3PS8A

Crystal structure of l68v mutant of human cystatin c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
b'GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
molecule tags Hydrolase inhibitor
source organism Homo sapiens
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ps8A00
2BO9B 1CEWI 1FA3A 2OCTA 4N6MA 5A0OB 1FUWA 1IV9A 1A90A 3S67A 3UL6A 5LC7A 3KSED 5ELJA 1MNLA 4EYCA 2KXGA 1CYVA 1YVBI 3L0RA 3MWZA 3PYJA 4TX4A 1CYUA 1LXEA 1MOLA 1NB3I 3KFQC 4N6OB 4N6LA 1N5PA 3QRDA 1IV7A 1N9JA 1KWIA 4N6NB 2O9UX 5LC6A 4ZM8A 1EQKA 2CH9A 3PXMA 1NB5I 4LZIA 3IMAB 3K9MC 1GD3A 1GD4A 1RN7A 4N6TA 1M9GA 2W9QA 1R4CA 1TIJA 3PS8A 1N5HA 3Q2PA 4N6V0 1ROAA 4N6UA 5ELUA 3UL5A 5EQLA 1PFPA 3GAXA 1DVCA 1STFI 2W9PA 3NX0A 4IT7A 3SVAA 1DVDA 1WNHA 1G96A 4CCVA 3LH4A 1A67A
chains in the Genus database with same CATH superfamily
3D3LA 1ULIB 1TU5A 1Y4KA 2PNCA 3CPOA 4OUQA 1BRHA 1T2IA 2XGLA 1BRIA 4GSPA 1A90A 1UUWB 1MWTA 2UUGC 1VQP3 2ZA4A 1KQS2 3KE7A 5M1AA 1FZUA 2LYXA 3KFQC 1WMOA 2AADA 5RNTA 1T3BA 5CF1A 1JBTA 1V74A 1OGXA 5IF6A 4HM2B 2CX0A 3LXUX 2HMOB 5CF2A 1NWWA 3MSOA 1RRLA 2F4YA 1JB4A 3WR2A 1UI8A 1OF5A 4BL2A 1RGKA 2P09A 1EEJA 4HAAA 1W02A 1JKGB 3NBJA 3HX8A 2OWPA 2KAAA 3G6E3 1QJGA 1IQYA 1B21A 1G96A 1KD14 1B2MA 1FGQA 3CU3A 3FF2A 4L8OA 5JBSA 4QWTA 1VQ73 4AKZA 1W2ZA 3O8YA 3X3XA 3ZG5A 3PCRA 3CC73 3FCSB 1HKXA 2V1LA 2SARA 1YGEA 3IPTA 3DGOA 4EW5A 4EBGA 2KXGA 1RNTA 1W7CA 1TJDA 1AQZA 3MWZA 5STDA 3ZFZA 3NM7A 3MYTA 2CWTA 3Q1CA 3QRDA 1BRNL 1EKMA 3WDGB 1EQKA 1VQ93 1JJ22 2FXTA 2BMOB 4HM7B 1JN5A 3CXC2 1TTOA 2OQEA 1MWRA 2INXA 3PS8A 1BIRA 1IVUA 2E2TA 1GMRA 2RFRA 4MEIA 4Q53A 4R9KA 3V92A 4HM0B 4CJNA 7RNTA 1JB2A 4HM4B 1WNHA 2Z77A 2XFTA 1DMQA 4CCVA 2ZHXB 2W56A 5HOHA 4HM3B 4JRFA 3GZRA 5BU4A 3KZTA 1MWSA 5JPPA 4NHFA 3S67A 5EVHA 2BU4A 8RNTA 3OV4A 1BNSA 2CFLA 4JF8A 3X41A 1YIT3 4HOHA 1B2SA 4N6OB 2OQEC 3DM8A 1UUGB 2KF3A 1BANA 4MMZB 3I0YA 4EC6A 1CH0A 1G02A 2E2VA 4ORLA 1NB5I 3G8ZA 3CD63 1VQO3 3T8NA 1TIJA 3HOHA 3IJEB 1RGCA 3Q2PA 4HM6B 4PEJA 2HMNB 1FW7A 3Q90A 3UL5A 8CHOA 4XBXA 3LT8A 5CK6A 2Q07A 4XBYA 1K28A 3MPHA 1IQ8A 3DY5A 5D83A 3TDGA 1OPYA 3LTCA 3CCM3 1BRJA 3MHEA 1A2VA 1ASKA 1LOVA 2ML5A 2WOHA 3D5GA 1GSPA 1LOWA 1W4NA 5KP4A 3WHOA 3GZYB 3HZPA 1GS3A 2XRXB 1W6CA 1T2HA 5ELJA 2BMRB 1MNLA 4MJDA 1SJWA 2W56B 2W03A 1NDOB 1DYUA 3N54B 1VZZA 2J8XB 1QALA 4BIRA 3HI7A 4XDWA 5GSPA 2CH9A 1BU4A 3NV0A 1BNGA 2E2UA 2RSXA 4LZIA 1L5GB 1GD3A 3V99A 5IEOA 3BNDA 2QA43 3BU4A 3LMLA 1FYSA 4BL3A 1RSNA 3DH2A 4HBRA 1AR0A 1O7GB 2GBWB 3SVAA 1BSAA 3WMDA 4MMXB 4RNTA 1TP6A 1RGFA 2HMMB 2IMJA 4EXRA 1YI23 1D6UA 3F7SA 1I8VA 1PYLA 1QAKA 2OCTA 4GB5A 3JUOA 1UCJA 3B8LA 1Q9EA 1TUHA 2KCDA 1W6YA 5D82A 1FUSA 7GSPA 3KKGA 4AEQA 1KWIA 2RNTA 5LC6A 3WA2X 3CC43 1UGHI 1VQN3 1GD4A 2B1XB 4KT3B 1B20A 1O7HB 2BHMA 1U8CB 3ALAA 1VQL3 2WGOA 2CWVA 2JDIH 1KC84 1RN1A 4ILFA 1M1XB 1JZDA 2WGQA 2GEYA 3VF1A 1X1YA 2IYJA 1TRQA 2ZDJA 3N9HA 1IT7A 4G1MB 1O7MB 3DGYA 3EX9A 4J5KA 1UUVB 1LOXA 3H51A 1DE3A 1JBSA 3G713 1BNJA 2IY2A 2CIUA 3CCU3 1JKGA 2R41A 3NBRA 2C4BA 2CX1A 3FF0A 1BVIA 4WYKB 5BIRA 4KFFA 3N8BA 2CC3A 2K54A 2GU3A 1OCVA 2MF7A 4XM4A 1YHQ3 3GSPA 4I5QA 1GY5A 3PCSA 2OOVA 1JZOA 2D1WA 3LTBA 1BSCA 1VQQA 1DMMA 1K9M4 3JVCA 3SOYA 3EE1A 1RDSA 1QMAA 1YGWA 1LNHA 2F56A 2F99A 2WOFA 3KN4A 3STDA 1C7HA 3FH1A 3RGAA 3UB1A 1IDPA 1S5AA 2A15A 4N6MA 1NNVA 1BNRA 5M19A 1N8R4 4OK0A 4WP5A 3WOFB 3PYJA 1KSIA 1NJI4 4K1VA 4N6LA 1MGRA 1NO3A 2CW9A 1ULJB 1O7NB 2YFJB 1CQSA 1E3VA 5IG0A 3ZG0A 1C54A 3DUKA 4X2OA 2FGTA 1MGWA 1RCLA 2AAEA 3IMAB 2LQVA 3EBYA 4R1KA 3S27A 2HOHA 1ROVA 2W9QA 2CG1A 1R4CA 2Z6BA 4N6UA 1PU4A 5KP1A 1Z1SA 1GYBA 2CHCA 1TFKA 1IVXA 2KRTA 2GXFA 3D5IA 1BSBA 3DGNA 5EQLA 5EEOA 3VGNA 2W9PA 3ECFA 4IT7A 1W5ZA 4RZMA 1IT8A 1RJOA 1SPUA 1UCKA 3PZWA 5G2GA 1IU7A 3URPA 3J7Yd 3CCS3 1X1WA 2BO9B 1R4YA 3GZXB 2UX0A 2FNQA 3MG2A 1CEWI 1M904 1I0VA 4DKIA 1LRAA 4N3VA 5G1LA 6GSPA 3EQQB 1LQGC 2HMKB 1N9EA 3S29A 5LC7A 1JRQA 1JN5B 4CPKA 1FGTA 1GOYA 1PY3A 2XGNA 3BNBA 1YJ93 2Z7AA 5AYSC 1RKYA 3VSYA 5CLKA 1N5PA 2P05A 3FZWA 1IV7A 3F8XA 5AIHA 2OTJ3 1SQWA 4GHOA 1E3RA 3FG4A 1RN7A 3BNEA 2CFGA 1E97A 3WA3A 1RMSA 2QIYA 1ROAA 4XB5A 1UI7A 4I4KA 2XSOB 3CPW2 1IQXA 1UCLA 3Q3FA 2BT3A 2CG0A 2L1SA 3X40A 3CCV3 2BMQB 5AIGA 1VQ43 2I9WA 3B4PA 3U97A 4XBTA 2RBIA 3MG1A 3OW22 4LMIA 3NQZA 3AHSA 1UCIA 1LXEA 1T5YA 2UGIA 3AGOA 2IUKA 1K734 3EHCA 3G0KA 4FMCA 2GSPA 1N9JA 1ZX2A 3CCQ3 4R4KA 3KSPA 4KFDA 5FW5A 3WOEB 1MWUA 3T8UA 2F86B 4HM1B 2W04A 2HMJB 3CCE3 4J5GA 1OHSA 2SBLA 1JBRA 4L8PA 1YJW3 1TRPA 2HMLB 3F8HA 4LGQA 2B24B 3NHXA 4KFEA 1D6ZA 1Q7HA 2Z76A 3K7CA 3D79A 3E99A 5AIFA 5JPUA 4K61A 4CDLA 1X1UA 1BNEA 4FR9A 2ML6A 3KSED 1OF5B 2H0IA 2RGQA 3JUQA 2MC8A 1MOLA 1NB3I 4J9AA 4K90B 4ZM8A 1LOYA 1US1A 1I2EA 3JUNA 3PGBA 3K9MC 1JB5A 4FCJA 6STDA 4O2HA 5IEPA 4IIAA 3KIIA 4AKYA 1G0TA 1SIHA 4BTYA 1OGZA 3GAXA 1Q40A 4MMYB 3NX0A 4BU4A 3NUVA 3QK9A 1OACA 4LYLB 4NREA 4RNYA 2BNGA 1FA3A 2GBXB 2YX9A 1RNBA 1UGIA 3BB9A 2RCDA 3A76A 1EG9B 1BUJA 1BRSA 1I2GA 1TFOA 3BNCA 3L0RA 3LYGA 3SXXA 4EV2A 1RGLA 4HZBB 1JV2B 1FGRA 1X1XA 4L7KA 1EA2A 1S723 1ZGXA 1B3SA 3HIIA 1OUNA 2KF4A 2R4IA 1V57A 3K63A 3SEDA 1M9GA 3OX9A 2C11A 4K1UA 1OHOA 3K5TA 1AVKA 1A2PA 3JUMA 5TGNA 4O8SA 2P0MA 2Y74A 1FUTA 1AVLA 1O7WB 3OWUA 1K41A 4KZ1A 5KP3A 3NXJA 3T0UA 1Q864 1ZO2A 4BTWA 1BRGA 1ISKA 3EN1B 1BGSA 2P38A 2CFDA 1B2UA 5CXOA 1YJN3 3OWYA 1W00A 3FSDA 3AGNA 3ROBA 3CME3 1M1K4 4TX4A 1Q40B 3DZLA 4RNZA 1NU3A 1SIIA 3B4OA 4KVHA 1W2B2 1GOVA 1UW1A 3FG1A 4OVMA 5AI1A 3BIRA 2KF6A 2XH9A 1GMPA 3M8CA 1I70A 3AMOA 2XR8B 1N5HA 1RCKA 3GWRA 4J8TA 3UJMA 4HJLB 1EUIC 2STDA 3NBBA 2YFIB 5AEUB 3RNTA 2YFLB 1OH0A 3NM2A 3S5CA 2D42A 1BSEA 4WHAA 3PXMA 1YVSA 5FGOA 3EBTA 3LH4A 5BVBA 3I553 5D81A 2KF5A 2O3OA 1B2XA 3X42A 5AIIA 1W01A 4GL6A 5DRVA 1VQ63 1SARA 2QGUA 3LZAA 1WQLB 3H3HA 1DETA 4EYCA 1I2FA 4O02B 3DMCA 2M7OA 2L4VA 1UDII 3F7XA 1D6YA 4N6NB 2CK3H 4EV5A 3A5EA 3EB8A 4O3VA 3RDEA 3CCJ3 1RTUA 2F5MA 3CMA3 4N6TA 4HZ9B 1RGEA 3UNLA 1Q814 4LSOA 1RRHA 3F40A 4X2HA 2PZVA 5ELUA 3EC9A 1HU9A 1F8NA 2WO0A 1PFPA 9RNTA 1BUQA 2CKFB 1I3FA 1A67A 3F14A 4HKVB 1I0XA 1Q42A 2H0HA 3G4S3 3HIGA 1N8QA 1IVWA 1W6GA 1B27A 2XEPA 2IUJA 5A0OB 3EF8A 3UL6A 1YVBI 3SYUA 1CYUA 4FMBA 1JNQA 5I97A 1VQ53 4HM8B 1STDA 2K3DA 3SLUA 4STDA 1YIJ3 2W2CA 4NPBA 3OWSA 1DMNA 2JQ5A 1WMNA 4FMDA 2H0GA 1RGGA 1HYFA 4RBNA 4BTXA 7STDA 2IA7A 5BXQA 4XDVA 1J2BA 3DGLA 4H61A 5DREA 4HM5B 1LVNA 3ER7A 5IG4A 1VQM3 3BLZA 3NV0B 2F98A 3OXAA 1Q7Y4 3I563 1K8A4 3HK4A 3LTDA 3U1WA 3MG3A 4R80A 1GY6A 6RNTA 1RGAA 3EJVA 1RGHA 3LT9A 2CWUA 3AMOB 5AYRB 2BIRA 3SX1A 1BAOA 3CNXA 1WTHA 3EN8A 2W0QA 2XFSA 3D9RA 1BSDA 1LQMB 3WODG 2F5WA 3GZBA 4LEHA 1IK3A 3LOYA 1YNVX 3K0ZA 4WWUC 2CFWA 3FGYA 5G1KA 4FMAA 2QEX3 1ZS7A 5HGRA 3SOAA 1RHLA 4U13A 2CFKA 4N6V0 3CNMA 1GOUA 1U5OA 3S28A 1DVDA 3V98A 1OHPA 1STFI 1HZ1A 1BOXA 2OOVC 1A2KA 3X3ZA 1GMQA 3CCR3 4IPBA 5AEWB 1BRKA 1QVG2 3GRDA 1GY7A 1Q824 3CCL3 2OTL3 2XSHB 2Y73A 2C10A 1FUWA 1IV9A 4FCMA 3FG3A 3MKIA 3D4AA 3JUPA 3NQYA 1CYVA 4HVNA 1QAFA 2GU1A 4R9LA 5IG3A 1I3IA 1O7PB 4WFOA 1FGMA 5M18A 1FGOA 2ZL8A 1AY7A 3FKAA 1BNIA 2O9UX 1RLSA 5IERA 4FCZA 3RGRA 5IG5A 1BNFA 4HYZA 1WMPA 2K0MA 3DGMA 1AV4A 1VQ83 3LTAA 2W6JH 3G16A 5IW9A 3FLJA 3KCHA 1IVVA 1V58A 2GEXA 2XF3A 3DXOA 3B7CA 1RN4A 2P0XA 4H3UA 4WYKA 1LNIA 5IENA 1DVCA 3AHWA 3CC23 1IYYA 3F9SA 3X3YA 1B2ZA 1QVF2 1VQK3
chains in the Genus database with same CATH topology
3D3LA 1ULIB 1TU5A 1Y4KA 2PNCA 3CPOA 4OUQA 2XGLA 1A90A 1UUWB 1VQP3 1KQS2 3KE7A 2LYXA 3KFQC 1WMOA 5CF1A 1V74A 1OGXA 5IF6A 4HM2B 3LXUX 2HMOB 5CF2A 1NWWA 3MSOA 1RRLA 1JB4A 1UI8A 1OF5A 2P09A 1W02A 1JKGB 3NBJA 3HX8A 2OWPA 3G6E3 1QJGA 1G96A 1IQYA 1KD14 1FGQA 3CU3A 3FF2A 4L8OA 5JBSA 4QWTA 1VQ73 4AKZA 1W2ZA 3O8YA 3X3XA 3PCRA 3CC73 3FCSB 1HKXA 2V1LA 1YGEA 3IPTA 3DGOA 4EBGA 2KXGA 1W7CA 5STDA 3MWZA 3NM7A 3MYTA 2CWTA 3Q1CA 3QRDA 1EKMA 3WDGB 1EQKA 1VQ93 1JJ22 2FXTA 2BMOB 4HM7B 1JN5A 3CXC2 2OQEA 2INXA 4Q53A 3PS8A 1IVUA 2E2TA 2RFRA 4MEIA 4R9KA 3V92A 4HM0B 1JB2A 4HM4B 1WNHA 2Z77A 2XFTA 1DMQA 4CCVA 2W56A 4HM3B 4JRFA 3GZRA 3KZTA 5JPPA 4NHFA 3S67A 5EVHA 3OV4A 4JF8A 2CFLA 3X41A 1YIT3 4N6OB 2OQEC 3DM8A 4MMZB 3I0YA 4EC6A 4ORLA 2E2VA 1NB5I 3G8ZA 3CD63 1VQO3 3T8NA 1TIJA 3IJEB 3Q2PA 4PEJA 4HM6B 2HMNB 3Q90A 3UL5A 8CHOA 4XBXA 3LT8A 5CK6A 2Q07A 4XBYA 1K28A 3MPHA 1IQ8A 3DY5A 3TDGA 1OPYA 3LTCA 3CCM3 3MHEA 1A2VA 1ASKA 2ML5A 2WOHA 1W4NA 5KP4A 3GZYB 3HZPA 1GS3A 2XRXB 1W6CA 5ELJA 2BMRB 1MNLA 4MJDA 1SJWA 2W56B 2W03A 1NDOB 1DYUA 3N54B 1VZZA 1QALA 3HI7A 4XDWA 2CH9A 3NV0A 2E2UA 2RSXA 4LZIA 1L5GB 3V99A 1GD3A 5IEOA 3BNDA 2QA43 3LMLA 4HBRA 1AR0A 1O7GB 2GBWB 3SVAA 3WMDA 4MMXB 4EXRA 2IMJA 1TP6A 2HMMB 1YI23 1D6UA 3F7SA 1QAKA 2OCTA 4GB5A 3JUOA 3B8LA 1TUHA 2KCDA 1W6YA 5D82A 3KKGA 4AEQA 1KWIA 5LC6A 3WA2X 3CC43 1VQN3 1GD4A 2B1XB 1O7HB 2BHMA 1U8CB 3ALAA 1VQL3 2WGOA 2CWVA 2JDIH 1KC84 1M1XB 2WGQA 2GEYA 3VF1A 2ZDJA 3N9HA 1IT7A 4G1MB 1O7MB 3EX9A 1UUVB 1LOXA 3H51A 3G713 2CIUA 3CCU3 1JKGA 3NBRA 4WYKB 3FF0A 4KFFA 3N8BA 2CC3A 2K54A 2GU3A 1OCVA 2MF7A 4XM4A 1YHQ3 1GY5A 3PCSA 2OOVA 2D1WA 3LTBA 1DMMA 1K9M4 3JVCA 3SOYA 3EE1A 1QMAA 1LNHA 2F99A 2WOFA 3KN4A 3STDA 1C7HA 3FH1A 3RGAA 3UB1A 1IDPA 1S5AA 2A15A 4N6MA 1N8R4 4OK0A 4WP5A 3WOFB 3PYJA 1KSIA 1NJI4 4K1VA 4N6LA 1NO3A 2CW9A 1ULJB 2YFJB 1O7NB 5IG0A 1CQSA 1E3VA 3DUKA 4X2OA 2FGTA 3IMAB 2LQVA 3EBYA 4R1KA 3S27A 1ROVA 2W9QA 2CG1A 1R4CA 2Z6BA 4N6UA 1PU4A 5KP1A 1Z1SA 1GYBA 2CHCA 1TFKA 1IVXA 2KRTA 2GXFA 3DGNA 3VGNA 5EQLA 5EEOA 2W9PA 3ECFA 4IT7A 1W5ZA 4RZMA 1IT8A 1RJOA 1SPUA 3PZWA 5G2GA 3CCS3 1IU7A 3J7Yd 3GZXB 2BO9B 2UX0A 2FNQA 3MG2A 1CEWI 1M904 4N3VA 3EQQB 2HMKB 1N9EA 3S29A 5LC7A 1JRQA 1JN5B 2XGNA 3BNBA 1FGTA 1YJ93 2Z7AA 5AYSC 1RKYA 3VSYA 5CLKA 1N5PA 2P05A 3FZWA 1IV7A 3F8XA 5AIHA 2OTJ3 1SQWA 1E3RA 3FG4A 1RN7A 3BNEA 2CFGA 1E97A 3WA3A 2QIYA 1ROAA 4XB5A 1UI7A 4I4KA 2XSOB 3CPW2 1IQXA 2BT3A 2CG0A 3X40A 3CCV3 2BMQB 5AIGA 1VQ43 2I9WA 3B4PA 3U97A 4XBTA 3MG1A 3OW22 4LMIA 3NQZA 1LXEA 1T5YA 1K734 2IUKA 3EHCA 3G0KA 4FMCA 1N9JA 1ZX2A 3CCQ3 4R4KA 3KSPA 4KFDA 5FW5A 3WOEB 3T8UA 2F86B 4HM1B 2W04A 2HMJB 3CCE3 1OHSA 2SBLA 4L8PA 1YJW3 2HMLB 3F8HA 4LGQA 2B24B 3NHXA 4KFEA 1D6ZA 2Z76A 3K7CA 3E99A 5AIFA 5JPUA 4K61A 4CDLA 4FR9A 2ML6A 3KSED 1OF5B 2RGQA 3JUQA 2MC8A 1MOLA 1NB3I 4J9AA 4K90B 4ZM8A 1US1A 3JUNA 3PGBA 3K9MC 1JB5A 4FCJA 6STDA 4O2HA 5IEPA 4IIAA 3KIIA 4AKYA 1SIHA 4BTYA 1OGZA 3GAXA 1Q40A 4MMYB 3NX0A 3NUVA 3QK9A 1OACA 4NREA 4RNYA 2BNGA 1FA3A 2GBXB 2YX9A 3BB9A 2RCDA 3A76A 1EG9B 1TFOA 3BNCA 3L0RA 3LYGA 3SXXA 4EV2A 4HZBB 1JV2B 1FGRA 4L7KA 1EA2A 1S723 3HIIA 1OUNA 2R4IA 3K63A 3SEDA 1M9GA 3OX9A 2C11A 4K1UA 1OHOA 3K5TA 1AVKA 3JUMA 5TGNA 4O8SA 2Y74A 2P0MA 1AVLA 1O7WB 3OWUA 1K41A 4KZ1A 5KP3A 3NXJA 3T0UA 1Q864 1ZO2A 4BTWA 1ISKA 3EN1B 2P38A 2CFDA 5CXOA 1YJN3 3OWYA 1W00A 3FSDA 3ROBA 3CME3 1M1K4 4TX4A 1Q40B 3DZLA 4RNZA 1NU3A 1SIIA 3B4OA 4KVHA 1W2B2 1UW1A 3FG1A 4OVMA 5AI1A 2XH9A 3M8CA 3AMOA 2XR8B 1N5HA 3GWRA 4J8TA 3UJMA 4HJLB 5AEUB 2STDA 3NBBA 2YFIB 2YFLB 1OH0A 3NM2A 3S5CA 2D42A 5FGOA 4WHAA 3PXMA 3EBTA 3LH4A 5BVBA 3I553 5D81A 2O3OA 3X42A 5AIIA 1W01A 4GL6A 5DRVA 1VQ63 3LZAA 2QGUA 1WQLB 3H3HA 4EYCA 4O02B 3DMCA 2M7OA 2L4VA 3F7XA 1D6YA 4N6NB 2CK3H 4EV5A 3EB8A 4O3VA 3RDEA 3CCJ3 3CMA3 4N6TA 4HZ9B 3UNLA 1Q814 4LSOA 1RRHA 3F40A 4X2HA 2PZVA 5ELUA 3EC9A 1HU9A 1F8NA 2WO0A 1PFPA 1BUQA 2CKFB 1A67A 3F14A 4HKVB 1Q42A 3G4S3 3HIGA 1N8QA 1IVWA 1W6GA 2XEPA 2IUJA 5A0OB 3EF8A 3UL6A 1YVBI 1CYUA 4FMBA 1JNQA 5I97A 1VQ53 4HM8B 1STDA 3SLUA 4STDA 1YIJ3 2W2CA 4RBNA 3OWSA 1DMNA 2JQ5A 1WMNA 4FMDA 4BTXA 7STDA 2IA7A 5BXQA 4XDVA 1J2BA 3DGLA 4H61A 5DREA 4HM5B 1LVNA 3ER7A 5IG4A 1VQM3 3BLZA 3NV0B 2F98A 3OXAA 1Q7Y4 3I563 1K8A4 3HK4A 3LTDA 3U1WA 3MG3A 4R80A 1GY6A 3EJVA 3LT9A 2CWUA 3AMOB 5AYRB 3SX1A 3CNXA 1WTHA 3EN8A 2W0QA 2XFSA 3D9RA 3WODG 3GZBA 1IK3A 4LEHA 3LOYA 3K0ZA 4WWUC 2CFWA 3FGYA 4FMAA 2QEX3 5HGRA 3SOAA 4U13A 2CFKA 4N6V0 3CNMA 1U5OA 3S28A 1DVDA 3V98A 1OHPA 1STFI 2OOVC 1A2KA 3X3ZA 3CCR3 4IPBA 5AEWB 1QVG2 3GRDA 1GY7A 1Q824 3CCL3 2OTL3 2XSHB 2Y73A 2C10A 1FUWA 1IV9A 4FCMA 3FG3A 3MKIA 3NQYA 3JUPA 1CYVA 4HVNA 1QAFA 2GU1A 4R9LA 5IG3A 1O7PB 4WFOA 1FGMA 1FGOA 2ZL8A 3FKAA 2O9UX 5IERA 4FCZA 3RGRA 5IG5A 4HYZA 1WMPA 2K0MA 3DGMA 1AV4A 1VQ83 3LTAA 2W6JH 3G16A 5IW9A 3FLJA 3DXOA 1IVVA 2GEXA 2XF3A 4H3UA 3B7CA 4WYKA 2P0XA 5D83A 5IENA 1DVCA 3CC23 3F9SA 3X3YA 1QVF2 1VQK3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO9 B;  1CEW I;  1FA3 A;  2OCT A;  4N6M A;  5A0O B;  1FUW A;  1IV9 A;  1A90 A;  3S67 A;  3UL6 A;  5LC7 A;  3KSE D;  5ELJ A;  1MNL A;  4EYC A;  2KXG A;  1CYV A;  1YVB I;  3L0R A;  3MWZ A;  3PYJ A;  4TX4 A;  1CYU A;  1LXE A;  1MOL A;  1NB3 I;  3KFQ C;  4N6O B;  4N6L A;  1N5P A;  3QRD A;  1IV7 A;  1N9J A;  1KWI A;  4N6N B;  2O9U X;  5LC6 A;  4ZM8 A;  1EQK A;  2CH9 A;  3PXM A;  1NB5 I;  4LZI A;  3IMA B;  3K9M C;  1GD3 A;  1GD4 A;  1RN7 A;  4N6T A;  1M9G A;  2W9Q A;  1R4C A;  1TIJ A;  3PS8 A;  1N5H A;  3Q2P A;  4N6V 0;  1ROA A;  4N6U A;  5ELU A;  3UL5 A;  5EQL A;  1PFP A;  3GAX A;  1DVC A;  1STF I;  2W9P A;  3NX0 A;  4IT7 A;  3SVA A;  1DVD A;  1WNH A;  1G96 A;  4CCV A;  3LH4 A;  1A67 A; 
#chains in the Genus database with same CATH topology
 3D3L A;  1ULI B;  1TU5 A;  1Y4K A;  2PNC A;  3CPO A;  4OUQ A;  1BRH A;  1T2I A;  2XGL A;  1BRI A;  4GSP A;  1A90 A;  1UUW B;  1MWT A;  2UUG C;  1VQP 3;  2ZA4 A;  1KQS 2;  3KE7 A;  5M1A A;  1FZU A;  2LYX A;  3KFQ C;  1WMO A;  2AAD A;  5RNT A;  1T3B A;  5CF1 A;  1JBT A;  1V74 A;  1OGX A;  5IF6 A;  4HM2 B;  2CX0 A;  3LXU X;  2HMO B;  5CF2 A;  1NWW A;  3MSO A;  1RRL A;  2F4Y A;  1JB4 A;  3WR2 A;  1UI8 A;  1OF5 A;  4BL2 A;  1RGK A;  2P09 A;  1EEJ A;  4HAA A;  1W02 A;  1JKG B;  3NBJ A;  3HX8 A;  2OWP A;  2KAA A;  3G6E 3;  1QJG A;  1IQY A;  1B21 A;  1G96 A;  1KD1 4;  1B2M A;  1FGQ A;  3CU3 A;  3FF2 A;  4L8O A;  5JBS A;  4QWT A;  1VQ7 3;  4AKZ A;  1W2Z A;  3O8Y A;  3X3X A;  3ZG5 A;  3PCR A;  3CC7 3;  3FCS B;  1HKX A;  2V1L A;  2SAR A;  1YGE A;  3IPT A;  3DGO A;  4EW5 A;  4EBG A;  2KXG A;  1RNT A;  1W7C A;  1TJD A;  1AQZ A;  3MWZ A;  5STD A;  3ZFZ A;  3NM7 A;  3MYT A;  2CWT A;  3Q1C A;  3QRD A;  1BRN L;  1EKM A;  3WDG B;  1EQK A;  1VQ9 3;  1JJ2 2;  2FXT A;  2BMO B;  4HM7 B;  1JN5 A;  3CXC 2;  1TTO A;  2OQE A;  1MWR A;  2INX A;  3PS8 A;  1BIR A;  1IVU A;  2E2T A;  1GMR A;  2RFR A;  4MEI A;  4Q53 A;  4R9K A;  3V92 A;  4HM0 B;  4CJN A;  7RNT A;  1JB2 A;  4HM4 B;  1WNH A;  2Z77 A;  2XFT A;  1DMQ A;  4CCV A;  2ZHX B;  2W56 A;  5HOH A;  4HM3 B;  4JRF A;  3GZR A;  5BU4 A;  3KZT A;  1MWS A;  5JPP A;  4NHF A;  3S67 A;  5EVH A;  2BU4 A;  8RNT A;  3OV4 A;  1BNS A;  2CFL A;  4JF8 A;  3X41 A;  1YIT 3;  4HOH A;  1B2S A;  4N6O B;  2OQE C;  3DM8 A;  1UUG B;  2KF3 A;  1BAN A;  4MMZ B;  3I0Y A;  4EC6 A;  1CH0 A;  1G02 A;  2E2V A;  4ORL A;  1NB5 I;  3G8Z A;  3CD6 3;  1VQO 3;  3T8N A;  1TIJ A;  3HOH A;  3IJE B;  1RGC A;  3Q2P A;  4HM6 B;  4PEJ A;  2HMN B;  1FW7 A;  3Q90 A;  3UL5 A;  8CHO A;  4XBX A;  3LT8 A;  5CK6 A;  2Q07 A;  4XBY A;  1K28 A;  3MPH A;  1IQ8 A;  3DY5 A;  5D83 A;  3TDG A;  1OPY A;  3LTC A;  3CCM 3;  1BRJ A;  3MHE A;  1A2V A;  1ASK A;  1LOV A;  2ML5 A;  2WOH A;  3D5G A;  1GSP A;  1LOW A;  1W4N A;  5KP4 A;  3WHO A;  3GZY B;  3HZP A;  1GS3 A;  2XRX B;  1W6C A;  1T2H A;  5ELJ A;  2BMR B;  1MNL A;  4MJD A;  1SJW A;  2W56 B;  2W03 A;  1NDO B;  1DYU A;  3N54 B;  1VZZ A;  2J8X B;  1QAL A;  4BIR A;  3HI7 A;  4XDW A;  5GSP A;  2CH9 A;  1BU4 A;  3NV0 A;  1BNG A;  2E2U A;  2RSX A;  4LZI A;  1L5G B;  1GD3 A;  3V99 A;  5IEO A;  3BND A;  2QA4 3;  3BU4 A;  3LML A;  1FYS A;  4BL3 A;  1RSN A;  3DH2 A;  4HBR A;  1AR0 A;  1O7G B;  2GBW B;  3SVA A;  1BSA A;  3WMD A;  4MMX B;  4RNT A;  1TP6 A;  1RGF A;  2HMM B;  2IMJ A;  4EXR A;  1YI2 3;  1D6U A;  3F7S A;  1I8V A;  1PYL A;  1QAK A;  2OCT A;  4GB5 A;  3JUO A;  1UCJ A;  3B8L A;  1Q9E A;  1TUH A;  2KCD A;  1W6Y A;  5D82 A;  1FUS A;  7GSP A;  3KKG A;  4AEQ A;  1KWI A;  2RNT A;  5LC6 A;  3WA2 X;  3CC4 3;  1UGH I;  1VQN 3;  1GD4 A;  2B1X B;  4KT3 B;  1B20 A;  1O7H B;  2BHM A;  1U8C B;  3ALA A;  1VQL 3;  2WGO A;  2CWV A;  2JDI H;  1KC8 4;  1RN1 A;  4ILF A;  1M1X B;  1JZD A;  2WGQ A;  2GEY A;  3VF1 A;  1X1Y A;  2IYJ A;  1TRQ A;  2ZDJ A;  3N9H A;  1IT7 A;  4G1M B;  1O7M B;  3DGY A;  3EX9 A;  4J5K A;  1UUV B;  1LOX A;  3H51 A;  1DE3 A;  1JBS A;  3G71 3;  1BNJ A;  2IY2 A;  2CIU A;  3CCU 3;  1JKG A;  2R41 A;  3NBR A;  2C4B A;  2CX1 A;  3FF0 A;  1BVI A;  4WYK B;  5BIR A;  4KFF A;  3N8B A;  2CC3 A;  2K54 A;  2GU3 A;  1OCV A;  2MF7 A;  4XM4 A;  1YHQ 3;  3GSP A;  4I5Q A;  1GY5 A;  3PCS A;  2OOV A;  1JZO A;  2D1W A;  3LTB A;  1BSC A;  1VQQ A;  1DMM A;  1K9M 4;  3JVC A;  3SOY A;  3EE1 A;  1RDS A;  1QMA A;  1YGW A;  1LNH A;  2F56 A;  2F99 A;  2WOF A;  3KN4 A;  3STD A;  1C7H A;  3FH1 A;  3RGA A;  3UB1 A;  1IDP A;  1S5A A;  2A15 A;  4N6M A;  1NNV A;  1BNR A;  5M19 A;  1N8R 4;  4OK0 A;  4WP5 A;  3WOF B;  3PYJ A;  1KSI A;  1NJI 4;  4K1V A;  4N6L A;  1MGR A;  1NO3 A;  2CW9 A;  1ULJ B;  1O7N B;  2YFJ B;  1CQS A;  1E3V A;  5IG0 A;  3ZG0 A;  1C54 A;  3DUK A;  4X2O A;  2FGT A;  1MGW A;  1RCL A;  2AAE A;  3IMA B;  2LQV A;  3EBY A;  4R1K A;  3S27 A;  2HOH A;  1ROV A;  2W9Q A;  2CG1 A;  1R4C A;  2Z6B A;  4N6U A;  1PU4 A;  5KP1 A;  1Z1S A;  1GYB A;  2CHC A;  1TFK A;  1IVX A;  2KRT A;  2GXF A;  3D5I A;  1BSB A;  3DGN A;  5EQL A;  5EEO A;  3VGN A;  2W9P A;  3ECF A;  4IT7 A;  1W5Z A;  4RZM A;  1IT8 A;  1RJO A;  1SPU A;  1UCK A;  3PZW A;  5G2G A;  1IU7 A;  3URP A;  3J7Y d;  3CCS 3;  1X1W A;  2BO9 B;  1R4Y A;  3GZX B;  2UX0 A;  2FNQ A;  3MG2 A;  1CEW I;  1M90 4;  1I0V A;  4DKI A;  1LRA A;  4N3V A;  5G1L A;  6GSP A;  3EQQ B;  1LQG C;  2HMK B;  1N9E A;  3S29 A;  5LC7 A;  1JRQ A;  1JN5 B;  4CPK A;  1FGT A;  1GOY A;  1PY3 A;  2XGN A;  3BNB A;  1YJ9 3;  2Z7A A;  5AYS C;  1RKY A;  3VSY A;  5CLK A;  1N5P A;  2P05 A;  3FZW A;  1IV7 A;  3F8X A;  5AIH A;  2OTJ 3;  1SQW A;  4GHO A;  1E3R A;  3FG4 A;  1RN7 A;  3BNE A;  2CFG A;  1E97 A;  3WA3 A;  1RMS A;  2QIY A;  1ROA A;  4XB5 A;  1UI7 A;  4I4K A;  2XSO B;  3CPW 2;  1IQX A;  1UCL A;  3Q3F A;  2BT3 A;  2CG0 A;  2L1S A;  3X40 A;  3CCV 3;  2BMQ B;  5AIG A;  1VQ4 3;  2I9W A;  3B4P A;  3U97 A;  4XBT A;  2RBI A;  3MG1 A;  3OW2 2;  4LMI A;  3NQZ A;  3AHS A;  1UCI A;  1LXE A;  1T5Y A;  2UGI A;  3AGO A;  2IUK A;  1K73 4;  3EHC A;  3G0K A;  4FMC A;  2GSP A;  1N9J A;  1ZX2 A;  3CCQ 3;  4R4K A;  3KSP A;  4KFD A;  5FW5 A;  3WOE B;  1MWU A;  3T8U A;  2F86 B;  4HM1 B;  2W04 A;  2HMJ B;  3CCE 3;  4J5G A;  1OHS A;  2SBL A;  1JBR A;  4L8P A;  1YJW 3;  1TRP A;  2HML B;  3F8H A;  4LGQ A;  2B24 B;  3NHX A;  4KFE A;  1D6Z A;  1Q7H A;  2Z76 A;  3K7C A;  3D79 A;  3E99 A;  5AIF A;  5JPU A;  4K61 A;  4CDL A;  1X1U A;  1BNE A;  4FR9 A;  2ML6 A;  3KSE D;  1OF5 B;  2H0I A;  2RGQ A;  3JUQ A;  2MC8 A;  1MOL A;  1NB3 I;  4J9A A;  4K90 B;  4ZM8 A;  1LOY A;  1US1 A;  1I2E A;  3JUN A;  3PGB A;  3K9M C;  1JB5 A;  4FCJ A;  6STD A;  4O2H A;  5IEP A;  4IIA A;  3KII A;  4AKY A;  1G0T A;  1SIH A;  4BTY A;  1OGZ A;  3GAX A;  1Q40 A;  4MMY B;  3NX0 A;  4BU4 A;  3NUV A;  3QK9 A;  1OAC A;  4LYL B;  4NRE A;  4RNY A;  2BNG A;  1FA3 A;  2GBX B;  2YX9 A;  1RNB A;  1UGI A;  3BB9 A;  2RCD A;  3A76 A;  1EG9 B;  1BUJ A;  1BRS A;  1I2G A;  1TFO A;  3BNC A;  3L0R A;  3LYG A;  3SXX A;  4EV2 A;  1RGL A;  4HZB B;  1JV2 B;  1FGR A;  1X1X A;  4L7K A;  1EA2 A;  1S72 3;  1ZGX A;  1B3S A;  3HII A;  1OUN A;  2KF4 A;  2R4I A;  1V57 A;  3K63 A;  3SED A;  1M9G A;  3OX9 A;  2C11 A;  4K1U A;  1OHO A;  3K5T A;  1AVK A;  1A2P A;  3JUM A;  5TGN A;  4O8S A;  2P0M A;  2Y74 A;  1FUT A;  1AVL A;  1O7W B;  3OWU A;  1K41 A;  4KZ1 A;  5KP3 A;  3NXJ A;  3T0U A;  1Q86 4;  1ZO2 A;  4BTW A;  1BRG A;  1ISK A;  3EN1 B;  1BGS A;  2P38 A;  2CFD A;  1B2U A;  5CXO A;  1YJN 3;  3OWY A;  1W00 A;  3FSD A;  3AGN A;  3ROB A;  3CME 3;  1M1K 4;  4TX4 A;  1Q40 B;  3DZL A;  4RNZ A;  1NU3 A;  1SII A;  3B4O A;  4KVH A;  1W2B 2;  1GOV A;  1UW1 A;  3FG1 A;  4OVM A;  5AI1 A;  3BIR A;  2KF6 A;  2XH9 A;  1GMP A;  3M8C A;  1I70 A;  3AMO A;  2XR8 B;  1N5H A;  1RCK A;  3GWR A;  4J8T A;  3UJM A;  4HJL B;  1EUI C;  2STD A;  3NBB A;  2YFI B;  5AEU B;  3RNT A;  2YFL B;  1OH0 A;  3NM2 A;  3S5C A;  2D42 A;  1BSE A;  4WHA A;  3PXM A;  1YVS A;  5FGO A;  3EBT A;  3LH4 A;  5BVB A;  3I55 3;  5D81 A;  2KF5 A;  2O3O A;  1B2X A;  3X42 A;  5AII A;  1W01 A;  4GL6 A;  5DRV A;  1VQ6 3;  1SAR A;  2QGU A;  3LZA A;  1WQL B;  3H3H A;  1DET A;  4EYC A;  1I2F A;  4O02 B;  3DMC A;  2M7O A;  2L4V A;  1UDI I;  3F7X A;  1D6Y A;  4N6N B;  2CK3 H;  4EV5 A;  3A5E A;  3EB8 A;  4O3V A;  3RDE A;  3CCJ 3;  1RTU A;  2F5M A;  3CMA 3;  4N6T A;  4HZ9 B;  1RGE A;  3UNL A;  1Q81 4;  4LSO A;  1RRH A;  3F40 A;  4X2H A;  2PZV A;  5ELU A;  3EC9 A;  1HU9 A;  1F8N A;  2WO0 A;  1PFP A;  9RNT A;  1BUQ A;  2CKF B;  1I3F A;  1A67 A;  3F14 A;  4HKV B;  1I0X A;  1Q42 A;  2H0H A;  3G4S 3;  3HIG A;  1N8Q A;  1IVW A;  1W6G A;  1B27 A;  2XEP A;  2IUJ A;  5A0O B;  3EF8 A;  3UL6 A;  1YVB I;  3SYU A;  1CYU A;  4FMB A;  1JNQ A;  5I97 A;  1VQ5 3;  4HM8 B;  1STD A;  2K3D A;  3SLU A;  4STD A;  1YIJ 3;  2W2C A;  4NPB A;  3OWS A;  1DMN A;  2JQ5 A;  1WMN A;  4FMD A;  2H0G A;  1RGG A;  1HYF A;  4RBN A;  4BTX A;  7STD A;  2IA7 A;  5BXQ A;  4XDV A;  1J2B A;  3DGL A;  4H61 A;  5DRE A;  4HM5 B;  1LVN A;  3ER7 A;  5IG4 A;  1VQM 3;  3BLZ A;  3NV0 B;  2F98 A;  3OXA A;  1Q7Y 4;  3I56 3;  1K8A 4;  3HK4 A;  3LTD A;  3U1W A;  3MG3 A;  4R80 A;  1GY6 A;  6RNT A;  1RGA A;  3EJV A;  1RGH A;  3LT9 A;  2CWU A;  3AMO B;  5AYR B;  2BIR A;  3SX1 A;  1BAO A;  3CNX A;  1WTH A;  3EN8 A;  2W0Q A;  2XFS A;  3D9R A;  1BSD A;  1LQM B;  3WOD G;  2F5W A;  3GZB A;  4LEH A;  1IK3 A;  3LOY A;  1YNV X;  3K0Z A;  4WWU C;  2CFW A;  3FGY A;  5G1K A;  4FMA A;  2QEX 3;  1ZS7 A;  5HGR A;  3SOA A;  1RHL A;  4U13 A;  2CFK A;  4N6V 0;  3CNM A;  1GOU A;  1U5O A;  3S28 A;  1DVD A;  3V98 A;  1OHP A;  1STF I;  1HZ1 A;  1BOX A;  2OOV C;  1A2K A;  3X3Z A;  1GMQ A;  3CCR 3;  4IPB A;  5AEW B;  1BRK A;  1QVG 2;  3GRD A;  1GY7 A;  1Q82 4;  3CCL 3;  2OTL 3;  2XSH B;  2Y73 A;  2C10 A;  1FUW A;  1IV9 A;  4FCM A;  3FG3 A;  3MKI A;  3D4A A;  3JUP A;  3NQY A;  1CYV A;  4HVN A;  1QAF A;  2GU1 A;  4R9L A;  5IG3 A;  1I3I A;  1O7P B;  4WFO A;  1FGM A;  5M18 A;  1FGO A;  2ZL8 A;  1AY7 A;  3FKA A;  1BNI A;  2O9U X;  1RLS A;  5IER A;  4FCZ A;  3RGR A;  5IG5 A;  1BNF A;  4HYZ A;  1WMP A;  2K0M A;  3DGM A;  1AV4 A;  1VQ8 3;  3LTA A;  2W6J H;  3G16 A;  5IW9 A;  3FLJ A;  3KCH A;  1IVV A;  1V58 A;  2GEX A;  2XF3 A;  3DXO A;  3B7C A;  1RN4 A;  2P0X A;  4H3U A;  4WYK A;  1LNI A;  5IEN A;  1DVC A;  3AHW A;  3CC2 3;  1IYY A;  3F9S A;  3X3Y A;  1B2Z A;  1QVF 2;  1VQK 3; 
#chains in the Genus database with same CATH homology
 3D3L A;  1ULI B;  1TU5 A;  1Y4K A;  2PNC A;  3CPO A;  4OUQ A;  2XGL A;  1A90 A;  1UUW B;  1VQP 3;  1KQS 2;  3KE7 A;  2LYX A;  3KFQ C;  1WMO A;  5CF1 A;  1V74 A;  1OGX A;  5IF6 A;  4HM2 B;  3LXU X;  2HMO B;  5CF2 A;  1NWW A;  3MSO A;  1RRL A;  1JB4 A;  1UI8 A;  1OF5 A;  2P09 A;  1W02 A;  1JKG B;  3NBJ A;  3HX8 A;  2OWP A;  3G6E 3;  1QJG A;  1G96 A;  1IQY A;  1KD1 4;  1FGQ A;  3CU3 A;  3FF2 A;  4L8O A;  5JBS A;  4QWT A;  1VQ7 3;  4AKZ A;  1W2Z A;  3O8Y A;  3X3X A;  3PCR A;  3CC7 3;  3FCS B;  1HKX A;  2V1L A;  1YGE A;  3IPT A;  3DGO A;  4EBG A;  2KXG A;  1W7C A;  5STD A;  3MWZ A;  3NM7 A;  3MYT A;  2CWT A;  3Q1C A;  3QRD A;  1EKM A;  3WDG B;  1EQK A;  1VQ9 3;  1JJ2 2;  2FXT A;  2BMO B;  4HM7 B;  1JN5 A;  3CXC 2;  2OQE A;  2INX A;  4Q53 A;  3PS8 A;  1IVU A;  2E2T A;  2RFR A;  4MEI A;  4R9K A;  3V92 A;  4HM0 B;  1JB2 A;  4HM4 B;  1WNH A;  2Z77 A;  2XFT A;  1DMQ A;  4CCV A;  2W56 A;  4HM3 B;  4JRF A;  3GZR A;  3KZT A;  5JPP A;  4NHF A;  3S67 A;  5EVH A;  3OV4 A;  4JF8 A;  2CFL A;  3X41 A;  1YIT 3;  4N6O B;  2OQE C;  3DM8 A;  4MMZ B;  3I0Y A;  4EC6 A;  4ORL A;  2E2V A;  1NB5 I;  3G8Z A;  3CD6 3;  1VQO 3;  3T8N A;  1TIJ A;  3IJE B;  3Q2P A;  4PEJ A;  4HM6 B;  2HMN B;  3Q90 A;  3UL5 A;  8CHO A;  4XBX A;  3LT8 A;  5CK6 A;  2Q07 A;  4XBY A;  1K28 A;  3MPH A;  1IQ8 A;  3DY5 A;  3TDG A;  1OPY A;  3LTC A;  3CCM 3;  3MHE A;  1A2V A;  1ASK A;  2ML5 A;  2WOH A;  1W4N A;  5KP4 A;  3GZY B;  3HZP A;  1GS3 A;  2XRX B;  1W6C A;  5ELJ A;  2BMR B;  1MNL A;  4MJD A;  1SJW A;  2W56 B;  2W03 A;  1NDO B;  1DYU A;  3N54 B;  1VZZ A;  1QAL A;  3HI7 A;  4XDW A;  2CH9 A;  3NV0 A;  2E2U A;  2RSX A;  4LZI A;  1L5G B;  3V99 A;  1GD3 A;  5IEO A;  3BND A;  2QA4 3;  3LML A;  4HBR A;  1AR0 A;  1O7G B;  2GBW B;  3SVA A;  3WMD A;  4MMX B;  4EXR A;  2IMJ A;  1TP6 A;  2HMM B;  1YI2 3;  1D6U A;  3F7S A;  1QAK A;  2OCT A;  4GB5 A;  3JUO A;  3B8L A;  1TUH A;  2KCD A;  1W6Y A;  5D82 A;  3KKG A;  4AEQ A;  1KWI A;  5LC6 A;  3WA2 X;  3CC4 3;  1VQN 3;  1GD4 A;  2B1X B;  1O7H B;  2BHM A;  1U8C B;  3ALA A;  1VQL 3;  2WGO A;  2CWV A;  2JDI H;  1KC8 4;  1M1X B;  2WGQ A;  2GEY A;  3VF1 A;  2ZDJ A;  3N9H A;  1IT7 A;  4G1M B;  1O7M B;  3EX9 A;  1UUV B;  1LOX A;  3H51 A;  3G71 3;  2CIU A;  3CCU 3;  1JKG A;  3NBR A;  4WYK B;  3FF0 A;  4KFF A;  3N8B A;  2CC3 A;  2K54 A;  2GU3 A;  1OCV A;  2MF7 A;  4XM4 A;  1YHQ 3;  1GY5 A;  3PCS A;  2OOV A;  2D1W A;  3LTB A;  1DMM A;  1K9M 4;  3JVC A;  3SOY A;  3EE1 A;  1QMA A;  1LNH A;  2F99 A;  2WOF A;  3KN4 A;  3STD A;  1C7H A;  3FH1 A;  3RGA A;  3UB1 A;  1IDP A;  1S5A A;  2A15 A;  4N6M A;  1N8R 4;  4OK0 A;  4WP5 A;  3WOF B;  3PYJ A;  1KSI A;  1NJI 4;  4K1V A;  4N6L A;  1NO3 A;  2CW9 A;  1ULJ B;  2YFJ B;  1O7N B;  5IG0 A;  1CQS A;  1E3V A;  3DUK A;  4X2O A;  2FGT A;  3IMA B;  2LQV A;  3EBY A;  4R1K A;  3S27 A;  1ROV A;  2W9Q A;  2CG1 A;  1R4C A;  2Z6B A;  4N6U A;  1PU4 A;  5KP1 A;  1Z1S A;  1GYB A;  2CHC A;  1TFK A;  1IVX A;  2KRT A;  2GXF A;  3DGN A;  3VGN A;  5EQL A;  5EEO A;  2W9P A;  3ECF A;  4IT7 A;  1W5Z A;  4RZM A;  1IT8 A;  1RJO A;  1SPU A;  3PZW A;  5G2G A;  3CCS 3;  1IU7 A;  3J7Y d;  3GZX B;  2BO9 B;  2UX0 A;  2FNQ A;  3MG2 A;  1CEW I;  1M90 4;  4N3V A;  3EQQ B;  2HMK B;  1N9E A;  3S29 A;  5LC7 A;  1JRQ A;  1JN5 B;  2XGN A;  3BNB A;  1FGT A;  1YJ9 3;  2Z7A A;  5AYS C;  1RKY A;  3VSY A;  5CLK A;  1N5P A;  2P05 A;  3FZW A;  1IV7 A;  3F8X A;  5AIH A;  2OTJ 3;  1SQW A;  1E3R A;  3FG4 A;  1RN7 A;  3BNE A;  2CFG A;  1E97 A;  3WA3 A;  2QIY A;  1ROA A;  4XB5 A;  1UI7 A;  4I4K A;  2XSO B;  3CPW 2;  1IQX A;  2BT3 A;  2CG0 A;  3X40 A;  3CCV 3;  2BMQ B;  5AIG A;  1VQ4 3;  2I9W A;  3B4P A;  3U97 A;  4XBT A;  3MG1 A;  3OW2 2;  4LMI A;  3NQZ A;  1LXE A;  1T5Y A;  1K73 4;  2IUK A;  3EHC A;  3G0K A;  4FMC A;  1N9J A;  1ZX2 A;  3CCQ 3;  4R4K A;  3KSP A;  4KFD A;  5FW5 A;  3WOE B;  3T8U A;  2F86 B;  4HM1 B;  2W04 A;  2HMJ B;  3CCE 3;  1OHS A;  2SBL A;  4L8P A;  1YJW 3;  2HML B;  3F8H A;  4LGQ A;  2B24 B;  3NHX A;  4KFE A;  1D6Z A;  2Z76 A;  3K7C A;  3E99 A;  5AIF A;  5JPU A;  4K61 A;  4CDL A;  4FR9 A;  2ML6 A;  3KSE D;  1OF5 B;  2RGQ A;  3JUQ A;  2MC8 A;  1MOL A;  1NB3 I;  4J9A A;  4K90 B;  4ZM8 A;  1US1 A;  3JUN A;  3PGB A;  3K9M C;  1JB5 A;  4FCJ A;  6STD A;  4O2H A;  5IEP A;  4IIA A;  3KII A;  4AKY A;  1SIH A;  4BTY A;  1OGZ A;  3GAX A;  1Q40 A;  4MMY B;  3NX0 A;  3NUV A;  3QK9 A;  1OAC A;  4NRE A;  4RNY A;  2BNG A;  1FA3 A;  2GBX B;  2YX9 A;  3BB9 A;  2RCD A;  3A76 A;  1EG9 B;  1TFO A;  3BNC A;  3L0R A;  3LYG A;  3SXX A;  4EV2 A;  4HZB B;  1JV2 B;  1FGR A;  4L7K A;  1EA2 A;  1S72 3;  3HII A;  1OUN A;  2R4I A;  3K63 A;  3SED A;  1M9G A;  3OX9 A;  2C11 A;  4K1U A;  1OHO A;  3K5T A;  1AVK A;  3JUM A;  5TGN A;  4O8S A;  2Y74 A;  2P0M A;  1AVL A;  1O7W B;  3OWU A;  1K41 A;  4KZ1 A;  5KP3 A;  3NXJ A;  3T0U A;  1Q86 4;  1ZO2 A;  4BTW A;  1ISK A;  3EN1 B;  2P38 A;  2CFD A;  5CXO A;  1YJN 3;  3OWY A;  1W00 A;  3FSD A;  3ROB A;  3CME 3;  1M1K 4;  4TX4 A;  1Q40 B;  3DZL A;  4RNZ A;  1NU3 A;  1SII A;  3B4O A;  4KVH A;  1W2B 2;  1UW1 A;  3FG1 A;  4OVM A;  5AI1 A;  2XH9 A;  3M8C A;  3AMO A;  2XR8 B;  1N5H A;  3GWR A;  4J8T A;  3UJM A;  4HJL B;  5AEU B;  2STD A;  3NBB A;  2YFI B;  2YFL B;  1OH0 A;  3NM2 A;  3S5C A;  2D42 A;  5FGO A;  4WHA A;  3PXM A;  3EBT A;  3LH4 A;  5BVB A;  3I55 3;  5D81 A;  2O3O A;  3X42 A;  5AII A;  1W01 A;  4GL6 A;  5DRV A;  1VQ6 3;  3LZA A;  2QGU A;  1WQL B;  3H3H A;  4EYC A;  4O02 B;  3DMC A;  2M7O A;  2L4V A;  3F7X A;  1D6Y A;  4N6N B;  2CK3 H;  4EV5 A;  3EB8 A;  4O3V A;  3RDE A;  3CCJ 3;  3CMA 3;  4N6T A;  4HZ9 B;  3UNL A;  1Q81 4;  4LSO A;  1RRH A;  3F40 A;  4X2H A;  2PZV A;  5ELU A;  3EC9 A;  1HU9 A;  1F8N A;  2WO0 A;  1PFP A;  1BUQ A;  2CKF B;  1A67 A;  3F14 A;  4HKV B;  1Q42 A;  3G4S 3;  3HIG A;  1N8Q A;  1IVW A;  1W6G A;  2XEP A;  2IUJ A;  5A0O B;  3EF8 A;  3UL6 A;  1YVB I;  1CYU A;  4FMB A;  1JNQ A;  5I97 A;  1VQ5 3;  4HM8 B;  1STD A;  3SLU A;  4STD A;  1YIJ 3;  2W2C A;  4RBN A;  3OWS A;  1DMN A;  2JQ5 A;  1WMN A;  4FMD A;  4BTX A;  7STD A;  2IA7 A;  5BXQ A;  4XDV A;  1J2B A;  3DGL A;  4H61 A;  5DRE A;  4HM5 B;  1LVN A;  3ER7 A;  5IG4 A;  1VQM 3;  3BLZ A;  3NV0 B;  2F98 A;  3OXA A;  1Q7Y 4;  3I56 3;  1K8A 4;  3HK4 A;  3LTD A;  3U1W A;  3MG3 A;  4R80 A;  1GY6 A;  3EJV A;  3LT9 A;  2CWU A;  3AMO B;  5AYR B;  3SX1 A;  3CNX A;  1WTH A;  3EN8 A;  2W0Q A;  2XFS A;  3D9R A;  3WOD G;  3GZB A;  1IK3 A;  4LEH A;  3LOY A;  3K0Z A;  4WWU C;  2CFW A;  3FGY A;  4FMA A;  2QEX 3;  5HGR A;  3SOA A;  4U13 A;  2CFK A;  4N6V 0;  3CNM A;  1U5O A;  3S28 A;  1DVD A;  3V98 A;  1OHP A;  1STF I;  2OOV C;  1A2K A;  3X3Z A;  3CCR 3;  4IPB A;  5AEW B;  1QVG 2;  3GRD A;  1GY7 A;  1Q82 4;  3CCL 3;  2OTL 3;  2XSH B;  2Y73 A;  2C10 A;  1FUW A;  1IV9 A;  4FCM A;  3FG3 A;  3MKI A;  3NQY A;  3JUP A;  1CYV A;  4HVN A;  1QAF A;  2GU1 A;  4R9L A;  5IG3 A;  1O7P B;  4WFO A;  1FGM A;  1FGO A;  2ZL8 A;  3FKA A;  2O9U X;  5IER A;  4FCZ A;  3RGR A;  5IG5 A;  4HYZ A;  1WMP A;  2K0M A;  3DGM A;  1AV4 A;  1VQ8 3;  3LTA A;  2W6J H;  3G16 A;  5IW9 A;  3FLJ A;  3DXO A;  1IVV A;  2GEX A;  2XF3 A;  4H3U A;  3B7C A;  4WYK A;  2P0X A;  5D83 A;  5IEN A;  1DVC A;  3CC2 3;  3F9S A;  3X3Y A;  1QVF 2;  1VQK 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...