1B3SA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
b'AQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b3sA00
1T2HA 2BU4A 9RNTA 1RSNA 1RNBA 2C4BA 1JBSA 4BIRA 3DH2A 1I2FA 3URPA 1BSEA 1JBTA 1A2PA 1BOXA 5GSPA 1LOYA 1BNGA 2BIRA 1BRKA 1BNJA 1PY3A 2HOHA 7GSPA 1UCKA 1FW7A 1RCKA 1AQZA 1GSPA 1RGFA 1FUSA 5BU4A 1Q9EA 1RN4A 2AADA 3BIRA 1BNIA 1UCLA 3A5EA 3BU4A 1SARA 1HYFA 2KAAA 1B2MA 2F4YA 3AGOA 4GSPA 1BNRA 1I2GA 1RGKA 1G02A 1RNTA 3D5GA 1CH0A 1RLSA 1RGHA 3AGNA 1GMQA 1YGWA 5RNTA 1ZGXA 1I0XA 4RNTA 1B27A 3AHSA 1RCLA 2F5WA 1X1UA 1BGSA 1LOWA 3DGYA 1UCJA 1B2SA 1X1XA 1I3IA 1YNVX 1BVIA 1HZ1A 1BIRA 3WR2A 2KF3A 1BSBA 4J5KA 1I2EA 2F5MA 1I70A 3D4AA 1RGCA 3WHOA 1B2XA 1BANA 1BRJA 1MGRA 4HAAA 1IYYA 1FYSA 2AAEA 1PYLA 1GOUA 1DE3A 8RNTA 1GMPA 6RNTA 3D5IA 1RGGA 1BUJA 1YVSA 1C54A 1RMSA 3AHWA 5HOHA 1B21A 1RGEA 4BU4A 7RNTA 1I8VA 1BRGA 1JBRA 1B3SA 1RDSA 3RNTA 1MGWA 4GHOA 1BSAA 1LOVA 1UCIA 1FUTA 2KF5A 1RGAA 1BU4A 1DETA 3GSPA 3HOHA 3Q3FA 5BIRA 6GSPA 1BRNL 1TRPA 1LNIA 1BRIA 3SYUA 2RNTA 2GSPA 1TRQA 1I3FA 1RHLA 1BSCA 1GOYA 2F56A 1RGLA 1I0VA 1BSDA 1BRHA 1X1YA 2ZA4A 1BNFA 4HOHA 1BNEA 1X1WA 1B20A 4J5GA 3KCHA 2KF6A 1T2IA 1B2UA 1GOVA 2SARA 1FZUA 1RTUA 1BAOA 1TTOA 2RBIA 1AY7A 2KF4A 1BRSA 1LRAA 1B2ZA 1GMRA 1R4YA 1RN1A 1BNSA
chains in the Genus database with same CATH superfamily
1T2HA 3NBJA 9RNTA 3X3YA 1RSNA 2XRXB 4XBXA 2QIYA 1LOXA 1GY5A 1NU3A 3F7XA 3SOAA 2XSOB 2W2CA 2XGLA 1I2FA 1RN7A 3EC9A 4L8OA 3KSPA 4EW5A 3OWSA 2O9UX 1TU5A 1JBTA 1IVVA 2K54A 3K5TA 2YX9A 4EV5A 2B24B 1O7MB 2QGUA 2HOHA 2BIRA 4ZM8A 1BNJA 7GSPA 3I553 1ZS7A 4HM7B 2IYJA 4K1VA 3CCR3 1FUSA 5BU4A 1LQGC 3BNCA 4EYCA 5AEWB 1RN4A 3FF2A 4JRFA 3OW22 2F99A 4EXRA 5BVBA 4KFFA 4HJLB 3B4OA 1OF5B 3FH1A 4HM2B 1YIT3 1N8R4 5G1LA 3JUMA 3VSYA 1QVF2 1STFI 4HM4B 1OHOA 2CH9A 2HMLB 4O8SA 1I2GA 1RGKA 2WO0A 3MWZA 2L1SA 4NPBA 3PCSA 3STDA 1W6YA 3L0RA 3S28A 3H51A 3JUQA 1OHSA 3AMOB 1ZGXA 1N5HA 1I0XA 4RNTA 4EV2A 3I0YA 2Z77A 2YFIB 1W01A 3HIIA 2XEPA 3V99A 1X1UA 1BGSA 4EBGA 1X1XA 3WOEB 1JZOA 1BVIA 2GBXB 1MWRA 2KF3A 4EC6A 2H0HA 4RNYA 3HI7A 4R80A 4WHAA 3FCSB 3CPW2 2P09A 1N8QA 2CWTA 3KFQC 2OTJ3 4BTYA 1NO3A 1RGCA 4O3VA 1YJ93 3WHOA 3PS8A 4HAAA 2BMOB 1FYSA 3ALAA 3B4PA 1O7NB 5AIGA 2WGQA 4BL3A 1IK3A 1OUNA 2CFKA 4HM0B 2M7OA 2Z76A 5IF6A 1EEJA 4XB5A 2W56B 1JBRA 3OWYA 1RDSA 4AKZA 4AKYA 4OUQA 1UUWB 1ZX2A 3LMLA 1E3VA 2MF7A 2CWVA 1V57A 2K3DA 1VQM3 1NJI4 1ISKA 1T5YA 5M19A 1LOVA 5G1KA 1FUTA 3PCRA 3U97A 2XFSA 3K9MC 4FR9A 3NBBA 1BU4A 3V98A 3GSPA 1T3BA 2OCTA 3CNMA 3HOHA 3LTDA 3FG1A 1UW1A 1UUGB 4H3UA 4HZ9B 6GSPA 3CC23 3SXXA 1TRPA 1BRIA 3WOFB 2RNTA 3FF0A 2GSPA 4FCJA 3GZYB 3O8YA 1IQYA 3D79A 1ULJB 1RHLA 1EUIC 1DVCA 4NREA 1JB2A 4BL2A 1X1YA 1U5OA 1O7GB 3GWRA 1O7PB 3V92A 4MMXB 1M1K4 1B20A 4FCMA 4RBNA 4WYKB 1T2IA 1B2UA 1GOVA 3CU3A 4OVMA 3CCV3 1UGHI 3RGRA 1W5ZA 5CLKA 3MKIA 1BAOA 3G8ZA 2PZVA 2YFJB 2HMOB 1AY7A 1UUVB 2A15A 4O2HA 1OF5A 1QAKA 3FSDA 3JUOA 5KP1A 1TP6A 4H61A 1RN1A 5IW9A 1IQ8A 3G4S3 2OTL3 1YIJ3 1O7HB 2BT3A 3Q90A 2GU1A 1ULIB 2STDA 1JN5B 3DGLA 2CFGA 3SEDA 5M1AA 3DH2A 3URPA 1UI7A 1WMPA 2KCDA 4GB5A 1QALA 1N5PA 2RFRA 4K1UA 4TX4A 1BOXA 2IUJA 5GSPA 1KC84 4R9KA 1SPUA 2HMJB 3KSED 1SIIA 3S67A 1LNHA 4U13A 2BHMA 1PY3A 1KQS2 4HM1B 1F8NA 1Q814 1SQWA 1AQZA 3EE1A 2GXFA 4N6TA 1R4CA 2W0QA 5AYSC 2W9PA 3F40A 3EJVA 4HM5B 3BU4A 3MSOA 2CWUA 2PNCA 1G0TA 3DZLA 4WP5A 3T8UA 1Q7HA 5D83A 1B2MA 5DRVA 1FGTA 3AGOA 2SBLA 3MHEA 1WQLB 2XR8B 3NBRA 3PZWA 4GSPA 1G02A 3ZFZA 1BNRA 2XF3A 1OGXA 2W56A 1NNVA 4MJDA 1YVBI 3EN1B 3AGNA 2Y74A 1U8CB 1S5AA 2W6JH 3F7SA 1IU7A 1RCLA 5AIFA 1YHQ3 1LOWA 3DGYA 1UCJA 1B2SA 1LVNA 1IT7A 2HMMB 1TFKA 2K0MA 1A67A 1OGZA 5G2GA 3EBTA 5CF1A 1BIRA 3LT8A 1BSBA 1I2EA 3ZG0A 1Q864 1IVXA 2WOFA 2F5MA 2CW9A 3LT9A 2CG0A 3NQZA 4MMZB 3PGBA 5A0OB 1E97A 2B1XB 3BNEA 2IA7A 1B2XA 1BANA 1EA2A 1HU9A 3ROBA 3WMDA 2AAEA 3LTAA 1V74A 1JZDA 1GOUA 1VQO3 8RNTA 4L8PA 1DMNA 1RGGA 3NM2A 2YFLB 5JPPA 4WYKA 3AHWA 1GD3A 3EHCA 1B21A 4BU4A 2Z6BA 2OQEA 2W9QA 3WA3A 1B3SA 1FGOA 4O02B 4CPKA 1DVDA 3D3LA 1MGWA 1Q40B 1JB5A 3K63A 5AIIA 3KZTA 5KP4A 2F98A 1VQ43 4I5QA 1A2KA 1ASKA 1IQXA 1DMMA 2XFTA 1CQSA 3OV4A 2KF5A 3A76A 3JUNA 3QK9A 4FCZA 4FMAA 4J8TA 1Q42A 1W4NA 1VQL3 2OWPA 1KSIA 2KRTA 2C10A 3Q3FA 4NHFA 2OOVA 3F8HA 1BRNL 2E2UA 3PYJA 1JN5A 1QAFA 4RZMA 3I563 5KP3A 5IEOA 3G16A 1GOYA 4ORLA 1NB5I 2F56A 2ZDJA 1A2VA 2W04A 3FG4A 1RRLA 4N6LA 1I0VA 3S5CA 3UNLA 1BRHA 3HK4A 1GY7A 4FMBA 1NWWA 1BNFA 4HKVB 3CCM3 1JKGB 3K7CA 3LYGA 2RGQA 3BNDA 1L5GB 2KF6A 4MEIA 1MWSA 5IENA 2ZL8A 3G713 3EN8A 1TTOA 2RBIA 2UGIA 2KF4A 1TIJA 1ROVA 1LRAA 3SX1A 3M8CA 3NX0A 3UL5A 5DREA 1OHPA 3IJEB 1BNSA 3B7CA 3ECFA 5IG4A 2BU4A 4L7KA 1FA3A 1ROAA 1VQ93 3DGOA 1K28A 1EG9B 5AI1A 2C4BA 5AYRB 1AVKA 2MC8A 1GYBA 2FXTA 3FLJA 4IIAA 5HGRA 4BIRA 4DKIA 3LTBA 1K9M4 1K734 4XBTA 1QMAA 2I9WA 4STDA 4K90B 3UJMA 1YJW3 1ZO2A 1BNGA 2BO9B 2IY2A 1LXEA 3CME3 3RDEA 1D6ZA 1VQ63 1RRHA 1GSPA 1YJN3 1JJ22 1RGFA 2V1LA 2WGOA 3RNTA 1Q9EA 1IVWA 3CCU3 1TJDA 1FGMA 1BNIA 4HVNA 3A5EA 4FMDA 5D81A 2P0XA 4HM3B 4HZBB 4G1MB 5EQLA 3UB1A 2F4YA 3S29A 2R41A 4IPBA 5AEUB 3CCE3 3F9SA 5AIHA 2ML6A 1A90A 1RNTA 4LGQA 1PFPA 1MNLA 4AEQA 5IG3A 1CH0A 3OWUA 2GEYA 1JV2B 5IG0A 1W6CA 3OXAA 3LH4A 4KFDA 1Q40A 5BXQA 8CHOA 1B27A 5M18A 4XDWA 1SJWA 1NDOB 1BUQA 1VQ83 2R4IA 3FGYA 2F86B 2XSHB 3HX8A 3EBYA 4Q53A 1I3IA 3B8LA 1DMQA 3LZAA 3RGAA 1HZ1A 1PU4A 2JDIH 5EVHA 1D6YA 3WR2A 4J5KA 3SOYA 3CXC2 1IV7A 1WMOA 1Q824 3G0KA 3BB9A 3D4AA 2C11A 3CPOA 1W6GA 1HKXA 2GU3A 1IYYA 4R9LA 1MGRA 1O7WB 1FGQA 5STDA 1PYLA 3S27A 1JKGA 2UX0A 3DUKA 6RNTA 3D5IA 1YVSA 1RMSA 4N6UA 4BTXA 4RNZA 1RGEA 7RNTA 2RCDA 1I8VA 1BRGA 3X42A 3GAXA 4R4KA 1UDII 1IV9A 2Y73A 3WA2X 3N8BA 3MG1A 1VQN3 3E99A 4J9AA 5JPUA 4FMCA 1D6UA 3K0ZA 3GZRA 1LQMB 2FGTA 1DETA 3DXOA 3PXMA 3IPTA 3EF8A 5CXOA 5BIRA 2CHCA 2P0MA 4LMIA 3X40A 2XGNA 1TRQA 1BSCA 3FKAA 3VF1A 2CKFB 1Q7Y4 1TUHA 3DGMA 1BSDA 5JBSA 1RJOA 1RKYA 2ZHXB 7STDA 4QWTA 1BNEA 1X1WA 3NUVA 1TFOA 3SLUA 2QA43 4HM6B 2CFWA 2H0GA 3EB8A 2SARA 4LZIA 3T8NA 4CCVA 1N9JA 4CDLA 1RTUA 5FW5A 1EKMA 1M9GA 2UUGC 2KXGA 2CIUA 2L4VA 3KIIA 3N9HA 3NV0B 4LEHA 2XH9A 2BMRB 1W02A 2H0IA 1W2ZA 1CYVA 4HM8B 3TDGA 2P38A 1GMRA 2HMNB 5I97A 2FNQA 3CMA3 1EQKA 3NQYA 1N9EA 1J2BA 2IMJA 3D9RA 1OACA 2E2TA 3CC43 1WNHA 1KD14 1JBSA 5ELJA 3CCL3 2CFLA 3CC73 1BSEA 1C7HA 5IG5A 3SVAA 1A2PA 2E2VA 1VQ73 3T0UA 3F14A 2WOHA 1LOYA 2GBWB 4IT7A 5D82A 3Q1CA 4JF8A 1M904 1BRKA 1MOLA 4HBRA 1UCKA 2LYXA 1FW7A 1RCKA 2D42A 2CX1A 5LC7A 4WWUC 4CJNA 4XDVA 4BTWA 2AADA 3BIRA 4LSOA 1AR0A 3DGNA 3G6E3 3JUPA 3CD63 1JRQA 1UCLA 1UGIA 2GEXA 3HIGA 3MPHA 3NM7A 1UI8A 1MWUA 4OK0A 3F8XA 1SARA 1HYFA 2KAAA 1JB4A 3UL6A 1SIHA 3NHXA 1VQK3 5CK6A 3KKGA 4N3VA 3U1WA 3D5GA 1IDPA 3BNBA 1RLSA 1RGHA 3FZWA 1GMQA 2CC3A 1YGWA 5RNTA 1DYUA 3BLZA 4N6OB 3X3XA 3N54B 3AHSA 4R1KA 2QEX3 3EQQB 2F5WA 4KFEA 3NXJA 3MYTA 2ML5A 5IEPA 1S723 1NB3I 5CF2A 1YNVX 1Z1SA 3Q2PA 1IT8A 1W7CA 1WMNA 5IERA 1QJGA 3QRDA 1CYUA 1VQ53 6STDA 1I70A 1FGRA 1GD4A 3CCQ3 1V58A 1W2B2 3ER7A 1BRJA 4LYLB 2OQEC 3EX9A 3LTCA 4N6V0 3X41A 1KWIA 2Q07A 4K61A 1OPYA 3KN4A 2BMQB 2J8XB 3LOYA 4GL6A 1GMPA 2JQ5A 1DE3A 4ILFA 1M1XB 4X2OA 1BUJA 4WFOA 1CEWI 3DMCA 3VGNA 5HOHA 1C54A 3MG3A 3CCJ3 1Y4KA 3IMAB 1OCVA 1AVLA 3OX9A 2CG1A 4XBYA 2OOVC 3LXUX 1W00A 3DY5A 3FG3A 4GHOA 4KT3B 4KVHA 4MMYB 2D1WA 3NV0A 1VZZA 2RSXA 1BSAA 1E3RA 1UCIA 3CNXA 4KZ1A 3WODG 1GY6A 1K41A 3CCS3 3HZPA 1RGAA 3JVCA 3ZG5A 2IUKA 3WDGB 2LQVA 4HYZA 2HMKB 5ELUA 1LNIA 3SYUA 1AV4A 1YGEA 1I3FA 2W03A 2CK3H 3AMOA 4X2HA 2P05A 1G96A 3X3ZA 1RGLA 1VQP3 1QVG2 1GS3A 3MG2A 3H3HA 1RNBA 2ZA4A 3GRDA 4I4KA 4PEJA 2BNGA 4HOHA 1K8A4 1FUWA 1IVUA 1WTHA 4J5GA 1YI23 5EEOA 3KCHA 3J7Yd 1JNQA 3GZBA 2INXA 2CX0A 1FZUA 2Z7AA 2O3OA 3KE7A 2CFDA 3GZXB 4N6NB 4N6MA 3DM8A 1OH0A 4XM4A 5TGNA 1BRSA 5LC6A 5FGOA 1STDA 1VQQA 1B2ZA 1US1A 1R4YA 1MWTA
chains in the Genus database with same CATH topology
1T2HA 2BU4A 9RNTA 1RSNA 1RNBA 2C4BA 1JBSA 4BIRA 3DH2A 1I2FA 3URPA 1BSEA 1JBTA 1A2PA 1BOXA 5GSPA 1LOYA 1BNGA 2BIRA 1BRKA 1BNJA 1PY3A 2HOHA 7GSPA 1UCKA 1FW7A 1RCKA 1AQZA 1GSPA 1RGFA 1FUSA 5BU4A 1Q9EA 1RN4A 2AADA 3BIRA 1BNIA 1UCLA 3A5EA 3BU4A 1SARA 1HYFA 2KAAA 1B2MA 2F4YA 3AGOA 4GSPA 1BNRA 1I2GA 1RGKA 1G02A 1RNTA 3D5GA 1CH0A 1RLSA 1RGHA 3AGNA 1GMQA 1YGWA 5RNTA 1ZGXA 1I0XA 4RNTA 1B27A 3AHSA 1RCLA 2F5WA 1X1UA 1BGSA 1LOWA 3DGYA 1UCJA 1B2SA 1X1XA 1I3IA 1YNVX 1BVIA 1HZ1A 1BIRA 3WR2A 2KF3A 1BSBA 4J5KA 1I2EA 2F5MA 1I70A 3D4AA 1RGCA 3WHOA 1B2XA 1BANA 1BRJA 1MGRA 4HAAA 1IYYA 1FYSA 2AAEA 1PYLA 1GOUA 1DE3A 8RNTA 1GMPA 6RNTA 3D5IA 1RGGA 1BUJA 1YVSA 1C54A 1RMSA 3AHWA 5HOHA 1B21A 1RGEA 4BU4A 7RNTA 1I8VA 1BRGA 1JBRA 1B3SA 1RDSA 3RNTA 1MGWA 4GHOA 1BSAA 1LOVA 1UCIA 1FUTA 2KF5A 1RGAA 1BU4A 1DETA 3GSPA 3HOHA 3Q3FA 5BIRA 6GSPA 1BRNL 1TRPA 1LNIA 1BRIA 3SYUA 2RNTA 2GSPA 1TRQA 1I3FA 1RHLA 1BSCA 1GOYA 2F56A 1RGLA 1I0VA 1BSDA 1BRHA 1X1YA 2ZA4A 1BNFA 4HOHA 1BNEA 1X1WA 1B20A 4J5GA 3KCHA 2KF6A 1T2IA 1B2UA 1GOVA 2SARA 1FZUA 1RTUA 1BAOA 1TTOA 2RBIA 1AY7A 2KF4A 1BRSA 1LRAA 1B2ZA 1GMRA 1R4YA 1RN1A 1BNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2H A;  2BU4 A;  9RNT A;  1RSN A;  1RNB A;  2C4B A;  1JBS A;  4BIR A;  3DH2 A;  1I2F A;  3URP A;  1BSE A;  1JBT A;  1A2P A;  1BOX A;  5GSP A;  1LOY A;  1BNG A;  2BIR A;  1BRK A;  1BNJ A;  1PY3 A;  2HOH A;  7GSP A;  1UCK A;  1FW7 A;  1RCK A;  1AQZ A;  1GSP A;  1RGF A;  1FUS A;  5BU4 A;  1Q9E A;  1RN4 A;  2AAD A;  3BIR A;  1BNI A;  1UCL A;  3A5E A;  3BU4 A;  1SAR A;  1HYF A;  2KAA A;  1B2M A;  2F4Y A;  3AGO A;  4GSP A;  1BNR A;  1I2G A;  1RGK A;  1G02 A;  1RNT A;  3D5G A;  1CH0 A;  1RLS A;  1RGH A;  3AGN A;  1GMQ A;  1YGW A;  5RNT A;  1ZGX A;  1I0X A;  4RNT A;  1B27 A;  3AHS A;  1RCL A;  2F5W A;  1X1U A;  1BGS A;  1LOW A;  3DGY A;  1UCJ A;  1B2S A;  1X1X A;  1I3I A;  1YNV X;  1BVI A;  1HZ1 A;  1BIR A;  3WR2 A;  2KF3 A;  1BSB A;  4J5K A;  1I2E A;  2F5M A;  1I70 A;  3D4A A;  1RGC A;  3WHO A;  1B2X A;  1BAN A;  1BRJ A;  1MGR A;  4HAA A;  1IYY A;  1FYS A;  2AAE A;  1PYL A;  1GOU A;  1DE3 A;  8RNT A;  1GMP A;  6RNT A;  3D5I A;  1RGG A;  1BUJ A;  1YVS A;  1C54 A;  1RMS A;  3AHW A;  5HOH A;  1B21 A;  1RGE A;  4BU4 A;  7RNT A;  1I8V A;  1BRG A;  1JBR A;  1B3S A;  1RDS A;  3RNT A;  1MGW A;  4GHO A;  1BSA A;  1LOV A;  1UCI A;  1FUT A;  2KF5 A;  1RGA A;  1BU4 A;  1DET A;  3GSP A;  3HOH A;  3Q3F A;  5BIR A;  6GSP A;  1BRN L;  1TRP A;  1LNI A;  1BRI A;  3SYU A;  2RNT A;  2GSP A;  1TRQ A;  1I3F A;  1RHL A;  1BSC A;  1GOY A;  2F56 A;  1RGL A;  1I0V A;  1BSD A;  1BRH A;  1X1Y A;  2ZA4 A;  1BNF A;  4HOH A;  1BNE A;  1X1W A;  1B20 A;  4J5G A;  3KCH A;  2KF6 A;  1T2I A;  1B2U A;  1GOV A;  2SAR A;  1FZU A;  1RTU A;  1BAO A;  1TTO A;  2RBI A;  1AY7 A;  2KF4 A;  1BRS A;  1LRA A;  1B2Z A;  1GMR A;  1R4Y A;  1RN1 A;  1BNS A; 
#chains in the Genus database with same CATH topology
 1T2H A;  3NBJ A;  9RNT A;  3X3Y A;  1RSN A;  2XRX B;  4XBX A;  2QIY A;  1LOX A;  1GY5 A;  1NU3 A;  3F7X A;  3SOA A;  2XSO B;  2W2C A;  2XGL A;  1I2F A;  1RN7 A;  3EC9 A;  4L8O A;  3KSP A;  4EW5 A;  3OWS A;  2O9U X;  1TU5 A;  1JBT A;  1IVV A;  2K54 A;  3K5T A;  2YX9 A;  4EV5 A;  2B24 B;  1O7M B;  2QGU A;  2HOH A;  2BIR A;  4ZM8 A;  1BNJ A;  7GSP A;  3I55 3;  1ZS7 A;  4HM7 B;  2IYJ A;  4K1V A;  3CCR 3;  1FUS A;  5BU4 A;  1LQG C;  3BNC A;  4EYC A;  5AEW B;  1RN4 A;  3FF2 A;  4JRF A;  3OW2 2;  2F99 A;  4EXR A;  5BVB A;  4KFF A;  4HJL B;  3B4O A;  1OF5 B;  3FH1 A;  4HM2 B;  1YIT 3;  1N8R 4;  5G1L A;  3JUM A;  3VSY A;  1QVF 2;  1STF I;  4HM4 B;  1OHO A;  2CH9 A;  2HML B;  4O8S A;  1I2G A;  1RGK A;  2WO0 A;  3MWZ A;  2L1S A;  4NPB A;  3PCS A;  3STD A;  1W6Y A;  3L0R A;  3S28 A;  3H51 A;  3JUQ A;  1OHS A;  3AMO B;  1ZGX A;  1N5H A;  1I0X A;  4RNT A;  4EV2 A;  3I0Y A;  2Z77 A;  2YFI B;  1W01 A;  3HII A;  2XEP A;  3V99 A;  1X1U A;  1BGS A;  4EBG A;  1X1X A;  3WOE B;  1JZO A;  1BVI A;  2GBX B;  1MWR A;  2KF3 A;  4EC6 A;  2H0H A;  4RNY A;  3HI7 A;  4R80 A;  4WHA A;  3FCS B;  3CPW 2;  2P09 A;  1N8Q A;  2CWT A;  3KFQ C;  2OTJ 3;  4BTY A;  1NO3 A;  1RGC A;  4O3V A;  1YJ9 3;  3WHO A;  3PS8 A;  4HAA A;  2BMO B;  1FYS A;  3ALA A;  3B4P A;  1O7N B;  5AIG A;  2WGQ A;  4BL3 A;  1IK3 A;  1OUN A;  2CFK A;  4HM0 B;  2M7O A;  2Z76 A;  5IF6 A;  1EEJ A;  4XB5 A;  2W56 B;  1JBR A;  3OWY A;  1RDS A;  4AKZ A;  4AKY A;  4OUQ A;  1UUW B;  1ZX2 A;  3LML A;  1E3V A;  2MF7 A;  2CWV A;  1V57 A;  2K3D A;  1VQM 3;  1NJI 4;  1ISK A;  1T5Y A;  5M19 A;  1LOV A;  5G1K A;  1FUT A;  3PCR A;  3U97 A;  2XFS A;  3K9M C;  4FR9 A;  3NBB A;  1BU4 A;  3V98 A;  3GSP A;  1T3B A;  2OCT A;  3CNM A;  3HOH A;  3LTD A;  3FG1 A;  1UW1 A;  1UUG B;  4H3U A;  4HZ9 B;  6GSP A;  3CC2 3;  3SXX A;  1TRP A;  1BRI A;  3WOF B;  2RNT A;  3FF0 A;  2GSP A;  4FCJ A;  3GZY B;  3O8Y A;  1IQY A;  3D79 A;  1ULJ B;  1RHL A;  1EUI C;  1DVC A;  4NRE A;  1JB2 A;  4BL2 A;  1X1Y A;  1U5O A;  1O7G B;  3GWR A;  1O7P B;  3V92 A;  4MMX B;  1M1K 4;  1B20 A;  4FCM A;  4RBN A;  4WYK B;  1T2I A;  1B2U A;  1GOV A;  3CU3 A;  4OVM A;  3CCV 3;  1UGH I;  3RGR A;  1W5Z A;  5CLK A;  3MKI A;  1BAO A;  3G8Z A;  2PZV A;  2YFJ B;  2HMO B;  1AY7 A;  1UUV B;  2A15 A;  4O2H A;  1OF5 A;  1QAK A;  3FSD A;  3JUO A;  5KP1 A;  1TP6 A;  4H61 A;  1RN1 A;  5IW9 A;  1IQ8 A;  3G4S 3;  2OTL 3;  1YIJ 3;  1O7H B;  2BT3 A;  3Q90 A;  2GU1 A;  1ULI B;  2STD A;  1JN5 B;  3DGL A;  2CFG A;  3SED A;  5M1A A;  3DH2 A;  3URP A;  1UI7 A;  1WMP A;  2KCD A;  4GB5 A;  1QAL A;  1N5P A;  2RFR A;  4K1U A;  4TX4 A;  1BOX A;  2IUJ A;  5GSP A;  1KC8 4;  4R9K A;  1SPU A;  2HMJ B;  3KSE D;  1SII A;  3S67 A;  1LNH A;  4U13 A;  2BHM A;  1PY3 A;  1KQS 2;  4HM1 B;  1F8N A;  1Q81 4;  1SQW A;  1AQZ A;  3EE1 A;  2GXF A;  4N6T A;  1R4C A;  2W0Q A;  5AYS C;  2W9P A;  3F40 A;  3EJV A;  4HM5 B;  3BU4 A;  3MSO A;  2CWU A;  2PNC A;  1G0T A;  3DZL A;  4WP5 A;  3T8U A;  1Q7H A;  5D83 A;  1B2M A;  5DRV A;  1FGT A;  3AGO A;  2SBL A;  3MHE A;  1WQL B;  2XR8 B;  3NBR A;  3PZW A;  4GSP A;  1G02 A;  3ZFZ A;  1BNR A;  2XF3 A;  1OGX A;  2W56 A;  1NNV A;  4MJD A;  1YVB I;  3EN1 B;  3AGN A;  2Y74 A;  1U8C B;  1S5A A;  2W6J H;  3F7S A;  1IU7 A;  1RCL A;  5AIF A;  1YHQ 3;  1LOW A;  3DGY A;  1UCJ A;  1B2S A;  1LVN A;  1IT7 A;  2HMM B;  1TFK A;  2K0M A;  1A67 A;  1OGZ A;  5G2G A;  3EBT A;  5CF1 A;  1BIR A;  3LT8 A;  1BSB A;  1I2E A;  3ZG0 A;  1Q86 4;  1IVX A;  2WOF A;  2F5M A;  2CW9 A;  3LT9 A;  2CG0 A;  3NQZ A;  4MMZ B;  3PGB A;  5A0O B;  1E97 A;  2B1X B;  3BNE A;  2IA7 A;  1B2X A;  1BAN A;  1EA2 A;  1HU9 A;  3ROB A;  3WMD A;  2AAE A;  3LTA A;  1V74 A;  1JZD A;  1GOU A;  1VQO 3;  8RNT A;  4L8P A;  1DMN A;  1RGG A;  3NM2 A;  2YFL B;  5JPP A;  4WYK A;  3AHW A;  1GD3 A;  3EHC A;  1B21 A;  4BU4 A;  2Z6B A;  2OQE A;  2W9Q A;  3WA3 A;  1B3S A;  1FGO A;  4O02 B;  4CPK A;  1DVD A;  3D3L A;  1MGW A;  1Q40 B;  1JB5 A;  3K63 A;  5AII A;  3KZT A;  5KP4 A;  2F98 A;  1VQ4 3;  4I5Q A;  1A2K A;  1ASK A;  1IQX A;  1DMM A;  2XFT A;  1CQS A;  3OV4 A;  2KF5 A;  3A76 A;  3JUN A;  3QK9 A;  4FCZ A;  4FMA A;  4J8T A;  1Q42 A;  1W4N A;  1VQL 3;  2OWP A;  1KSI A;  2KRT A;  2C10 A;  3Q3F A;  4NHF A;  2OOV A;  3F8H A;  1BRN L;  2E2U A;  3PYJ A;  1JN5 A;  1QAF A;  4RZM A;  3I56 3;  5KP3 A;  5IEO A;  3G16 A;  1GOY A;  4ORL A;  1NB5 I;  2F56 A;  2ZDJ A;  1A2V A;  2W04 A;  3FG4 A;  1RRL A;  4N6L A;  1I0V A;  3S5C A;  3UNL A;  1BRH A;  3HK4 A;  1GY7 A;  4FMB A;  1NWW A;  1BNF A;  4HKV B;  3CCM 3;  1JKG B;  3K7C A;  3LYG A;  2RGQ A;  3BND A;  1L5G B;  2KF6 A;  4MEI A;  1MWS A;  5IEN A;  2ZL8 A;  3G71 3;  3EN8 A;  1TTO A;  2RBI A;  2UGI A;  2KF4 A;  1TIJ A;  1ROV A;  1LRA A;  3SX1 A;  3M8C A;  3NX0 A;  3UL5 A;  5DRE A;  1OHP A;  3IJE B;  1BNS A;  3B7C A;  3ECF A;  5IG4 A;  2BU4 A;  4L7K A;  1FA3 A;  1ROA A;  1VQ9 3;  3DGO A;  1K28 A;  1EG9 B;  5AI1 A;  2C4B A;  5AYR B;  1AVK A;  2MC8 A;  1GYB A;  2FXT A;  3FLJ A;  4IIA A;  5HGR A;  4BIR A;  4DKI A;  3LTB A;  1K9M 4;  1K73 4;  4XBT A;  1QMA A;  2I9W A;  4STD A;  4K90 B;  3UJM A;  1YJW 3;  1ZO2 A;  1BNG A;  2BO9 B;  2IY2 A;  1LXE A;  3CME 3;  3RDE A;  1D6Z A;  1VQ6 3;  1RRH A;  1GSP A;  1YJN 3;  1JJ2 2;  1RGF A;  2V1L A;  2WGO A;  3RNT A;  1Q9E A;  1IVW A;  3CCU 3;  1TJD A;  1FGM A;  1BNI A;  4HVN A;  3A5E A;  4FMD A;  5D81 A;  2P0X A;  4HM3 B;  4HZB B;  4G1M B;  5EQL A;  3UB1 A;  2F4Y A;  3S29 A;  2R41 A;  4IPB A;  5AEU B;  3CCE 3;  3F9S A;  5AIH A;  2ML6 A;  1A90 A;  1RNT A;  4LGQ A;  1PFP A;  1MNL A;  4AEQ A;  5IG3 A;  1CH0 A;  3OWU A;  2GEY A;  1JV2 B;  5IG0 A;  1W6C A;  3OXA A;  3LH4 A;  4KFD A;  1Q40 A;  5BXQ A;  8CHO A;  1B27 A;  5M18 A;  4XDW A;  1SJW A;  1NDO B;  1BUQ A;  1VQ8 3;  2R4I A;  3FGY A;  2F86 B;  2XSH B;  3HX8 A;  3EBY A;  4Q53 A;  1I3I A;  3B8L A;  1DMQ A;  3LZA A;  3RGA A;  1HZ1 A;  1PU4 A;  2JDI H;  5EVH A;  1D6Y A;  3WR2 A;  4J5K A;  3SOY A;  3CXC 2;  1IV7 A;  1WMO A;  1Q82 4;  3G0K A;  3BB9 A;  3D4A A;  2C11 A;  3CPO A;  1W6G A;  1HKX A;  2GU3 A;  1IYY A;  4R9L A;  1MGR A;  1O7W B;  1FGQ A;  5STD A;  1PYL A;  3S27 A;  1JKG A;  2UX0 A;  3DUK A;  6RNT A;  3D5I A;  1YVS A;  1RMS A;  4N6U A;  4BTX A;  4RNZ A;  1RGE A;  7RNT A;  2RCD A;  1I8V A;  1BRG A;  3X42 A;  3GAX A;  4R4K A;  1UDI I;  1IV9 A;  2Y73 A;  3WA2 X;  3N8B A;  3MG1 A;  1VQN 3;  3E99 A;  4J9A A;  5JPU A;  4FMC A;  1D6U A;  3K0Z A;  3GZR A;  1LQM B;  2FGT A;  1DET A;  3DXO A;  3PXM A;  3IPT A;  3EF8 A;  5CXO A;  5BIR A;  2CHC A;  2P0M A;  4LMI A;  3X40 A;  2XGN A;  1TRQ A;  1BSC A;  3FKA A;  3VF1 A;  2CKF B;  1Q7Y 4;  1TUH A;  3DGM A;  1BSD A;  5JBS A;  1RJO A;  1RKY A;  2ZHX B;  7STD A;  4QWT A;  1BNE A;  1X1W A;  3NUV A;  1TFO A;  3SLU A;  2QA4 3;  4HM6 B;  2CFW A;  2H0G A;  3EB8 A;  2SAR A;  4LZI A;  3T8N A;  4CCV A;  1N9J A;  4CDL A;  1RTU A;  5FW5 A;  1EKM A;  1M9G A;  2UUG C;  2KXG A;  2CIU A;  2L4V A;  3KII A;  3N9H A;  3NV0 B;  4LEH A;  2XH9 A;  2BMR B;  1W02 A;  2H0I A;  1W2Z A;  1CYV A;  4HM8 B;  3TDG A;  2P38 A;  1GMR A;  2HMN B;  5I97 A;  2FNQ A;  3CMA 3;  1EQK A;  3NQY A;  1N9E A;  1J2B A;  2IMJ A;  3D9R A;  1OAC A;  2E2T A;  3CC4 3;  1WNH A;  1KD1 4;  1JBS A;  5ELJ A;  3CCL 3;  2CFL A;  3CC7 3;  1BSE A;  1C7H A;  5IG5 A;  3SVA A;  1A2P A;  2E2V A;  1VQ7 3;  3T0U A;  3F14 A;  2WOH A;  1LOY A;  2GBW B;  4IT7 A;  5D82 A;  3Q1C A;  4JF8 A;  1M90 4;  1BRK A;  1MOL A;  4HBR A;  1UCK A;  2LYX A;  1FW7 A;  1RCK A;  2D42 A;  2CX1 A;  5LC7 A;  4WWU C;  4CJN A;  4XDV A;  4BTW A;  2AAD A;  3BIR A;  4LSO A;  1AR0 A;  3DGN A;  3G6E 3;  3JUP A;  3CD6 3;  1JRQ A;  1UCL A;  1UGI A;  2GEX A;  3HIG A;  3MPH A;  3NM7 A;  1UI8 A;  1MWU A;  4OK0 A;  3F8X A;  1SAR A;  1HYF A;  2KAA A;  1JB4 A;  3UL6 A;  1SIH A;  3NHX A;  1VQK 3;  5CK6 A;  3KKG A;  4N3V A;  3U1W A;  3D5G A;  1IDP A;  3BNB A;  1RLS A;  1RGH A;  3FZW A;  1GMQ A;  2CC3 A;  1YGW A;  5RNT A;  1DYU A;  3BLZ A;  4N6O B;  3X3X A;  3N54 B;  3AHS A;  4R1K A;  2QEX 3;  3EQQ B;  2F5W A;  4KFE A;  3NXJ A;  3MYT A;  2ML5 A;  5IEP A;  1S72 3;  1NB3 I;  5CF2 A;  1YNV X;  1Z1S A;  3Q2P A;  1IT8 A;  1W7C A;  1WMN A;  5IER A;  1QJG A;  3QRD A;  1CYU A;  1VQ5 3;  6STD A;  1I70 A;  1FGR A;  1GD4 A;  3CCQ 3;  1V58 A;  1W2B 2;  3ER7 A;  1BRJ A;  4LYL B;  2OQE C;  3EX9 A;  3LTC A;  4N6V 0;  3X41 A;  1KWI A;  2Q07 A;  4K61 A;  1OPY A;  3KN4 A;  2BMQ B;  2J8X B;  3LOY A;  4GL6 A;  1GMP A;  2JQ5 A;  1DE3 A;  4ILF A;  1M1X B;  4X2O A;  1BUJ A;  4WFO A;  1CEW I;  3DMC A;  3VGN A;  5HOH A;  1C54 A;  3MG3 A;  3CCJ 3;  1Y4K A;  3IMA B;  1OCV A;  1AVL A;  3OX9 A;  2CG1 A;  4XBY A;  2OOV C;  3LXU X;  1W00 A;  3DY5 A;  3FG3 A;  4GHO A;  4KT3 B;  4KVH A;  4MMY B;  2D1W A;  3NV0 A;  1VZZ A;  2RSX A;  1BSA A;  1E3R A;  1UCI A;  3CNX A;  4KZ1 A;  3WOD G;  1GY6 A;  1K41 A;  3CCS 3;  3HZP A;  1RGA A;  3JVC A;  3ZG5 A;  2IUK A;  3WDG B;  2LQV A;  4HYZ A;  2HMK B;  5ELU A;  1LNI A;  3SYU A;  1AV4 A;  1YGE A;  1I3F A;  2W03 A;  2CK3 H;  3AMO A;  4X2H A;  2P05 A;  1G96 A;  3X3Z A;  1RGL A;  1VQP 3;  1QVG 2;  1GS3 A;  3MG2 A;  3H3H A;  1RNB A;  2ZA4 A;  3GRD A;  4I4K A;  4PEJ A;  2BNG A;  4HOH A;  1K8A 4;  1FUW A;  1IVU A;  1WTH A;  4J5G A;  1YI2 3;  5EEO A;  3KCH A;  3J7Y d;  1JNQ A;  3GZB A;  2INX A;  2CX0 A;  1FZU A;  2Z7A A;  2O3O A;  3KE7 A;  2CFD A;  3GZX B;  4N6N B;  4N6M A;  3DM8 A;  1OH0 A;  4XM4 A;  5TGN A;  1BRS A;  5LC6 A;  5FGO A;  1STD A;  1VQQ A;  1B2Z A;  1US1 A;  1R4Y A;  1MWT A; 
#chains in the Genus database with same CATH homology
 1T2H A;  2BU4 A;  9RNT A;  1RSN A;  1RNB A;  2C4B A;  1JBS A;  4BIR A;  3DH2 A;  1I2F A;  3URP A;  1BSE A;  1JBT A;  1A2P A;  1BOX A;  5GSP A;  1LOY A;  1BNG A;  2BIR A;  1BRK A;  1BNJ A;  1PY3 A;  2HOH A;  7GSP A;  1UCK A;  1FW7 A;  1RCK A;  1AQZ A;  1GSP A;  1RGF A;  1FUS A;  5BU4 A;  1Q9E A;  1RN4 A;  2AAD A;  3BIR A;  1BNI A;  1UCL A;  3A5E A;  3BU4 A;  1SAR A;  1HYF A;  2KAA A;  1B2M A;  2F4Y A;  3AGO A;  4GSP A;  1BNR A;  1I2G A;  1RGK A;  1G02 A;  1RNT A;  3D5G A;  1CH0 A;  1RLS A;  1RGH A;  3AGN A;  1GMQ A;  1YGW A;  5RNT A;  1ZGX A;  1I0X A;  4RNT A;  1B27 A;  3AHS A;  1RCL A;  2F5W A;  1X1U A;  1BGS A;  1LOW A;  3DGY A;  1UCJ A;  1B2S A;  1X1X A;  1I3I A;  1YNV X;  1BVI A;  1HZ1 A;  1BIR A;  3WR2 A;  2KF3 A;  1BSB A;  4J5K A;  1I2E A;  2F5M A;  1I70 A;  3D4A A;  1RGC A;  3WHO A;  1B2X A;  1BAN A;  1BRJ A;  1MGR A;  4HAA A;  1IYY A;  1FYS A;  2AAE A;  1PYL A;  1GOU A;  1DE3 A;  8RNT A;  1GMP A;  6RNT A;  3D5I A;  1RGG A;  1BUJ A;  1YVS A;  1C54 A;  1RMS A;  3AHW A;  5HOH A;  1B21 A;  1RGE A;  4BU4 A;  7RNT A;  1I8V A;  1BRG A;  1JBR A;  1B3S A;  1RDS A;  3RNT A;  1MGW A;  4GHO A;  1BSA A;  1LOV A;  1UCI A;  1FUT A;  2KF5 A;  1RGA A;  1BU4 A;  1DET A;  3GSP A;  3HOH A;  3Q3F A;  5BIR A;  6GSP A;  1BRN L;  1TRP A;  1LNI A;  1BRI A;  3SYU A;  2RNT A;  2GSP A;  1TRQ A;  1I3F A;  1RHL A;  1BSC A;  1GOY A;  2F56 A;  1RGL A;  1I0V A;  1BSD A;  1BRH A;  1X1Y A;  2ZA4 A;  1BNF A;  4HOH A;  1BNE A;  1X1W A;  1B20 A;  4J5G A;  3KCH A;  2KF6 A;  1T2I A;  1B2U A;  1GOV A;  2SAR A;  1FZU A;  1RTU A;  1BAO A;  1TTO A;  2RBI A;  1AY7 A;  2KF4 A;  1BRS A;  1LRA A;  1B2Z A;  1GMR A;  1R4Y A;  1RN1 A;  1BNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...