1DVCA

Solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEFIN A
publication title The three-dimensional solution structure of human stefin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease inhibitor
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dvcA00
5EQLA 4N6TA 1N5HA 3KFQC 1A90A 1FUWA 3K9MC 1NB3I 3QRDA 3MWZA 3S67A 1PFPA 1ROAA 1FA3A 4N6UA 1KWIA 3SVAA 1IV9A 1NB5I 1RN7A 4N6LA 3UL6A 2KXGA 2O9UX 1A67A 1DVCA 4ZM8A 1YVBI 1CYUA 2CH9A 4IT7A 5ELUA 3IMAB 4TX4A 5A0OB 1LXEA 2BO9B 5ELJA 4LZIA 4EYCA 1MNLA 1DVDA 2OCTA 1GD3A 1MOLA 1CYVA 3PYJA 1M9GA 3L0RA 1GD4A 4N6OB 1R4CA 3UL5A 1STFI 4N6MA 5LC6A 3KSED 4N6NB 3Q2PA 1N9JA 1WNHA 3PS8A 1EQKA 1G96A 1IV7A 1CEWI 1N5PA 2W9PA 5LC7A 3GAXA 4CCVA 2W9QA 3NX0A 3PXMA 3LH4A 1TIJA 4N6V0
chains in the Genus database with same CATH superfamily
3IJEB 2OQEC 3MG3A 3G16A 4MEIA 4FR9A 3AMOA 1BRGA 4FCJA 3HIIA 3HZPA 4J5GA 4LEHA 1RN1A 1YNVX 2BNGA 3DMCA 4N6TA 1ZS7A 1GOVA 1N5HA 3KFQC 1FGTA 2GSPA 1BUJA 2KF3A 1BRSA 3B4PA 1C54A 1T5YA 4XBXA 5JPPA 5EVHA 1BSAA 1BIRA 3QRDA 3MWZA 2CFDA 3F8XA 2ML5A 3KIIA 3Q90A 4J5KA 5CLKA 5STDA 3F7SA 2UGIA 4HM4B 3G6E3 3QK9A 1NDOB 4N6UA 3G0KA 3FG3A 1BNJA 1QAFA 1SARA 2C4BA 2GU1A 1EG9B 2WGQA 2CK3H 3CCQ3 1VQM3 3N9HA 4HZBB 1GMQA 1X1YA 4G1MB 2FNQA 1Q824 1AV4A 2KAAA 7RNTA 4N6LA 2ZHXB 3URPA 1T2IA 2IA7A 1UCKA 3EC9A 5DREA 1KD14 2FXTA 5AYSC 1TFOA 5G1KA 4HVNA 5GSPA 2Q07A 3NV0B 1LVNA 3GZYB 3JUMA 1W01A 2OWPA 4LGQA 4GHOA 2HMLB 4HKVB 5EEOA 1I2EA 3FKAA 4O2HA 3WDGB 2GBWB 4X2OA 1OF5A 1RGFA 1UI8A 2BMRB 2CH9A 2MF7A 2QIYA 2RSXA 3DZLA 3GZXB 3KN4A 4IT7A 4KFFA 3S5CA 1RCKA 1G0TA 1U5OA 1UCLA 3CPOA 1HYFA 5TGNA 4FCMA 1R4YA 3GSPA 1W2B2 5AIFA 5FW5A 3SLUA 3HK4A 1Q42A 2BO9B 2Y73A 1FGQA 1IQXA 1E97A 3KE7A 3D79A 4LZIA 2ZL8A 4EYCA 2P05A 3WOEB 3VGNA 3EN8A 5IEPA 1VQQA 4BIRA 4L8PA 1GMRA 3CCM3 1W6CA 4NREA 1EKMA 1OACA 1TRQA 1JKGA 1RN4A 1PU4A 4GB5A 1JN5A 2OOVC 3PYJA 1BUQA 1S723 1GYBA 1Z1SA 3B7CA 3WHOA 4EC6A 3LZAA 3MG1A 2HMJB 2KF6A 1BRKA 1B2SA 1O7HB 2H0IA 4N6OB 4JRFA 1A2VA 3CC23 2XEPA 1IVWA 1OUNA 1UDII 3EHCA 3T8NA 3UL5A 1LOVA 2W03A 2B1XB 3CCU3 3UB1A 4KT3B 3AMOB 1IQ8A 2BMOB 3Q2PA 1DE3A 1RGKA 2YFJB 2CHCA 1EQKA 1UCJA 3NUVA 2R41A 2CFGA 1W6YA 3F40A 1CEWI 5BU4A 4HZ9B 1RTUA 3U97A 4XB5A 3N8BA 1I3IA 1TP6A 3AGOA 1BANA 1STDA 2GU3A 3BNBA 1GSPA 3J7Yd 3FF0A 4XDVA 4WFOA 1HU9A 3WOFB 1BRIA 1JRQA 3B8LA 3BNEA 3WR2A 1Q40B 1NJI4 1FGMA 4IIAA 1MWUA 2W9QA 3AHSA 4CJNA 2CWTA 8RNTA 1PY3A 1WTHA 1I0XA 3PCRA 3SEDA 1X1XA 2SBLA 1IVUA 4R9KA 6RNTA 3FSDA 4ILFA 4STDA 3O8YA 1FW7A 1QALA 3LTBA 1JBRA 3PXMA 4R80A 1M904 3D4AA 2CWVA 1LQGC 1IQYA 2CIUA 1RMSA 4HBRA 3GZBA 4GL6A 3LOYA 4HYZA 1MWRA 2QA43 1UUGB 1B20A 3CMA3 3KSPA 2HMOB 2P0XA 3F8HA 3OX9A 4JF8A 5DRVA 1EUIC 4BTXA 1Q814 2KF5A 2XGLA 4R9LA 6STDA 1IK3A 3D5GA 3MSOA 5IENA 1NO3A 2IUJA 4J8TA 2J8XB 4WYKA 1VQ73 1NB3I 4K90B 3DGNA 3I563 1DMMA 1BSBA 3JUNA 2W6JH 2HMNB 1B2UA 1RDSA 1ROAA 1OHOA 3BIRA 3CD63 2AADA 4HM0B 2MC8A 1A2PA 3ROBA 3AGNA 4MJDA 1JB2A 1EA2A 1N9EA 1NB5I 1RN7A 2CW9A 4I5QA 1N8R4 3B4OA 1WMOA 1ASKA 4DKIA 1VQ93 1LNHA 3PZWA 1GOUA 4MMXB 3LT8A 4FMAA 2WGOA 1B2XA 2WOFA 4RNTA 1VQO3 3ECFA 2D42A 3DUKA 1W6GA 1A67A 3DM8A 2Z6BA 3GZRA 4HM5B 4K1VA 1RJOA 1GS3A 1W7CA 3LMLA 1YVBI 4PEJA 4FMBA 3S28A 2Y74A 3HI7A 3SX1A 1CYUA 3FH1A 2XFSA 1B2ZA 2BU4A 2W56A 2OOVA 4LYLB 3ZG5A 2L4VA 3G8ZA 1BNRA 3EE1A 2RNTA 1O7NB 5BVBA 1KC84 3D5IA 3DGMA 1BSCA 3K5TA 4XBTA 3IMAB 3FG1A 2E2TA 3NBRA 2AAEA 2GEYA 3FCSB 3G4S3 1UUWB 4NHFA 1MWSA 4TX4A 4QWTA 5A0OB 4CDLA 2JDIH 1LXEA 1JNQA 2ML6A 5ELJA 3CPW2 4HM8B 1FGOA 2P0MA 4HM6B 1GMPA 2KRTA 1MNLA 4GSPA 1DMQA 1BSDA 1GD3A 1CYVA 1BNGA 3LXUX 1IVXA 1N8QA 1YGEA 3ZG0A 1YVSA 3SOYA 3PCSA 1V57A 1LOYA 3CNXA 1OH0A 4OUQA 3CCJ3 5AIGA 2PNCA 1D6YA 1ROVA 5HOHA 1FZUA 5IW9A 1R4CA 1UUVB 2CC3A 1A2KA 1STFI 2KF4A 3K7CA 4KFDA 4X2HA 5JPUA 1DYUA 5LC6A 3KSED 2HMMB 3CME3 3H3HA 3ALAA 1WNHA 2YFIB 1AQZA 5HGRA 1G96A 3NM7A 3DGOA 1I2FA 3OXAA 1JZOA 1JBTA 1TRPA 3I0YA 1FGRA 5IF6A 4N3VA 3OWUA 1N5PA 4EV5A 5M18A 1VQ43 1B27A 4WYKB 1RNTA 3CCR3 3KZTA 4CCVA 1QAKA 3EJVA 2LYXA 3F7XA 3FLJA 4XM4A 3HOHA 4H3UA 4L8OA 1JB5A 1BRHA 1G02A 2K0MA 3N54B 3RGAA 1SPUA 5CXOA 3WA3A 4I4KA 3E99A 1GY5A 4WHAA 3LH4A 2Z77A 5AEWB 4N6V0 4RNYA 1OGZA 5IEOA 2CG0A 2CFWA 2RCDA 3NHXA 1AVLA 2JQ5A 1JV2B 3CU3A 1I8VA 1W02A 5AIHA 1GOYA 2K54A 3CCL3 2CX0A 5CF2A 1TU5A 1A90A 2I9WA 2QGUA 2F86B 4WP5A 1RGHA 4EXRA 1X1WA 3CXC2 2ZA4A 3K9MC 3K0ZA 3JUPA 3STDA 1HKXA 2XRXB 3BNDA 3M8CA 2B24B 4H61A 1PFPA 2XFTA 4LSOA 3T8UA 1JJ22 1RLSA 2HOHA 2XSHB 2D1WA 5D81A 1FA3A 1YIJ3 2F99A 1RGEA 1IVVA 1IV9A 3EBTA 3SVAA 2O3OA 3WODG 1V58A 1OHSA 5G2GA 3JUOA 2ZDJA 1YJN3 1VQN3 1ZX2A 3H51A 1RRHA 1T3BA 3FG4A 5FGOA 4Q53A 1RGLA 4R1KA 5RNTA 4HOHA 5BIRA 3MG2A 4MMYB 3SOAA 3EF8A 2GEXA 3RGRA 2KXGA 3CNMA 3X40A 1BAOA 3LTDA 3FF2A 2BHMA 1YGWA 4XBYA 1E3VA 3NV0A 4OK0A 4RZMA 5D82A 2F4YA 1B2MA 3V92A 1BGSA 2WOHA 1AVKA 3FGYA 3NBBA 2H0HA 1I3FA 3UJMA 1SIHA 1T2HA 4HM7B 5IG3A 5IERA 1OF5B 2M7OA 1JB4A 1CQSA 1VZZA 2BMQB 5M19A 3DGLA 2CG1A 2A15A 3FZWA 1K8A4 3DY5A 7GSPA 1YI23 3HIGA 4O3VA 2GBXB 1W4NA 1K28A 3EB8A 1US1A 2IY2A 5IG5A 1Q9EA 5JBSA 1EEJA 1UGIA 4O02B 4BL3A 1Q7Y4 1VQ53 1LOWA 1BNFA 3NBJA 3X3YA 4KFEA 4HJLB 1DVDA 2OCTA 3NXJA 3LTCA 1C7HA 1BNIA 1TFKA 3SYUA 4BTYA 1IT7A 1JKGB 1MOLA 2F98A 2INXA 1JN5B 2XF3A 3HX8A 4O8SA 4ORLA 1RRLA 2RGQA 1OPYA 1J2BA 1TJDA 1RSNA 1QVG2 1O7WB 2LQVA 3L0RA 3CCS3 1GD4A 3EBYA 1B3SA 3VF1A 1IU7A 1ZGXA 3NQZA 3SXXA 4HAAA 1BRJA 1B21A 3F14A 3MHEA 1N9JA 3PS8A 3Q3FA 1TUHA 2CFLA 2Z76A 1ULIB 1JBSA 1IV7A 1SQWA 4BTWA 3I553 1O7GB 2UUGC 3BU4A 1D6UA 1D6ZA 5AEUB 1YIT3 5LC7A 3EX9A 1FYSA 1LOXA 2L1SA 1Q40A 2CKFB 2QEX3 4EBGA 1MWTA 4NPBA 9RNTA 1I70A 1VQK3 2C10A 1Q864 3X41A 4BL2A 1SIIA 3V98A 1IYYA 3U1WA 1PYLA 3OWSA 1OGXA 1M1XB 1U8CB 3Q1CA 3ZFZA 1UGHI 1E3RA 3NM2A 5D83A 3X42A 4LMIA 3NQYA 5EQLA 3DGYA 1OCVA 4J9AA 3X3XA 5KP3A 1BVIA 1BNSA 1FUSA 2H0GA 3KKGA 3LTAA 2CFKA 1QMAA 1HZ1A 3VSYA 2UX0A 3GRDA 1BRNL 1Q7HA 2R4IA 1FUWA 3MPHA 4HM3B 2HMKB 3D9RA 1NNVA 3K63A 4IPBA 2K3DA 1WQLB 4AKYA 3GWRA 2RFRA 1LQMB 5KP1A 3V99A 3S67A 4EV2A 1QJGA 2F5WA 2P09A 3CC73 2BIRA 1KWIA 1ULJB 3DH2A 1VQ83 1RHLA 5G1LA 2W2CA 2WO0A 3BNCA 4U13A 1RCLA 2CWUA 4KZ1A 3CCE3 1FUTA 1V74A 4FMCA 5IG4A 2IYJA 7STDA 1CH0A 1RKYA 1K9M4 3UL6A 1RGCA 3F9SA 1KSIA 1NU3A 1MGWA 1S5AA 1W2ZA 1TTOA 4R4KA 3RDEA 1YHQ3 1UW1A 1O7PB 1F8NA 1W00A 1GY6A 2O9UX 2PZVA 1DVCA 2W0QA 3LT9A 4ZM8A 2F56A 4WWUC 1KQS2 2YX9A 1OHPA 2FGTA 3PGBA 2YFLB 2KCDA 1LNIA 5CK6A 1VQL3 2W56B 4HM2B 3IPTA 4XDWA 3CC43 2E2UA 1DETA 5M1AA 2BT3A 4K1UA 2RBIA 1DMNA 1IDPA 3EN1B 3TDGA 1X1UA 3BLZA 1WMNA 4L7KA 1I2GA 1VQP3 5IG0A 3WMDA 8CHOA 2IUKA 2Z7AA 1MGRA 2OQEA 2SARA 2XGNA 5AIIA 2XH9A 3RNTA 1IT8A 1O7MB 2F5MA 3OV4A 3A76A 3OW22 2E2VA 3LYGA 1VQ63 3MKIA 3JVCA 1YJ93 3EQQB 5AI1A 1Y4KA 1ISKA 1UCIA 4CPKA 1BOXA 6GSPA 2OTJ3 4AEQA 4FMDA 5CF1A 3S27A 1UI7A 3DXOA 3KCHA 4RBNA 2OTL3 1M9GA 1ZO2A 4BU4A 2XR8B 5ELUA 3D3LA 1RNBA 1L5GB 3UNLA 4N6MA 5I97A 4K61A 4N6NB 2P38A 3G713 3OWYA 4FCZA 4AKZA 3JUQA 4RNZA 4EW5A 1NWWA 5AYRB 3T0UA 1BU4A 1LRAA 1RGAA 2W04A 4OVMA 3MYTA 2W9PA 3AHWA 3BB9A 4MMZB 5BXQA 3GAXA 2V1LA 2IMJA 3WA2X 5KP4A 3NX0A 1M1K4 3S29A 1AR0A 1WMPA 3X3ZA 1K734 1GY7A 1RGGA 2XSOB 3CCV3 3ER7A 1JZDA 1AY7A 1I0VA 1W5ZA 2C11A 1BNEA 3A5EA 4KVHA 1QVF2 1K41A 1SJWA 1BSEA 1YJW3 2STDA 1TIJA 2GXFA 2CX1A 4HM1B
chains in the Genus database with same CATH topology
3IJEB 2OQEC 3MG3A 3G16A 4MEIA 4FR9A 3AMOA 4FCJA 3HIIA 3HZPA 4LEHA 3DMCA 2BNGA 4N6TA 1N5HA 3KFQC 1FGTA 3B4PA 1T5YA 4XBXA 5JPPA 5EVHA 3QRDA 3MWZA 2CFDA 3F8XA 2ML5A 3KIIA 3Q90A 5CLKA 5STDA 3F7SA 3G6E3 4HM4B 3QK9A 1NDOB 4N6UA 3G0KA 3FG3A 1QAFA 2GU1A 1EG9B 2WGQA 2CK3H 3CCQ3 1VQM3 3N9HA 4HZBB 4G1MB 2FNQA 1Q824 1AV4A 4N6LA 2IA7A 3EC9A 5DREA 1KD14 2FXTA 5AYSC 1TFOA 4HVNA 2Q07A 3NV0B 1LVNA 3GZYB 3JUMA 1W01A 2OWPA 4LGQA 2HMLB 4HKVB 5EEOA 3WDGB 3FKAA 4O2HA 2GBWB 4X2OA 1OF5A 1UI8A 2BMRB 2CH9A 2MF7A 2QIYA 2RSXA 3DZLA 3GZXB 3KN4A 4IT7A 4KFFA 3S5CA 1VQ83 1U5OA 3CPOA 5TGNA 4FCMA 1W2B2 5AIFA 5FW5A 3SLUA 3HK4A 1Q42A 2BO9B 2Y73A 1FGQA 1IQXA 1E97A 3KE7A 4LZIA 2ZL8A 4EYCA 2P05A 3WOEB 3VGNA 3EN8A 5IEPA 4L8PA 3CCM3 1W6CA 4NREA 1EKMA 1OACA 1JKGA 1PU4A 4GB5A 1JN5A 2OOVC 3PYJA 1BUQA 1S723 1GYBA 1Z1SA 3B7CA 4EC6A 3LZAA 3MG1A 2HMJB 1O7HB 4N6OB 4JRFA 1A2VA 3CC23 2XEPA 1IVWA 1OUNA 3EHCA 3T8NA 3UL5A 2W03A 3CCU3 2B1XB 3UB1A 3AMOB 1IQ8A 2BMOB 3Q2PA 1EQKA 2YFJB 2CHCA 3NUVA 2CFGA 1W6YA 3F40A 1CEWI 4HZ9B 3U97A 4XB5A 3N8BA 1TP6A 1STDA 2GU3A 3BNBA 3J7Yd 3FF0A 4XDVA 4WFOA 1HU9A 3WOFB 1JRQA 3BNEA 3B8LA 1NJI4 1Q40B 1FGMA 4IIAA 2W9QA 2CWTA 3PCRA 1WTHA 3SEDA 2SBLA 1IVUA 4R9KA 3FSDA 4STDA 3O8YA 1QALA 3LTBA 3PXMA 4R80A 1M904 2CWVA 1IQYA 2CIUA 4HBRA 3GZBA 4GL6A 3LOYA 4HYZA 2QA43 3CMA3 3KSPA 2HMOB 2P0XA 3F8HA 3OX9A 4JF8A 5DRVA 4BTXA 1Q814 2XGLA 4R9LA 6STDA 1IK3A 3MSOA 5IENA 1NO3A 2IUJA 4J8TA 4WYKA 1VQ73 1NB3I 4K90B 3DGNA 3I563 1DMMA 3JUNA 2W6JH 2HMNB 1ROAA 1OHOA 3CD63 4HM0B 2MC8A 3ROBA 4MJDA 1JB2A 1EA2A 1N9EA 1NB5I 1RN7A 2CW9A 1N8R4 3B4OA 1WMOA 1ASKA 1LNHA 3PZWA 4MMXB 3LT8A 4FMAA 2WGOA 2WOFA 1VQO3 3ECFA 2D42A 3DUKA 1W6GA 1A67A 3DM8A 2Z6BA 3GZRA 4HM5B 4K1VA 1RJOA 1GS3A 1W7CA 3LMLA 1YVBI 4PEJA 4FMBA 3S28A 2Y74A 3HI7A 3SX1A 1CYUA 3FH1A 2XFSA 2W56A 2OOVA 2L4VA 3G8ZA 3EE1A 5BVBA 1O7NB 1KC84 3DGMA 4XBTA 5ELUA 3K5TA 3IMAB 3FG1A 2E2TA 3NBRA 3G4S3 2GEYA 3FCSB 1UUWB 4NHFA 4TX4A 5A0OB 4QWTA 4CDLA 2JDIH 1LXEA 1JNQA 2ML6A 5ELJA 3CPW2 4HM8B 1FGOA 2P0MA 4HM6B 2KRTA 1MNLA 1DMQA 1GD3A 1CYVA 3LXUX 5KP1A 1IVXA 1N8QA 1YGEA 3SOYA 3PCSA 3CNXA 1OH0A 4OUQA 3CCJ3 5AIGA 2PNCA 1D6YA 1ROVA 5IW9A 1R4CA 1UUVB 2CC3A 1A2KA 1STFI 3K7CA 4KFDA 4X2HA 5JPUA 1DYUA 5LC6A 3KSED 2HMMB 3CME3 3H3HA 3ALAA 1WNHA 2YFIB 5HGRA 1G96A 3NM7A 3DGOA 3OXAA 3I0YA 1FGRA 5IF6A 4N3VA 3OWUA 1N5PA 4EV5A 1VQ43 4WYKB 3CCR3 3KZTA 4CCVA 1QAKA 3EJVA 2LYXA 3F7XA 3FLJA 4XM4A 4H3UA 4L8OA 1JB5A 3WA3A 3N54B 2K0MA 3RGAA 1SPUA 5CXOA 4I4KA 3E99A 1GY5A 4WHAA 3LH4A 2Z77A 5AEWB 4N6V0 4RNYA 1OGZA 5IEOA 2CG0A 2CFWA 2RCDA 3NHXA 1AVLA 2JQ5A 1JV2B 3CU3A 1W02A 5AIHA 2K54A 3CCL3 5CF2A 1TU5A 1A90A 2I9WA 2QGUA 2F86B 4WP5A 4EXRA 3CXC2 3K9MC 3K0ZA 3JUPA 3STDA 1HKXA 2XRXB 3BNDA 3M8CA 2B24B 4H61A 1PFPA 2XFTA 4LSOA 3T8UA 1JJ22 2XSHB 2D1WA 5D81A 1FA3A 1YIJ3 2F99A 3SVAA 1IVVA 1IV9A 3EBTA 3WODG 2O3OA 1YJN3 1OHSA 5G2GA 3JUOA 2ZDJA 1VQN3 1ZX2A 3H51A 1RRHA 3FG4A 5FGOA 4Q53A 4R1KA 3MG2A 4MMYB 3SOAA 3EF8A 2GEXA 3RGRA 2KXGA 3CNMA 3X40A 3LTDA 3FF2A 2BHMA 4XBYA 1E3VA 3NV0A 4OK0A 4RZMA 5D82A 3V92A 2WOHA 1AVKA 3FGYA 3NBBA 3UJMA 1SIHA 4HM7B 5IG3A 5IERA 1OF5B 2M7OA 1JB4A 1CQSA 1VZZA 2BMQB 3DGLA 2CG1A 2A15A 3FZWA 1K8A4 3DY5A 1YI23 3HIGA 4O3VA 2GBXB 1W4NA 1K28A 3EB8A 1US1A 5IG5A 5JBSA 1Q7Y4 1VQ53 1VQ93 4O02B 3NBJA 3X3YA 4KFEA 4HJLB 1DVDA 2OCTA 3NXJA 3LTCA 1C7HA 1TFKA 4BTYA 1IT7A 1JKGB 1MOLA 2F98A 2INXA 2XF3A 1JN5B 3HX8A 4O8SA 4ORLA 1RRLA 2RGQA 1OPYA 1J2BA 1QVG2 1O7WB 2LQVA 3L0RA 3CCS3 1GD4A 3EBYA 3VF1A 1IU7A 3NQZA 3SXXA 3F14A 3MHEA 1N9JA 3PS8A 1TUHA 2CFLA 2Z76A 1ULIB 1IV7A 1SQWA 4BTWA 3I553 1O7GB 1D6UA 1D6ZA 5AEUB 1YIT3 5LC7A 3EX9A 1LOXA 1Q40A 2CKFB 2QEX3 4EBGA 1VQK3 2C10A 1Q864 3X41A 1SIIA 3V98A 3U1WA 3OWSA 1OGXA 1M1XB 1U8CB 3Q1CA 1E3RA 3NM2A 5D83A 3X42A 4LMIA 3NQYA 5EQLA 1OCVA 4J9AA 3X3XA 5KP3A 3KKGA 3LTAA 2CFKA 1QMAA 3VSYA 2UX0A 3GRDA 1FUWA 2R4IA 3MPHA 4HM3B 2HMKB 3D9RA 3K63A 4IPBA 1WQLB 4AKYA 3GWRA 2RFRA 3V99A 3S67A 4EV2A 1QJGA 2P09A 3CC73 1KWIA 1ULJB 2W2CA 2WO0A 3BNCA 4U13A 2CWUA 4KZ1A 3CCE3 1V74A 4FMCA 5IG4A 7STDA 1RKYA 1K9M4 3UL6A 3F9SA 1KSIA 1NU3A 1W2ZA 1S5AA 3RDEA 4R4KA 1YHQ3 1UW1A 1O7PB 1F8NA 1W00A 1GY6A 2O9UX 2PZVA 1DVCA 2W0QA 3LT9A 4ZM8A 4WWUC 1KQS2 2YX9A 1OHPA 2FGTA 3PGBA 2YFLB 2KCDA 5CK6A 1VQL3 2W56B 4HM2B 3IPTA 4XDWA 3CC43 2E2UA 2BT3A 4K1UA 1DMNA 1IDPA 3EN1B 3TDGA 3BLZA 1WMNA 4L7KA 1VQP3 5IG0A 3WMDA 8CHOA 2IUKA 2Z7AA 2OQEA 2XGNA 5AIIA 2XH9A 1IT8A 1O7MB 3OV4A 3A76A 3OW22 2E2VA 3LYGA 1VQ63 3MKIA 3JVCA 1YJ93 3EQQB 5AI1A 1Y4KA 1ISKA 2OTJ3 4AEQA 4FMDA 5CF1A 3S27A 1UI7A 3DXOA 4RBNA 2OTL3 1M9GA 1ZO2A 2XR8B 3D3LA 1L5GB 3UNLA 4N6MA 5I97A 4K61A 4N6NB 2P38A 3G713 3OWYA 4FCZA 4AKZA 3JUQA 4RNZA 1NWWA 5AYRB 3T0UA 2W04A 4OVMA 3MYTA 2W9PA 3BB9A 4MMZB 5BXQA 3GAXA 2V1LA 2IMJA 3WA2X 5KP4A 3NX0A 1M1K4 3S29A 1AR0A 1WMPA 3X3ZA 1K734 1GY7A 2XSOB 3CCV3 3ER7A 1W5ZA 2C11A 4KVHA 1QVF2 1K41A 1SJWA 1YJW3 2STDA 1TIJA 2GXFA 4HM1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQL A;  4N6T A;  1N5H A;  3KFQ C;  1A90 A;  1FUW A;  3K9M C;  1NB3 I;  3QRD A;  3MWZ A;  3S67 A;  1PFP A;  1ROA A;  1FA3 A;  4N6U A;  1KWI A;  3SVA A;  1IV9 A;  1NB5 I;  1RN7 A;  4N6L A;  3UL6 A;  2KXG A;  2O9U X;  1A67 A;  1DVC A;  4ZM8 A;  1YVB I;  1CYU A;  2CH9 A;  4IT7 A;  5ELU A;  3IMA B;  4TX4 A;  5A0O B;  1LXE A;  2BO9 B;  5ELJ A;  4LZI A;  4EYC A;  1MNL A;  1DVD A;  2OCT A;  1GD3 A;  1MOL A;  1CYV A;  3PYJ A;  1M9G A;  3L0R A;  1GD4 A;  4N6O B;  1R4C A;  3UL5 A;  1STF I;  4N6M A;  5LC6 A;  3KSE D;  4N6N B;  3Q2P A;  1N9J A;  1WNH A;  3PS8 A;  1EQK A;  1G96 A;  1IV7 A;  1CEW I;  1N5P A;  2W9P A;  5LC7 A;  3GAX A;  4CCV A;  2W9Q A;  3NX0 A;  3PXM A;  3LH4 A;  1TIJ A;  4N6V 0; 
#chains in the Genus database with same CATH topology
 3IJE B;  2OQE C;  3MG3 A;  3G16 A;  4MEI A;  4FR9 A;  3AMO A;  1BRG A;  4FCJ A;  3HII A;  3HZP A;  4J5G A;  4LEH A;  1RN1 A;  1YNV X;  2BNG A;  3DMC A;  4N6T A;  1ZS7 A;  1GOV A;  1N5H A;  3KFQ C;  1FGT A;  2GSP A;  1BUJ A;  2KF3 A;  1BRS A;  3B4P A;  1C54 A;  1T5Y A;  4XBX A;  5JPP A;  5EVH A;  1BSA A;  1BIR A;  3QRD A;  3MWZ A;  2CFD A;  3F8X A;  2ML5 A;  3KII A;  3Q90 A;  4J5K A;  5CLK A;  5STD A;  3F7S A;  2UGI A;  4HM4 B;  3G6E 3;  3QK9 A;  1NDO B;  4N6U A;  3G0K A;  3FG3 A;  1BNJ A;  1QAF A;  1SAR A;  2C4B A;  2GU1 A;  1EG9 B;  2WGQ A;  2CK3 H;  3CCQ 3;  1VQM 3;  3N9H A;  4HZB B;  1GMQ A;  1X1Y A;  4G1M B;  2FNQ A;  1Q82 4;  1AV4 A;  2KAA A;  7RNT A;  4N6L A;  2ZHX B;  3URP A;  1T2I A;  2IA7 A;  1UCK A;  3EC9 A;  5DRE A;  1KD1 4;  2FXT A;  5AYS C;  1TFO A;  5G1K A;  4HVN A;  5GSP A;  2Q07 A;  3NV0 B;  1LVN A;  3GZY B;  3JUM A;  1W01 A;  2OWP A;  4LGQ A;  4GHO A;  2HML B;  4HKV B;  5EEO A;  1I2E A;  3FKA A;  4O2H A;  3WDG B;  2GBW B;  4X2O A;  1OF5 A;  1RGF A;  1UI8 A;  2BMR B;  2CH9 A;  2MF7 A;  2QIY A;  2RSX A;  3DZL A;  3GZX B;  3KN4 A;  4IT7 A;  4KFF A;  3S5C A;  1RCK A;  1G0T A;  1U5O A;  1UCL A;  3CPO A;  1HYF A;  5TGN A;  4FCM A;  1R4Y A;  3GSP A;  1W2B 2;  5AIF A;  5FW5 A;  3SLU A;  3HK4 A;  1Q42 A;  2BO9 B;  2Y73 A;  1FGQ A;  1IQX A;  1E97 A;  3KE7 A;  3D79 A;  4LZI A;  2ZL8 A;  4EYC A;  2P05 A;  3WOE B;  3VGN A;  3EN8 A;  5IEP A;  1VQQ A;  4BIR A;  4L8P A;  1GMR A;  3CCM 3;  1W6C A;  4NRE A;  1EKM A;  1OAC A;  1TRQ A;  1JKG A;  1RN4 A;  1PU4 A;  4GB5 A;  1JN5 A;  2OOV C;  3PYJ A;  1BUQ A;  1S72 3;  1GYB A;  1Z1S A;  3B7C A;  3WHO A;  4EC6 A;  3LZA A;  3MG1 A;  2HMJ B;  2KF6 A;  1BRK A;  1B2S A;  1O7H B;  2H0I A;  4N6O B;  4JRF A;  1A2V A;  3CC2 3;  2XEP A;  1IVW A;  1OUN A;  1UDI I;  3EHC A;  3T8N A;  3UL5 A;  1LOV A;  2W03 A;  2B1X B;  3CCU 3;  3UB1 A;  4KT3 B;  3AMO B;  1IQ8 A;  2BMO B;  3Q2P A;  1DE3 A;  1RGK A;  2YFJ B;  2CHC A;  1EQK A;  1UCJ A;  3NUV A;  2R41 A;  2CFG A;  1W6Y A;  3F40 A;  1CEW I;  5BU4 A;  4HZ9 B;  1RTU A;  3U97 A;  4XB5 A;  3N8B A;  1I3I A;  1TP6 A;  3AGO A;  1BAN A;  1STD A;  2GU3 A;  3BNB A;  1GSP A;  3J7Y d;  3FF0 A;  4XDV A;  4WFO A;  1HU9 A;  3WOF B;  1BRI A;  1JRQ A;  3B8L A;  3BNE A;  3WR2 A;  1Q40 B;  1NJI 4;  1FGM A;  4IIA A;  1MWU A;  2W9Q A;  3AHS A;  4CJN A;  2CWT A;  8RNT A;  1PY3 A;  1WTH A;  1I0X A;  3PCR A;  3SED A;  1X1X A;  2SBL A;  1IVU A;  4R9K A;  6RNT A;  3FSD A;  4ILF A;  4STD A;  3O8Y A;  1FW7 A;  1QAL A;  3LTB A;  1JBR A;  3PXM A;  4R80 A;  1M90 4;  3D4A A;  2CWV A;  1LQG C;  1IQY A;  2CIU A;  1RMS A;  4HBR A;  3GZB A;  4GL6 A;  3LOY A;  4HYZ A;  1MWR A;  2QA4 3;  1UUG B;  1B20 A;  3CMA 3;  3KSP A;  2HMO B;  2P0X A;  3F8H A;  3OX9 A;  4JF8 A;  5DRV A;  1EUI C;  4BTX A;  1Q81 4;  2KF5 A;  2XGL A;  4R9L A;  6STD A;  1IK3 A;  3D5G A;  3MSO A;  5IEN A;  1NO3 A;  2IUJ A;  4J8T A;  2J8X B;  4WYK A;  1VQ7 3;  1NB3 I;  4K90 B;  3DGN A;  3I56 3;  1DMM A;  1BSB A;  3JUN A;  2W6J H;  2HMN B;  1B2U A;  1RDS A;  1ROA A;  1OHO A;  3BIR A;  3CD6 3;  2AAD A;  4HM0 B;  2MC8 A;  1A2P A;  3ROB A;  3AGN A;  4MJD A;  1JB2 A;  1EA2 A;  1N9E A;  1NB5 I;  1RN7 A;  2CW9 A;  4I5Q A;  1N8R 4;  3B4O A;  1WMO A;  1ASK A;  4DKI A;  1VQ9 3;  1LNH A;  3PZW A;  1GOU A;  4MMX B;  3LT8 A;  4FMA A;  2WGO A;  1B2X A;  2WOF A;  4RNT A;  1VQO 3;  3ECF A;  2D42 A;  3DUK A;  1W6G A;  1A67 A;  3DM8 A;  2Z6B A;  3GZR A;  4HM5 B;  4K1V A;  1RJO A;  1GS3 A;  1W7C A;  3LML A;  1YVB I;  4PEJ A;  4FMB A;  3S28 A;  2Y74 A;  3HI7 A;  3SX1 A;  1CYU A;  3FH1 A;  2XFS A;  1B2Z A;  2BU4 A;  2W56 A;  2OOV A;  4LYL B;  3ZG5 A;  2L4V A;  3G8Z A;  1BNR A;  3EE1 A;  2RNT A;  1O7N B;  5BVB A;  1KC8 4;  3D5I A;  3DGM A;  1BSC A;  3K5T A;  4XBT A;  3IMA B;  3FG1 A;  2E2T A;  3NBR A;  2AAE A;  2GEY A;  3FCS B;  3G4S 3;  1UUW B;  4NHF A;  1MWS A;  4TX4 A;  4QWT A;  5A0O B;  4CDL A;  2JDI H;  1LXE A;  1JNQ A;  2ML6 A;  5ELJ A;  3CPW 2;  4HM8 B;  1FGO A;  2P0M A;  4HM6 B;  1GMP A;  2KRT A;  1MNL A;  4GSP A;  1DMQ A;  1BSD A;  1GD3 A;  1CYV A;  1BNG A;  3LXU X;  1IVX A;  1N8Q A;  1YGE A;  3ZG0 A;  1YVS A;  3SOY A;  3PCS A;  1V57 A;  1LOY A;  3CNX A;  1OH0 A;  4OUQ A;  3CCJ 3;  5AIG A;  2PNC A;  1D6Y A;  1ROV A;  5HOH A;  1FZU A;  5IW9 A;  1R4C A;  1UUV B;  2CC3 A;  1A2K A;  1STF I;  2KF4 A;  3K7C A;  4KFD A;  4X2H A;  5JPU A;  1DYU A;  5LC6 A;  3KSE D;  2HMM B;  3CME 3;  3H3H A;  3ALA A;  1WNH A;  2YFI B;  1AQZ A;  5HGR A;  1G96 A;  3NM7 A;  3DGO A;  1I2F A;  3OXA A;  1JZO A;  1JBT A;  1TRP A;  3I0Y A;  1FGR A;  5IF6 A;  4N3V A;  3OWU A;  1N5P A;  4EV5 A;  5M18 A;  1VQ4 3;  1B27 A;  4WYK B;  1RNT A;  3CCR 3;  3KZT A;  4CCV A;  1QAK A;  3EJV A;  2LYX A;  3F7X A;  3FLJ A;  4XM4 A;  3HOH A;  4H3U A;  4L8O A;  1JB5 A;  1BRH A;  1G02 A;  2K0M A;  3N54 B;  3RGA A;  1SPU A;  5CXO A;  3WA3 A;  4I4K A;  3E99 A;  1GY5 A;  4WHA A;  3LH4 A;  2Z77 A;  5AEW B;  4N6V 0;  4RNY A;  1OGZ A;  5IEO A;  2CG0 A;  2CFW A;  2RCD A;  3NHX A;  1AVL A;  2JQ5 A;  1JV2 B;  3CU3 A;  1I8V A;  1W02 A;  5AIH A;  1GOY A;  2K54 A;  3CCL 3;  2CX0 A;  5CF2 A;  1TU5 A;  1A90 A;  2I9W A;  2QGU A;  2F86 B;  4WP5 A;  1RGH A;  4EXR A;  1X1W A;  3CXC 2;  2ZA4 A;  3K9M C;  3K0Z A;  3JUP A;  3STD A;  1HKX A;  2XRX B;  3BND A;  3M8C A;  2B24 B;  4H61 A;  1PFP A;  2XFT A;  4LSO A;  3T8U A;  1JJ2 2;  1RLS A;  2HOH A;  2XSH B;  2D1W A;  5D81 A;  1FA3 A;  1YIJ 3;  2F99 A;  1RGE A;  1IVV A;  1IV9 A;  3EBT A;  3SVA A;  2O3O A;  3WOD G;  1V58 A;  1OHS A;  5G2G A;  3JUO A;  2ZDJ A;  1YJN 3;  1VQN 3;  1ZX2 A;  3H51 A;  1RRH A;  1T3B A;  3FG4 A;  5FGO A;  4Q53 A;  1RGL A;  4R1K A;  5RNT A;  4HOH A;  5BIR A;  3MG2 A;  4MMY B;  3SOA A;  3EF8 A;  2GEX A;  3RGR A;  2KXG A;  3CNM A;  3X40 A;  1BAO A;  3LTD A;  3FF2 A;  2BHM A;  1YGW A;  4XBY A;  1E3V A;  3NV0 A;  4OK0 A;  4RZM A;  5D82 A;  2F4Y A;  1B2M A;  3V92 A;  1BGS A;  2WOH A;  1AVK A;  3FGY A;  3NBB A;  2H0H A;  1I3F A;  3UJM A;  1SIH A;  1T2H A;  4HM7 B;  5IG3 A;  5IER A;  1OF5 B;  2M7O A;  1JB4 A;  1CQS A;  1VZZ A;  2BMQ B;  5M19 A;  3DGL A;  2CG1 A;  2A15 A;  3FZW A;  1K8A 4;  3DY5 A;  7GSP A;  1YI2 3;  3HIG A;  4O3V A;  2GBX B;  1W4N A;  1K28 A;  3EB8 A;  1US1 A;  2IY2 A;  5IG5 A;  1Q9E A;  5JBS A;  1EEJ A;  1UGI A;  4O02 B;  4BL3 A;  1Q7Y 4;  1VQ5 3;  1LOW A;  1BNF A;  3NBJ A;  3X3Y A;  4KFE A;  4HJL B;  1DVD A;  2OCT A;  3NXJ A;  3LTC A;  1C7H A;  1BNI A;  1TFK A;  3SYU A;  4BTY A;  1IT7 A;  1JKG B;  1MOL A;  2F98 A;  2INX A;  1JN5 B;  2XF3 A;  3HX8 A;  4O8S A;  4ORL A;  1RRL A;  2RGQ A;  1OPY A;  1J2B A;  1TJD A;  1RSN A;  1QVG 2;  1O7W B;  2LQV A;  3L0R A;  3CCS 3;  1GD4 A;  3EBY A;  1B3S A;  3VF1 A;  1IU7 A;  1ZGX A;  3NQZ A;  3SXX A;  4HAA A;  1BRJ A;  1B21 A;  3F14 A;  3MHE A;  1N9J A;  3PS8 A;  3Q3F A;  1TUH A;  2CFL A;  2Z76 A;  1ULI B;  1JBS A;  1IV7 A;  1SQW A;  4BTW A;  3I55 3;  1O7G B;  2UUG C;  3BU4 A;  1D6U A;  1D6Z A;  5AEU B;  1YIT 3;  5LC7 A;  3EX9 A;  1FYS A;  1LOX A;  2L1S A;  1Q40 A;  2CKF B;  2QEX 3;  4EBG A;  1MWT A;  4NPB A;  9RNT A;  1I70 A;  1VQK 3;  2C10 A;  1Q86 4;  3X41 A;  4BL2 A;  1SII A;  3V98 A;  1IYY A;  3U1W A;  1PYL A;  3OWS A;  1OGX A;  1M1X B;  1U8C B;  3Q1C A;  3ZFZ A;  1UGH I;  1E3R A;  3NM2 A;  5D83 A;  3X42 A;  4LMI A;  3NQY A;  5EQL A;  3DGY A;  1OCV A;  4J9A A;  3X3X A;  5KP3 A;  1BVI A;  1BNS A;  1FUS A;  2H0G A;  3KKG A;  3LTA A;  2CFK A;  1QMA A;  1HZ1 A;  3VSY A;  2UX0 A;  3GRD A;  1BRN L;  1Q7H A;  2R4I A;  1FUW A;  3MPH A;  4HM3 B;  2HMK B;  3D9R A;  1NNV A;  3K63 A;  4IPB A;  2K3D A;  1WQL B;  4AKY A;  3GWR A;  2RFR A;  1LQM B;  5KP1 A;  3V99 A;  3S67 A;  4EV2 A;  1QJG A;  2F5W A;  2P09 A;  3CC7 3;  2BIR A;  1KWI A;  1ULJ B;  3DH2 A;  1VQ8 3;  1RHL A;  5G1L A;  2W2C A;  2WO0 A;  3BNC A;  4U13 A;  1RCL A;  2CWU A;  4KZ1 A;  3CCE 3;  1FUT A;  1V74 A;  4FMC A;  5IG4 A;  2IYJ A;  7STD A;  1CH0 A;  1RKY A;  1K9M 4;  3UL6 A;  1RGC A;  3F9S A;  1KSI A;  1NU3 A;  1MGW A;  1S5A A;  1W2Z A;  1TTO A;  4R4K A;  3RDE A;  1YHQ 3;  1UW1 A;  1O7P B;  1F8N A;  1W00 A;  1GY6 A;  2O9U X;  2PZV A;  1DVC A;  2W0Q A;  3LT9 A;  4ZM8 A;  2F56 A;  4WWU C;  1KQS 2;  2YX9 A;  1OHP A;  2FGT A;  3PGB A;  2YFL B;  2KCD A;  1LNI A;  5CK6 A;  1VQL 3;  2W56 B;  4HM2 B;  3IPT A;  4XDW A;  3CC4 3;  2E2U A;  1DET A;  5M1A A;  2BT3 A;  4K1U A;  2RBI A;  1DMN A;  1IDP A;  3EN1 B;  3TDG A;  1X1U A;  3BLZ A;  1WMN A;  4L7K A;  1I2G A;  1VQP 3;  5IG0 A;  3WMD A;  8CHO A;  2IUK A;  2Z7A A;  1MGR A;  2OQE A;  2SAR A;  2XGN A;  5AII A;  2XH9 A;  3RNT A;  1IT8 A;  1O7M B;  2F5M A;  3OV4 A;  3A76 A;  3OW2 2;  2E2V A;  3LYG A;  1VQ6 3;  3MKI A;  3JVC A;  1YJ9 3;  3EQQ B;  5AI1 A;  1Y4K A;  1ISK A;  1UCI A;  4CPK A;  1BOX A;  6GSP A;  2OTJ 3;  4AEQ A;  4FMD A;  5CF1 A;  3S27 A;  1UI7 A;  3DXO A;  3KCH A;  4RBN A;  2OTL 3;  1M9G A;  1ZO2 A;  4BU4 A;  2XR8 B;  5ELU A;  3D3L A;  1RNB A;  1L5G B;  3UNL A;  4N6M A;  5I97 A;  4K61 A;  4N6N B;  2P38 A;  3G71 3;  3OWY A;  4FCZ A;  4AKZ A;  3JUQ A;  4RNZ A;  4EW5 A;  1NWW A;  5AYR B;  3T0U A;  1BU4 A;  1LRA A;  1RGA A;  2W04 A;  4OVM A;  3MYT A;  2W9P A;  3AHW A;  3BB9 A;  4MMZ B;  5BXQ A;  3GAX A;  2V1L A;  2IMJ A;  3WA2 X;  5KP4 A;  3NX0 A;  1M1K 4;  3S29 A;  1AR0 A;  1WMP A;  3X3Z A;  1K73 4;  1GY7 A;  1RGG A;  2XSO B;  3CCV 3;  3ER7 A;  1JZD A;  1AY7 A;  1I0V A;  1W5Z A;  2C11 A;  1BNE A;  3A5E A;  4KVH A;  1QVF 2;  1K41 A;  1SJW A;  1BSE A;  1YJW 3;  2STD A;  1TIJ A;  2GXF A;  2CX1 A;  4HM1 B; 
#chains in the Genus database with same CATH homology
 3IJE B;  2OQE C;  3MG3 A;  3G16 A;  4MEI A;  4FR9 A;  3AMO A;  4FCJ A;  3HII A;  3HZP A;  4LEH A;  3DMC A;  2BNG A;  4N6T A;  1N5H A;  3KFQ C;  1FGT A;  3B4P A;  1T5Y A;  4XBX A;  5JPP A;  5EVH A;  3QRD A;  3MWZ A;  2CFD A;  3F8X A;  2ML5 A;  3KII A;  3Q90 A;  5CLK A;  5STD A;  3F7S A;  3G6E 3;  4HM4 B;  3QK9 A;  1NDO B;  4N6U A;  3G0K A;  3FG3 A;  1QAF A;  2GU1 A;  1EG9 B;  2WGQ A;  2CK3 H;  3CCQ 3;  1VQM 3;  3N9H A;  4HZB B;  4G1M B;  2FNQ A;  1Q82 4;  1AV4 A;  4N6L A;  2IA7 A;  3EC9 A;  5DRE A;  1KD1 4;  2FXT A;  5AYS C;  1TFO A;  4HVN A;  2Q07 A;  3NV0 B;  1LVN A;  3GZY B;  3JUM A;  1W01 A;  2OWP A;  4LGQ A;  2HML B;  4HKV B;  5EEO A;  3WDG B;  3FKA A;  4O2H A;  2GBW B;  4X2O A;  1OF5 A;  1UI8 A;  2BMR B;  2CH9 A;  2MF7 A;  2QIY A;  2RSX A;  3DZL A;  3GZX B;  3KN4 A;  4IT7 A;  4KFF A;  3S5C A;  1VQ8 3;  1U5O A;  3CPO A;  5TGN A;  4FCM A;  1W2B 2;  5AIF A;  5FW5 A;  3SLU A;  3HK4 A;  1Q42 A;  2BO9 B;  2Y73 A;  1FGQ A;  1IQX A;  1E97 A;  3KE7 A;  4LZI A;  2ZL8 A;  4EYC A;  2P05 A;  3WOE B;  3VGN A;  3EN8 A;  5IEP A;  4L8P A;  3CCM 3;  1W6C A;  4NRE A;  1EKM A;  1OAC A;  1JKG A;  1PU4 A;  4GB5 A;  1JN5 A;  2OOV C;  3PYJ A;  1BUQ A;  1S72 3;  1GYB A;  1Z1S A;  3B7C A;  4EC6 A;  3LZA A;  3MG1 A;  2HMJ B;  1O7H B;  4N6O B;  4JRF A;  1A2V A;  3CC2 3;  2XEP A;  1IVW A;  1OUN A;  3EHC A;  3T8N A;  3UL5 A;  2W03 A;  3CCU 3;  2B1X B;  3UB1 A;  3AMO B;  1IQ8 A;  2BMO B;  3Q2P A;  1EQK A;  2YFJ B;  2CHC A;  3NUV A;  2CFG A;  1W6Y A;  3F40 A;  1CEW I;  4HZ9 B;  3U97 A;  4XB5 A;  3N8B A;  1TP6 A;  1STD A;  2GU3 A;  3BNB A;  3J7Y d;  3FF0 A;  4XDV A;  4WFO A;  1HU9 A;  3WOF B;  1JRQ A;  3BNE A;  3B8L A;  1NJI 4;  1Q40 B;  1FGM A;  4IIA A;  2W9Q A;  2CWT A;  3PCR A;  1WTH A;  3SED A;  2SBL A;  1IVU A;  4R9K A;  3FSD A;  4STD A;  3O8Y A;  1QAL A;  3LTB A;  3PXM A;  4R80 A;  1M90 4;  2CWV A;  1IQY A;  2CIU A;  4HBR A;  3GZB A;  4GL6 A;  3LOY A;  4HYZ A;  2QA4 3;  3CMA 3;  3KSP A;  2HMO B;  2P0X A;  3F8H A;  3OX9 A;  4JF8 A;  5DRV A;  4BTX A;  1Q81 4;  2XGL A;  4R9L A;  6STD A;  1IK3 A;  3MSO A;  5IEN A;  1NO3 A;  2IUJ A;  4J8T A;  4WYK A;  1VQ7 3;  1NB3 I;  4K90 B;  3DGN A;  3I56 3;  1DMM A;  3JUN A;  2W6J H;  2HMN B;  1ROA A;  1OHO A;  3CD6 3;  4HM0 B;  2MC8 A;  3ROB A;  4MJD A;  1JB2 A;  1EA2 A;  1N9E A;  1NB5 I;  1RN7 A;  2CW9 A;  1N8R 4;  3B4O A;  1WMO A;  1ASK A;  1LNH A;  3PZW A;  4MMX B;  3LT8 A;  4FMA A;  2WGO A;  2WOF A;  1VQO 3;  3ECF A;  2D42 A;  3DUK A;  1W6G A;  1A67 A;  3DM8 A;  2Z6B A;  3GZR A;  4HM5 B;  4K1V A;  1RJO A;  1GS3 A;  1W7C A;  3LML A;  1YVB I;  4PEJ A;  4FMB A;  3S28 A;  2Y74 A;  3HI7 A;  3SX1 A;  1CYU A;  3FH1 A;  2XFS A;  2W56 A;  2OOV A;  2L4V A;  3G8Z A;  3EE1 A;  5BVB A;  1O7N B;  1KC8 4;  3DGM A;  4XBT A;  5ELU A;  3K5T A;  3IMA B;  3FG1 A;  2E2T A;  3NBR A;  3G4S 3;  2GEY A;  3FCS B;  1UUW B;  4NHF A;  4TX4 A;  5A0O B;  4QWT A;  4CDL A;  2JDI H;  1LXE A;  1JNQ A;  2ML6 A;  5ELJ A;  3CPW 2;  4HM8 B;  1FGO A;  2P0M A;  4HM6 B;  2KRT A;  1MNL A;  1DMQ A;  1GD3 A;  1CYV A;  3LXU X;  5KP1 A;  1IVX A;  1N8Q A;  1YGE A;  3SOY A;  3PCS A;  3CNX A;  1OH0 A;  4OUQ A;  3CCJ 3;  5AIG A;  2PNC A;  1D6Y A;  1ROV A;  5IW9 A;  1R4C A;  1UUV B;  2CC3 A;  1A2K A;  1STF I;  3K7C A;  4KFD A;  4X2H A;  5JPU A;  1DYU A;  5LC6 A;  3KSE D;  2HMM B;  3CME 3;  3H3H A;  3ALA A;  1WNH A;  2YFI B;  5HGR A;  1G96 A;  3NM7 A;  3DGO A;  3OXA A;  3I0Y A;  1FGR A;  5IF6 A;  4N3V A;  3OWU A;  1N5P A;  4EV5 A;  1VQ4 3;  4WYK B;  3CCR 3;  3KZT A;  4CCV A;  1QAK A;  3EJV A;  2LYX A;  3F7X A;  3FLJ A;  4XM4 A;  4H3U A;  4L8O A;  1JB5 A;  3WA3 A;  3N54 B;  2K0M A;  3RGA A;  1SPU A;  5CXO A;  4I4K A;  3E99 A;  1GY5 A;  4WHA A;  3LH4 A;  2Z77 A;  5AEW B;  4N6V 0;  4RNY A;  1OGZ A;  5IEO A;  2CG0 A;  2CFW A;  2RCD A;  3NHX A;  1AVL A;  2JQ5 A;  1JV2 B;  3CU3 A;  1W02 A;  5AIH A;  2K54 A;  3CCL 3;  5CF2 A;  1TU5 A;  1A90 A;  2I9W A;  2QGU A;  2F86 B;  4WP5 A;  4EXR A;  3CXC 2;  3K9M C;  3K0Z A;  3JUP A;  3STD A;  1HKX A;  2XRX B;  3BND A;  3M8C A;  2B24 B;  4H61 A;  1PFP A;  2XFT A;  4LSO A;  3T8U A;  1JJ2 2;  2XSH B;  2D1W A;  5D81 A;  1FA3 A;  1YIJ 3;  2F99 A;  3SVA A;  1IVV A;  1IV9 A;  3EBT A;  3WOD G;  2O3O A;  1YJN 3;  1OHS A;  5G2G A;  3JUO A;  2ZDJ A;  1VQN 3;  1ZX2 A;  3H51 A;  1RRH A;  3FG4 A;  5FGO A;  4Q53 A;  4R1K A;  3MG2 A;  4MMY B;  3SOA A;  3EF8 A;  2GEX A;  3RGR A;  2KXG A;  3CNM A;  3X40 A;  3LTD A;  3FF2 A;  2BHM A;  4XBY A;  1E3V A;  3NV0 A;  4OK0 A;  4RZM A;  5D82 A;  3V92 A;  2WOH A;  1AVK A;  3FGY A;  3NBB A;  3UJM A;  1SIH A;  4HM7 B;  5IG3 A;  5IER A;  1OF5 B;  2M7O A;  1JB4 A;  1CQS A;  1VZZ A;  2BMQ B;  3DGL A;  2CG1 A;  2A15 A;  3FZW A;  1K8A 4;  3DY5 A;  1YI2 3;  3HIG A;  4O3V A;  2GBX B;  1W4N A;  1K28 A;  3EB8 A;  1US1 A;  5IG5 A;  5JBS A;  1Q7Y 4;  1VQ5 3;  1VQ9 3;  4O02 B;  3NBJ A;  3X3Y A;  4KFE A;  4HJL B;  1DVD A;  2OCT A;  3NXJ A;  3LTC A;  1C7H A;  1TFK A;  4BTY A;  1IT7 A;  1JKG B;  1MOL A;  2F98 A;  2INX A;  2XF3 A;  1JN5 B;  3HX8 A;  4O8S A;  4ORL A;  1RRL A;  2RGQ A;  1OPY A;  1J2B A;  1QVG 2;  1O7W B;  2LQV A;  3L0R A;  3CCS 3;  1GD4 A;  3EBY A;  3VF1 A;  1IU7 A;  3NQZ A;  3SXX A;  3F14 A;  3MHE A;  1N9J A;  3PS8 A;  1TUH A;  2CFL A;  2Z76 A;  1ULI B;  1IV7 A;  1SQW A;  4BTW A;  3I55 3;  1O7G B;  1D6U A;  1D6Z A;  5AEU B;  1YIT 3;  5LC7 A;  3EX9 A;  1LOX A;  1Q40 A;  2CKF B;  2QEX 3;  4EBG A;  1VQK 3;  2C10 A;  1Q86 4;  3X41 A;  1SII A;  3V98 A;  3U1W A;  3OWS A;  1OGX A;  1M1X B;  1U8C B;  3Q1C A;  1E3R A;  3NM2 A;  5D83 A;  3X42 A;  4LMI A;  3NQY A;  5EQL A;  1OCV A;  4J9A A;  3X3X A;  5KP3 A;  3KKG A;  3LTA A;  2CFK A;  1QMA A;  3VSY A;  2UX0 A;  3GRD A;  1FUW A;  2R4I A;  3MPH A;  4HM3 B;  2HMK B;  3D9R A;  3K63 A;  4IPB A;  1WQL B;  4AKY A;  3GWR A;  2RFR A;  3V99 A;  3S67 A;  4EV2 A;  1QJG A;  2P09 A;  3CC7 3;  1KWI A;  1ULJ B;  2W2C A;  2WO0 A;  3BNC A;  4U13 A;  2CWU A;  4KZ1 A;  3CCE 3;  1V74 A;  4FMC A;  5IG4 A;  7STD A;  1RKY A;  1K9M 4;  3UL6 A;  3F9S A;  1KSI A;  1NU3 A;  1W2Z A;  1S5A A;  3RDE A;  4R4K A;  1YHQ 3;  1UW1 A;  1O7P B;  1F8N A;  1W00 A;  1GY6 A;  2O9U X;  2PZV A;  1DVC A;  2W0Q A;  3LT9 A;  4ZM8 A;  4WWU C;  1KQS 2;  2YX9 A;  1OHP A;  2FGT A;  3PGB A;  2YFL B;  2KCD A;  5CK6 A;  1VQL 3;  2W56 B;  4HM2 B;  3IPT A;  4XDW A;  3CC4 3;  2E2U A;  2BT3 A;  4K1U A;  1DMN A;  1IDP A;  3EN1 B;  3TDG A;  3BLZ A;  1WMN A;  4L7K A;  1VQP 3;  5IG0 A;  3WMD A;  8CHO A;  2IUK A;  2Z7A A;  2OQE A;  2XGN A;  5AII A;  2XH9 A;  1IT8 A;  1O7M B;  3OV4 A;  3A76 A;  3OW2 2;  2E2V A;  3LYG A;  1VQ6 3;  3MKI A;  3JVC A;  1YJ9 3;  3EQQ B;  5AI1 A;  1Y4K A;  1ISK A;  2OTJ 3;  4AEQ A;  4FMD A;  5CF1 A;  3S27 A;  1UI7 A;  3DXO A;  4RBN A;  2OTL 3;  1M9G A;  1ZO2 A;  2XR8 B;  3D3L A;  1L5G B;  3UNL A;  4N6M A;  5I97 A;  4K61 A;  4N6N B;  2P38 A;  3G71 3;  3OWY A;  4FCZ A;  4AKZ A;  3JUQ A;  4RNZ A;  1NWW A;  5AYR B;  3T0U A;  2W04 A;  4OVM A;  3MYT A;  2W9P A;  3BB9 A;  4MMZ B;  5BXQ A;  3GAX A;  2V1L A;  2IMJ A;  3WA2 X;  5KP4 A;  3NX0 A;  1M1K 4;  3S29 A;  1AR0 A;  1WMP A;  3X3Z A;  1K73 4;  1GY7 A;  2XSO B;  3CCV 3;  3ER7 A;  1W5Z A;  2C11 A;  4KVH A;  1QVF 2;  1K41 A;  1SJW A;  1YJW 3;  2STD A;  1TIJ A;  2GXF A;  4HM1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...