1DVCA

Solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEFIN A
publication title The three-dimensional solution structure of human stefin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease inhibitor
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dvcA00
1IV9A 3UL6A 5EQLA 2W9QA 5ELJA 1TIJA 2OCTA 4N6NB 1A90A 4LZIA 1DVCA 1R4CA 2O9UX 1M9GA 3PXMA 3IMAB 1ROAA 5A0OB 3SVAA 2BO9B 4EYCA 1FA3A 1CEWI 4N6TA 3K9MC 3PYJA 4TX4A 3KFQC 4N6LA 4N6OB 1WNHA 1EQKA 3LH4A 1NB5I 4N6V0 1N9JA 3GAXA 1FUWA 5LC6A 2W9PA 1YVBI 4CCVA 1A67A 1LXEA 3Q2PA 1MOLA 1STFI 3MWZA 1RN7A 1CYUA 1NB3I 4IT7A 1N5PA 3QRDA 4N6UA 5ELUA 1MNLA 1N5HA 2CH9A 1GD3A 3KSED 4ZM8A 2KXGA 3L0RA 1KWIA 3UL5A 1CYVA 4N6MA 1G96A 3S67A 1DVDA 1IV7A 1PFPA 5LC7A 3NX0A 3PS8A 1GD4A
chains in the Genus database with same CATH superfamily
1E97A 1NDOB 3VF1A 4XBTA 1W7CA 1AY7A 3PCSA 3V98A 1O7PB 3CME3 1K8A4 3B7CA 4KVHA 1VQL3 2XSHB 5IERA 1KSIA 2W9QA 3V99A 1RRLA 1UI7A 1X1WA 2UUGC 4FMBA 3CMA3 2F56A 3URPA 1A90A 4GSPA 4IPBA 3LT8A 1JKGA 2RSXA 1M9GA 3ALAA 1G0TA 1OHSA 5IW9A 1Q864 1FZUA 1RGGA 1EG9B 1AR0A 1IT8A 1ZO2A 2IUKA 1VQQA 3G6E3 3M8CA 1MWRA 1BSBA 4HM4B 2F5WA 1BRGA 1I0VA 2WOHA 5M18A 1A2VA 1N9EA 1V74A 2CFWA 2H0HA 3BNCA 1QMAA 1OACA 2RNTA 1VQK3 1CEWI 1LVNA 2E2TA 5D81A 2GXFA 2IMJA 3KCHA 1LOWA 4XB5A 1IVVA 4J5GA 4O8SA 3NHXA 1M1K4 4U13A 1HYFA 3CCE3 2OOVA 4HZBB 2GU3A 2F4YA 5G1KA 5HGRA 3FG3A 2P38A 4FMCA 3GSPA 5CF1A 1BGSA 3MKIA 3F14A 3UB1A 2CHCA 3G16A 3LH4A 1F8NA 2L1SA 1JB2A 2WGOA 3AGNA 3LTAA 1ULIB 1D6UA 1BNJA 1T2IA 1WMNA 2YX9A 1VQP3 3FG4A 3LXUX 3GZXB 3FLJA 1UCKA 1U5OA 3DGOA 1WMOA 3EBYA 3NXJA 1GOVA 4AEQA 2Z76A 1WTHA 1RLSA 2LQVA 2W9PA 4K90B 2P09A 2HMNB 4R80A 1IYYA 1OPYA 2KAAA 2QA43 3D5IA 1Z1SA 3SOAA 4GHOA 3Q2PA 2MF7A 1O7MB 2E2UA 3AMOA 4CJNA 3K5TA 2MC8A 3G8ZA 4MMYB 9RNTA 4XBYA 7GSPA 6RNTA 5FW5A 4BTXA 1JZOA 3CU3A 2BMQB 1W00A 1STDA 2ZHXB 3FZWA 3A5EA 4AKZA 1MWUA 1NB3I 3I0YA 3JUNA 1B20A 4HVNA 4LGQA 2OWPA 3EQQB 5AIGA 1I3IA 4HM7B 4N3VA 4N6UA 5ELUA 5BU4A 3X3XA 1MNLA 1LRAA 1RNBA 2SBLA 3DY5A 1EEJA 8CHOA 2OTJ3 4OUQA 1N5HA 2HMKB 5I97A 2CH9A 1QAKA 2HMMB 1GD3A 1RTUA 3KZTA 3I553 3FKAA 4O3VA 3DXOA 1IT7A 1FYSA 1UDII 2CC3A 2CIUA 3L0RA 3SLUA 1VQ63 4J5KA 1JNQA 2AAEA 2L4VA 1JZDA 4KT3B 1BSDA 1W02A 1UGIA 3CD63 5DREA 1Q9EA 1FUSA 1X1YA 1CYVA 1VQO3 1C54A 1LOXA 3PZWA 3CPW2 4N6MA 4JF8A 5STDA 5AEUB 3EX9A 3ZG0A 3K0ZA 1IV7A 1JJ22 1B2ZA 4I5QA 4WP5A 1IQYA 1T5YA 3ZG5A 2XFSA 2BU4A 2F99A 3SXXA 3B8LA 1GS3A 1UCLA 1RCKA 2FNQA 2JDIH 2GBXB 2BMOB 3G713 1IV9A 1VQM3 5EQLA 1BSEA 1C7HA 2KCDA 3FF2A 5AI1A 5ELJA 1BRSA 5D83A 1YJN3 1B2MA 3LTCA 2CFKA 3EB8A 2XSOB 2W56B 3CNMA 1TIJA 4WWUC 7STDA 1TTOA 2CWUA 1BSAA 1RJOA 3AGOA 5JPPA 1IVWA 3HIGA 1UCIA 2R4IA 5BVBA 3S29A 3AMOB 4G1MB 5AIFA 5M1AA 3LTBA 3HOHA 4ILFA 3F40A 1ROAA 1K28A 4HM1B 3CCS3 3ZFZA 3EN1B 4EW5A 4FCZA 1LOVA 2BO9B 3NV0A 1BVIA 2W2CA 3TDGA 3LOYA 4BTWA 3SYUA 3NBJA 3OWSA 3WA3A 4EYCA 1VQ73 1B21A 1FGTA 1GYBA 1RGAA 1RGLA 1OF5B 2O3OA 3JUQA 4KFFA 2GEXA 1ZGXA 3F7XA 4L8OA 5GSPA 1OHPA 1FA3A 3N9HA 3O8YA 4XM4A 4XDWA 3PYJA 1NWWA 2BIRA 3DM8A 1AVLA 3D79A 4H61A 1E3RA 1K734 4N6OB 5CK6A 2GU1A 2QGUA 1DE3A 1BAOA 5TGNA 1EQKA 1BNEA 2LYXA 3EE1A 3T8NA 6STDA 2RBIA 1O7NB 5KP3A 1VQ43 1BRHA 2I9WA 3G0KA 1N9JA 3E99A 3KIIA 5EVHA 3S5CA 1RNTA 2F98A 1I2FA 3U97A 3F8HA 4EV2A 1GMPA 5LC6A 4RNYA 3OXAA 5AYSC 1FUWA 3CNXA 3CC23 1UCJA 1IK3A 3B4PA 3CC73 3GRDA 3F8XA 1YVBI 1DYUA 1CH0A 1A2KA 1GMQA 4KZ1A 3CCQ3 1B3SA 1I3FA 1BNFA 2BT3A 5IEOA 3U1WA 1TJDA 5IF6A 1W6GA 1CQSA 1JRQA 2BNGA 3MHEA 2F86B 2STDA 2W6JH 3MWZA 2Y74A 5JPUA 1YHQ3 1S5AA 4L7KA 1YI23 1QALA 1KD14 1SARA 3STDA 2XF3A 1CYUA 4FCMA 3D4AA 3S28A 1KQS2 3OV4A 1PY3A 3NQZA 3NQYA 5DRVA 3V92A 1RN4A 1ULJB 3H3HA 1K9M4 4FMDA 1UUGB 1N8R4 1BRNL 5IG0A 1IDPA 1PU4A 1TFOA 1KC84 3SX1A 2XFTA 3JUOA 1K41A 2CWVA 2RFRA 4R9LA 2HMOB 1VZZA 4KFEA 4ZM8A 1QAFA 2Z6BA 5M19A 1W2ZA 4FR9A 1YJW3 2CFDA 2D42A 1RMSA 1SJWA 5CXOA 3UL5A 3LT9A 5IENA 1JKGB 4BIRA 2W04A 3Q90A 3NM2A 1BUJA 2P0XA 2ZA4A 3NM7A 2ZDJA 4KFDA 1IVXA 3RGRA 3S67A 1DVDA 1I8VA 2P0MA 4FMAA 4K1VA 5LC7A 4WHAA 2GSPA 2PNCA 1TP6A 4Q53A 1NNVA 3T8UA 3X41A 4BTYA 1OCVA 3VSYA 2C4BA 3ECFA 2A15A 1GY7A 3BU4A 3ROBA 4WFOA 3DZLA 1O7GB 1TUHA 2CKFB 5AIIA 1RDSA 1YIT3 4BL2A 1VQ83 4X2HA 2M7OA 3BLZA 5CLKA 1RGFA 1T3BA 4RZMA 3CCV3 4BU4A 3DGMA 3FGYA 4N6NB 1WQLB 1JBSA 4LZIA 1IVUA 1R4CA 1RGHA 2KRTA 2O9UX 1MWTA 1G02A 1UI8A 1W6YA 1X1XA 2KF6A 3KE7A 4ORLA 1I70A 4HBRA 2K3DA 3NBBA 3JUMA 2H0GA 3H51A 3UNLA 3PGBA 5IG3A 3FF0A 1R4YA 3A76A 4EXRA 5IG5A 1S723 3MG1A 3MYTA 2XH9A 4HM6B 4HYZA 3KKGA 2K54A 1EUIC 1FW7A 1BIRA 2CX1A 1M1XB 4FCJA 1AVKA 1HU9A 3AHSA 3K9MC 4R1KA 4TX4A 5D82A 1ROVA 2E2VA 3RDEA 1VQ53 1RN1A 2ML6A 1Q814 1SIIA 2B24B 1NJI4 3HK4A 5EEOA 2ML5A 1RCLA 2C11A 2UGIA 4NPBA 4HM0B 5BIRA 1RKYA 3MSOA 1UGHI 1NB5I 2YFLB 1UUWB 1Q40A 3GAXA 3J7Yd 3ER7A 2WGQA 1TU5A 1LQMB 1AQZA 2IA7A 3HX8A 1FGMA 2KF4A 2CW9A 2C10A 4HM2B 3IJEB 1JN5A 2OQEC 5FGOA 2ZL8A 1GMRA 2W03A 2CG1A 1B2SA 1YGWA 4HZ9B 1VQN3 1JBRA 1BUQA 1LXEA 1RRHA 4DKIA 2CG0A 2QIYA 3DGNA 4R4KA 3Q1CA 1W6CA 1YGEA 3EF8A 4LSOA 2XGNA 1STFI 2CK3H 1RSNA 3LZAA 3D5GA 4OVMA 3KN4A 3WODG 4QWTA 3CCJ3 3WOEB 1RN7A 1J2BA 2GEYA 2B1XB 1OHOA 1TRQA 1IQXA 1X1UA 3WA2X 1I2EA 3WDGB 5HOHA 1LQGC 4EV5A 4RBNA 3WR2A 3HIIA 3IPTA 5RNTA 5KP4A 1GSPA 1UUVB 4HM8B 2F5MA 1FGRA 2Y73A 1A2PA 4WYKA 3LYGA 4HKVB 2Q07A 1YIJ3 2KF3A 1JB5A 3EC9A 3MG3A 3QK9A 4MMXB 1TFKA 1SPUA 4STDA 1MGRA 1D6ZA 1KWIA 2KF5A 1DETA 1E3VA 3RNTA 4OK0A 3FG1A 3CCM3 2XRXB 3D3LA 3MG2A 5AIHA 4GB5A 3BNDA 3DUKA 4L8PA 4RNZA 4EC6A 1OH0A 1FUTA 1Q7Y4 3CC43 3CCR3 1W01A 3NX0A 1AV4A 2WOFA 1GD4A 3BB9A 1Q40B 3GZRA 1IU7A 2INXA 2XEPA 4HOHA 1OGXA 3NV0B 3DGLA 3NUVA 4J8TA 4XBXA 3X3ZA 3I563 3EJVA 3LMLA 3UL6A 1BRKA 2GBWB 1L5GB 1D6YA 2CX0A 1OUNA 3N8BA 4JRFA 4LMIA 1JN5B 1Q824 1DMQA 5G2GA 1Y4KA 2IY2A 2OCTA 2XR8B 3MPHA 1US1A 3G4S3 4CDLA 1DVCA 1I0XA 3UJMA 3DH2A 3PXMA 3CXC2 3N54B 1YVSA 4EBGA 2CFGA 3FCSB 3IMAB 1YJ93 1BSCA 1BNSA 2P05A 3SOYA 1BANA 1ASKA 1FGQA 2HMLB 1BRJA 5A0OB 4H3UA 3SVAA 1QVF2 1HZ1A 2OOVC 3BNEA 3F9SA 2CFLA 4RNTA 1ZS7A 1B2XA 1EA2A 3CPOA 8RNTA 3K63A 1MGWA 2W56A 4LEHA 1BNRA 2SARA 3VGNA 2BHMA 4WYKB 1QVG2 4N6TA 3NBRA 1ISKA 1BU4A 1O7HB 2FGTA 3DGYA 4PEJA 5G1LA 5AYRB 3JVCA 4XDVA 3X42A 2V1LA 1RGKA 3KFQC 4HAAA 4MMZB 1JB4A 4N6LA 1GY6A 1WNHA 5IG4A 6GSPA 1T2HA 3B4OA 3EHCA 4HM3B 1BNIA 3SEDA 3FSDA 1NO3A 4N6V0 1JBTA 1GOUA 2UX0A 2QEX3 1B2UA 4NHFA 2BMRB 2YFIB 3CCU3 2YFJB 3OWYA 4IIAA 3K7CA 3S27A 1YNVX 1OF5A 3PCRA 1FGOA 2RCDA 4K1UA 1Q7HA 2CWTA 3FH1A 3GWRA 3KSPA 3JUPA 4NREA 1LNHA 2AADA 1Q42A 2W0QA 5BXQA 4CCVA 1IQ8A 1A67A 1RGCA 2H0IA 3OWUA 1B27A 4BL3A 4AKYA 4O2HA 3LTDA 5AEWB 5IEPA 1GOYA 3X40A 3WOFB 1LOYA 7RNTA 1O7WB 1ZX2A 1MOLA 1V58A 3CCL3 2RGQA 2IUJA 1RHLA 1VQ93 1GY5A 4HJLB 1V57A 2Z7AA 3D9RA 4HM5B 4O02B 2OQEA 1SQWA 1JV2B 1U8CB 3T0UA 1BOXA 4MJDA 4IT7A 1DMMA 3X3YA 3EN8A 1QJGA 3AHWA 4MEIA 1N5PA 3EBTA 3GZBA 3HI7A 2R41A 3HZPA 3QRDA 3OX9A 1WMPA 4CPKA 2WO0A 2HMJB 3GZYB 1RGEA 2IYJA 3BIRA 2FXTA 2J8XB 4I4KA 3OW22 1W2B2 2HOHA 2OTL3 5KP1A 2K0MA 2D1WA 4GL6A 1MWSA 3KSED 1N8QA 4K61A 1I2GA 2KXGA 1TRPA 5JBSA 1OGZA 1DMNA 3BNBA 3RGAA 5CF2A 2PZVA 4X2OA 2JQ5A 4J9AA 1BRIA 1PYLA 2XGLA 1HKXA 4LYLB 3Q3FA 1G96A 1EKMA 4R9KA 3WMDA 1W5ZA 3DMCA 3F7SA 1LNIA 1PFPA 3WHOA 2Z77A 1NU3A 1W4NA 1SIHA 1UW1A 1M904 3PS8A 1BNGA
chains in the Genus database with same CATH topology
1E97A 1NDOB 3VF1A 4XBTA 1W7CA 3PCSA 3V98A 1O7PB 3CME3 1K8A4 3B7CA 4KVHA 1VQL3 2XSHB 5IERA 1KSIA 2W9QA 3V99A 1RRLA 1UI7A 4FMBA 3CMA3 1A90A 4IPBA 3LT8A 1JKGA 2RSXA 1M9GA 3ALAA 1OHSA 5IW9A 1Q864 1EG9B 1AR0A 1IT8A 1ZO2A 2IUKA 3G6E3 3M8CA 4HM4B 2WOHA 1A2VA 1N9EA 1V74A 2CFWA 3BNCA 1QMAA 1OACA 1VQK3 1CEWI 1LVNA 2E2TA 5D81A 2GXFA 2IMJA 4XB5A 1IVVA 1M1K4 4O8SA 3NHXA 4U13A 3CCE3 2OOVA 4HZBB 2GU3A 5HGRA 3FG3A 2P38A 4FMCA 5CF1A 3MKIA 3F14A 3UB1A 2CHCA 3G16A 3LH4A 1F8NA 2WGOA 1JB2A 3LTAA 1ULIB 1D6UA 1WMNA 2YX9A 1VQP3 3FG4A 3LXUX 3GZXB 3FLJA 3DGOA 1U5OA 1WMOA 3EBYA 3NXJA 4AEQA 2Z76A 1WTHA 2LQVA 2W9PA 4K90B 2P09A 2HMNB 4R80A 1OPYA 2QA43 1Z1SA 3SOAA 3Q2PA 2MF7A 1O7MB 3AMOA 2E2UA 3K5TA 2MC8A 3G8ZA 4MMYB 4XBYA 5FW5A 4BTXA 3CU3A 2BMQB 1W00A 1STDA 3FZWA 4AKZA 3I0YA 1NB3I 3JUNA 4HVNA 4LGQA 2OWPA 3EQQB 5AIGA 4HM7B 4N3VA 4N6UA 5ELUA 3X3XA 1MNLA 2SBLA 3DY5A 8CHOA 2OTJ3 4OUQA 1N5HA 2HMKB 5I97A 2CH9A 1QAKA 2HMMB 1GD3A 3KZTA 3I553 3FKAA 4O3VA 3DXOA 1IT7A 2CC3A 2CIUA 3L0RA 3SLUA 1VQ63 1JNQA 2L4VA 1W02A 3CD63 5DREA 1VQO3 1CYVA 1LOXA 3PZWA 3CPW2 4N6MA 4JF8A 5STDA 5AEUB 3EX9A 3K0ZA 1IV7A 1JJ22 4WP5A 1IQYA 1T5YA 2XFSA 2F99A 3SXXA 3B8LA 1GS3A 2FNQA 2JDIH 2GBXB 2BMOB 3G713 1IV9A 1VQM3 5EQLA 3FF2A 1C7HA 2KCDA 5AI1A 1YJN3 5ELJA 5D83A 3LTCA 2CFKA 3EB8A 2XSOB 2W56B 3CNMA 1TIJA 4WWUC 7STDA 2CWUA 1RJOA 5JPPA 1IVWA 3HIGA 2R4IA 5BVBA 3S29A 3AMOB 4G1MB 5AIFA 3LTBA 3F40A 1ROAA 1K28A 4HM1B 3CCS3 3EN1B 4FCZA 2BO9B 3NV0A 2W2CA 3TDGA 3LOYA 4BTWA 3NBJA 3OWSA 3WA3A 4EYCA 1VQ73 1GYBA 1FGTA 2O3OA 1OF5B 3JUQA 4KFFA 2GEXA 1FA3A 3F7XA 4L8OA 1OHPA 3N9HA 3O8YA 4XM4A 4XDWA 3PYJA 1NWWA 3DM8A 1AVLA 4H61A 1E3RA 1K734 4N6OB 5CK6A 2GU1A 2QGUA 5TGNA 1EQKA 2LYXA 3EE1A 3T8NA 6STDA 1O7NB 5KP3A 1VQ43 2I9WA 3G0KA 1N9JA 3E99A 3KIIA 5EVHA 3S5CA 2F98A 3U97A 1FUWA 3F8HA 4EV2A 5LC6A 4RNYA 3OXAA 5AYSC 3CNXA 3CC23 1IK3A 3B4PA 3CC73 3GRDA 3F8XA 1YVBI 1DYUA 1A2KA 4KZ1A 3CCQ3 2BT3A 5IEOA 3U1WA 5IF6A 1W6GA 1CQSA 1JRQA 2BNGA 3MHEA 2F86B 2STDA 2W6JH 3MWZA 2Y74A 5JPUA 1YHQ3 1S5AA 4L7KA 1YI23 1QALA 1KD14 3STDA 2XF3A 1CYUA 4FCMA 3S28A 1KQS2 3OV4A 3NQZA 3NQYA 5DRVA 3V92A 1K9M4 1ULJB 3H3HA 4FMDA 1N8R4 5IG0A 1IDPA 1PU4A 1TFOA 1KC84 3SX1A 2XFTA 3JUOA 1K41A 2CWVA 2RFRA 4R9LA 2HMOB 1VZZA 4KFEA 4ZM8A 1QAFA 2Z6BA 1W2ZA 4FR9A 1YJW3 2CFDA 2D42A 5CXOA 1SJWA 3UL5A 5IENA 3LT9A 1JKGB 2W04A 3Q90A 3NM2A 2P0XA 3NM7A 2ZDJA 4KFDA 1IVXA 3RGRA 3S67A 1DVDA 2P0MA 4FMAA 4K1VA 5LC7A 4WHAA 2PNCA 1TP6A 4Q53A 3T8UA 3X41A 4BTYA 1OCVA 3VSYA 3ECFA 2A15A 1GY7A 3ROBA 4WFOA 3DZLA 1O7GB 1TUHA 2CKFB 5AIIA 1YIT3 1VQ83 4X2HA 2M7OA 3BLZA 5CLKA 4RZMA 3CCV3 3DGMA 3FGYA 4N6NB 1WQLB 4LZIA 1IVUA 1R4CA 2KRTA 2O9UX 1W6YA 1UI8A 3KE7A 4ORLA 4HBRA 3NBBA 3JUMA 3H51A 3UNLA 3PGBA 5IG3A 3FF0A 3A76A 4EXRA 5IG5A 1S723 3MG1A 3MYTA 2XH9A 4HM6B 4HYZA 3KKGA 2K54A 1M1XB 4FCJA 1AVKA 1HU9A 3K9MC 4TX4A 4R1KA 5D82A 1ROVA 2E2VA 3RDEA 1VQ53 1Q814 2ML6A 1NJI4 1SIIA 2B24B 3HK4A 5EEOA 2ML5A 2C11A 4HM0B 1RKYA 3MSOA 1NB5I 2YFLB 1UUWB 1Q40A 3GAXA 3J7Yd 3ER7A 2WGQA 1TU5A 2IA7A 3HX8A 1FGMA 2CW9A 2C10A 4HM2B 3IJEB 1JN5A 2OQEC 5FGOA 2ZL8A 2W03A 2CG1A 1VQN3 4HZ9B 1BUQA 1LXEA 1RRHA 2CG0A 2QIYA 3DGNA 4R4KA 3Q1CA 1W6CA 1YGEA 3EF8A 4LSOA 2XGNA 1STFI 2CK3H 3LZAA 4OVMA 3KN4A 3WODG 4QWTA 3CCJ3 3WOEB 1RN7A 1J2BA 2GEYA 2B1XB 1OHOA 1IQXA 3WA2X 3WDGB 4EV5A 4RBNA 3HIIA 3IPTA 5KP4A 1UUVB 4HM8B 1FGRA 2Y73A 4WYKA 3LYGA 4HKVB 2Q07A 1YIJ3 3MG3A 1JB5A 3EC9A 3QK9A 4MMXB 1TFKA 1SPUA 4STDA 1D6ZA 1KWIA 1E3VA 3CCM3 4OK0A 3FG1A 2XRXB 3D3LA 3MG2A 5AIHA 4GB5A 3BNDA 3DUKA 4L8PA 4RNZA 4EC6A 1OH0A 1Q7Y4 3CC43 3CCR3 1W01A 3NX0A 2WOFA 1AV4A 1GD4A 3BB9A 1Q40B 3GZRA 1IU7A 2INXA 2XEPA 1OGXA 3NV0B 3DGLA 3NUVA 4J8TA 4XBXA 3X3ZA 3I563 3EJVA 3LMLA 3UL6A 2GBWB 1L5GB 1D6YA 3N8BA 1OUNA 4JRFA 4LMIA 1JN5B 1Q824 1DMQA 5G2GA 1Y4KA 2OCTA 2XR8B 3MPHA 1US1A 3G4S3 4CDLA 1DVCA 3UJMA 3PXMA 3CXC2 3N54B 4EBGA 2CFGA 3FCSB 3IMAB 1YJ93 2P05A 3SOYA 5A0OB 1ASKA 1FGQA 2HMLB 1QVF2 4H3UA 3SVAA 2OOVC 3BNEA 3F9SA 2CFLA 1EA2A 3CPOA 3K63A 2W56A 4LEHA 3VGNA 2BHMA 4WYKB 1QVG2 4N6TA 3NBRA 1ISKA 2FGTA 1O7HB 4PEJA 5AYRB 3JVCA 4XDVA 3X42A 2V1LA 3KFQC 4MMZB 4N6LA 1JB4A 1GY6A 1WNHA 5IG4A 3B4OA 3EHCA 4HM3B 3SEDA 1NO3A 4N6V0 2UX0A 2QEX3 3CCU3 4NHFA 2BMRB 2YFIB 2YFJB 3OWYA 4IIAA 3K7CA 3S27A 1OF5A 3PCRA 1FGOA 2RCDA 4K1UA 2CWTA 3FH1A 3GWRA 3KSPA 3JUPA 4NREA 1LNHA 1Q42A 2W0QA 5BXQA 4CCVA 1IQ8A 1A67A 3OWUA 4AKYA 4O2HA 3LTDA 5AEWB 5IEPA 3X40A 3WOFB 1O7WB 1ZX2A 1MOLA 3CCL3 2RGQA 2IUJA 1VQ93 1GY5A 4HJLB 2Z7AA 3D9RA 4HM5B 4O02B 2OQEA 1SQWA 1JV2B 1U8CB 3T0UA 4MJDA 4IT7A 1DMMA 3X3YA 3EN8A 1QJGA 4MEIA 1N5PA 3EBTA 3GZBA 3HI7A 3HZPA 3QRDA 3OX9A 1WMPA 2WO0A 2HMJB 3GZYB 2FXTA 4I4KA 3OW22 1W2B2 2OTL3 5KP1A 2K0MA 2D1WA 4GL6A 3KSED 1N8QA 4K61A 2KXGA 5JBSA 1OGZA 1DMNA 3BNBA 3RGAA 5CF2A 2PZVA 4X2OA 2JQ5A 4J9AA 2XGLA 1HKXA 1G96A 1EKMA 4R9KA 3WMDA 1W5ZA 3DMCA 3F7SA 1PFPA 1M904 2Z77A 1NU3A 1SIHA 1UW1A 1W4NA 3PS8A 3FSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV9 A;  3UL6 A;  5EQL A;  2W9Q A;  5ELJ A;  1TIJ A;  2OCT A;  4N6N B;  1A90 A;  4LZI A;  1DVC A;  1R4C A;  2O9U X;  1M9G A;  3PXM A;  3IMA B;  1ROA A;  5A0O B;  3SVA A;  2BO9 B;  4EYC A;  1FA3 A;  1CEW I;  4N6T A;  3K9M C;  3PYJ A;  4TX4 A;  3KFQ C;  4N6L A;  4N6O B;  1WNH A;  1EQK A;  3LH4 A;  1NB5 I;  4N6V 0;  1N9J A;  3GAX A;  1FUW A;  5LC6 A;  2W9P A;  1YVB I;  4CCV A;  1A67 A;  1LXE A;  3Q2P A;  1MOL A;  1STF I;  3MWZ A;  1RN7 A;  1CYU A;  1NB3 I;  4IT7 A;  1N5P A;  3QRD A;  4N6U A;  5ELU A;  1MNL A;  1N5H A;  2CH9 A;  1GD3 A;  3KSE D;  4ZM8 A;  2KXG A;  3L0R A;  1KWI A;  3UL5 A;  1CYV A;  4N6M A;  1G96 A;  3S67 A;  1DVD A;  1IV7 A;  1PFP A;  5LC7 A;  3NX0 A;  3PS8 A;  1GD4 A; 
#chains in the Genus database with same CATH topology
 1E97 A;  1NDO B;  3VF1 A;  4XBT A;  1W7C A;  1AY7 A;  3PCS A;  3V98 A;  1O7P B;  3CME 3;  1K8A 4;  3B7C A;  4KVH A;  1VQL 3;  2XSH B;  5IER A;  1KSI A;  2W9Q A;  3V99 A;  1RRL A;  1UI7 A;  1X1W A;  2UUG C;  4FMB A;  3CMA 3;  2F56 A;  3URP A;  1A90 A;  4GSP A;  4IPB A;  3LT8 A;  1JKG A;  2RSX A;  1M9G A;  3ALA A;  1G0T A;  1OHS A;  5IW9 A;  1Q86 4;  1FZU A;  1RGG A;  1EG9 B;  1AR0 A;  1IT8 A;  1ZO2 A;  2IUK A;  1VQQ A;  3G6E 3;  3M8C A;  1MWR A;  1BSB A;  4HM4 B;  2F5W A;  1BRG A;  1I0V A;  2WOH A;  5M18 A;  1A2V A;  1N9E A;  1V74 A;  2CFW A;  2H0H A;  3BNC A;  1QMA A;  1OAC A;  2RNT A;  1VQK 3;  1CEW I;  1LVN A;  2E2T A;  5D81 A;  2GXF A;  2IMJ A;  3KCH A;  1LOW A;  4XB5 A;  1IVV A;  4J5G A;  4O8S A;  3NHX A;  1M1K 4;  4U13 A;  1HYF A;  3CCE 3;  2OOV A;  4HZB B;  2GU3 A;  2F4Y A;  5G1K A;  5HGR A;  3FG3 A;  2P38 A;  4FMC A;  3GSP A;  5CF1 A;  1BGS A;  3MKI A;  3F14 A;  3UB1 A;  2CHC A;  3G16 A;  3LH4 A;  1F8N A;  2L1S A;  1JB2 A;  2WGO A;  3AGN A;  3LTA A;  1ULI B;  1D6U A;  1BNJ A;  1T2I A;  1WMN A;  2YX9 A;  1VQP 3;  3FG4 A;  3LXU X;  3GZX B;  3FLJ A;  1UCK A;  1U5O A;  3DGO A;  1WMO A;  3EBY A;  3NXJ A;  1GOV A;  4AEQ A;  2Z76 A;  1WTH A;  1RLS A;  2LQV A;  2W9P A;  4K90 B;  2P09 A;  2HMN B;  4R80 A;  1IYY A;  1OPY A;  2KAA A;  2QA4 3;  3D5I A;  1Z1S A;  3SOA A;  4GHO A;  3Q2P A;  2MF7 A;  1O7M B;  2E2U A;  3AMO A;  4CJN A;  3K5T A;  2MC8 A;  3G8Z A;  4MMY B;  9RNT A;  4XBY A;  7GSP A;  6RNT A;  5FW5 A;  4BTX A;  1JZO A;  3CU3 A;  2BMQ B;  1W00 A;  1STD A;  2ZHX B;  3FZW A;  3A5E A;  4AKZ A;  1MWU A;  1NB3 I;  3I0Y A;  3JUN A;  1B20 A;  4HVN A;  4LGQ A;  2OWP A;  3EQQ B;  5AIG A;  1I3I A;  4HM7 B;  4N3V A;  4N6U A;  5ELU A;  5BU4 A;  3X3X A;  1MNL A;  1LRA A;  1RNB A;  2SBL A;  3DY5 A;  1EEJ A;  8CHO A;  2OTJ 3;  4OUQ A;  1N5H A;  2HMK B;  5I97 A;  2CH9 A;  1QAK A;  2HMM B;  1GD3 A;  1RTU A;  3KZT A;  3I55 3;  3FKA A;  4O3V A;  3DXO A;  1IT7 A;  1FYS A;  1UDI I;  2CC3 A;  2CIU A;  3L0R A;  3SLU A;  1VQ6 3;  4J5K A;  1JNQ A;  2AAE A;  2L4V A;  1JZD A;  4KT3 B;  1BSD A;  1W02 A;  1UGI A;  3CD6 3;  5DRE A;  1Q9E A;  1FUS A;  1X1Y A;  1CYV A;  1VQO 3;  1C54 A;  1LOX A;  3PZW A;  3CPW 2;  4N6M A;  4JF8 A;  5STD A;  5AEU B;  3EX9 A;  3ZG0 A;  3K0Z A;  1IV7 A;  1JJ2 2;  1B2Z A;  4I5Q A;  4WP5 A;  1IQY A;  1T5Y A;  3ZG5 A;  2XFS A;  2BU4 A;  2F99 A;  3SXX A;  3B8L A;  1GS3 A;  1UCL A;  1RCK A;  2FNQ A;  2JDI H;  2GBX B;  2BMO B;  3G71 3;  1IV9 A;  1VQM 3;  5EQL A;  1BSE A;  1C7H A;  2KCD A;  3FF2 A;  5AI1 A;  5ELJ A;  1BRS A;  5D83 A;  1YJN 3;  1B2M A;  3LTC A;  2CFK A;  3EB8 A;  2XSO B;  2W56 B;  3CNM A;  1TIJ A;  4WWU C;  7STD A;  1TTO A;  2CWU A;  1BSA A;  1RJO A;  3AGO A;  5JPP A;  1IVW A;  3HIG A;  1UCI A;  2R4I A;  5BVB A;  3S29 A;  3AMO B;  4G1M B;  5AIF A;  5M1A A;  3LTB A;  3HOH A;  4ILF A;  3F40 A;  1ROA A;  1K28 A;  4HM1 B;  3CCS 3;  3ZFZ A;  3EN1 B;  4EW5 A;  4FCZ A;  1LOV A;  2BO9 B;  3NV0 A;  1BVI A;  2W2C A;  3TDG A;  3LOY A;  4BTW A;  3SYU A;  3NBJ A;  3OWS A;  3WA3 A;  4EYC A;  1VQ7 3;  1B21 A;  1FGT A;  1GYB A;  1RGA A;  1RGL A;  1OF5 B;  2O3O A;  3JUQ A;  4KFF A;  2GEX A;  1ZGX A;  3F7X A;  4L8O A;  5GSP A;  1OHP A;  1FA3 A;  3N9H A;  3O8Y A;  4XM4 A;  4XDW A;  3PYJ A;  1NWW A;  2BIR A;  3DM8 A;  1AVL A;  3D79 A;  4H61 A;  1E3R A;  1K73 4;  4N6O B;  5CK6 A;  2GU1 A;  2QGU A;  1DE3 A;  1BAO A;  5TGN A;  1EQK A;  1BNE A;  2LYX A;  3EE1 A;  3T8N A;  6STD A;  2RBI A;  1O7N B;  5KP3 A;  1VQ4 3;  1BRH A;  2I9W A;  3G0K A;  1N9J A;  3E99 A;  3KII A;  5EVH A;  3S5C A;  1RNT A;  2F98 A;  1I2F A;  3U97 A;  3F8H A;  4EV2 A;  1GMP A;  5LC6 A;  4RNY A;  3OXA A;  5AYS C;  1FUW A;  3CNX A;  3CC2 3;  1UCJ A;  1IK3 A;  3B4P A;  3CC7 3;  3GRD A;  3F8X A;  1YVB I;  1DYU A;  1CH0 A;  1A2K A;  1GMQ A;  4KZ1 A;  3CCQ 3;  1B3S A;  1I3F A;  1BNF A;  2BT3 A;  5IEO A;  3U1W A;  1TJD A;  5IF6 A;  1W6G A;  1CQS A;  1JRQ A;  2BNG A;  3MHE A;  2F86 B;  2STD A;  2W6J H;  3MWZ A;  2Y74 A;  5JPU A;  1YHQ 3;  1S5A A;  4L7K A;  1YI2 3;  1QAL A;  1KD1 4;  1SAR A;  3STD A;  2XF3 A;  1CYU A;  4FCM A;  3D4A A;  3S28 A;  1KQS 2;  3OV4 A;  1PY3 A;  3NQZ A;  3NQY A;  5DRV A;  3V92 A;  1RN4 A;  1ULJ B;  3H3H A;  1K9M 4;  4FMD A;  1UUG B;  1N8R 4;  1BRN L;  5IG0 A;  1IDP A;  1PU4 A;  1TFO A;  1KC8 4;  3SX1 A;  2XFT A;  3JUO A;  1K41 A;  2CWV A;  2RFR A;  4R9L A;  2HMO B;  1VZZ A;  4KFE A;  4ZM8 A;  1QAF A;  2Z6B A;  5M19 A;  1W2Z A;  4FR9 A;  1YJW 3;  2CFD A;  2D42 A;  1RMS A;  1SJW A;  5CXO A;  3UL5 A;  3LT9 A;  5IEN A;  1JKG B;  4BIR A;  2W04 A;  3Q90 A;  3NM2 A;  1BUJ A;  2P0X A;  2ZA4 A;  3NM7 A;  2ZDJ A;  4KFD A;  1IVX A;  3RGR A;  3S67 A;  1DVD A;  1I8V A;  2P0M A;  4FMA A;  4K1V A;  5LC7 A;  4WHA A;  2GSP A;  2PNC A;  1TP6 A;  4Q53 A;  1NNV A;  3T8U A;  3X41 A;  4BTY A;  1OCV A;  3VSY A;  2C4B A;  3ECF A;  2A15 A;  1GY7 A;  3BU4 A;  3ROB A;  4WFO A;  3DZL A;  1O7G B;  1TUH A;  2CKF B;  5AII A;  1RDS A;  1YIT 3;  4BL2 A;  1VQ8 3;  4X2H A;  2M7O A;  3BLZ A;  5CLK A;  1RGF A;  1T3B A;  4RZM A;  3CCV 3;  4BU4 A;  3DGM A;  3FGY A;  4N6N B;  1WQL B;  1JBS A;  4LZI A;  1IVU A;  1R4C A;  1RGH A;  2KRT A;  2O9U X;  1MWT A;  1G02 A;  1UI8 A;  1W6Y A;  1X1X A;  2KF6 A;  3KE7 A;  4ORL A;  1I70 A;  4HBR A;  2K3D A;  3NBB A;  3JUM A;  2H0G A;  3H51 A;  3UNL A;  3PGB A;  5IG3 A;  3FF0 A;  1R4Y A;  3A76 A;  4EXR A;  5IG5 A;  1S72 3;  3MG1 A;  3MYT A;  2XH9 A;  4HM6 B;  4HYZ A;  3KKG A;  2K54 A;  1EUI C;  1FW7 A;  1BIR A;  2CX1 A;  1M1X B;  4FCJ A;  1AVK A;  1HU9 A;  3AHS A;  3K9M C;  4R1K A;  4TX4 A;  5D82 A;  1ROV A;  2E2V A;  3RDE A;  1VQ5 3;  1RN1 A;  2ML6 A;  1Q81 4;  1SII A;  2B24 B;  1NJI 4;  3HK4 A;  5EEO A;  2ML5 A;  1RCL A;  2C11 A;  2UGI A;  4NPB A;  4HM0 B;  5BIR A;  1RKY A;  3MSO A;  1UGH I;  1NB5 I;  2YFL B;  1UUW B;  1Q40 A;  3GAX A;  3J7Y d;  3ER7 A;  2WGQ A;  1TU5 A;  1LQM B;  1AQZ A;  2IA7 A;  3HX8 A;  1FGM A;  2KF4 A;  2CW9 A;  2C10 A;  4HM2 B;  3IJE B;  1JN5 A;  2OQE C;  5FGO A;  2ZL8 A;  1GMR A;  2W03 A;  2CG1 A;  1B2S A;  1YGW A;  4HZ9 B;  1VQN 3;  1JBR A;  1BUQ A;  1LXE A;  1RRH A;  4DKI A;  2CG0 A;  2QIY A;  3DGN A;  4R4K A;  3Q1C A;  1W6C A;  1YGE A;  3EF8 A;  4LSO A;  2XGN A;  1STF I;  2CK3 H;  1RSN A;  3LZA A;  3D5G A;  4OVM A;  3KN4 A;  3WOD G;  4QWT A;  3CCJ 3;  3WOE B;  1RN7 A;  1J2B A;  2GEY A;  2B1X B;  1OHO A;  1TRQ A;  1IQX A;  1X1U A;  3WA2 X;  1I2E A;  3WDG B;  5HOH A;  1LQG C;  4EV5 A;  4RBN A;  3WR2 A;  3HII A;  3IPT A;  5RNT A;  5KP4 A;  1GSP A;  1UUV B;  4HM8 B;  2F5M A;  1FGR A;  2Y73 A;  1A2P A;  4WYK A;  3LYG A;  4HKV B;  2Q07 A;  1YIJ 3;  2KF3 A;  1JB5 A;  3EC9 A;  3MG3 A;  3QK9 A;  4MMX B;  1TFK A;  1SPU A;  4STD A;  1MGR A;  1D6Z A;  1KWI A;  2KF5 A;  1DET A;  1E3V A;  3RNT A;  4OK0 A;  3FG1 A;  3CCM 3;  2XRX B;  3D3L A;  3MG2 A;  5AIH A;  4GB5 A;  3BND A;  3DUK A;  4L8P A;  4RNZ A;  4EC6 A;  1OH0 A;  1FUT A;  1Q7Y 4;  3CC4 3;  3CCR 3;  1W01 A;  3NX0 A;  1AV4 A;  2WOF A;  1GD4 A;  3BB9 A;  1Q40 B;  3GZR A;  1IU7 A;  2INX A;  2XEP A;  4HOH A;  1OGX A;  3NV0 B;  3DGL A;  3NUV A;  4J8T A;  4XBX A;  3X3Z A;  3I56 3;  3EJV A;  3LML A;  3UL6 A;  1BRK A;  2GBW B;  1L5G B;  1D6Y A;  2CX0 A;  1OUN A;  3N8B A;  4JRF A;  4LMI A;  1JN5 B;  1Q82 4;  1DMQ A;  5G2G A;  1Y4K A;  2IY2 A;  2OCT A;  2XR8 B;  3MPH A;  1US1 A;  3G4S 3;  4CDL A;  1DVC A;  1I0X A;  3UJM A;  3DH2 A;  3PXM A;  3CXC 2;  3N54 B;  1YVS A;  4EBG A;  2CFG A;  3FCS B;  3IMA B;  1YJ9 3;  1BSC A;  1BNS A;  2P05 A;  3SOY A;  1BAN A;  1ASK A;  1FGQ A;  2HML B;  1BRJ A;  5A0O B;  4H3U A;  3SVA A;  1QVF 2;  1HZ1 A;  2OOV C;  3BNE A;  3F9S A;  2CFL A;  4RNT A;  1ZS7 A;  1B2X A;  1EA2 A;  3CPO A;  8RNT A;  3K63 A;  1MGW A;  2W56 A;  4LEH A;  1BNR A;  2SAR A;  3VGN A;  2BHM A;  4WYK B;  1QVG 2;  4N6T A;  3NBR A;  1ISK A;  1BU4 A;  1O7H B;  2FGT A;  3DGY A;  4PEJ A;  5G1L A;  5AYR B;  3JVC A;  4XDV A;  3X42 A;  2V1L A;  1RGK A;  3KFQ C;  4HAA A;  4MMZ B;  1JB4 A;  4N6L A;  1GY6 A;  1WNH A;  5IG4 A;  6GSP A;  1T2H A;  3B4O A;  3EHC A;  4HM3 B;  1BNI A;  3SED A;  3FSD A;  1NO3 A;  4N6V 0;  1JBT A;  1GOU A;  2UX0 A;  2QEX 3;  1B2U A;  4NHF A;  2BMR B;  2YFI B;  3CCU 3;  2YFJ B;  3OWY A;  4IIA A;  3K7C A;  3S27 A;  1YNV X;  1OF5 A;  3PCR A;  1FGO A;  2RCD A;  4K1U A;  1Q7H A;  2CWT A;  3FH1 A;  3GWR A;  3KSP A;  3JUP A;  4NRE A;  1LNH A;  2AAD A;  1Q42 A;  2W0Q A;  5BXQ A;  4CCV A;  1IQ8 A;  1A67 A;  1RGC A;  2H0I A;  3OWU A;  1B27 A;  4BL3 A;  4AKY A;  4O2H A;  3LTD A;  5AEW B;  5IEP A;  1GOY A;  3X40 A;  3WOF B;  1LOY A;  7RNT A;  1O7W B;  1ZX2 A;  1MOL A;  1V58 A;  3CCL 3;  2RGQ A;  2IUJ A;  1RHL A;  1VQ9 3;  1GY5 A;  4HJL B;  1V57 A;  2Z7A A;  3D9R A;  4HM5 B;  4O02 B;  2OQE A;  1SQW A;  1JV2 B;  1U8C B;  3T0U A;  1BOX A;  4MJD A;  4IT7 A;  1DMM A;  3X3Y A;  3EN8 A;  1QJG A;  3AHW A;  4MEI A;  1N5P A;  3EBT A;  3GZB A;  3HI7 A;  2R41 A;  3HZP A;  3QRD A;  3OX9 A;  1WMP A;  4CPK A;  2WO0 A;  2HMJ B;  3GZY B;  1RGE A;  2IYJ A;  3BIR A;  2FXT A;  2J8X B;  4I4K A;  3OW2 2;  1W2B 2;  2HOH A;  2OTL 3;  5KP1 A;  2K0M A;  2D1W A;  4GL6 A;  1MWS A;  3KSE D;  1N8Q A;  4K61 A;  1I2G A;  2KXG A;  1TRP A;  5JBS A;  1OGZ A;  1DMN A;  3BNB A;  3RGA A;  5CF2 A;  2PZV A;  4X2O A;  2JQ5 A;  4J9A A;  1BRI A;  1PYL A;  2XGL A;  1HKX A;  4LYL B;  3Q3F A;  1G96 A;  1EKM A;  4R9K A;  3WMD A;  1W5Z A;  3DMC A;  3F7S A;  1LNI A;  1PFP A;  3WHO A;  2Z77 A;  1NU3 A;  1W4N A;  1SIH A;  1UW1 A;  1M90 4;  3PS8 A;  1BNG A; 
#chains in the Genus database with same CATH homology
 1E97 A;  1NDO B;  3VF1 A;  4XBT A;  1W7C A;  3PCS A;  3V98 A;  1O7P B;  3CME 3;  1K8A 4;  3B7C A;  4KVH A;  1VQL 3;  2XSH B;  5IER A;  1KSI A;  2W9Q A;  3V99 A;  1RRL A;  1UI7 A;  4FMB A;  3CMA 3;  1A90 A;  4IPB A;  3LT8 A;  1JKG A;  2RSX A;  1M9G A;  3ALA A;  1OHS A;  5IW9 A;  1Q86 4;  1EG9 B;  1AR0 A;  1IT8 A;  1ZO2 A;  2IUK A;  3G6E 3;  3M8C A;  4HM4 B;  2WOH A;  1A2V A;  1N9E A;  1V74 A;  2CFW A;  3BNC A;  1QMA A;  1OAC A;  1VQK 3;  1CEW I;  1LVN A;  2E2T A;  5D81 A;  2GXF A;  2IMJ A;  4XB5 A;  1IVV A;  1M1K 4;  4O8S A;  3NHX A;  4U13 A;  3CCE 3;  2OOV A;  4HZB B;  2GU3 A;  5HGR A;  3FG3 A;  2P38 A;  4FMC A;  5CF1 A;  3MKI A;  3F14 A;  3UB1 A;  2CHC A;  3G16 A;  3LH4 A;  1F8N A;  2WGO A;  1JB2 A;  3LTA A;  1ULI B;  1D6U A;  1WMN A;  2YX9 A;  1VQP 3;  3FG4 A;  3LXU X;  3GZX B;  3FLJ A;  3DGO A;  1U5O A;  1WMO A;  3EBY A;  3NXJ A;  4AEQ A;  2Z76 A;  1WTH A;  2LQV A;  2W9P A;  4K90 B;  2P09 A;  2HMN B;  4R80 A;  1OPY A;  2QA4 3;  1Z1S A;  3SOA A;  3Q2P A;  2MF7 A;  1O7M B;  3AMO A;  2E2U A;  3K5T A;  2MC8 A;  3G8Z A;  4MMY B;  4XBY A;  5FW5 A;  4BTX A;  3CU3 A;  2BMQ B;  1W00 A;  1STD A;  3FZW A;  4AKZ A;  3I0Y A;  1NB3 I;  3JUN A;  4HVN A;  4LGQ A;  2OWP A;  3EQQ B;  5AIG A;  4HM7 B;  4N3V A;  4N6U A;  5ELU A;  3X3X A;  1MNL A;  2SBL A;  3DY5 A;  8CHO A;  2OTJ 3;  4OUQ A;  1N5H A;  2HMK B;  5I97 A;  2CH9 A;  1QAK A;  2HMM B;  1GD3 A;  3KZT A;  3I55 3;  3FKA A;  4O3V A;  3DXO A;  1IT7 A;  2CC3 A;  2CIU A;  3L0R A;  3SLU A;  1VQ6 3;  1JNQ A;  2L4V A;  1W02 A;  3CD6 3;  5DRE A;  1VQO 3;  1CYV A;  1LOX A;  3PZW A;  3CPW 2;  4N6M A;  4JF8 A;  5STD A;  5AEU B;  3EX9 A;  3K0Z A;  1IV7 A;  1JJ2 2;  4WP5 A;  1IQY A;  1T5Y A;  2XFS A;  2F99 A;  3SXX A;  3B8L A;  1GS3 A;  2FNQ A;  2JDI H;  2GBX B;  2BMO B;  3G71 3;  1IV9 A;  1VQM 3;  5EQL A;  3FF2 A;  1C7H A;  2KCD A;  5AI1 A;  1YJN 3;  5ELJ A;  5D83 A;  3LTC A;  2CFK A;  3EB8 A;  2XSO B;  2W56 B;  3CNM A;  1TIJ A;  4WWU C;  7STD A;  2CWU A;  1RJO A;  5JPP A;  1IVW A;  3HIG A;  2R4I A;  5BVB A;  3S29 A;  3AMO B;  4G1M B;  5AIF A;  3LTB A;  3F40 A;  1ROA A;  1K28 A;  4HM1 B;  3CCS 3;  3EN1 B;  4FCZ A;  2BO9 B;  3NV0 A;  2W2C A;  3TDG A;  3LOY A;  4BTW A;  3NBJ A;  3OWS A;  3WA3 A;  4EYC A;  1VQ7 3;  1GYB A;  1FGT A;  2O3O A;  1OF5 B;  3JUQ A;  4KFF A;  2GEX A;  1FA3 A;  3F7X A;  4L8O A;  1OHP A;  3N9H A;  3O8Y A;  4XM4 A;  4XDW A;  3PYJ A;  1NWW A;  3DM8 A;  1AVL A;  4H61 A;  1E3R A;  1K73 4;  4N6O B;  5CK6 A;  2GU1 A;  2QGU A;  5TGN A;  1EQK A;  2LYX A;  3EE1 A;  3T8N A;  6STD A;  1O7N B;  5KP3 A;  1VQ4 3;  2I9W A;  3G0K A;  1N9J A;  3E99 A;  3KII A;  5EVH A;  3S5C A;  2F98 A;  3U97 A;  1FUW A;  3F8H A;  4EV2 A;  5LC6 A;  4RNY A;  3OXA A;  5AYS C;  3CNX A;  3CC2 3;  1IK3 A;  3B4P A;  3CC7 3;  3GRD A;  3F8X A;  1YVB I;  1DYU A;  1A2K A;  4KZ1 A;  3CCQ 3;  2BT3 A;  5IEO A;  3U1W A;  5IF6 A;  1W6G A;  1CQS A;  1JRQ A;  2BNG A;  3MHE A;  2F86 B;  2STD A;  2W6J H;  3MWZ A;  2Y74 A;  5JPU A;  1YHQ 3;  1S5A A;  4L7K A;  1YI2 3;  1QAL A;  1KD1 4;  3STD A;  2XF3 A;  1CYU A;  4FCM A;  3S28 A;  1KQS 2;  3OV4 A;  3NQZ A;  3NQY A;  5DRV A;  3V92 A;  1K9M 4;  1ULJ B;  3H3H A;  4FMD A;  1N8R 4;  5IG0 A;  1IDP A;  1PU4 A;  1TFO A;  1KC8 4;  3SX1 A;  2XFT A;  3JUO A;  1K41 A;  2CWV A;  2RFR A;  4R9L A;  2HMO B;  1VZZ A;  4KFE A;  4ZM8 A;  1QAF A;  2Z6B A;  1W2Z A;  4FR9 A;  1YJW 3;  2CFD A;  2D42 A;  5CXO A;  1SJW A;  3UL5 A;  5IEN A;  3LT9 A;  1JKG B;  2W04 A;  3Q90 A;  3NM2 A;  2P0X A;  3NM7 A;  2ZDJ A;  4KFD A;  1IVX A;  3RGR A;  3S67 A;  1DVD A;  2P0M A;  4FMA A;  4K1V A;  5LC7 A;  4WHA A;  2PNC A;  1TP6 A;  4Q53 A;  3T8U A;  3X41 A;  4BTY A;  1OCV A;  3VSY A;  3ECF A;  2A15 A;  1GY7 A;  3ROB A;  4WFO A;  3DZL A;  1O7G B;  1TUH A;  2CKF B;  5AII A;  1YIT 3;  1VQ8 3;  4X2H A;  2M7O A;  3BLZ A;  5CLK A;  4RZM A;  3CCV 3;  3DGM A;  3FGY A;  4N6N B;  1WQL B;  4LZI A;  1IVU A;  1R4C A;  2KRT A;  2O9U X;  1W6Y A;  1UI8 A;  3KE7 A;  4ORL A;  4HBR A;  3NBB A;  3JUM A;  3H51 A;  3UNL A;  3PGB A;  5IG3 A;  3FF0 A;  3A76 A;  4EXR A;  5IG5 A;  1S72 3;  3MG1 A;  3MYT A;  2XH9 A;  4HM6 B;  4HYZ A;  3KKG A;  2K54 A;  1M1X B;  4FCJ A;  1AVK A;  1HU9 A;  3K9M C;  4TX4 A;  4R1K A;  5D82 A;  1ROV A;  2E2V A;  3RDE A;  1VQ5 3;  1Q81 4;  2ML6 A;  1NJI 4;  1SII A;  2B24 B;  3HK4 A;  5EEO A;  2ML5 A;  2C11 A;  4HM0 B;  1RKY A;  3MSO A;  1NB5 I;  2YFL B;  1UUW B;  1Q40 A;  3GAX A;  3J7Y d;  3ER7 A;  2WGQ A;  1TU5 A;  2IA7 A;  3HX8 A;  1FGM A;  2CW9 A;  2C10 A;  4HM2 B;  3IJE B;  1JN5 A;  2OQE C;  5FGO A;  2ZL8 A;  2W03 A;  2CG1 A;  1VQN 3;  4HZ9 B;  1BUQ A;  1LXE A;  1RRH A;  2CG0 A;  2QIY A;  3DGN A;  4R4K A;  3Q1C A;  1W6C A;  1YGE A;  3EF8 A;  4LSO A;  2XGN A;  1STF I;  2CK3 H;  3LZA A;  4OVM A;  3KN4 A;  3WOD G;  4QWT A;  3CCJ 3;  3WOE B;  1RN7 A;  1J2B A;  2GEY A;  2B1X B;  1OHO A;  1IQX A;  3WA2 X;  3WDG B;  4EV5 A;  4RBN A;  3HII A;  3IPT A;  5KP4 A;  1UUV B;  4HM8 B;  1FGR A;  2Y73 A;  4WYK A;  3LYG A;  4HKV B;  2Q07 A;  1YIJ 3;  3MG3 A;  1JB5 A;  3EC9 A;  3QK9 A;  4MMX B;  1TFK A;  1SPU A;  4STD A;  1D6Z A;  1KWI A;  1E3V A;  3CCM 3;  4OK0 A;  3FG1 A;  2XRX B;  3D3L A;  3MG2 A;  5AIH A;  4GB5 A;  3BND A;  3DUK A;  4L8P A;  4RNZ A;  4EC6 A;  1OH0 A;  1Q7Y 4;  3CC4 3;  3CCR 3;  1W01 A;  3NX0 A;  2WOF A;  1AV4 A;  1GD4 A;  3BB9 A;  1Q40 B;  3GZR A;  1IU7 A;  2INX A;  2XEP A;  1OGX A;  3NV0 B;  3DGL A;  3NUV A;  4J8T A;  4XBX A;  3X3Z A;  3I56 3;  3EJV A;  3LML A;  3UL6 A;  2GBW B;  1L5G B;  1D6Y A;  3N8B A;  1OUN A;  4JRF A;  4LMI A;  1JN5 B;  1Q82 4;  1DMQ A;  5G2G A;  1Y4K A;  2OCT A;  2XR8 B;  3MPH A;  1US1 A;  3G4S 3;  4CDL A;  1DVC A;  3UJM A;  3PXM A;  3CXC 2;  3N54 B;  4EBG A;  2CFG A;  3FCS B;  3IMA B;  1YJ9 3;  2P05 A;  3SOY A;  5A0O B;  1ASK A;  1FGQ A;  2HML B;  1QVF 2;  4H3U A;  3SVA A;  2OOV C;  3BNE A;  3F9S A;  2CFL A;  1EA2 A;  3CPO A;  3K63 A;  2W56 A;  4LEH A;  3VGN A;  2BHM A;  4WYK B;  1QVG 2;  4N6T A;  3NBR A;  1ISK A;  2FGT A;  1O7H B;  4PEJ A;  5AYR B;  3JVC A;  4XDV A;  3X42 A;  2V1L A;  3KFQ C;  4MMZ B;  4N6L A;  1JB4 A;  1GY6 A;  1WNH A;  5IG4 A;  3B4O A;  3EHC A;  4HM3 B;  3SED A;  1NO3 A;  4N6V 0;  2UX0 A;  2QEX 3;  3CCU 3;  4NHF A;  2BMR B;  2YFI B;  2YFJ B;  3OWY A;  4IIA A;  3K7C A;  3S27 A;  1OF5 A;  3PCR A;  1FGO A;  2RCD A;  4K1U A;  2CWT A;  3FH1 A;  3GWR A;  3KSP A;  3JUP A;  4NRE A;  1LNH A;  1Q42 A;  2W0Q A;  5BXQ A;  4CCV A;  1IQ8 A;  1A67 A;  3OWU A;  4AKY A;  4O2H A;  3LTD A;  5AEW B;  5IEP A;  3X40 A;  3WOF B;  1O7W B;  1ZX2 A;  1MOL A;  3CCL 3;  2RGQ A;  2IUJ A;  1VQ9 3;  1GY5 A;  4HJL B;  2Z7A A;  3D9R A;  4HM5 B;  4O02 B;  2OQE A;  1SQW A;  1JV2 B;  1U8C B;  3T0U A;  4MJD A;  4IT7 A;  1DMM A;  3X3Y A;  3EN8 A;  1QJG A;  4MEI A;  1N5P A;  3EBT A;  3GZB A;  3HI7 A;  3HZP A;  3QRD A;  3OX9 A;  1WMP A;  2WO0 A;  2HMJ B;  3GZY B;  2FXT A;  4I4K A;  3OW2 2;  1W2B 2;  2OTL 3;  5KP1 A;  2K0M A;  2D1W A;  4GL6 A;  3KSE D;  1N8Q A;  4K61 A;  2KXG A;  5JBS A;  1OGZ A;  1DMN A;  3BNB A;  3RGA A;  5CF2 A;  2PZV A;  4X2O A;  2JQ5 A;  4J9A A;  2XGL A;  1HKX A;  1G96 A;  1EKM A;  4R9K A;  3WMD A;  1W5Z A;  3DMC A;  3F7S A;  1PFP A;  1M90 4;  2Z77 A;  1NU3 A;  1SIH A;  1UW1 A;  1W4N A;  3PS8 A;  3FSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...