1B3SA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
AQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (BARNASE)
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b3sA00
1Q9EA 1C54A 1RNTA 1BNFA 3AHWA 2AADA 5BIRA 1RCKA 1RN1A 1RGGA 1RNBA 1B2XA 1PY3A 1GSPA 1RGFA 1I70A 1B2SA 2C4BA 1RDSA 3WR2A 1TRQA 1HZ1A 1AQZA 1DE3A 1BRNL 6RNTA 3HOHA 2BIRA 1YGWA 5GSPA 1I2FA 1BVIA 8RNTA 1JBTA 1BSDA 1BU4A 1BSCA 3AGOA 9RNTA 1GMQA 1B2UA 3URPA 1B2MA 1UCIA 1RLSA 1PYLA 1JBRA 1BUJA 1X1UA 2F5WA 1GOVA 1AY7A 1LNIA 2F4YA 1BGSA 1BNJA 1GMRA 4BIRA 1RGHA 1RGAA 1BSEA 3WHOA 1I3FA 1BNEA 1TTOA 1RGKA 1X1YA 1RTUA 5RNTA 1RN4A 1RHLA 2AAEA 1BRHA 3BU4A 1GMPA 4GSPA 1MGRA 1T2HA 1BIRA 2F56A 1FW7A 1I0VA 2F5MA 1FUTA 2RNTA 1B27A 1BAOA 3DH2A 1GOUA 1RGLA 1YVSA 1BSBA 5HOHA 1RGCA 4HOHA 1I2EA 1LOVA 1BRGA 1BRSA 1ZGXA 2RBIA 1BRJA 2ZA4A 3A5EA 4RNTA 1BNSA 7GSPA 3KCHA 1G02A 2KF4A 1LOYA 4HAAA 1T2IA 2GSPA 1BANA 1MGWA 1BNGA 3D5IA 2HOHA 3AHSA 3DGYA 3SYUA 6GSPA 1BNIA 1I0XA 1IYYA 1UCLA 1YNVX 1RGEA 1SARA 1RMSA 2KF5A 7RNTA 1GOYA 1BSAA 1RSNA 1BRKA 2BU4A 4BU4A 5BU4A 1X1WA 3D4AA 1B20A 1TRPA 1X1XA 1CH0A 1DETA 1BRIA 1LOWA 1B2ZA 1A2PA 1BOXA 1I8VA 1I2GA 3BIRA 1UCJA 3Q3FA 4GHOA 1BNRA 1RCLA 1FYSA 3D5GA 1JBSA 1LRAA 2KF6A 1R4YA 1FZUA 1I3IA 1HYFA 2KF3A 2SARA 3GSPA 3RNTA 4J5KA 1B3SA 3AGNA 1UCKA 1B21A 4J5GA 2KAAA 1FUSA
chains in the Genus database with same CATH superfamily
3AHWA 2AADA 5BIRA 1RN1A 2R4IA 1N9JA 1W2B2 1A90A 3K63A 2LQVA 3NM2A 1PY3A 2CKFB 3KIIA 2ZHXB 1RGFA 1UUGB 1Y4KA 3IMAB 3Q90A 1D6UA 3G6E3 1IQYA 5AYSC 3GZYB 2J8XB 2INXA 3PZWA 2E2VA 2ML5A 2UUGC 1BRNL 2I9WA 3NBBA 2RCDA 3IJEB 3ROBA 3SVAA 1VQO3 5I97A 4CCVA 2L1SA 2Z6BA 1WMOA 4X2HA 1BU4A 1BSCA 3PGBA 2HMJB 1S5AA 2OQEC 3AMOA 9RNTA 3QRDA 1GMQA 4FCZA 1UW1A 3OWUA 1OHSA 2CW9A 3L0RA 1M1K4 1JBRA 1SIHA 2A15A 2W04A 1O7WB 1YGEA 4HM2B 1FGOA 2H0IA 4R80A 2CG1A 3V92A 4R1KA 1LNIA 2P0XA 4MMYB 1IV7A 3FH1A 4HM7B 1BNJA 1RGAA 2Z76A 4XBXA 1DMNA 1VQ93 2HMKB 2Z7AA 1F8NA 1WMPA 1DYUA 1K734 2CK3H 3Q2PA 2E2TA 3DGLA 4L8OA 3STDA 1U5OA 4HM6B 1UI8A 2OOVA 1RHLA 2QIYA 4ORLA 3RGRA 3FCSB 1JNQA 2XEPA 5LC6A 1Q7HA 2GXFA 1IVXA 4MMXB 1TIJA 1OACA 3JVCA 3EF8A 1OGZA 2CHCA 2O9UX 2F56A 3LTDA 1PU4A 1I0VA 3CCE3 1AV4A 1B27A 1BAOA 1LVNA 1FUWA 1WTHA 3LXUX 3GZRA 3AMOB 1T5YA 3UJMA 3EQQB 4GL6A 3FF0A 1RGCA 2OCTA 4HOHA 1I2EA 3S5CA 1BRSA 3CCL3 1QAKA 3LH4A 1AVLA 1BRJA 1BUQA 1TFOA 3FLJA 3KCHA 4PEJA 1O7GB 2STDA 1MGWA 5CXOA 2CX0A 2C11A 2HOHA 1EA2A 3CCS3 5AIFA 1IDPA 1O7PB 2OOVC 4J8TA 1DMMA 2KF5A 5G2GA 1GOYA 1BSAA 2WOFA 4O2HA 2BU4A 3KFQC 4KFDA 3G0KA 1RJOA 3T0UA 3ECFA 5IG5A 4BL2A 4KFFA 1VZZA 3BNDA 1X1XA 4FMAA 1V74A 3HIIA 2GEXA 1NDOB 3OX9A 1TU5A 1Q42A 2CFLA 1UCJA 3D3LA 5ELUA 5IW9A 1O7HB 1STDA 1W02A 1W7CA 2E2UA 3CCU3 3CC43 3D5GA 1EQKA 1W6YA 4MEIA 2CX1A 1R4YA 4K61A 3EE1A 1R4CA 3X3YA 1TFKA 2KRTA 5KP1A 2GU1A 4N6UA 1KWIA 3CPW2 2RGQA 3EN1B 1W4NA 3F7SA 5IG0A 3HI7A 3IPTA 3H51A 4J5GA 2QGUA 4HZBB 5BXQA 2KAAA 2IA7A 3CPOA 1EG9B 4R9KA 2RFRA 3ZG0A 5JPUA 1RNTA 1VQL3 3CCJ3 2HMMB 1RCKA 2KXGA 5G1LA 4N6NB 1OUNA 3LOYA 3GZBA 1VQP3 4FMBA 1V58A 1ZS7A 2K0MA 3BB9A 3K9MC 4K1VA 1S723 1I70A 1IV9A 2C4BA 2YX9A 4EC6A 2XFSA 2XSOB 1RDSA 1D6ZA 3N8BA 4LMIA 1NWWA 4HM3B 2IYJA 4I5QA 2JDIH 4TX4A 2CC3A 3HOHA 2BIRA 4Q53A 1Q814 1YGWA 5GSPA 1I2FA 3CCQ3 1BVIA 2HMNB 4IIAA 8RNTA 4FMCA 1IT7A 1BSDA 3DZLA 3AGOA 5EVHA 4BTYA 2CFDA 3I563 3LMLA 5STDA 1B2UA 1UCIA 1KQS2 2UGIA 2LYXA 2V1LA 3NXJA 4NPBA 4GB5A 4BTWA 1PYLA 2BO9B 3H3HA 1BUJA 3KZTA 3HIGA 2BMRB 1BGSA 1GMRA 2F98A 1RGHA 1W6GA 3S29A 1VQN3 1AR0A 3J7Yd 3CU3A 5AYRB 2KCDA 1EEJA 2WO0A 4HYZA 1I3FA 5M19A 3D9RA 1TTOA 1JB4A 1RGKA 3BNCA 1EKMA 5JBSA 1IVVA 3VGNA 1RTUA 1IVUA 2SBLA 1YJW3 3O8YA 1JJ22 1E3VA 1Z1SA 4HM0B 5IF6A 1QVG2 2AAEA 1A2KA 3WMDA 3T8UA 3BU4A 1O7MB 8CHOA 1KSIA 2B24B 3JUPA 3N54B 4FMDA 4H61A 4U13A 4G1MB 1MGRA 2BT3A 3SX1A 2HMLB 5IENA 1OH0A 3CME3 1GY5A 1UGIA 1EUIC 1YVSA 4CPKA 4XB5A 1WQLB 3UL6A 5HOHA 1Q40A 3T8NA 2PZVA 1A2VA 2CFKA 1NU3A 2GBWB 3ER7A 1RKYA 1QVF2 3E99A 1QMAA 3PXMA 3A5EA 3Q1CA 2CFWA 3F9SA 4RNTA 3WODG 3OV4A 1VQ73 2W03A 1JB2A 1E97A 3N9HA 3V99A 2QA43 2GSPA 1BANA 2F86B 3D5IA 3EBTA 4EV5A 3DGYA 3SYUA 3MPHA 3CC23 1Q824 1I0XA 4LZIA 1A67A 1US1A 1IYYA 2PNCA 1ZX2A 1LNHA 1STFI 3LYGA 1UUWB 4KZ1A 4N6OB 1RRHA 4EV2A 2XGLA 1RSNA 1BRKA 2XSHB 4WP5A 5DREA 3S28A 5D82A 3OW22 1OHPA 1SPUA 1N5PA 1LQGC 3UL5A 4FR9A 4AEQA 1TRPA 2R41A 4RNZA 3PYJA 4JRFA 2QEX3 1GD3A 1DETA 3U1WA 1A2PA 1I8VA 3D79A 2IUJA 3HX8A 2P38A 1C7HA 1OCVA 2B1XB 1FA3A 1ASKA 4GHOA 3G8ZA 1JN5A 1FYSA 5G1KA 3K5TA 2O3OA 1GS3A 1Q40B 1W5ZA 3FG4A 4KFEA 1FZUA 1VQK3 1I3IA 1HYFA 1SJWA 3GSPA 3GWRA 4KVHA 1MWRA 1CYUA 4J5KA 3LT9A 3AGNA 2W6JH 3GRDA 4QWTA 4LSOA 2HMOB 4MJDA 1CQSA 3FKAA 1Q9EA 5KP3A 1BNFA 5TGNA 1RGGA 1VQ63 1UGHI 3DGOA 5AEUB 1B2XA 2BHMA 3HK4A 3KSED 5IEPA 1GSPA 2CWUA 1OPYA 3DM8A 1B2SA 1CEWI 4LEHA 3BNBA 3WR2A 5AIHA 3EC9A 1HZ1A 1QALA 1V57A 1JRQA 1DE3A 4HZ9B 1SQWA 4RNYA 4JF8A 4HM5B 3G4S3 2IMJA 3DUKA 3URPA 4WFOA 5LC7A 1AVKA 1JN5B 1MWTA 3X3XA 5M18A 1RLSA 1M904 4EBGA 1GY6A 1WMNA 2OTL3 1QJGA 3NV0A 4FCJA 2F5WA 3JUQA 3MKIA 2ML6A 1YI23 1AY7A 1ULJB 1KD14 3FF2A 3FZWA 2WGOA 1YVBI 1LOXA 1VQ53 4LYLB 3WOFB 1IVWA 1NB5I 3CCR3 2W9PA 7STDA 2ZDJA 5HGRA 3CCM3 2IUKA 2JQ5A 3SOYA 1X1YA 3DMCA 3F8XA 3CMA3 5IERA 1GYBA 1RN4A 1UUVB 3DGNA 3X42A 3NUVA 1IQ8A 1G96A 2P09A 3VF1A 3B8LA 2D42A 3LZAA 1ULIB 1SIIA 1BRHA 3RGAA 4OUQA 2CWVA 3MHEA 2BNGA 4GSPA 4H3UA 4N6TA 3I0YA 1N8QA 3OXAA 1T2HA 4HVNA 5KP4A 2F5MA 3CNMA 5DRVA 3KKGA 3DH2A 3HZPA 4NHFA 2OTJ3 1GOUA 3LTCA 4I4KA 1RGLA 4N6V0 1VQ83 4WYKA 3FGYA 5CF2A 2Y73A 1VQM3 1BRGA 4CDLA 3NM7A 2Y74A 1GY7A 4IPBA 1N5HA 4STDA 2RBIA 1Q864 1E3RA 1BNSA 1W2ZA 3NV0B 4FCMA 4WHAA 5A0OB 7GSPA 3CCV3 1K28A 1LOYA 2P0MA 3K7CA 5AIGA 4HAAA 4HBRA 1T2IA 4MMZB 3F7XA 4HJLB 1BNGA 2BMQB 1VQQA 1DVCA 3S27A 1JZDA 1O7NB 1NO3A 6GSPA 4R9LA 1BNIA 5EQLA 2W2CA 2W0QA 4ILFA 5FGOA 5BVBA 2GU3A 1FGTA 2CIUA 4K1UA 4BU4A 2L4VA 3JUMA 2Z77A 1KC84 1LQMB 2Q07A 2ZL8A 5ELJA 2YFJB 1GD4A 1YJN3 1K9M4 5IG4A 3TDGA 3U97A 1BRIA 1B2ZA 1TP6A 3OWYA 1I2GA 3BIRA 3Q3FA 3NBRA 1BNRA 3NX0A 1FGMA 3MG2A 1IT8A 3G713 3FSDA 2GEYA 1YIT3 1LRAA 5CLKA 3GZXB 2KF6A 3KN4A 4WYKB 3F8HA 3FG1A 4O8SA 1YHQ3 1Q7Y4 1U8CB 1NB3I 1FGQA 1HKXA 4HKVB 3MSOA 1DMQA 1UCKA 2H0GA 4KT3B 6STDA 1JKGB 1ROVA 3LTBA 1N9EA 5JPPA 1FUSA 3I553 1C54A 3NBJA 1W6CA 3DY5A 1OHOA 3BLZA 1HU9A 3UB1A 3NHXA 1RNBA 5D81A 3B4OA 2MC8A 3B7CA 1MOLA 5AIIA 2M7OA 4J9AA 1W01A 3WDGB 3SEDA 3ALAA 3VSYA 1OF5A 1TRQA 1AQZA 4DKIA 2F99A 2C10A 6RNTA 1WNHA 2OWPA 3X3ZA 1JBTA 4HM4B 1ISKA 2P05A 1MWSA 3MG3A 1B2MA 1MWUA 2CFGA 1JV2B 1D6YA 3A76A 3G16A 3KE7A 2YFLB 2YFIB 3SLUA 3EHCA 4XDVA 1L5GB 1DVDA 2XRXB 4L8PA 1X1UA 3CXC2 1GOVA 4XBTA 2F4YA 4BIRA 3WA2X 2FXTA 4RBNA 4HM8B 3EN8A 1IK3A 4EXRA 3WA3A 1BSEA 1TUHA 3WHOA 1BNEA 3CC73 4N6MA 2XH9A 2FGTA 3LTAA 4CJNA 3EB8A 4IT7A 1NNVA 5CF1A 5RNTA 4RZMA 1OGXA 2IY2A 1VQ43 3RDEA 3DXOA 1UDII 3UNLA 3EX9A 3MWZA 1GMPA 2W56A 3PCRA 4BTXA 2CWTA 3CNXA 4EW5A 1J2BA 1OF5B 4HM1B 4AKZA 3WOEB 4WWUC 1BIRA 1K8A4 1FW7A 1FUTA 2RNTA 1N8R4 1ROAA 3FG3A 5CK6A 4XDWA 3BNEA 4OK0A 3NQYA 5FW5A 1BSBA 1RN7A 2XR8B 3B4PA 4R4KA 2CG0A 1T3BA 4K90B 5M1AA 1LOVA 3JUOA 2FNQA 4XBYA 3ZFZA 4X2OA 3X41A 1ZGXA 2ZA4A 2GBXB 3M8CA 2BMOB 2MF7A 1G02A 3MG1A 2WGQA 3DGMA 1NJI4 3EBYA 2K3DA 2KF4A 1YJ93 2UX0A 1QAFA 1W00A 3SOAA 3V98A 1JZOA 3JUNA 4LGQA 3AHSA 3OWSA 4L7KA 5AEWB 1MNLA 5AI1A 4AKYA 2W9QA 2H0HA 2XFTA 1JB5A 1UCLA 1YNVX 1RGEA 1SARA 1RMSA 7RNTA 2XGNA 3S67A 4O02B 4O3VA 3KSPA 3GAXA 3LT8A 2D1WA 1TJDA 5BU4A 4XM4A 4EYCA 1X1WA 3D4AA 4N3VA 3NQZA 5IEOA 3F14A 3K0ZA 1RRLA 1FGRA 1B20A 3EJVA 4N6LA 5D83A 2W56B 1YIJ3 1CH0A 2WOHA 1LOWA 1BOXA 3CD63 3PS8A 1CYVA 5IG3A 3F40A 3MYTA 1RCLA 5EEOA 2K54A 3PCSA 2OQEA 3ZG5A 1JKGA 1LXEA 2CH9A 1M9GA 4ZM8A 2XF3A 4NREA 1JBSA 3QK9A 1M1XB 2RSXA 2KF3A 2SARA 4OVMA 3RNTA 1B3SA 1ZO2A 3SXXA 1UI7A 1B21A 1PFPA 4BL3A 1IQXA 3X40A 1G0TA 1IU7A 1K41A
chains in the Genus database with same CATH topology
1Q9EA 1C54A 1RNTA 1BNFA 3AHWA 2AADA 5BIRA 1RCKA 1RN1A 1RGGA 1RNBA 1B2XA 1PY3A 1GSPA 1RGFA 1I70A 1B2SA 2C4BA 1RDSA 3WR2A 1TRQA 1HZ1A 1AQZA 1DE3A 1BRNL 6RNTA 3HOHA 2BIRA 1YGWA 5GSPA 1I2FA 1BVIA 8RNTA 1JBTA 1BSDA 1BU4A 1BSCA 3AGOA 9RNTA 1GMQA 1B2UA 3URPA 1B2MA 1UCIA 1RLSA 1PYLA 1JBRA 1BUJA 1X1UA 2F5WA 1GOVA 1AY7A 1LNIA 2F4YA 1BGSA 1BNJA 1GMRA 4BIRA 1RGHA 1RGAA 1BSEA 3WHOA 1I3FA 1BNEA 1TTOA 1RGKA 1X1YA 1RTUA 5RNTA 1RN4A 1RHLA 2AAEA 1BRHA 3BU4A 1GMPA 4GSPA 1MGRA 1T2HA 1BIRA 2F56A 1FW7A 1I0VA 2F5MA 1FUTA 2RNTA 1B27A 1BAOA 3DH2A 1GOUA 1RGLA 1YVSA 1BSBA 5HOHA 1RGCA 4HOHA 1I2EA 1LOVA 1BRGA 1BRSA 1ZGXA 2RBIA 1BRJA 2ZA4A 3A5EA 4RNTA 1BNSA 7GSPA 3KCHA 1G02A 2KF4A 1LOYA 4HAAA 1T2IA 2GSPA 1BANA 1MGWA 1BNGA 3D5IA 2HOHA 3AHSA 3DGYA 3SYUA 6GSPA 1BNIA 1I0XA 1IYYA 1UCLA 1YNVX 1RGEA 1SARA 1RMSA 2KF5A 7RNTA 1GOYA 1BSAA 1RSNA 1BRKA 2BU4A 4BU4A 5BU4A 1X1WA 3D4AA 1B20A 1TRPA 1X1XA 1CH0A 1DETA 1BRIA 1LOWA 1B2ZA 1A2PA 1BOXA 1I8VA 1I2GA 3BIRA 1UCJA 3Q3FA 4GHOA 1BNRA 1RCLA 1FYSA 3D5GA 1JBSA 1LRAA 2KF6A 1R4YA 1FZUA 1I3IA 1HYFA 2KF3A 2SARA 3GSPA 3RNTA 4J5KA 1B3SA 3AGNA 1UCKA 1B21A 4J5GA 2KAAA 1FUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9E A;  1C54 A;  1RNT A;  1BNF A;  3AHW A;  2AAD A;  5BIR A;  1RCK A;  1RN1 A;  1RGG A;  1RNB A;  1B2X A;  1PY3 A;  1GSP A;  1RGF A;  1I70 A;  1B2S A;  2C4B A;  1RDS A;  3WR2 A;  1TRQ A;  1HZ1 A;  1AQZ A;  1DE3 A;  1BRN L;  6RNT A;  3HOH A;  2BIR A;  1YGW A;  5GSP A;  1I2F A;  1BVI A;  8RNT A;  1JBT A;  1BSD A;  1BU4 A;  1BSC A;  3AGO A;  9RNT A;  1GMQ A;  1B2U A;  3URP A;  1B2M A;  1UCI A;  1RLS A;  1PYL A;  1JBR A;  1BUJ A;  1X1U A;  2F5W A;  1GOV A;  1AY7 A;  1LNI A;  2F4Y A;  1BGS A;  1BNJ A;  1GMR A;  4BIR A;  1RGH A;  1RGA A;  1BSE A;  3WHO A;  1I3F A;  1BNE A;  1TTO A;  1RGK A;  1X1Y A;  1RTU A;  5RNT A;  1RN4 A;  1RHL A;  2AAE A;  1BRH A;  3BU4 A;  1GMP A;  4GSP A;  1MGR A;  1T2H A;  1BIR A;  2F56 A;  1FW7 A;  1I0V A;  2F5M A;  1FUT A;  2RNT A;  1B27 A;  1BAO A;  3DH2 A;  1GOU A;  1RGL A;  1YVS A;  1BSB A;  5HOH A;  1RGC A;  4HOH A;  1I2E A;  1LOV A;  1BRG A;  1BRS A;  1ZGX A;  2RBI A;  1BRJ A;  2ZA4 A;  3A5E A;  4RNT A;  1BNS A;  7GSP A;  3KCH A;  1G02 A;  2KF4 A;  1LOY A;  4HAA A;  1T2I A;  2GSP A;  1BAN A;  1MGW A;  1BNG A;  3D5I A;  2HOH A;  3AHS A;  3DGY A;  3SYU A;  6GSP A;  1BNI A;  1I0X A;  1IYY A;  1UCL A;  1YNV X;  1RGE A;  1SAR A;  1RMS A;  2KF5 A;  7RNT A;  1GOY A;  1BSA A;  1RSN A;  1BRK A;  2BU4 A;  4BU4 A;  5BU4 A;  1X1W A;  3D4A A;  1B20 A;  1TRP A;  1X1X A;  1CH0 A;  1DET A;  1BRI A;  1LOW A;  1B2Z A;  1A2P A;  1BOX A;  1I8V A;  1I2G A;  3BIR A;  1UCJ A;  3Q3F A;  4GHO A;  1BNR A;  1RCL A;  1FYS A;  3D5G A;  1JBS A;  1LRA A;  2KF6 A;  1R4Y A;  1FZU A;  1I3I A;  1HYF A;  2KF3 A;  2SAR A;  3GSP A;  3RNT A;  4J5K A;  1B3S A;  3AGN A;  1UCK A;  1B21 A;  4J5G A;  2KAA A;  1FUS A; 
#chains in the Genus database with same CATH topology
 3AHW A;  2AAD A;  5BIR A;  1RN1 A;  2R4I A;  1N9J A;  1W2B 2;  1A90 A;  3K63 A;  2LQV A;  3NM2 A;  1PY3 A;  2CKF B;  3KII A;  2ZHX B;  1RGF A;  1UUG B;  1Y4K A;  3IMA B;  3Q90 A;  1D6U A;  3G6E 3;  1IQY A;  5AYS C;  3GZY B;  2J8X B;  2INX A;  3PZW A;  2E2V A;  2ML5 A;  2UUG C;  1BRN L;  2I9W A;  3NBB A;  2RCD A;  3IJE B;  3ROB A;  3SVA A;  1VQO 3;  5I97 A;  4CCV A;  2L1S A;  2Z6B A;  1WMO A;  4X2H A;  1BU4 A;  1BSC A;  3PGB A;  2HMJ B;  1S5A A;  2OQE C;  3AMO A;  9RNT A;  3QRD A;  1GMQ A;  4FCZ A;  1UW1 A;  3OWU A;  1OHS A;  2CW9 A;  3L0R A;  1M1K 4;  1JBR A;  1SIH A;  2A15 A;  2W04 A;  1O7W B;  1YGE A;  4HM2 B;  1FGO A;  2H0I A;  4R80 A;  2CG1 A;  3V92 A;  4R1K A;  1LNI A;  2P0X A;  4MMY B;  1IV7 A;  3FH1 A;  4HM7 B;  1BNJ A;  1RGA A;  2Z76 A;  4XBX A;  1DMN A;  1VQ9 3;  2HMK B;  2Z7A A;  1F8N A;  1WMP A;  1DYU A;  1K73 4;  2CK3 H;  3Q2P A;  2E2T A;  3DGL A;  4L8O A;  3STD A;  1U5O A;  4HM6 B;  1UI8 A;  2OOV A;  1RHL A;  2QIY A;  4ORL A;  3RGR A;  3FCS B;  1JNQ A;  2XEP A;  5LC6 A;  1Q7H A;  2GXF A;  1IVX A;  4MMX B;  1TIJ A;  1OAC A;  3JVC A;  3EF8 A;  1OGZ A;  2CHC A;  2O9U X;  2F56 A;  3LTD A;  1PU4 A;  1I0V A;  3CCE 3;  1AV4 A;  1B27 A;  1BAO A;  1LVN A;  1FUW A;  1WTH A;  3LXU X;  3GZR A;  3AMO B;  1T5Y A;  3UJM A;  3EQQ B;  4GL6 A;  3FF0 A;  1RGC A;  2OCT A;  4HOH A;  1I2E A;  3S5C A;  1BRS A;  3CCL 3;  1QAK A;  3LH4 A;  1AVL A;  1BRJ A;  1BUQ A;  1TFO A;  3FLJ A;  3KCH A;  4PEJ A;  1O7G B;  2STD A;  1MGW A;  5CXO A;  2CX0 A;  2C11 A;  2HOH A;  1EA2 A;  3CCS 3;  5AIF A;  1IDP A;  1O7P B;  2OOV C;  4J8T A;  1DMM A;  2KF5 A;  5G2G A;  1GOY A;  1BSA A;  2WOF A;  4O2H A;  2BU4 A;  3KFQ C;  4KFD A;  3G0K A;  1RJO A;  3T0U A;  3ECF A;  5IG5 A;  4BL2 A;  4KFF A;  1VZZ A;  3BND A;  1X1X A;  4FMA A;  1V74 A;  3HII A;  2GEX A;  1NDO B;  3OX9 A;  1TU5 A;  1Q42 A;  2CFL A;  1UCJ A;  3D3L A;  5ELU A;  5IW9 A;  1O7H B;  1STD A;  1W02 A;  1W7C A;  2E2U A;  3CCU 3;  3CC4 3;  3D5G A;  1EQK A;  1W6Y A;  4MEI A;  2CX1 A;  1R4Y A;  4K61 A;  3EE1 A;  1R4C A;  3X3Y A;  1TFK A;  2KRT A;  5KP1 A;  2GU1 A;  4N6U A;  1KWI A;  3CPW 2;  2RGQ A;  3EN1 B;  1W4N A;  3F7S A;  5IG0 A;  3HI7 A;  3IPT A;  3H51 A;  4J5G A;  2QGU A;  4HZB B;  5BXQ A;  2KAA A;  2IA7 A;  3CPO A;  1EG9 B;  4R9K A;  2RFR A;  3ZG0 A;  5JPU A;  1RNT A;  1VQL 3;  3CCJ 3;  2HMM B;  1RCK A;  2KXG A;  5G1L A;  4N6N B;  1OUN A;  3LOY A;  3GZB A;  1VQP 3;  4FMB A;  1V58 A;  1ZS7 A;  2K0M A;  3BB9 A;  3K9M C;  4K1V A;  1S72 3;  1I70 A;  1IV9 A;  2C4B A;  2YX9 A;  4EC6 A;  2XFS A;  2XSO B;  1RDS A;  1D6Z A;  3N8B A;  4LMI A;  1NWW A;  4HM3 B;  2IYJ A;  4I5Q A;  2JDI H;  4TX4 A;  2CC3 A;  3HOH A;  2BIR A;  4Q53 A;  1Q81 4;  1YGW A;  5GSP A;  1I2F A;  3CCQ 3;  1BVI A;  2HMN B;  4IIA A;  8RNT A;  4FMC A;  1IT7 A;  1BSD A;  3DZL A;  3AGO A;  5EVH A;  4BTY A;  2CFD A;  3I56 3;  3LML A;  5STD A;  1B2U A;  1UCI A;  1KQS 2;  2UGI A;  2LYX A;  2V1L A;  3NXJ A;  4NPB A;  4GB5 A;  4BTW A;  1PYL A;  2BO9 B;  3H3H A;  1BUJ A;  3KZT A;  3HIG A;  2BMR B;  1BGS A;  1GMR A;  2F98 A;  1RGH A;  1W6G A;  3S29 A;  1VQN 3;  1AR0 A;  3J7Y d;  3CU3 A;  5AYR B;  2KCD A;  1EEJ A;  2WO0 A;  4HYZ A;  1I3F A;  5M19 A;  3D9R A;  1TTO A;  1JB4 A;  1RGK A;  3BNC A;  1EKM A;  5JBS A;  1IVV A;  3VGN A;  1RTU A;  1IVU A;  2SBL A;  1YJW 3;  3O8Y A;  1JJ2 2;  1E3V A;  1Z1S A;  4HM0 B;  5IF6 A;  1QVG 2;  2AAE A;  1A2K A;  3WMD A;  3T8U A;  3BU4 A;  1O7M B;  8CHO A;  1KSI A;  2B24 B;  3JUP A;  3N54 B;  4FMD A;  4H61 A;  4U13 A;  4G1M B;  1MGR A;  2BT3 A;  3SX1 A;  2HML B;  5IEN A;  1OH0 A;  3CME 3;  1GY5 A;  1UGI A;  1EUI C;  1YVS A;  4CPK A;  4XB5 A;  1WQL B;  3UL6 A;  5HOH A;  1Q40 A;  3T8N A;  2PZV A;  1A2V A;  2CFK A;  1NU3 A;  2GBW B;  3ER7 A;  1RKY A;  1QVF 2;  3E99 A;  1QMA A;  3PXM A;  3A5E A;  3Q1C A;  2CFW A;  3F9S A;  4RNT A;  3WOD G;  3OV4 A;  1VQ7 3;  2W03 A;  1JB2 A;  1E97 A;  3N9H A;  3V99 A;  2QA4 3;  2GSP A;  1BAN A;  2F86 B;  3D5I A;  3EBT A;  4EV5 A;  3DGY A;  3SYU A;  3MPH A;  3CC2 3;  1Q82 4;  1I0X A;  4LZI A;  1A67 A;  1US1 A;  1IYY A;  2PNC A;  1ZX2 A;  1LNH A;  1STF I;  3LYG A;  1UUW B;  4KZ1 A;  4N6O B;  1RRH A;  4EV2 A;  2XGL A;  1RSN A;  1BRK A;  2XSH B;  4WP5 A;  5DRE A;  3S28 A;  5D82 A;  3OW2 2;  1OHP A;  1SPU A;  1N5P A;  1LQG C;  3UL5 A;  4FR9 A;  4AEQ A;  1TRP A;  2R41 A;  4RNZ A;  3PYJ A;  4JRF A;  2QEX 3;  1GD3 A;  1DET A;  3U1W A;  1A2P A;  1I8V A;  3D79 A;  2IUJ A;  3HX8 A;  2P38 A;  1C7H A;  1OCV A;  2B1X B;  1FA3 A;  1ASK A;  4GHO A;  3G8Z A;  1JN5 A;  1FYS A;  5G1K A;  3K5T A;  2O3O A;  1GS3 A;  1Q40 B;  1W5Z A;  3FG4 A;  4KFE A;  1FZU A;  1VQK 3;  1I3I A;  1HYF A;  1SJW A;  3GSP A;  3GWR A;  4KVH A;  1MWR A;  1CYU A;  4J5K A;  3LT9 A;  3AGN A;  2W6J H;  3GRD A;  4QWT A;  4LSO A;  2HMO B;  4MJD A;  1CQS A;  3FKA A;  1Q9E A;  5KP3 A;  1BNF A;  5TGN A;  1RGG A;  1VQ6 3;  1UGH I;  3DGO A;  5AEU B;  1B2X A;  2BHM A;  3HK4 A;  3KSE D;  5IEP A;  1GSP A;  2CWU A;  1OPY A;  3DM8 A;  1B2S A;  1CEW I;  4LEH A;  3BNB A;  3WR2 A;  5AIH A;  3EC9 A;  1HZ1 A;  1QAL A;  1V57 A;  1JRQ A;  1DE3 A;  4HZ9 B;  1SQW A;  4RNY A;  4JF8 A;  4HM5 B;  3G4S 3;  2IMJ A;  3DUK A;  3URP A;  4WFO A;  5LC7 A;  1AVK A;  1JN5 B;  1MWT A;  3X3X A;  5M18 A;  1RLS A;  1M90 4;  4EBG A;  1GY6 A;  1WMN A;  2OTL 3;  1QJG A;  3NV0 A;  4FCJ A;  2F5W A;  3JUQ A;  3MKI A;  2ML6 A;  1YI2 3;  1AY7 A;  1ULJ B;  1KD1 4;  3FF2 A;  3FZW A;  2WGO A;  1YVB I;  1LOX A;  1VQ5 3;  4LYL B;  3WOF B;  1IVW A;  1NB5 I;  3CCR 3;  2W9P A;  7STD A;  2ZDJ A;  5HGR A;  3CCM 3;  2IUK A;  2JQ5 A;  3SOY A;  1X1Y A;  3DMC A;  3F8X A;  3CMA 3;  5IER A;  1GYB A;  1RN4 A;  1UUV B;  3DGN A;  3X42 A;  3NUV A;  1IQ8 A;  1G96 A;  2P09 A;  3VF1 A;  3B8L A;  2D42 A;  3LZA A;  1ULI B;  1SII A;  1BRH A;  3RGA A;  4OUQ A;  2CWV A;  3MHE A;  2BNG A;  4GSP A;  4H3U A;  4N6T A;  3I0Y A;  1N8Q A;  3OXA A;  1T2H A;  4HVN A;  5KP4 A;  2F5M A;  3CNM A;  5DRV A;  3KKG A;  3DH2 A;  3HZP A;  4NHF A;  2OTJ 3;  1GOU A;  3LTC A;  4I4K A;  1RGL A;  4N6V 0;  1VQ8 3;  4WYK A;  3FGY A;  5CF2 A;  2Y73 A;  1VQM 3;  1BRG A;  4CDL A;  3NM7 A;  2Y74 A;  1GY7 A;  4IPB A;  1N5H A;  4STD A;  2RBI A;  1Q86 4;  1E3R A;  1BNS A;  1W2Z A;  3NV0 B;  4FCM A;  4WHA A;  5A0O B;  7GSP A;  3CCV 3;  1K28 A;  1LOY A;  2P0M A;  3K7C A;  5AIG A;  4HAA A;  4HBR A;  1T2I A;  4MMZ B;  3F7X A;  4HJL B;  1BNG A;  2BMQ B;  1VQQ A;  1DVC A;  3S27 A;  1JZD A;  1O7N B;  1NO3 A;  6GSP A;  4R9L A;  1BNI A;  5EQL A;  2W2C A;  2W0Q A;  4ILF A;  5FGO A;  5BVB A;  2GU3 A;  1FGT A;  2CIU A;  4K1U A;  4BU4 A;  2L4V A;  3JUM A;  2Z77 A;  1KC8 4;  1LQM B;  2Q07 A;  2ZL8 A;  5ELJ A;  2YFJ B;  1GD4 A;  1YJN 3;  1K9M 4;  5IG4 A;  3TDG A;  3U97 A;  1BRI A;  1B2Z A;  1TP6 A;  3OWY A;  1I2G A;  3BIR A;  3Q3F A;  3NBR A;  1BNR A;  3NX0 A;  1FGM A;  3MG2 A;  1IT8 A;  3G71 3;  3FSD A;  2GEY A;  1YIT 3;  1LRA A;  5CLK A;  3GZX B;  2KF6 A;  3KN4 A;  4WYK B;  3F8H A;  3FG1 A;  4O8S A;  1YHQ 3;  1Q7Y 4;  1U8C B;  1NB3 I;  1FGQ A;  1HKX A;  4HKV B;  3MSO A;  1DMQ A;  1UCK A;  2H0G A;  4KT3 B;  6STD A;  1JKG B;  1ROV A;  3LTB A;  1N9E A;  5JPP A;  1FUS A;  3I55 3;  1C54 A;  3NBJ A;  1W6C A;  3DY5 A;  1OHO A;  3BLZ A;  1HU9 A;  3UB1 A;  3NHX A;  1RNB A;  5D81 A;  3B4O A;  2MC8 A;  3B7C A;  1MOL A;  5AII A;  2M7O A;  4J9A A;  1W01 A;  3WDG B;  3SED A;  3ALA A;  3VSY A;  1OF5 A;  1TRQ A;  1AQZ A;  4DKI A;  2F99 A;  2C10 A;  6RNT A;  1WNH A;  2OWP A;  3X3Z A;  1JBT A;  4HM4 B;  1ISK A;  2P05 A;  1MWS A;  3MG3 A;  1B2M A;  1MWU A;  2CFG A;  1JV2 B;  1D6Y A;  3A76 A;  3G16 A;  3KE7 A;  2YFL B;  2YFI B;  3SLU A;  3EHC A;  4XDV A;  1L5G B;  1DVD A;  2XRX B;  4L8P A;  1X1U A;  3CXC 2;  1GOV A;  4XBT A;  2F4Y A;  4BIR A;  3WA2 X;  2FXT A;  4RBN A;  4HM8 B;  3EN8 A;  1IK3 A;  4EXR A;  3WA3 A;  1BSE A;  1TUH A;  3WHO A;  1BNE A;  3CC7 3;  4N6M A;  2XH9 A;  2FGT A;  3LTA A;  4CJN A;  3EB8 A;  4IT7 A;  1NNV A;  5CF1 A;  5RNT A;  4RZM A;  1OGX A;  2IY2 A;  1VQ4 3;  3RDE A;  3DXO A;  1UDI I;  3UNL A;  3EX9 A;  3MWZ A;  1GMP A;  2W56 A;  3PCR A;  4BTX A;  2CWT A;  3CNX A;  4EW5 A;  1J2B A;  1OF5 B;  4HM1 B;  4AKZ A;  3WOE B;  4WWU C;  1BIR A;  1K8A 4;  1FW7 A;  1FUT A;  2RNT A;  1N8R 4;  1ROA A;  3FG3 A;  5CK6 A;  4XDW A;  3BNE A;  4OK0 A;  3NQY A;  5FW5 A;  1BSB A;  1RN7 A;  2XR8 B;  3B4P A;  4R4K A;  2CG0 A;  1T3B A;  4K90 B;  5M1A A;  1LOV A;  3JUO A;  2FNQ A;  4XBY A;  3ZFZ A;  4X2O A;  3X41 A;  1ZGX A;  2ZA4 A;  2GBX B;  3M8C A;  2BMO B;  2MF7 A;  1G02 A;  3MG1 A;  2WGQ A;  3DGM A;  1NJI 4;  3EBY A;  2K3D A;  2KF4 A;  1YJ9 3;  2UX0 A;  1QAF A;  1W00 A;  3SOA A;  3V98 A;  1JZO A;  3JUN A;  4LGQ A;  3AHS A;  3OWS A;  4L7K A;  5AEW B;  1MNL A;  5AI1 A;  4AKY A;  2W9Q A;  2H0H A;  2XFT A;  1JB5 A;  1UCL A;  1YNV X;  1RGE A;  1SAR A;  1RMS A;  7RNT A;  2XGN A;  3S67 A;  4O02 B;  4O3V A;  3KSP A;  3GAX A;  3LT8 A;  2D1W A;  1TJD A;  5BU4 A;  4XM4 A;  4EYC A;  1X1W A;  3D4A A;  4N3V A;  3NQZ A;  5IEO A;  3F14 A;  3K0Z A;  1RRL A;  1FGR A;  1B20 A;  3EJV A;  4N6L A;  5D83 A;  2W56 B;  1YIJ 3;  1CH0 A;  2WOH A;  1LOW A;  1BOX A;  3CD6 3;  3PS8 A;  1CYV A;  5IG3 A;  3F40 A;  3MYT A;  1RCL A;  5EEO A;  2K54 A;  3PCS A;  2OQE A;  3ZG5 A;  1JKG A;  1LXE A;  2CH9 A;  1M9G A;  4ZM8 A;  2XF3 A;  4NRE A;  1JBS A;  3QK9 A;  1M1X B;  2RSX A;  2KF3 A;  2SAR A;  4OVM A;  3RNT A;  1B3S A;  1ZO2 A;  3SXX A;  1UI7 A;  1B21 A;  1PFP A;  4BL3 A;  1IQX A;  3X40 A;  1G0T A;  1IU7 A;  1K41 A; 
#chains in the Genus database with same CATH homology
 1Q9E A;  1C54 A;  1RNT A;  1BNF A;  3AHW A;  2AAD A;  5BIR A;  1RCK A;  1RN1 A;  1RGG A;  1RNB A;  1B2X A;  1PY3 A;  1GSP A;  1RGF A;  1I70 A;  1B2S A;  2C4B A;  1RDS A;  3WR2 A;  1TRQ A;  1HZ1 A;  1AQZ A;  1DE3 A;  1BRN L;  6RNT A;  3HOH A;  2BIR A;  1YGW A;  5GSP A;  1I2F A;  1BVI A;  8RNT A;  1JBT A;  1BSD A;  1BU4 A;  1BSC A;  3AGO A;  9RNT A;  1GMQ A;  1B2U A;  3URP A;  1B2M A;  1UCI A;  1RLS A;  1PYL A;  1JBR A;  1BUJ A;  1X1U A;  2F5W A;  1GOV A;  1AY7 A;  1LNI A;  2F4Y A;  1BGS A;  1BNJ A;  1GMR A;  4BIR A;  1RGH A;  1RGA A;  1BSE A;  3WHO A;  1I3F A;  1BNE A;  1TTO A;  1RGK A;  1X1Y A;  1RTU A;  5RNT A;  1RN4 A;  1RHL A;  2AAE A;  1BRH A;  3BU4 A;  1GMP A;  4GSP A;  1MGR A;  1T2H A;  1BIR A;  2F56 A;  1FW7 A;  1I0V A;  2F5M A;  1FUT A;  2RNT A;  1B27 A;  1BAO A;  3DH2 A;  1GOU A;  1RGL A;  1YVS A;  1BSB A;  5HOH A;  1RGC A;  4HOH A;  1I2E A;  1LOV A;  1BRG A;  1BRS A;  1ZGX A;  2RBI A;  1BRJ A;  2ZA4 A;  3A5E A;  4RNT A;  1BNS A;  7GSP A;  3KCH A;  1G02 A;  2KF4 A;  1LOY A;  4HAA A;  1T2I A;  2GSP A;  1BAN A;  1MGW A;  1BNG A;  3D5I A;  2HOH A;  3AHS A;  3DGY A;  3SYU A;  6GSP A;  1BNI A;  1I0X A;  1IYY A;  1UCL A;  1YNV X;  1RGE A;  1SAR A;  1RMS A;  2KF5 A;  7RNT A;  1GOY A;  1BSA A;  1RSN A;  1BRK A;  2BU4 A;  4BU4 A;  5BU4 A;  1X1W A;  3D4A A;  1B20 A;  1TRP A;  1X1X A;  1CH0 A;  1DET A;  1BRI A;  1LOW A;  1B2Z A;  1A2P A;  1BOX A;  1I8V A;  1I2G A;  3BIR A;  1UCJ A;  3Q3F A;  4GHO A;  1BNR A;  1RCL A;  1FYS A;  3D5G A;  1JBS A;  1LRA A;  2KF6 A;  1R4Y A;  1FZU A;  1I3I A;  1HYF A;  2KF3 A;  2SAR A;  3GSP A;  3RNT A;  4J5K A;  1B3S A;  3AGN A;  1UCK A;  1B21 A;  4J5G A;  2KAA A;  1FUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...