VQ5 3;  4HM1 B;  1G96 A;  1YVB I;  4G1M B;  4WP5 A;  2CWU A;  1QMA A;  2JDI H;  1WMP A;  2OQE A;  1SPU A;  2ML5 A;  1IVW A;  1OF5 B;  2CFL A;  1US1 A;  2WOF A;  3WOF B;  4H61 A;  1W01 A;  2D42 A;  2WO0 A;  3FKA A;  3IJE B;  2OTL 3;  5CLK A;  1UUW B;  4JRF A;  2CC3 A;  3OWY A;  3JUN A;  1IV7 A;  1FGR A;  3PYJ A;  1PFP A;  4HM8 B;  3UNL A;  1O7W B;  2KCD A;  2W6J H;  4N6L A;  5BXQ A;  3F40 A;  3NBR A;  3WA3 A;  3FG1 A;  1N8R 4;  2W56 A;  3U1W A;  4N6T A;  5CF1 A;  1WQL B;  3S5C A;  2ZL8 A;  3F14 A;  3HIG A;  3UB1 A;  3KSP A;  3KFQ C;  5CK6 A;  3V98 A;  2I9W A;  3CCR 3;  4IIA A;  4WYK B;  2LYX A;  4EBG A;  3F7S A;  3GWR A;  3MPH A;  3LZA A;  2F86 B;  2RGQ A;  3PS8 A;  3B4P A;  3NUV A;  1Q82 4;  3K9M C;  5AIH A;  1YIJ 3;  1W6C A;  2V1L A;  1JN5 A;  1WNH A;  3FF0 A;  4LEH A;  2YFI B;  3HX8 A;  2PZV A;  3X3X A;  3CNX A;  4HVN A;  3N9H A;  5IEN A;  1JKG B;  5LC7 A;  1YJ9 3;  2E2U A;  2GXF A;  2F99 A;  1T5Y A;  4K90 B;  1IVV A;  1VQ4 3;  2XF3 A;  4AKY A;  1ULJ B;  1DMN A;  2RSX A;  3JVC A;  1LOX A;  3PZW A;  1TU5 A;  3PGB A;  2GEX A;  3CCS 3;  3EQQ B;  2D1W A;  1OUN A;  2OOV C;  3D9R A;  5IG3 A;  1UI8 A;  5D82 A;  1NB5 I;  5EEO A;  2BHM A;  4HM5 B;  4HM6 B;  3Q90 A;  2E2T A;  4XDV A;  1KSI A;  3B7C A;  3OV4 A;  1NO3 A;  1O7M B;  3FG4 A;  5A0O B;  2YX9 A;  2W0Q A;  3RGA A;  5BVB A;  1KC8 4;  3LYG A;  5AI1 A;  1EG9 B;  1FUW A;  1VQL 3;  4WHA A;  1NB3 I;  4FMD A;  2XFT A;  5EQL A;  3X3Z A;  1UI7 A;  3CU3 A;  4EXR A;  2W04 A;  3LT8 A;  3JUM A;  4KVH A;  1VQK 3;  3G0K A;  1O7P B;  2O3O A;  1E3V A;  3GZX B;  3NV0 A;  2IMJ A;  4IPB A;  2MC8 A;  1S5A A;  3QRD A;  1IQ8 A;  4L7K A;  2YFL B;  3EE1 A;  5KP3 A;  2GU3 A;  1TFK A;  2E2V A;  1E3R A;  4LSO A;  1YGE A;  4H3U A;  1N5H A;  3K7C A;  2UX0 A;  1U5O A;  3BNC A;  3FLJ A;  4MMY B;  3K0Z A;  2M7O A;  1QAK A;  2KXG A;  4LGQ A;  1KQS 2;  3A76 A;  3CPW 2;  4STD A;  2Z76 A;  3PXM A;  1YJW 3;  1VQP 3;  4FMC A;  3AMO A;  1UUV B;  1GS3 A;  4MMX B;  2GBX B;  2CFG A;  3S27 A;  1IVU A;  1DMM A;  2B24 B;  3S29 A;  2Y74 A;  1Y4K A;  1QJG A;  5IEO A;  3K5T A;  2BO9 B;  2KRT A;  3B8L A;  3CCV 3;  1L5G B;  1JB4 A;  2OCT A;  4WFO A;  1EA2 A;  2W56 B;  3GAX A;  8CHO A;  2INX A;  4XB5 A;  5AEW B;  2HMN B;  3EJV A;  5DRE A;  1J2B A;  4CCV A;  3MHE A;  5AEU B;  2LQV A;  3OWS A;  5CF2 A;  3NM2 A;  2WOH A;  3EN8 A;  1IU7 A;  3SED A;  2Z6B A;  3T8N A;  3DGM A;  4TX4 A;  4OUQ A;  1OHP A;  2CG1 A;  1VZZ A;  3M8C A;  3OW2 2;  4FMB A;  5FGO A;  3NBB A;  1JN5 B;  3LML A;  1NDO B;  4ORL A;  4XM4 A;  4FCJ A;  1VQ9 3;  5AYS C;  1W00 A;  6STD A;  1VQO 3;  4XBY A;  3TDG A;  1ZX2 A;  3KN4 A;  4O3V A;  1A2K A;  1D6U A;  1IV9 A;  1NU3 A;  4FCZ A;  1EQK A;  2CWV A;  3NM7 A;  1CYV A;  1JNQ A;  2HMM B;  1VQ7 3;  3BB9 A;  4FR9 A;  4N3V A;  4I4K A;  2F98 A;  3G8Z A;  3WDG B;  1F8N A;  4N6O B;  4X2H A;  3MWZ A;  5KP1 A;  3BLZ A;  1UW1 A;  2BNG A;  3WOD G;  1KWI A;  3N54 B;  3H3H A;  1W7C A;  3EF8 A;  4KFD A;  3SXX A;  1Q42 A;  4RBN A;  3CXC 2;  1N9J A;  3HZP A;  5D83 A;  4CDL A;  3WOE B;  4EV2 A;  3LT9 A;  2IA7 A;  2P0X A;  1JV2 B;  3ECF A;  1IDP A;  4EV5 A;  4MJD A;  4RZM A;  3DUK A;  3EX9 A;  4HM4 B;  4HM7 B;  1DVD A;  1M9G A;  2XFS A;  3HK4 A;  1IT8 A;  4MEI A;  1Q40 A;  2HML B;  4N6N B;  1TUH A;  2FNQ A;  1OGX A;  3G4S 3;  1ROV A;  5AIG A;  3NV0 B;  3V99 A;  4BTY A;  1O7H B;  4EC6 A;  3KZT A;  2JQ5 A;  4R9K A;  3OXA A;  3DZL A;  4HM2 B;  4GB5 A;  2B1X B;  3SX1 A;  1D6Z A;  4X2O A;  5EVH A;  1O7G B;  3S28 A;  3DM8 A;  2CWT A;  3ROB A;  2XGN A;  1NJI 4;  3OX9 A;  1BUQ A;  1M1K 4;  3X3Y A;  1GD3 A;  2CG0 A;  2STD A;  3CMA 3;  1K28 A;  3FSD A;  3RGR A;  4R9L A;  1LVN A;  2QGU A;  3LH4 A;  3X41 A;  1GY6 A;  3LTC A;  3V92 A;  1RRH A;  2OTJ 3;  3CPO A;  1A90 A;  1JJ2 2;  3E99 A;  3UL6 A;  3LXU X;  3FF2 A;  2CFD A;  3LOY A;  4Q53 A;  3F8X A;  2CFW A;  1JB5 A;  1IVX A;  1OAC A;  3BNB A;  1R4C A;  2O9U X;  2CHC A;  2Q07 A;  5JBS A;  4LMI A;  1QAL A;  2W2C A;  5TGN A;  5AYR B;  3N8B A;  1K41 A;  3JUQ A;  3GZR A;  1OPY A;  3S67 A;  3CC4 3;  3I56 3;  1S72 3;  1YHQ 3;  3F7X A;  5G2G A;  4RNZ A;  2P38 A;  2W03 A;  3SLU A;  2XRX B;  3GZB A;  4OK0 A;  2L4V A;  3NXJ A;  3CD6 3;  5AII A;  1GY5 A;  2FXT A;  2GBW B;  1N8Q A;  1AV4 A;  1EKM A;  1DMQ A;  3PCR A;  2BMQ B;  1E97 A;  4NHF A;  4XDW A;  7STD A;  3I55 3;  5IEP A;  5STD A;  3HI7 A;  5HGR A;  5I97 A;  5KP4 A;  1FGQ A;  1LNH A;  1A2V A;  2ZDJ A;  4L8O A;  4J8T A;  1O7N B;  5FW5 A;  5IER A;  1K8A 4;  1AR0 A;  2Z77 A;  3DGL A;  2RFR A;  1JKG A;  4XBT A;  5LC6 A;  1OGZ A;  1QVG 2;  2HMJ B;  1U8C B;  2C10 A;  3EC9 A;  4RNY A;  1TP6 A;  1M1X B;  3SVA A;  1W6Y A;  1N9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...