1DVCA

Solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease inhibitor
molecule keywords STEFIN A
publication title The three-dimensional solution structure of human stefin A.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dvcA00
1NB3I 2W9PA 4IT7A 3Q2PA 4ZM8A 3MWZA 3PXMA 1EQKA 1NB5I 1YVBI 1GD4A 1A90A 1G96A 1DVCA 4LZIA 1IV9A 3PS8A 4CCVA 2OCTA 4N6NB 1LXEA 3SVAA 1N5PA 5LC6A 2CH9A 2O9UX 1CYUA 1TIJA 1ROAA 4EYCA 1RN7A 3UL5A 1M9GA 3L0RA 5LC7A 1KWIA 4N6OB 1GD3A 5ELJA 3KSED 2BO9B 3KFQC 1WNHA 3LH4A 3IMAB 5ELUA 3QRDA 3UL6A 1PFPA 1CYVA 5EQLA 1A67A 3K9MC 1R4CA 2KXGA 1FUWA 3PYJA 1STFI 3S67A 3GAXA 1MOLA 4N6LA 4N6V0 5A0OB 1MNLA 3NX0A 2W9QA 1DVDA 1IV7A 1FA3A 1CEWI 4N6MA 1N9JA 1N5HA 4N6TA 4N6UA 4TX4A
chains in the Genus database with same CATH superfamily
1Q824 1BAOA 1UGIA 2P0XA 4HM5B 3I553 4HM3B 4IT7A 2RGQA 4WYKA 3K7CA 3MWZA 3S28A 1YIT3 3V99A 1BNSA 1R4YA 4HM2B 1NU3A 2I9WA 2IA7A 1FYSA 3CCR3 1OCVA 1M1K4 3HOHA 2HMNB 5EEOA 2CX1A 4GHOA 1VQ83 2W56A 1RCKA 2B24B 3WODG 1RDSA 4AEQA 2ML6A 3K0ZA 4XB5A 1LNHA 3T8NA 3HZPA 4EBGA 1GD4A 1YHQ3 3S5CA 1AQZA 1RNBA 4K1UA 1A90A 3ZG5A 1SPUA 1Y4KA 3NQYA 2Z76A 1OPYA 3JUPA 3PGBA 1LNIA 1W7CA 4BL2A 1BRKA 3F7XA 3EF8A 1K8A4 1RRHA 3DGLA 1LOXA 3RNTA 1QVG2 1PYLA 1LOYA 1UI8A 2GBXB 3FG4A 2RCDA 4HM0B 2GSPA 1ZGXA 1G02A 1YVSA 2CFDA 2O9UX 2RNTA 4BTYA 1VZZA 3EBYA 3SYUA 4BU4A 2ML5A 4MMZB 5M18A 1EEJA 1OGXA 3LTAA 2B1XB 1RGHA 1RN7A 1W2B2 3A5EA 1M9GA 1MWTA 3MG3A 4G1MB 4LMIA 3ZFZA 3CCM3 3KSED 1LRAA 2K3DA 2WGOA 3KFQC 1RGAA 1I8VA 1QJGA 1UGHI 1WNHA 4HZBB 3ER7A 3Q3FA 5AIGA 3IMAB 1KD14 1IT7A 5STDA 1MWSA 2M7OA 1RGCA 4I5QA 3D5IA 2GXFA 4IPBA 1B3SA 4L8OA 1NO3A 1TUHA 2HMLB 1I0XA 2CWUA 2HMKB 4HM4B 4KFDA 1B2MA 1C54A 5IG5A 4J8TA 1T5YA 2INXA 2YFLB 5AIFA 4BTXA 3DGOA 1X1UA 2XRXB 3NUVA 1RHLA 1YJW3 3NQZA 4O3VA 5EQLA 3F9SA 1YJ93 2XGNA 3MG2A 1W5ZA 5FW5A 1O7MB 3CCQ3 3BNEA 1QAFA 3B4PA 3PCSA 4RNYA 1RNTA 2ZL8A 3GZXB 1I3IA 1K734 2Y74A 2KF4A 3OWUA 3DM8A 3PYJA 1A2PA 1BSDA 3S67A 3D5GA 4O02B 4KT3B 1EA2A 1I0VA 1B2ZA 4X2OA 1UCIA 1RCLA 3NV0B 1D6UA 1RJOA 2L1SA 1MOLA 2ZDJA 3EE1A 7RNTA 3LTDA 1AR0A 1LQMB 4HZ9B 5HOHA 3N9HA 3G8ZA 5IF6A 4OUQA 1I2EA 2V1LA 3KE7A 3ALAA 5KP4A 3D9RA 3NX0A 1YJN3 1EUIC 2KAAA 1HZ1A 4WYKB 1K28A 1DVDA 1YGWA 2WO0A 1CH0A 3SEDA 4J5GA 1E3VA 3KKGA 4I4KA 2YFJB 1OHPA 2OTL3 3FG3A 4EXRA 5AEWB 3N54B 1UCLA 1QMAA 4MMYB 1X1WA 2XF3A 4HKVB 1JZDA 1Q40B 3Q90A 4GL6A 2W9PA 3HIGA 5AYRB 1GY7A 1RN4A 3AHSA 3Q2PA 3CME3 4L7KA 1OHOA 1O7PB 1IVUA 1VQQA 4HM6B 3TDGA 1V74A 2SARA 2ZHXB 4ZM8A 3G6E3 1PY3A 1BVIA 2R41A 3SLUA 1DETA 3HX8A 3UJMA 4XBXA 1IU7A 3PXMA 1MGRA 5AI1A 1TRQA 1ZX2A 2JQ5A 2ZA4A 1EQKA 3NBBA 3CXC2 1MGWA 2P0MA 1GMPA 1YVBI 1O7HB 3ECFA 4QWTA 5AIIA 1QALA 3HIIA 3UNLA 1BU4A 1W01A 1NWWA 1DMQA 4HAAA 9RNTA 3CC23 4O2HA 2W2CA 3M8CA 2A15A 3OW22 1U5OA 2H0IA 1DVCA 3URPA 4IIAA 4LGQA 1T3BA 1EG9B 1Z1SA 1JB5A 1HU9A 1IQYA 2H0HA 3D3LA 4N6NB 5D81A 1IVWA 1Q42A 4GB5A 3EHCA 1JNQA 1LXEA 2E2VA 3SVAA 3X3ZA 2XGLA 3D4AA 1I70A 3K63A 5JPUA 1X1XA 2K0MA 5LC6A 1IQXA 1GOVA 3UB1A 1CYUA 2MF7A 3BIRA 3CCS3 1FGTA 4NHFA 3LOYA 2CKFB 1BSAA 2K54A 3FF0A 1BRGA 1WMPA 4EYCA 5G1KA 4FR9A 2W0QA 3L0RA 1JBSA 5LC7A 3GZYB 1BRHA 2BIRA 2QIYA 3B8LA 3BNBA 3MSOA 1V57A 1N8QA 3O8YA 2Q07A 5ELJA 3RGAA 3SXXA 2F4YA 2QEX3 1FGOA 1Q40A 1RMSA 1WQLB 1T2IA 4H3UA 3CCJ3 1FGRA 2GEXA 1BSBA 1KC84 2P05A 3MHEA 1O7GB 1OACA 3NM7A 4MMXB 2CFGA 1S5AA 1Q7HA 2HMMB 1LQGC 2CWVA 5CK6A 2XEPA 3G713 1GS3A 1E97A 1W02A 4FCMA 3LYGA 1BUJA 4EW5A 1RKYA 2CG0A 1CYVA 1BANA 5I97A 1BOXA 3CC73 3PCRA 5BU4A 1VQ53 2HMJB 3F40A 3CCU3 4U13A 1R4CA 2Z6BA 4RNTA 3RGRA 1FUWA 2BU4A 1BSCA 1A2KA 1JRQA 1STFI 1D6ZA 4HJLB 1ULJB 4RBNA 3GAXA 2BT3A 4MJDA 5KP3A 1TFOA 1VQ73 1VQL3 3CCE3 1LVNA 5IG3A 2P09A 4N6LA 3WMDA 2Z7AA 4KFEA 4N6V0 1K9M4 3CPOA 5AIHA 3V92A 1E3RA 3E99A 1MNLA 1FZUA 1B2SA 1UI7A 4FMAA 4RZMA 5BIRA 1RGEA 2STDA 1SQWA 2YX9A 2IUJA 2CFWA 3NBJA 1VQ43 2BMOB 2GU1A 3OXAA 2CFLA 2O3OA 1N9EA 6GSPA 1RRLA 1FA3A 3LTCA 1VQP3 3DZLA 3JUQA 1X1YA 3JUNA 5IENA 3DY5A 4HM7B 1JJ22 1BSEA 3GSPA 3BLZA 4WHAA 1TU5A 1TTOA 1RSNA 1B2XA 4N3VA 1OHSA 2KF5A 4WFOA 1BGSA 4TX4A 1UW1A 1NB3I 2IYJA 1KSIA 1QVF2 3WA3A 6RNTA 3RDEA 3FSDA 1DMMA 1T2HA 3BNDA 4HYZA 3KSPA 4EV5A 4K90B 5EVHA 1B2UA 2F99A 3G4S3 3LT9A 2C4BA 2IY2A 3JUOA 2UGIA 4OK0A 3WOEB 3CD63 2FNQA 3T8UA 1DE3A 3AGNA 3F7SA 2OQEA 2YFIB 3FG1A 3I0YA 3WDGB 2PZVA 1FUSA 1JN5B 1YNVX 1G96A 3EBTA 4XM4A 3FLJA 2OTJ3 1UUGB 3J7Yd 2F98A 2R4IA 4FCJA 2J8XB 3U97A 3X42A 2OWPA 2PNCA 4HVNA 1VQ63 4LEHA 2RFRA 1GOUA 1GY5A 3DH2A 1ASKA 1N5PA 1IQ8A 3X41A 4JRFA 1RLSA 4FMCA 2F5WA 4K61A 3NXJA 3IPTA 1FGQA 1OGZA 3MYTA 2F56A 3ROBA 3T0UA 1J2BA 1WMOA 1TIJA 3MPHA 1ROAA 1SIHA 1N8R4 1YIJ3 1SARA 5JBSA 1BNGA 1KWIA 2H0GA 2IMJA 4N6OB 1GD3A 3X3YA 2UX0A 2AADA 1W2ZA 5DRVA 2BO9B 3Q1CA 3KN4A 2CK3H 2CHCA 1DYUA 2SBLA 3AMOB 5DREA 5RNTA 3OWYA 3JUMA 2CG1A 3NHXA 8RNTA 2BNGA 5ELUA 4ORLA 1IVXA 3KCHA 2CFKA 4L8PA 3S27A 3DGMA 1KQS2 1OF5A 3UL6A 2BMRB 1BRJA 4OVMA 1PFPA 1RGFA 1US1A 2HMOB 2CX0A 4NPBA 3LTBA 2RSXA 5AEUB 3F8HA 4KVHA 1LOWA 1FUTA 1JN5A 3K9MC 1WMNA 2FXTA 4STDA 2OOVA 2F5MA 1O7WB 2KXGA 3SX1A 2FGTA 4H61A 2D1WA 3MKIA 1GOYA 4PEJA 3DUKA 3F8XA 4HOHA 3CMA3 1I2GA 1JZOA 2GEYA 3BB9A 3AGOA 2C11A 3FF2A 2BHMA 1ISKA 5JPPA 5FGOA 1STDA 2CIUA 1TFKA 5D83A 2BMQB 3PZWA 2D42A 4WP5A 4DKIA 3BNCA 5CLKA 2UUGC 2XH9A 2QA43 4GSPA 4XDVA 1Q9EA 3CCV3 2W9QA 5IW9A 3EJVA 3ZG0A 1GMRA 5BXQA 2KCDA 3OX9A 4FCZA 4Q53A 1VQ93 5IEOA 1TRPA 3VSYA 1VQM3 3FH1A 3AMOA 3CNXA 4R9KA 4XDWA 1CEWI 1RGLA 5D82A 1VQO3 1N5HA 4BL3A 4R4KA 5M1AA 3OV4A 2WOHA 1B20A 1I3FA 3CCL3 1JB4A 3STDA 4NREA 4HM1B 3DXOA 4AKZA 3GZRA 3B7CA 3KZTA 1RN1A 3LT8A 5IG4A 4R1KA 1UUWB 3HK4A 4AKYA 6STDA 1CQSA 1W00A 2E2UA 2Z77A 3DGNA 3DGYA 2JDIH 3WHOA 1GY6A 2Y73A 1RGKA 5CF1A 3GRDA 3EN1B 3FZWA 3EQQB 1YI23 1UCJA 2XSOB 2W04A 1NB5I 1NNVA 1W4NA 2QGUA 2KF3A 2LYXA 3HI7A 1IK3A 2KF6A 4MEIA 1IVVA 4O8SA 1A2VA 4K1VA 5BVBA 1AVKA 3NBRA 3G16A 4LSOA 3VGNA 3LXUX 1ROVA 1IV9A 4LZIA 5G1LA 5TGNA 1L5GB 3PS8A 5KP1A 3FKAA 4CCVA 2OCTA 4XBTA 4CJNA 1JKGB 1S723 1BIRA 1BNFA 1MWUA 1M1XB 1UDII 5GSPA 1BNRA 1IYYA 3OWSA 4X2HA 7GSPA 1OH0A 1AY7A 2P38A 5CF2A 4FMBA 2CH9A 2HOHA 4J9AA 4R9LA 2CC3A 2XSHB 4BIRA 1IT8A 1NDOB 1OF5B 2OQEC 1SJWA 1IDPA 4RNZA 4CDLA 3I563 1BNIA 1YGEA 4XBYA 1EKMA 3UL5A 1W6CA 2W6JH 1SIIA 2IUKA 2WGQA 1B27A 1WTHA 1F8NA 1U8CB 2RBIA 3SOYA 1W6YA 3BU4A 4J5KA 3V98A 3JVCA 8CHOA 1GMQA 4LYLB 1O7NB 3AHWA 3EB8A 3K5TA 3D79A 1HKXA 4KFFA 1GYBA 1QAKA 3LH4A 4WWUC 3CC43 3H3HA 3LMLA 1AVLA 2CWTA 3EX9A 3H51A 1I2FA 3EN8A 3N8BA 2WOFA 3QRDA 1BNJA 1RTUA 3B4OA 3VF1A 4JF8A 1TP6A 2CW9A 1JB2A 2GU3A 2L4VA 5IERA 1OUNA 3CPW2 2XR8B 3MG1A 1BRNL 1LOVA 2F86B 3WR2A 2W03A 3X40A 1A67A 7STDA 4FMDA 4EV2A 1UUVB 1BUQA 3X3XA 2W56B 1K41A 2XFSA 3IJEB 1B21A 4HBRA 1JV2B 3A76A 2MC8A 4EC6A 3NM2A 3DMCA 1HYFA 3S29A 1GSPA 1JKGA 2GBWB 1MWRA 4ILFA 1BRSA 1UCKA 4CPKA 1PU4A 1Q864 3FCSB 1JBTA 3F14A 3GWRA 2LQVA 1M904 3WA2X 5AYSC 5M19A 1Q814 3U1WA 4HM8B 5G2GA 5IEPA 1FGMA 2C10A 1TJDA 5A0OB 1RGGA 1BNEA 2OOVC 1NJI4 1FW7A 1W6GA 1VQK3 1C7HA 1G0TA 5HGRA 1IV7A 1ZO2A 3G0KA 2E2TA 3WOFB 1V58A 3FGYA 4R80A 1Q7Y4 1DMNA 4KZ1A 1JBRA 3SOAA 3CNMA 5CXOA 3EC9A 5IG0A 1BRIA 2XFTA 1D6YA 3NV0A 4N6MA 4BTWA 1N9JA 3GZBA 1VQN3 2KRTA 3QK9A 2AAEA 1ULIB 3CU3A 4N6TA 1ZS7A 1AV4A 4N6UA 3KIIA 3LZAA
chains in the Genus database with same CATH topology
1Q824 2P0XA 4HM5B 3I553 4HM3B 4IT7A 2RGQA 4WYKA 3K7CA 3MWZA 3S28A 1YIT3 3V99A 4HM2B 1NU3A 2I9WA 2IA7A 1M1K4 3CCR3 1OCVA 2HMNB 5EEOA 1VQ83 2W56A 2B24B 3WODG 4AEQA 2ML6A 3K0ZA 4XB5A 1LNHA 3T8NA 3HZPA 4EBGA 1GD4A 1YHQ3 3S5CA 1A90A 4K1UA 1SPUA 1Y4KA 3NQYA 2Z76A 1OPYA 3JUPA 3PGBA 1W7CA 3F7XA 3EF8A 1K8A4 1RRHA 3DGLA 1LOXA 1QVG2 1UI8A 2GBXB 3FG4A 2RCDA 4HM0B 2O9UX 2CFDA 4BTYA 1VZZA 3EBYA 2ML5A 4MMZB 1OGXA 3LTAA 2B1XB 1RN7A 1W2B2 1M9GA 3MG3A 4G1MB 4LMIA 3KSED 2WGOA 3KFQC 1QJGA 4HZBB 1WNHA 3ER7A 5AIGA 3IMAB 1KD14 1IT7A 5STDA 2M7OA 2GXFA 4IPBA 4L8OA 1NO3A 1TUHA 2HMLB 2CWUA 2HMKB 4HM4B 4KFDA 5IG5A 4J8TA 1T5YA 2INXA 2YFLB 5AIFA 4BTXA 3DGOA 2XRXB 3NUVA 1YJW3 3NQZA 4O3VA 5EQLA 3F9SA 1YJ93 2XGNA 3MG2A 1W5ZA 5FW5A 1O7MB 3CCQ3 3BNEA 1QAFA 3B4PA 3PCSA 4RNYA 2ZL8A 3GZXB 1K734 2Y74A 3OWUA 3DM8A 3PYJA 3S67A 4O02B 1EA2A 4X2OA 3NV0B 1D6UA 1RJOA 2ZDJA 1MOLA 3EE1A 3LTDA 1AR0A 4HZ9B 3N9HA 3G8ZA 5IF6A 4OUQA 2V1LA 3KE7A 5KP4A 3ALAA 1YJN3 3D9RA 3NX0A 4WYKB 1K28A 1DVDA 2WO0A 3SEDA 1E3VA 3KKGA 4I4KA 2YFJB 1OHPA 2OTL3 3FG3A 4EXRA 5AEWB 3N54B 1QMAA 4MMYB 2XF3A 4HKVB 3Q90A 1Q40B 4GL6A 2W9PA 3HIGA 5AYRB 1GY7A 3CME3 3Q2PA 4L7KA 1OHOA 1O7PB 1IVUA 4HM6B 3TDGA 1V74A 3G6E3 4ZM8A 3SLUA 3HX8A 3UJMA 4XBXA 1IU7A 3PXMA 5AI1A 1ZX2A 2JQ5A 1EQKA 3NBBA 3CXC2 2P0MA 4QWTA 1YVBI 1O7HB 3ECFA 5AIIA 5IEPA 1QALA 3HIIA 3UNLA 1W01A 1NWWA 1DMQA 3CC23 4O2HA 2W2CA 3M8CA 2A15A 3OW22 1U5OA 1DVCA 4IIAA 4LGQA 1EG9B 1Z1SA 1HU9A 1JB5A 1IQYA 3D3LA 4N6NB 5D81A 1IVWA 1Q42A 4GB5A 3EHCA 1JNQA 1LXEA 2E2VA 3SVAA 3X3ZA 2XGLA 3K63A 5JPUA 5LC6A 2K0MA 1IQXA 3UB1A 1CYUA 2MF7A 3CCS3 1FGTA 4NHFA 3LOYA 2CKFB 2K54A 3FF0A 1WMPA 4EYCA 4FR9A 2W0QA 3L0RA 5LC7A 3GZYB 3MSOA 2QIYA 5ELJA 3B8LA 3BNBA 3O8YA 3RGAA 1N8QA 3SXXA 2Q07A 2QEX3 1FGOA 1Q40A 1WQLB 4H3UA 3CCJ3 1FGRA 2GEXA 1KC84 2P05A 3MHEA 1O7GB 1OACA 3NM7A 4MMXB 2CFGA 1S5AA 2HMMB 2CWVA 5CK6A 2XEPA 3G713 1GS3A 1E97A 1W02A 4FCMA 3LYGA 1RKYA 2CG0A 1CYVA 5I97A 3CC73 3PCRA 1VQ53 2HMJB 3F40A 3CCU3 4U13A 1R4CA 2Z6BA 3RGRA 1FUWA 1A2KA 1JRQA 1STFI 1D6ZA 4HJLB 1ULJB 4RBNA 3GAXA 2BT3A 4MJDA 5KP3A 1TFOA 1VQ73 1VQL3 3CCE3 1LVNA 5IG3A 2P09A 4N6LA 3WMDA 2Z7AA 4KFEA 4N6V0 1K9M4 3CPOA 5AIHA 3V92A 1E3RA 3E99A 1MNLA 1UI7A 4FMAA 4RZMA 2STDA 1SQWA 2YX9A 2IUJA 2CFWA 3NBJA 1VQ43 2BMOB 2GU1A 3OXAA 2CFLA 2O3OA 1N9EA 1RRLA 1FA3A 3LTCA 1VQP3 3DZLA 3JUQA 3JUNA 5IENA 3DY5A 4HM7B 1JJ22 3BLZA 4WHAA 1TU5A 4N3VA 4WFOA 1OHSA 4TX4A 1UW1A 1NB3I 1KSIA 1QVF2 3WA3A 3RDEA 3FSDA 1DMMA 3BNDA 4HYZA 3KSPA 4EV5A 4K90B 5EVHA 3G4S3 2F99A 3LT9A 3JUOA 3WOEB 3CD63 4OK0A 2FNQA 3T8UA 3F7SA 2OQEA 2YFIB 3FG1A 3I0YA 3WDGB 2PZVA 1JN5B 1G96A 3EBTA 4XM4A 3FLJA 2OTJ3 3J7Yd 2F98A 2R4IA 4FCJA 3U97A 3X42A 2OWPA 2PNCA 4HVNA 1VQ63 4LEHA 2RFRA 1GY5A 1ASKA 1N5PA 1IQ8A 3X41A 4JRFA 4FMCA 4K61A 3NXJA 3IPTA 1FGQA 1OGZA 3MYTA 3ROBA 3T0UA 1J2BA 1WMOA 1TIJA 3MPHA 1ROAA 1SIHA 1N8R4 1YIJ3 5JBSA 3X3YA 1KWIA 2IMJA 4N6OB 1GD3A 2UX0A 1W2ZA 5DRVA 2BO9B 3Q1CA 3KN4A 2CK3H 2CHCA 1DYUA 2SBLA 3AMOB 5DREA 3OWYA 3JUMA 2CG1A 3NHXA 2BNGA 5ELUA 4ORLA 1IVXA 2CFKA 4L8PA 3S27A 3DGMA 1KQS2 1OF5A 3UL6A 2BMRB 4OVMA 1PFPA 1US1A 2HMOB 3LTBA 2RSXA 5AEUB 3F8HA 4KVHA 3K9MC 4STDA 1JN5A 5JPPA 1WMNA 2FXTA 2OOVA 3SX1A 1O7WB 2KXGA 2FGTA 4H61A 2D1WA 3MKIA 4PEJA 3DUKA 3F8XA 3CMA3 2GEYA 3BB9A 2C11A 3FF2A 2BHMA 1ISKA 5FGOA 1STDA 2CIUA 1TFKA 5D83A 2BMQB 3PZWA 2D42A 4WP5A 3BNCA 5CLKA 2XH9A 2QA43 4XDVA 3CCV3 2W9QA 5IW9A 3EJVA 5BXQA 2KCDA 3OX9A 4FCZA 4Q53A 1VQ93 5IEOA 3VSYA 1VQM3 3FH1A 3AMOA 3CNXA 4R9KA 4XDWA 1CEWI 5D82A 1VQO3 1N5HA 4R4KA 3OV4A 2WOHA 3CCL3 1JB4A 3STDA 4NREA 4HM1B 3DXOA 4AKZA 3GZRA 3B7CA 3KZTA 3LT8A 5IG4A 4R1KA 1UUWB 3HK4A 4AKYA 6STDA 1CQSA 1W00A 2E2UA 2Z77A 3DGNA 2JDIH 1GY6A 2Y73A 5CF1A 3GRDA 3EN1B 3FZWA 3EQQB 1YI23 1NB5I 2XSOB 2W04A 1W4NA 2QGUA 2LYXA 3HI7A 1IK3A 4MEIA 1IVVA 4O8SA 1A2VA 4K1VA 5BVBA 1AVKA 3NBRA 3G16A 4LSOA 3VGNA 3LXUX 1ROVA 1IV9A 4LZIA 5TGNA 1L5GB 3PS8A 5KP1A 3FKAA 4CCVA 2OCTA 4XBTA 1S723 1JKGB 1M1XB 3OWSA 4X2HA 1OH0A 2P38A 5CF2A 4FMBA 2CH9A 4J9AA 4R9LA 2CC3A 2XSHB 1IT8A 1NDOB 1OF5B 2OQEC 1SJWA 1IDPA 4RNZA 4CDLA 3I563 1YGEA 4XBYA 1EKMA 3UL5A 1W6CA 2W6JH 1SIIA 2IUKA 2WGQA 1WTHA 3CCM3 1F8NA 1U8CB 3SOYA 1W6YA 3V98A 3JVCA 8CHOA 1O7NB 3K5TA 3EB8A 1HKXA 4KFFA 1GYBA 1QAKA 3LH4A 4WWUC 3CC43 3H3HA 3LMLA 1AVLA 2CWTA 3EX9A 3H51A 3EN8A 3N8BA 2WOFA 3QRDA 3B4OA 3VF1A 4JF8A 1TP6A 2CW9A 1JB2A 2GU3A 2L4VA 5IERA 1OUNA 3CPW2 2XR8B 3MG1A 2F86B 1A67A 2W03A 3X40A 7STDA 4FMDA 4EV2A 1UUVB 1BUQA 3X3XA 2W56B 1K41A 2XFSA 3IJEB 4HBRA 1JV2B 3A76A 2MC8A 4EC6A 3NM2A 3DMCA 3S29A 1JKGA 2GBWB 1PU4A 1Q864 3FCSB 3F14A 3GWRA 2LQVA 1M904 3WA2X 5AYSC 1Q814 3U1WA 4HM8B 5G2GA 1FGMA 2C10A 5A0OB 2OOVC 1NJI4 1W6GA 1VQK3 1C7HA 5HGRA 1IV7A 1ZO2A 3G0KA 2E2TA 3WOFB 3FGYA 4R80A 1Q7Y4 1DMNA 4KZ1A 3SOAA 3CNMA 5CXOA 3EC9A 5IG0A 2XFTA 3NV0A 1D6YA 4N6MA 4BTWA 1N9JA 3GZBA 1VQN3 2KRTA 3QK9A 3CU3A 1ULIB 4N6TA 1AV4A 4N6UA 3KIIA 3LZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB3 I;  2W9P A;  4IT7 A;  3Q2P A;  4ZM8 A;  3MWZ A;  3PXM A;  1EQK A;  1NB5 I;  1YVB I;  1GD4 A;  1A90 A;  1G96 A;  1DVC A;  4LZI A;  1IV9 A;  3PS8 A;  4CCV A;  2OCT A;  4N6N B;  1LXE A;  3SVA A;  1N5P A;  5LC6 A;  2CH9 A;  2O9U X;  1CYU A;  1TIJ A;  1ROA A;  4EYC A;  1RN7 A;  3UL5 A;  1M9G A;  3L0R A;  5LC7 A;  1KWI A;  4N6O B;  1GD3 A;  5ELJ A;  3KSE D;  2BO9 B;  3KFQ C;  1WNH A;  3LH4 A;  3IMA B;  5ELU A;  3QRD A;  3UL6 A;  1PFP A;  1CYV A;  5EQL A;  1A67 A;  3K9M C;  1R4C A;  2KXG A;  1FUW A;  3PYJ A;  1STF I;  3S67 A;  3GAX A;  1MOL A;  4N6L A;  4N6V 0;  5A0O B;  1MNL A;  3NX0 A;  2W9Q A;  1DVD A;  1IV7 A;  1FA3 A;  1CEW I;  4N6M A;  1N9J A;  1N5H A;  4N6T A;  4N6U A;  4TX4 A; 
#chains in the Genus database with same CATH topology
 1Q82 4;  1BAO A;  1UGI A;  2P0X A;  4HM5 B;  3I55 3;  4HM3 B;  4IT7 A;  2RGQ A;  4WYK A;  3K7C A;  3MWZ A;  3S28 A;  1YIT 3;  3V99 A;  1BNS A;  1R4Y A;  4HM2 B;  1NU3 A;  2I9W A;  2IA7 A;  1FYS A;  3CCR 3;  1OCV A;  1M1K 4;  3HOH A;  2HMN B;  5EEO A;  2CX1 A;  4GHO A;  1VQ8 3;  2W56 A;  1RCK A;  2B24 B;  3WOD G;  1RDS A;  4AEQ A;  2ML6 A;  3K0Z A;  4XB5 A;  1LNH A;  3T8N A;  3HZP A;  4EBG A;  1GD4 A;  1YHQ 3;  3S5C A;  1AQZ A;  1RNB A;  4K1U A;  1A90 A;  3ZG5 A;  1SPU A;  1Y4K A;  3NQY A;  2Z76 A;  1OPY A;  3JUP A;  3PGB A;  1LNI A;  1W7C A;  4BL2 A;  1BRK A;  3F7X A;  3EF8 A;  1K8A 4;  1RRH A;  3DGL A;  1LOX A;  3RNT A;  1QVG 2;  1PYL A;  1LOY A;  1UI8 A;  2GBX B;  3FG4 A;  2RCD A;  4HM0 B;  2GSP A;  1ZGX A;  1G02 A;  1YVS A;  2CFD A;  2O9U X;  2RNT A;  4BTY A;  1VZZ A;  3EBY A;  3SYU A;  4BU4 A;  2ML5 A;  4MMZ B;  5M18 A;  1EEJ A;  1OGX A;  3LTA A;  2B1X B;  1RGH A;  1RN7 A;  1W2B 2;  3A5E A;  1M9G A;  1MWT A;  3MG3 A;  4G1M B;  4LMI A;  3ZFZ A;  3CCM 3;  3KSE D;  1LRA A;  2K3D A;  2WGO A;  3KFQ C;  1RGA A;  1I8V A;  1QJG A;  1UGH I;  1WNH A;  4HZB B;  3ER7 A;  3Q3F A;  5AIG A;  3IMA B;  1KD1 4;  1IT7 A;  5STD A;  1MWS A;  2M7O A;  1RGC A;  4I5Q A;  3D5I A;  2GXF A;  4IPB A;  1B3S A;  4L8O A;  1NO3 A;  1TUH A;  2HML B;  1I0X A;  2CWU A;  2HMK B;  4HM4 B;  4KFD A;  1B2M A;  1C54 A;  5IG5 A;  4J8T A;  1T5Y A;  2INX A;  2YFL B;  5AIF A;  4BTX A;  3DGO A;  1X1U A;  2XRX B;  3NUV A;  1RHL A;  1YJW 3;  3NQZ A;  4O3V A;  5EQL A;  3F9S A;  1YJ9 3;  2XGN A;  3MG2 A;  1W5Z A;  5FW5 A;  1O7M B;  3CCQ 3;  3BNE A;  1QAF A;  3B4P A;  3PCS A;  4RNY A;  1RNT A;  2ZL8 A;  3GZX B;  1I3I A;  1K73 4;  2Y74 A;  2KF4 A;  3OWU A;  3DM8 A;  3PYJ A;  1A2P A;  1BSD A;  3S67 A;  3D5G A;  4O02 B;  4KT3 B;  1EA2 A;  1I0V A;  1B2Z A;  4X2O A;  1UCI A;  1RCL A;  3NV0 B;  1D6U A;  1RJO A;  2L1S A;  1MOL A;  2ZDJ A;  3EE1 A;  7RNT A;  3LTD A;  1AR0 A;  1LQM B;  4HZ9 B;  5HOH A;  3N9H A;  3G8Z A;  5IF6 A;  4OUQ A;  1I2E A;  2V1L A;  3KE7 A;  3ALA A;  5KP4 A;  3D9R A;  3NX0 A;  1YJN 3;  1EUI C;  2KAA A;  1HZ1 A;  4WYK B;  1K28 A;  1DVD A;  1YGW A;  2WO0 A;  1CH0 A;  3SED A;  4J5G A;  1E3V A;  3KKG A;  4I4K A;  2YFJ B;  1OHP A;  2OTL 3;  3FG3 A;  4EXR A;  5AEW B;  3N54 B;  1UCL A;  1QMA A;  4MMY B;  1X1W A;  2XF3 A;  4HKV B;  1JZD A;  1Q40 B;  3Q90 A;  4GL6 A;  2W9P A;  3HIG A;  5AYR B;  1GY7 A;  1RN4 A;  3AHS A;  3Q2P A;  3CME 3;  4L7K A;  1OHO A;  1O7P B;  1IVU A;  1VQQ A;  4HM6 B;  3TDG A;  1V74 A;  2SAR A;  2ZHX B;  4ZM8 A;  3G6E 3;  1PY3 A;  1BVI A;  2R41 A;  3SLU A;  1DET A;  3HX8 A;  3UJM A;  4XBX A;  1IU7 A;  3PXM A;  1MGR A;  5AI1 A;  1TRQ A;  1ZX2 A;  2JQ5 A;  2ZA4 A;  1EQK A;  3NBB A;  3CXC 2;  1MGW A;  2P0M A;  1GMP A;  1YVB I;  1O7H B;  3ECF A;  4QWT A;  5AII A;  1QAL A;  3HII A;  3UNL A;  1BU4 A;  1W01 A;  1NWW A;  1DMQ A;  4HAA A;  9RNT A;  3CC2 3;  4O2H A;  2W2C A;  3M8C A;  2A15 A;  3OW2 2;  1U5O A;  2H0I A;  1DVC A;  3URP A;  4IIA A;  4LGQ A;  1T3B A;  1EG9 B;  1Z1S A;  1JB5 A;  1HU9 A;  1IQY A;  2H0H A;  3D3L A;  4N6N B;  5D81 A;  1IVW A;  1Q42 A;  4GB5 A;  3EHC A;  1JNQ A;  1LXE A;  2E2V A;  3SVA A;  3X3Z A;  2XGL A;  3D4A A;  1I70 A;  3K63 A;  5JPU A;  1X1X A;  2K0M A;  5LC6 A;  1IQX A;  1GOV A;  3UB1 A;  1CYU A;  2MF7 A;  3BIR A;  3CCS 3;  1FGT A;  4NHF A;  3LOY A;  2CKF B;  1BSA A;  2K54 A;  3FF0 A;  1BRG A;  1WMP A;  4EYC A;  5G1K A;  4FR9 A;  2W0Q A;  3L0R A;  1JBS A;  5LC7 A;  3GZY B;  1BRH A;  2BIR A;  2QIY A;  3B8L A;  3BNB A;  3MSO A;  1V57 A;  1N8Q A;  3O8Y A;  2Q07 A;  5ELJ A;  3RGA A;  3SXX A;  2F4Y A;  2QEX 3;  1FGO A;  1Q40 A;  1RMS A;  1WQL B;  1T2I A;  4H3U A;  3CCJ 3;  1FGR A;  2GEX A;  1BSB A;  1KC8 4;  2P05 A;  3MHE A;  1O7G B;  1OAC A;  3NM7 A;  4MMX B;  2CFG A;  1S5A A;  1Q7H A;  2HMM B;  1LQG C;  2CWV A;  5CK6 A;  2XEP A;  3G71 3;  1GS3 A;  1E97 A;  1W02 A;  4FCM A;  3LYG A;  1BUJ A;  4EW5 A;  1RKY A;  2CG0 A;  1CYV A;  1BAN A;  5I97 A;  1BOX A;  3CC7 3;  3PCR A;  5BU4 A;  1VQ5 3;  2HMJ B;  3F40 A;  3CCU 3;  4U13 A;  1R4C A;  2Z6B A;  4RNT A;  3RGR A;  1FUW A;  2BU4 A;  1BSC A;  1A2K A;  1JRQ A;  1STF I;  1D6Z A;  4HJL B;  1ULJ B;  4RBN A;  3GAX A;  2BT3 A;  4MJD A;  5KP3 A;  1TFO A;  1VQ7 3;  1VQL 3;  3CCE 3;  1LVN A;  5IG3 A;  2P09 A;  4N6L A;  3WMD A;  2Z7A A;  4KFE A;  4N6V 0;  1K9M 4;  3CPO A;  5AIH A;  3V92 A;  1E3R A;  3E99 A;  1MNL A;  1FZU A;  1B2S A;  1UI7 A;  4FMA A;  4RZM A;  5BIR A;  1RGE A;  2STD A;  1SQW A;  2YX9 A;  2IUJ A;  2CFW A;  3NBJ A;  1VQ4 3;  2BMO B;  2GU1 A;  3OXA A;  2CFL A;  2O3O A;  1N9E A;  6GSP A;  1RRL A;  1FA3 A;  3LTC A;  1VQP 3;  3DZL A;  3JUQ A;  1X1Y A;  3JUN A;  5IEN A;  3DY5 A;  4HM7 B;  1JJ2 2;  1BSE A;  3GSP A;  3BLZ A;  4WHA A;  1TU5 A;  1TTO A;  1RSN A;  1B2X A;  4N3V A;  1OHS A;  2KF5 A;  4WFO A;  1BGS A;  4TX4 A;  1UW1 A;  1NB3 I;  2IYJ A;  1KSI A;  1QVF 2;  3WA3 A;  6RNT A;  3RDE A;  3FSD A;  1DMM A;  1T2H A;  3BND A;  4HYZ A;  3KSP A;  4EV5 A;  4K90 B;  5EVH A;  1B2U A;  2F99 A;  3G4S 3;  3LT9 A;  2C4B A;  2IY2 A;  3JUO A;  2UGI A;  4OK0 A;  3WOE B;  3CD6 3;  2FNQ A;  3T8U A;  1DE3 A;  3AGN A;  3F7S A;  2OQE A;  2YFI B;  3FG1 A;  3I0Y A;  3WDG B;  2PZV A;  1FUS A;  1JN5 B;  1YNV X;  1G96 A;  3EBT A;  4XM4 A;  3FLJ A;  2OTJ 3;  1UUG B;  3J7Y d;  2F98 A;  2R4I A;  4FCJ A;  2J8X B;  3U97 A;  3X42 A;  2OWP A;  2PNC A;  4HVN A;  1VQ6 3;  4LEH A;  2RFR A;  1GOU A;  1GY5 A;  3DH2 A;  1ASK A;  1N5P A;  1IQ8 A;  3X41 A;  4JRF A;  1RLS A;  4FMC A;  2F5W A;  4K61 A;  3NXJ A;  3IPT A;  1FGQ A;  1OGZ A;  3MYT A;  2F56 A;  3ROB A;  3T0U A;  1J2B A;  1WMO A;  1TIJ A;  3MPH A;  1ROA A;  1SIH A;  1N8R 4;  1YIJ 3;  1SAR A;  5JBS A;  1BNG A;  1KWI A;  2H0G A;  2IMJ A;  4N6O B;  1GD3 A;  3X3Y A;  2UX0 A;  2AAD A;  1W2Z A;  5DRV A;  2BO9 B;  3Q1C A;  3KN4 A;  2CK3 H;  2CHC A;  1DYU A;  2SBL A;  3AMO B;  5DRE A;  5RNT A;  3OWY A;  3JUM A;  2CG1 A;  3NHX A;  8RNT A;  2BNG A;  5ELU A;  4ORL A;  1IVX A;  3KCH A;  2CFK A;  4L8P A;  3S27 A;  3DGM A;  1KQS 2;  1OF5 A;  3UL6 A;  2BMR B;  1BRJ A;  4OVM A;  1PFP A;  1RGF A;  1US1 A;  2HMO B;  2CX0 A;  4NPB A;  3LTB A;  2RSX A;  5AEU B;  3F8H A;  4KVH A;  1LOW A;  1FUT A;  1JN5 A;  3K9M C;  1WMN A;  2FXT A;  4STD A;  2OOV A;  2F5M A;  1O7W B;  2KXG A;  3SX1 A;  2FGT A;  4H61 A;  2D1W A;  3MKI A;  1GOY A;  4PEJ A;  3DUK A;  3F8X A;  4HOH A;  3CMA 3;  1I2G A;  1JZO A;  2GEY A;  3BB9 A;  3AGO A;  2C11 A;  3FF2 A;  2BHM A;  1ISK A;  5JPP A;  5FGO A;  1STD A;  2CIU A;  1TFK A;  5D83 A;  2BMQ B;  3PZW A;  2D42 A;  4WP5 A;  4DKI A;  3BNC A;  5CLK A;  2UUG C;  2XH9 A;  2QA4 3;  4GSP A;  4XDV A;  1Q9E A;  3CCV 3;  2W9Q A;  5IW9 A;  3EJV A;  3ZG0 A;  1GMR A;  5BXQ A;  2KCD A;  3OX9 A;  4FCZ A;  4Q53 A;  1VQ9 3;  5IEO A;  1TRP A;  3VSY A;  1VQM 3;  3FH1 A;  3AMO A;  3CNX A;  4R9K A;  4XDW A;  1CEW I;  1RGL A;  5D82 A;  1VQO 3;  1N5H A;  4BL3 A;  4R4K A;  5M1A A;  3OV4 A;  2WOH A;  1B20 A;  1I3F A;  3CCL 3;  1JB4 A;  3STD A;  4NRE A;  4HM1 B;  3DXO A;  4AKZ A;  3GZR A;  3B7C A;  3KZT A;  1RN1 A;  3LT8 A;  5IG4 A;  4R1K A;  1UUW B;  3HK4 A;  4AKY A;  6STD A;  1CQS A;  1W00 A;  2E2U A;  2Z77 A;  3DGN A;  3DGY A;  2JDI H;  3WHO A;  1GY6 A;  2Y73 A;  1RGK A;  5CF1 A;  3GRD A;  3EN1 B;  3FZW A;  3EQQ B;  1YI2 3;  1UCJ A;  2XSO B;  2W04 A;  1NB5 I;  1NNV A;  1W4N A;  2QGU A;  2KF3 A;  2LYX A;  3HI7 A;  1IK3 A;  2KF6 A;  4MEI A;  1IVV A;  4O8S A;  1A2V A;  4K1V A;  5BVB A;  1AVK A;  3NBR A;  3G16 A;  4LSO A;  3VGN A;  3LXU X;  1ROV A;  1IV9 A;  4LZI A;  5G1L A;  5TGN A;  1L5G B;  3PS8 A;  5KP1 A;  3FKA A;  4CCV A;  2OCT A;  4XBT A;  4CJN A;  1JKG B;  1S72 3;  1BIR A;  1BNF A;  1MWU A;  1M1X B;  1UDI I;  5GSP A;  1BNR A;  1IYY A;  3OWS A;  4X2H A;  7GSP A;  1OH0 A;  1AY7 A;  2P38 A;  5CF2 A;  4FMB A;  2CH9 A;  2HOH A;  4J9A A;  4R9L A;  2CC3 A;  2XSH B;  4BIR A;  1IT8 A;  1NDO B;  1OF5 B;  2OQE C;  1SJW A;  1IDP A;  4RNZ A;  4CDL A;  3I56 3;  1BNI A;  1YGE A;  4XBY A;  1EKM A;  3UL5 A;  1W6C A;  2W6J H;  1SII A;  2IUK A;  2WGQ A;  1B27 A;  1WTH A;  1F8N A;  1U8C B;  2RBI A;  3SOY A;  1W6Y A;  3BU4 A;  4J5K A;  3V98 A;  3JVC A;  8CHO A;  1GMQ A;  4LYL B;  1O7N B;  3AHW A;  3EB8 A;  3K5T A;  3D79 A;  1HKX A;  4KFF A;  1GYB A;  1QAK A;  3LH4 A;  4WWU C;  3CC4 3;  3H3H A;  3LML A;  1AVL A;  2CWT A;  3EX9 A;  3H51 A;  1I2F A;  3EN8 A;  3N8B A;  2WOF A;  3QRD A;  1BNJ A;  1RTU A;  3B4O A;  3VF1 A;  4JF8 A;  1TP6 A;  2CW9 A;  1JB2 A;  2GU3 A;  2L4V A;  5IER A;  1OUN A;  3CPW 2;  2XR8 B;  3MG1 A;  1BRN L;  1LOV A;  2F86 B;  3WR2 A;  2W03 A;  3X40 A;  1A67 A;  7STD A;  4FMD A;  4EV2 A;  1UUV B;  1BUQ A;  3X3X A;  2W56 B;  1K41 A;  2XFS A;  3IJE B;  1B21 A;  4HBR A;  1JV2 B;  3A76 A;  2MC8 A;  4EC6 A;  3NM2 A;  3DMC A;  1HYF A;  3S29 A;  1GSP A;  1JKG A;  2GBW B;  1MWR A;  4ILF A;  1BRS A;  1UCK A;  4CPK A;  1PU4 A;  1Q86 4;  3FCS B;  1JBT A;  3F14 A;  3GWR A;  2LQV A;  1M90 4;  3WA2 X;  5AYS C;  5M19 A;  1Q81 4;  3U1W A;  4HM8 B;  5G2G A;  5IEP A;  1FGM A;  2C10 A;  1TJD A;  5A0O B;  1RGG A;  1BNE A;  2OOV C;  1NJI 4;  1FW7 A;  1W6G A;  1VQK 3;  1C7H A;  1G0T A;  5HGR A;  1IV7 A;  1ZO2 A;  3G0K A;  2E2T A;  3WOF B;  1V58 A;  3FGY A;  4R80 A;  1Q7Y 4;  1DMN A;  4KZ1 A;  1JBR A;  3SOA A;  3CNM A;  5CXO A;  3EC9 A;  5IG0 A;  1BRI A;  2XFT A;  1D6Y A;  3NV0 A;  4N6M A;  4BTW A;  1N9J A;  3GZB A;  1VQN 3;  2KRT A;  3QK9 A;  2AAE A;  1ULI B;  3CU3 A;  4N6T A;  1ZS7 A;  1AV4 A;  4N6U A;  3KII A;  3LZA A; 
#chains in the Genus database with same CATH homology
 1Q82 4;  2P0X A;  4HM5 B;  3I55 3;  4HM3 B;  4IT7 A;  2RGQ A;  4WYK A;  3K7C A;  3MWZ A;  3S28 A;  1YIT 3;  3V99 A;  4HM2 B;  1NU3 A;  2I9W A;  2IA7 A;  1M1K 4;  3CCR 3;  1OCV A;  2HMN B;  5EEO A;  1VQ8 3;  2W56 A;  2B24 B;  3WOD G;  4AEQ A;  2ML6 A;  3K0Z A;  4XB5 A;  1LNH A;  3T8N A;  3HZP A;  4EBG A;  1GD4 A;  1YHQ 3;  3S5C A;  1A90 A;  4K1U A;  1SPU A;  1Y4K A;  3NQY A;  2Z76 A;  1OPY A;  3JUP A;  3PGB A;  1W7C A;  3F7X A;  3EF8 A;  1K8A 4;  1RRH A;  3DGL A;  1LOX A;  1QVG 2;  1UI8 A;  2GBX B;  3FG4 A;  2RCD A;  4HM0 B;  2O9U X;  2CFD A;  4BTY A;  1VZZ A;  3EBY A;  2ML5 A;  4MMZ B;  1OGX A;  3LTA A;  2B1X B;  1RN7 A;  1W2B 2;  1M9G A;  3MG3 A;  4G1M B;  4LMI A;  3KSE D;  2WGO A;  3KFQ C;  1QJG A;  4HZB B;  1WNH A;  3ER7 A;  5AIG A;  3IMA B;  1KD1 4;  1IT7 A;  5STD A;  2M7O A;  2GXF A;  4IPB A;  4L8O A;  1NO3 A;  1TUH A;  2HML B;  2CWU A;  2HMK B;  4HM4 B;  4KFD A;  5IG5 A;  4J8T A;  1T5Y A;  2INX A;  2YFL B;  5AIF A;  4BTX A;  3DGO A;  2XRX B;  3NUV A;  1YJW 3;  3NQZ A;  4O3V A;  5EQL A;  3F9S A;  1YJ9 3;  2XGN A;  3MG2 A;  1W5Z A;  5FW5 A;  1O7M B;  3CCQ 3;  3BNE A;  1QAF A;  3B4P A;  3PCS A;  4RNY A;  2ZL8 A;  3GZX B;  1K73 4;  2Y74 A;  3OWU A;  3DM8 A;  3PYJ A;  3S67 A;  4O02 B;  1EA2 A;  4X2O A;  3NV0 B;  1D6U A;  1RJO A;  2ZDJ A;  1MOL A;  3EE1 A;  3LTD A;  1AR0 A;  4HZ9 B;  3N9H A;  3G8Z A;  5IF6 A;  4OUQ A;  2V1L A;  3KE7 A;  5KP4 A;  3ALA A;  1YJN 3;  3D9R A;  3NX0 A;  4WYK B;  1K28 A;  1DVD A;  2WO0 A;  3SED A;  1E3V A;  3KKG A;  4I4K A;  2YFJ B;  1OHP A;  2OTL 3;  3FG3 A;  4EXR A;  5AEW B;  3N54 B;  1QMA A;  4MMY B;  2XF3 A;  4HKV B;  3Q90 A;  1Q40 B;  4GL6 A;  2W9P A;  3HIG A;  5AYR B;  1GY7 A;  3CME 3;  3Q2P A;  4L7K A;  1OHO A;  1O7P B;  1IVU A;  4HM6 B;  3TDG A;  1V74 A;  3G6E 3;  4ZM8 A;  3SLU A;  3HX8 A;  3UJM A;  4XBX A;  1IU7 A;  3PXM A;  5AI1 A;  1ZX2 A;  2JQ5 A;  1EQK A;  3NBB A;  3CXC 2;  2P0M A;  4QWT A;  1YVB I;  1O7H B;  3ECF A;  5AII A;  5IEP A;  1QAL A;  3HII A;  3UNL A;  1W01 A;  1NWW A;  1DMQ A;  3CC2 3;  4O2H A;  2W2C A;  3M8C A;  2A15 A;  3OW2 2;  1U5O A;  1DVC A;  4IIA A;  4LGQ A;  1EG9 B;  1Z1S A;  1HU9 A;  1JB5 A;  1IQY A;  3D3L A;  4N6N B;  5D81 A;  1IVW A;  1Q42 A;  4GB5 A;  3EHC A;  1JNQ A;  1LXE A;  2E2V A;  3SVA A;  3X3Z A;  2XGL A;  3K63 A;  5JPU A;  5LC6 A;  2K0M A;  1IQX A;  3UB1 A;  1CYU A;  2MF7 A;  3CCS 3;  1FGT A;  4NHF A;  3LOY A;  2CKF B;  2K54 A;  3FF0 A;  1WMP A;  4EYC A;  4FR9 A;  2W0Q A;  3L0R A;  5LC7 A;  3GZY B;  3MSO A;  2QIY A;  5ELJ A;  3B8L A;  3BNB A;  3O8Y A;  3RGA A;  1N8Q A;  3SXX A;  2Q07 A;  2QEX 3;  1FGO A;  1Q40 A;  1WQL B;  4H3U A;  3CCJ 3;  1FGR A;  2GEX A;  1KC8 4;  2P05 A;  3MHE A;  1O7G B;  1OAC A;  3NM7 A;  4MMX B;  2CFG A;  1S5A A;  2HMM B;  2CWV A;  5CK6 A;  2XEP A;  3G71 3;  1GS3 A;  1E97 A;  1W02 A;  4FCM A;  3LYG A;  1RKY A;  2CG0 A;  1CYV A;  5I97 A;  3CC7 3;  3PCR A;  1VQ5 3;  2HMJ B;  3F40 A;  3CCU 3;  4U13 A;  1R4C A;  2Z6B A;  3RGR A;  1FUW A;  1A2K A;  1JRQ A;  1STF I;  1D6Z A;  4HJL B;  1ULJ B;  4RBN A;  3GAX A;  2BT3 A;  4MJD A;  5KP3 A;  1TFO A;  1VQ7 3;  1VQL 3;  3CCE 3;  1LVN A;  5IG3 A;  2P09 A;  4N6L A;  3WMD A;  2Z7A A;  4KFE A;  4N6V 0;  1K9M 4;  3CPO A;  5AIH A;  3V92 A;  1E3R A;  3E99 A;  1MNL A;  1UI7 A;  4FMA A;  4RZM A;  2STD A;  1SQW A;  2YX9 A;  2IUJ A;  2CFW A;  3NBJ A;  1VQ4 3;  2BMO B;  2GU1 A;  3OXA A;  2CFL A;  2O3O A;  1N9E A;  1RRL A;  1FA3 A;  3LTC A;  1VQP 3;  3DZL A;  3JUQ A;  3JUN A;  5IEN A;  3DY5 A;  4HM7 B;  1JJ2 2;  3BLZ A;  4WHA A;  1TU5 A;  4N3V A;  4WFO A;  1OHS A;  4TX4 A;  1UW1 A;  1NB3 I;  1KSI A;  1QVF 2;  3WA3 A;  3RDE A;  3FSD A;  1DMM A;  3BND A;  4HYZ A;  3KSP A;  4EV5 A;  4K90 B;  5EVH A;  3G4S 3;  2F99 A;  3LT9 A;  3JUO A;  3WOE B;  3CD6 3;  4OK0 A;  2FNQ A;  3T8U A;  3F7S A;  2OQE A;  2YFI B;  3FG1 A;  3I0Y A;  3WDG B;  2PZV A;  1JN5 B;  1G96 A;  3EBT A;  4XM4 A;  3FLJ A;  2OTJ 3;  3J7Y d;  2F98 A;  2R4I A;  4FCJ A;  3U97 A;  3X42 A;  2OWP A;  2PNC A;  4HVN A;  1VQ6 3;  4LEH A;  2RFR A;  1GY5 A;  1ASK A;  1N5P A;  1IQ8 A;  3X41 A;  4JRF A;  4FMC A;  4K61 A;  3NXJ A;  3IPT A;  1FGQ A;  1OGZ A;  3MYT A;  3ROB A;  3T0U A;  1J2B A;  1WMO A;  1TIJ A;  3MPH A;  1ROA A;  1SIH A;  1N8R 4;  1YIJ 3;  5JBS A;  3X3Y A;  1KWI A;  2IMJ A;  4N6O B;  1GD3 A;  2UX0 A;  1W2Z A;  5DRV A;  2BO9 B;  3Q1C A;  3KN4 A;  2CK3 H;  2CHC A;  1DYU A;  2SBL A;  3AMO B;  5DRE A;  3OWY A;  3JUM A;  2CG1 A;  3NHX A;  2BNG A;  5ELU A;  4ORL A;  1IVX A;  2CFK A;  4L8P A;  3S27 A;  3DGM A;  1KQS 2;  1OF5 A;  3UL6 A;  2BMR B;  4OVM A;  1PFP A;  1US1 A;  2HMO B;  3LTB A;  2RSX A;  5AEU B;  3F8H A;  4KVH A;  3K9M C;  4STD A;  1JN5 A;  5JPP A;  1WMN A;  2FXT A;  2OOV A;  3SX1 A;  1O7W B;  2KXG A;  2FGT A;  4H61 A;  2D1W A;  3MKI A;  4PEJ A;  3DUK A;  3F8X A;  3CMA 3;  2GEY A;  3BB9 A;  2C11 A;  3FF2 A;  2BHM A;  1ISK A;  5FGO A;  1STD A;  2CIU A;  1TFK A;  5D83 A;  2BMQ B;  3PZW A;  2D42 A;  4WP5 A;  3BNC A;  5CLK A;  2XH9 A;  2QA4 3;  4XDV A;  3CCV 3;  2W9Q A;  5IW9 A;  3EJV A;  5BXQ A;  2KCD A;  3OX9 A;  4FCZ A;  4Q53 A;  1VQ9 3;  5IEO A;  3VSY A;  1VQM 3;  3FH1 A;  3AMO A;  3CNX A;  4R9K A;  4XDW A;  1CEW I;  5D82 A;  1VQO 3;  1N5H A;  4R4K A;  3OV4 A;  2WOH A;  3CCL 3;  1JB4 A;  3STD A;  4NRE A;  4HM1 B;  3DXO A;  4AKZ A;  3GZR A;  3B7C A;  3KZT A;  3LT8 A;  5IG4 A;  4R1K A;  1UUW B;  3HK4 A;  4AKY A;  6STD A;  1CQS A;  1W00 A;  2E2U A;  2Z77 A;  3DGN A;  2JDI H;  1GY6 A;  2Y73 A;  5CF1 A;  3GRD A;  3EN1 B;  3FZW A;  3EQQ B;  1YI2 3;  1NB5 I;  2XSO B;  2W04 A;  1W4N A;  2QGU A;  2LYX A;  3HI7 A;  1IK3 A;  4MEI A;  1IVV A;  4O8S A;  1A2V A;  4K1V A;  5BVB A;  1AVK A;  3NBR A;  3G16 A;  4LSO A;  3VGN A;  3LXU X;  1ROV A;  1IV9 A;  4LZI A;  5TGN A;  1L5G B;  3PS8 A;  5KP1 A;  3FKA A;  4CCV A;  2OCT A;  4XBT A;  1S72 3;  1JKG B;  1M1X B;  3OWS A;  4X2H A;  1OH0 A;  2P38 A;  5CF2 A;  4FMB A;  2CH9 A;  4J9A A;  4R9L A;  2CC3 A;  2XSH B;  1IT8 A;  1NDO B;  1OF5 B;  2OQE C;  1SJW A;  1IDP A;  4RNZ A;  4CDL A;  3I56 3;  1YGE A;  4XBY A;  1EKM A;  3UL5 A;  1W6C A;  2W6J H;  1SII A;  2IUK A;  2WGQ A;  1WTH A;  3CCM 3;  1F8N A;  1U8C B;  3SOY A;  1W6Y A;  3V98 A;  3JVC A;  8CHO A;  1O7N B;  3K5T A;  3EB8 A;  1HKX A;  4KFF A;  1GYB A;  1QAK A;  3LH4 A;  4WWU C;  3CC4 3;  3H3H A;  3LML A;  1AVL A;  2CWT A;  3EX9 A;  3H51 A;  3EN8 A;  3N8B A;  2WOF A;  3QRD A;  3B4O A;  3VF1 A;  4JF8 A;  1TP6 A;  2CW9 A;  1JB2 A;  2GU3 A;  2L4V A;  5IER A;  1OUN A;  3CPW 2;  2XR8 B;  3MG1 A;  2F86 B;  1A67 A;  2W03 A;  3X40 A;  7STD A;  4FMD A;  4EV2 A;  1UUV B;  1BUQ A;  3X3X A;  2W56 B;  1K41 A;  2XFS A;  3IJE B;  4HBR A;  1JV2 B;  3A76 A;  2MC8 A;  4EC6 A;  3NM2 A;  3DMC A;  3S29 A;  1JKG A;  2GBW B;  1PU4 A;  1Q86 4;  3FCS B;  3F14 A;  3GWR A;  2LQV A;  1M90 4;  3WA2 X;  5AYS C;  1Q81 4;  3U1W A;  4HM8 B;  5G2G A;  1FGM A;  2C10 A;  5A0O B;  2OOV C;  1NJI 4;  1W6G A;  1VQK 3;  1C7H A;  5HGR A;  1IV7 A;  1ZO2 A;  3G0K A;  2E2T A;  3WOF B;  3FGY A;  4R80 A;  1Q7Y 4;  1DMN A;  4KZ1 A;  3SOA A;  3CNM A;  5CXO A;  3EC9 A;  5IG0 A;  2XFT A;  3NV0 A;  1D6Y A;  4N6M A;  4BTW A;  1N9J A;  3GZB A;  1VQN 3;  2KRT A;  3QK9 A;  3CU3 A;  1ULI B;  4N6T A;  1AV4 A;  4N6U A;  3KII A;  3LZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...