1B3SA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
AQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (BARNASE)
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b3sA00
1I2FA 4BU4A 3D5GA 3RNTA 1PYLA 1JBTA 1LOYA 1GOUA 1RNTA 1RGHA 1RN4A 1BRNL 1I0XA 5RNTA 1LOVA 1DE3A 1BNGA 2RNTA 1BNEA 1YVSA 2F56A 2SARA 1BVIA 3AHWA 3KCHA 1BRIA 1X1WA 2ZA4A 3AHSA 1I2EA 1RN1A 1JBSA 1B2XA 1BNSA 1BSEA 1GMQA 1YGWA 1UCJA 1RGFA 1B2UA 1B2MA 2C4BA 3WHOA 1RNBA 1GMRA 1TTOA 1DETA 1G02A 1BSCA 1X1UA 1YNVX 1RDSA 1PY3A 1I0VA 2KAAA 2AAEA 3BIRA 2F5MA 1ZGXA 1FUSA 1RGCA 3AGNA 4J5GA 3Q3FA 3WR2A 1RGGA 2HOHA 7RNTA 3DGYA 2RBIA 1GMPA 4J5KA 1BIRA 1UCIA 2F5WA 1BGSA 1MGWA 2KF5A 1I8VA 1BNIA 1B21A 1RGKA 1BANA 5HOHA 1T2IA 4HOHA 1MGRA 1BU4A 1RTUA 1B27A 1B2SA 1GOVA 5BU4A 1B2ZA 4GSPA 1LRAA 5BIRA 1BRHA 1UCLA 1TRQA 1BNFA 1I3FA 1RCKA 1UCKA 1RLSA 6RNTA 1BRKA 2KF4A 2BU4A 2KF3A 7GSPA 6GSPA 3D5IA 1HZ1A 1FYSA 1I3IA 9RNTA 1RHLA 2GSPA 3AGOA 1RMSA 3SYUA 2KF6A 3BU4A 1RGLA 1FZUA 1T2HA 4BIRA 1FUTA 1I2GA 1GOYA 1Q9EA 4RNTA 1LOWA 1CH0A 1JBRA 1BAOA 1LNIA 2AADA 1BOXA 1HYFA 1B20A 3D4AA 1BSBA 1RSNA 5GSPA 1BRGA 1R4YA 3DH2A 3URPA 1BSDA 4HAAA 1BRSA 4GHOA 1BRJA 1BUJA 1RGEA 1X1YA 2BIRA 8RNTA 2F4YA 1BNJA 1X1XA 1I70A 1BNRA 3A5EA 1RGAA 1BSAA 3GSPA 1AQZA 1A2PA 1RCLA 1GSPA 1C54A 1TRPA 1IYYA 1SARA 1B3SA 3HOHA 1FW7A 1AY7A
chains in the Genus database with same CATH superfamily
2XGNA 1K28A 1CYVA 1G0TA 3D5GA 1VQM3 3CD63 2CHCA 2P05A 2F98A 1RGHA 3B8LA 4FMCA 3B4OA 3N9HA 1BUQA 1OF5B 1V74A 4TX4A 3UL5A 1VQ83 4WWUC 4AEQA 2RNTA 2OOVA 4PEJA 1A2KA 3HZPA 3I563 1BVIA 3AHWA 3DGMA 4K1UA 1M9GA 2IA7A 5AEWB 3D3LA 1RRHA 3U97A 1STFI 1JB5A 1I2EA 2CK3H 2B24B 3S28A 1BSEA 1O7MB 4FCJA 3CCV3 7STDA 2L1SA 3EE1A 2OTL3 1ROVA 3WMDA 3WHOA 3FKAA 2GXFA 1VQ93 2XFSA 1BSCA 1NB5I 4HM4B 4R9LA 2UGIA 3DUKA 4O8SA 4R80A 1YNVX 1RDSA 1PY3A 4H3UA 5IF6A 4LZIA 2F5MA 3F7XA 1JN5A 3EQQB 1QAFA 1PFPA 1LVNA 1RGCA 1VZZA 3JVCA 4J5GA 1QJGA 4N6OB 5STDA 3MWZA 2GBXB 3WR2A 2CIUA 1FGMA 2D42A 7RNTA 2MF7A 2BO9B 3GAXA 1JV2B 3PZWA 4IPBA 4J5KA 3S29A 1BIRA 2F5WA 3IJEB 5BVBA 1M1XB 2IY2A 2Z6BA 3FG4A 1BNIA 2XEPA 1B21A 3A76A 5HGRA 3V92A 1RGKA 3FCSB 5EQLA 1KQS2 1JJ22 5D83A 1R4CA 1RTUA 3X42A 1JNQA 1LRAA 3X40A 4K90B 2JQ5A 2PZVA 2HMLB 4HZBB 2CG0A 4LMIA 1A67A 2FGTA 1VQQA 1UCKA 3HK4A 6RNTA 1CEWI 1F8NA 3PCSA 5I97A 2BMRB 3CMA3 3I553 2F86B 3AMOA 1I3IA 1GY7A 3KSPA 2UUGC 2Q07A 5AEUB 1ZS7A 3LOYA 3K7CA 4JRFA 1RMSA 2CFWA 3KIIA 1FGOA 3EBTA 2HMKB 3HIGA 1UGIA 1SJWA 1T2HA 3GWRA 3GZRA 6STDA 2C10A 5AIHA 1FUTA 1C7HA 1ULJB 1IT8A 1D6UA 1GOYA 1Q814 1Q824 3G6E3 1GS3A 3WODG 4HZ9B 1LNIA 2Y73A 3CPW2 1BOXA 4KT3B 1LOXA 1RSNA 1QMAA 4R4KA 5AIIA 4WHAA 5JPPA 3PS8A 5G2GA 3S5CA 4LSOA 1BSDA 4HAAA 3EJVA 1IT7A 1RGEA 2OQEC 3K63A 1D6YA 2OTJ3 1T5YA 4N3VA 3G4S3 2W9PA 3ALAA 8RNTA 1VQ53 1YGEA 1X1XA 3GZYB 4I4KA 1IYYA 4MMZB 1QALA 1FA3A 1WMNA 5IG5A 1AQZA 1GD3A 2CC3A 5CK6A 1Z1SA 1RCLA 1EQKA 3MG1A 4EXRA 4Q53A 1TU5A 1WQLB 3HOHA 3FF0A 2C4BA 1AY7A 2INXA 3QRDA 3LT8A 4BU4A 2LYXA 2QIYA 3KSED 3EX9A 3MSOA 3JUOA 5D81A 1LOYA 1RNTA 2IYJA 1W02A 3E99A 4HJLB 2W56B 2CFLA 4J8TA 4KFEA 1Q40B 5IERA 1EKMA 4IT7A 1OPYA 1MWTA 3NV0A 4MJDA 4HVNA 4FCMA 2CFGA 1RJOA 2ML5A 4XBXA 1DVCA 1YVSA 2SARA 4OUQA 5LC6A 2MC8A 3KCHA 2P0XA 2YFJB 1Q7HA 2I9WA 2E2VA 1X1WA 2HMJB 2GBWB 4HBRA 4O2HA 4NREA 2ZL8A 3OWYA 1JBSA 3X3ZA 1B2XA 4N6UA 4ZM8A 1TP6A 1YGWA 1UCJA 5JPUA 1L5GB 2W9QA 3VSYA 2BHMA 2CKFB 2XSHB 3CCU3 3FH1A 4BTYA 1IVUA 2H0IA 2SBLA 1IVXA 1K41A 1RNBA 1V58A 1V57A 1G02A 1A2VA 2K54A 2CWTA 1UW1A 2CH9A 4KVHA 4WFOA 1Q42A 2KAAA 3BB9A 4NPBA 5BXQA 5IEPA 1S723 4FCZA 1FUSA 4FMAA 1W00A 5KP4A 2O3OA 5EVHA 1YIT3 3LTBA 3NX0A 3Q3FA 2OOVC 3EHCA 2CWVA 4CJNA 2HMOB 2WOFA 4BTXA 1JRQA 4EV2A 2P38A 4EBGA 5IG3A 2ML6A 2FNQA 1BGSA 1MGWA 2KF5A 2A15A 1DVDA 3EF8A 3F8HA 1G96A 1T2IA 2W56A 4HOHA 4RNYA 2FXTA 3S27A 1B27A 5BU4A 3RDEA 1CQSA 1BNFA 3OWSA 3LXUX 1YIJ3 1RLSA 1LQGC 1WNHA 3CNXA 2KF3A 5FW5A 7GSPA 2W0QA 3OV4A 2BNGA 2L4VA 3PYJA 2BMOB 3LTAA 2IUKA 3D5IA 1KD14 1IQXA 4STDA 5EEOA 2GSPA 3MG3A 4HM0B 3AGOA 4LEHA 1N9JA 2GEXA 3RGAA 3CCL3 1DYUA 3BU4A 4L8OA 1OH0A 1RGLA 5KP1A 1UI7A 2GU3A 3EN8A 2IMJA 3CCS3 3SOYA 3K0ZA 5M18A 4RNTA 4R1KA 2BT3A 1ROAA 3B4PA 3G8ZA 2XGLA 5IG4A 1O7GB 2RCDA 1BRGA 1AVLA 3DM8A 5AYSC 3X41A 3SOAA 2XH9A 5G1LA 4G1MB 4XBTA 4GHOA 2YFLB 1BRJA 3NHXA 1BUJA 1X1YA 3HI7A 2JDIH 3G16A 1Q7Y4 3NV0B 1N5PA 2CX0A 2CG1A 1ZX2A 1KC84 2F4YA 4AKYA 1I70A 5CXOA 1EA2A 2KCDA 1VQL3 3DZLA 3DGLA 1KWIA 4FR9A 3GSPA 4IIAA 1A2PA 1IV9A 2V1LA 2CX1A 5AIGA 3UL6A 3JUQA 1M904 5A0OB 4KFFA 3LMLA 1SARA 2GEYA 2XF3A 2F99A 4HM3B 4L8PA 1RN7A 5RNTA 1YJ93 3BLZA 1ASKA 2HMNB 3O8YA 4N6MA 4HM5B 3ZG5A 1YVBI 2P09A 1HU9A 3SX1A 3RNTA 3WOEB 3D79A 1PYLA 3F9SA 3SVAA 1DMNA 1RN4A 2H0GA 1SIHA 3OXAA 3T0UA 3JUMA 3MHEA 4HM1B 3ROBA 1GY6A 3NM2A 1FGQA 4HYZA 1W2B2 4XDWA 1IV7A 1JKGB 1DE3A 1SIIA 3ECFA 3T8UA 3IMAB 2C11A 2GU1A 4K1VA 1MWSA 2Z76A 2F56A 4QWTA 1O7PB 2B1XB 3Q90A 1BRIA 3WDGB 1VQN3 3CCQ3 2ZA4A 3AHSA 4NHFA 2K0MA 2J8XB 4XB5A 1BNSA 3S67A 1N8R4 3D9RA 1FUWA 3LYGA 1IDPA 1ULIB 4DKIA 4K61A 1ISKA 2R4IA 1QAKA 1DETA 3NXJA 3DGNA 4HM8B 1VQ63 2OCTA 3LH4A 1DMMA 1I0VA 2AAEA 3CC43 1UGHI 1O7HB 3MG2A 1IK3A 1N9EA 3N54B 2M7OA 1E3RA 1MWRA 4BL2A 2D1WA 5DREA 1VQK3 1IVVA 1RGGA 3U1WA 2HOHA 2XRXB 4KFDA 2K3DA 3UB1A 4I5QA 3Q1CA 1GMPA 1UCIA 4CDLA 1SQWA 3EBYA 3FF2A 3SEDA 1I8VA 5AYRB 3HIIA 1W6GA 1BANA 1OACA 5HOHA 3J7Yd 1OF5A 1BU4A 1GOVA 4ORLA 1B2ZA 1NB3I 3KN4A 4H61A 3GZBA 4MMYB 3JUPA 5AIFA 1UCLA 1OGZA 2WOHA 5IEOA 4RZMA 1VQ73 3FG1A 2WO0A 1K734 1MNLA 1BRKA 1Q40A 2BU4A 2KF4A 2OWPA 1IQ8A 4LGQA 5CLKA 3V99A 3X3YA 3DY5A 1GYBA 1W2ZA 1TFKA 9RNTA 1NNVA 3EB8A 3N8BA 1FGRA 1NWWA 3SLUA 3SYUA 1JB4A 1W01A 3CU3A 5DRVA 1TIJA 3GZXB 1FZUA 4FMBA 3WOFB 3JUNA 2IUJA 4BIRA 3NUVA 1QVF2 4XBYA 1Q9EA 1VQP3 1MWUA 1JBRA 1BAOA 2AADA 3EC9A 3LT9A 1W4NA 3LTDA 1B20A 1US1A 3PGBA 4X2OA 1W6CA 2CW9A 3G0KA 1N8QA 1RKYA 3DGOA 3MKIA 1JN5B 2LQVA 2W2CA 3LTCA 3WA3A 3CCR3 4R9KA 4ILFA 2BIRA 1M1K4 1EG9B 3ZG0A 3NQYA 1TJDA 2CWUA 4X2HA 1BNJA 1LNHA 1BNRA 1QVG2 1VQ43 5M1AA 4WYKB 4HM7B 4EYCA 1RGAA 4OVMA 1BSAA 1AVKA 3WA2X 5IW9A 1WMPA 1OHSA 2ZDJA 3M8CA 1EEJA 3AMOB 5CF2A 1IQYA 1TRPA 4HM2B 1B3SA 1JZOA 3H3HA 4U13A 1DMQA 1AV4A 5AI1A 3FLJA 1I2FA 2STDA 3CME3 1O7NB 1Y4KA 1OGXA 2ZHXB 2Z77A 3V98A 3VF1A 1AR0A 1FGTA 1UUVB 4EW5A 2O9UX 1JBTA 1GOUA 1RRLA 1BRNL 1S5AA 3FGYA 1I0XA 1HKXA 3PCRA 3OWUA 4HKVB 2Y74A 5IG0A 5ELJA 3F8XA 5JBSA 2W03A 3STDA 1PU4A 4KZ1A 3QK9A 1LOVA 1E97A 2QGUA 1BNGA 3I0YA 4N6V0 1BNEA 4OK0A 5KP3A 1YHQ3 3NBJA 3T8NA 2RSXA 3BNEA 3NBBA 1WMOA 1VQO3 1K9M4 5M19A 1RN1A 1ZO2A 1K8A4 1GMQA 4WYKA 3CCE3 2QEX3 1RGFA 1B2UA 1B2MA 3DMCA 3F14A 1O7WB 3FG3A 1GD4A 1GMRA 3DXOA 3L0RA 1TTOA 2BMQB 3H51A 3NQZA 5TGNA 1X1UA 2XR8B 4N6NB 1U5OA 1CYUA 3EN1B 1JKGA 1W6YA 3BNCA 2QA43 2OQEA 2Z7AA 3BIRA 1SPUA 1U8CB 1ZGXA 4XDVA 3RGRA 3CC23 3AGNA 3CNMA 1W5ZA 1N5HA 2CFKA 2PNCA 3CXC2 2W6JH 3HX8A 4N6LA 1NO3A 3DGYA 4O3VA 3OW22 1D6ZA 2RBIA 2YX9A 1YJW3 1Q864 1JB2A 1NDOB 1JZDA 1OHPA 1GY5A 3NBRA 2XFTA 3TDGA 3CC73 2XSOB 8CHOA 3CCM3 3UNLA 4MEIA 4N6TA 1UI8A 3BNDA 3KZTA 3NM7A 1MGRA 1LQMB 1YJN3 3SXXA 4HM6B 1B2SA 3KFQC 4GSPA 5BIRA 1KSIA 1BRHA 1W7CA 1TRQA 4RBNA 3Q2PA 1T3BA 3GRDA 1I3FA 3F40A 4GL6A 1UUWB 1RCKA 4JF8A 1J2BA 4J9AA 4FMDA 3K5TA 1LXEA 5D82A 6GSPA 1HZ1A 1FYSA 1NU3A 2E2TA 2HMMB 2KRTA 3BNBA 3K9MC 3CCJ3 4GB5A 3F7SA 1RHLA 2W04A 1UUGB 1STDA 4RNZA 3MPHA 3MYTA 3X3XA 5IENA 2KF6A 1UDII 1WTHA 5CF1A 1IVWA 1IU7A 3LZAA 1I2GA 2R41A 1EUIC 2WGOA 1A90A 2E2UA 4O02B 1OUNA 1LOWA 1CH0A 1OCVA 1TUHA 3FZWA 3KE7A 3KKGA 4WP5A 3FSDA 4CPKA 1HYFA 3D4AA 1BSBA 2UX0A 5GSPA 1R4YA 3DH2A 4EV5A 3URPA 1OHOA 3G713 1BRSA 1E3VA 3IPTA 3UJMA 4CCVA 4EC6A 5FGOA 4AKZA 3OX9A 2WGQA 2H0HA 2YFIB 3ZFZA 3A5EA 4BL3A 4BTWA 5ELUA 1MOLA 1YI23 3CPOA 2P0MA 2KXGA 3VGNA 2CFDA 2RGQA 4MMXB 3B7CA 5G1KA 1GSPA 1NJI4 4LYLB 3PXMA 4L7KA 1C54A 3ER7A 4XM4A 5LC7A 2RFRA 1TFOA 1FW7A
chains in the Genus database with same CATH topology
1I2FA 4BU4A 3D5GA 3RNTA 1PYLA 1JBTA 1LOYA 1GOUA 1RNTA 1RGHA 1RN4A 1BRNL 1I0XA 5RNTA 1LOVA 1DE3A 1BNGA 2RNTA 1BNEA 1YVSA 2F56A 2SARA 1BVIA 3AHWA 3KCHA 1BRIA 1X1WA 2ZA4A 3AHSA 1I2EA 1RN1A 1JBSA 1B2XA 1BNSA 1BSEA 1GMQA 1YGWA 1UCJA 1RGFA 1B2UA 1B2MA 2C4BA 3WHOA 1RNBA 1GMRA 1TTOA 1DETA 1G02A 1BSCA 1X1UA 1YNVX 1RDSA 1PY3A 1I0VA 2KAAA 2AAEA 3BIRA 2F5MA 1ZGXA 1FUSA 1RGCA 3AGNA 4J5GA 3Q3FA 3WR2A 1RGGA 2HOHA 7RNTA 3DGYA 2RBIA 1GMPA 4J5KA 1BIRA 1UCIA 2F5WA 1BGSA 1MGWA 2KF5A 1I8VA 1BNIA 1B21A 1RGKA 1BANA 5HOHA 1T2IA 4HOHA 1MGRA 1BU4A 1RTUA 1B27A 1B2SA 1GOVA 5BU4A 1B2ZA 4GSPA 1LRAA 5BIRA 1BRHA 1UCLA 1TRQA 1BNFA 1I3FA 1RCKA 1UCKA 1RLSA 6RNTA 1BRKA 2KF4A 2BU4A 2KF3A 7GSPA 6GSPA 3D5IA 1HZ1A 1FYSA 1I3IA 9RNTA 1RHLA 2GSPA 3AGOA 1RMSA 3SYUA 2KF6A 3BU4A 1RGLA 1FZUA 1T2HA 4BIRA 1FUTA 1I2GA 1GOYA 1Q9EA 4RNTA 1LOWA 1CH0A 1JBRA 1BAOA 1LNIA 2AADA 1BOXA 1HYFA 1B20A 3D4AA 1BSBA 1RSNA 5GSPA 1BRGA 1R4YA 3DH2A 3URPA 1BSDA 4HAAA 1BRSA 4GHOA 1BRJA 1BUJA 1RGEA 1X1YA 2BIRA 8RNTA 2F4YA 1BNJA 1X1XA 1I70A 1BNRA 3A5EA 1RGAA 1BSAA 3GSPA 1AQZA 1A2PA 1RCLA 1GSPA 1C54A 1TRPA 1IYYA 1SARA 1B3SA 3HOHA 1FW7A 1AY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  4BU4 A;  3D5G A;  3RNT A;  1PYL A;  1JBT A;  1LOY A;  1GOU A;  1RNT A;  1RGH A;  1RN4 A;  1BRN L;  1I0X A;  5RNT A;  1LOV A;  1DE3 A;  1BNG A;  2RNT A;  1BNE A;  1YVS A;  2F56 A;  2SAR A;  1BVI A;  3AHW A;  3KCH A;  1BRI A;  1X1W A;  2ZA4 A;  3AHS A;  1I2E A;  1RN1 A;  1JBS A;  1B2X A;  1BNS A;  1BSE A;  1GMQ A;  1YGW A;  1UCJ A;  1RGF A;  1B2U A;  1B2M A;  2C4B A;  3WHO A;  1RNB A;  1GMR A;  1TTO A;  1DET A;  1G02 A;  1BSC A;  1X1U A;  1YNV X;  1RDS A;  1PY3 A;  1I0V A;  2KAA A;  2AAE A;  3BIR A;  2F5M A;  1ZGX A;  1FUS A;  1RGC A;  3AGN A;  4J5G A;  3Q3F A;  3WR2 A;  1RGG A;  2HOH A;  7RNT A;  3DGY A;  2RBI A;  1GMP A;  4J5K A;  1BIR A;  1UCI A;  2F5W A;  1BGS A;  1MGW A;  2KF5 A;  1I8V A;  1BNI A;  1B21 A;  1RGK A;  1BAN A;  5HOH A;  1T2I A;  4HOH A;  1MGR A;  1BU4 A;  1RTU A;  1B27 A;  1B2S A;  1GOV A;  5BU4 A;  1B2Z A;  4GSP A;  1LRA A;  5BIR A;  1BRH A;  1UCL A;  1TRQ A;  1BNF A;  1I3F A;  1RCK A;  1UCK A;  1RLS A;  6RNT A;  1BRK A;  2KF4 A;  2BU4 A;  2KF3 A;  7GSP A;  6GSP A;  3D5I A;  1HZ1 A;  1FYS A;  1I3I A;  9RNT A;  1RHL A;  2GSP A;  3AGO A;  1RMS A;  3SYU A;  2KF6 A;  3BU4 A;  1RGL A;  1FZU A;  1T2H A;  4BIR A;  1FUT A;  1I2G A;  1GOY A;  1Q9E A;  4RNT A;  1LOW A;  1CH0 A;  1JBR A;  1BAO A;  1LNI A;  2AAD A;  1BOX A;  1HYF A;  1B20 A;  3D4A A;  1BSB A;  1RSN A;  5GSP A;  1BRG A;  1R4Y A;  3DH2 A;  3URP A;  1BSD A;  4HAA A;  1BRS A;  4GHO A;  1BRJ A;  1BUJ A;  1RGE A;  1X1Y A;  2BIR A;  8RNT A;  2F4Y A;  1BNJ A;  1X1X A;  1I70 A;  1BNR A;  3A5E A;  1RGA A;  1BSA A;  3GSP A;  1AQZ A;  1A2P A;  1RCL A;  1GSP A;  1C54 A;  1TRP A;  1IYY A;  1SAR A;  1B3S A;  3HOH A;  1FW7 A;  1AY7 A; 
#chains in the Genus database with same CATH topology
 2XGN A;  1K28 A;  1CYV A;  1G0T A;  3D5G A;  1VQM 3;  3CD6 3;  2CHC A;  2P05 A;  2F98 A;  1RGH A;  3B8L A;  4FMC A;  3B4O A;  3N9H A;  1BUQ A;  1OF5 B;  1V74 A;  4TX4 A;  3UL5 A;  1VQ8 3;  4WWU C;  4AEQ A;  2RNT A;  2OOV A;  4PEJ A;  1A2K A;  3HZP A;  3I56 3;  1BVI A;  3AHW A;  3DGM A;  4K1U A;  1M9G A;  2IA7 A;  5AEW B;  3D3L A;  1RRH A;  3U97 A;  1STF I;  1JB5 A;  1I2E A;  2CK3 H;  2B24 B;  3S28 A;  1BSE A;  1O7M B;  4FCJ A;  3CCV 3;  7STD A;  2L1S A;  3EE1 A;  2OTL 3;  1ROV A;  3WMD A;  3WHO A;  3FKA A;  2GXF A;  1VQ9 3;  2XFS A;  1BSC A;  1NB5 I;  4HM4 B;  4R9L A;  2UGI A;  3DUK A;  4O8S A;  4R80 A;  1YNV X;  1RDS A;  1PY3 A;  4H3U A;  5IF6 A;  4LZI A;  2F5M A;  3F7X A;  1JN5 A;  3EQQ B;  1QAF A;  1PFP A;  1LVN A;  1RGC A;  1VZZ A;  3JVC A;  4J5G A;  1QJG A;  4N6O B;  5STD A;  3MWZ A;  2GBX B;  3WR2 A;  2CIU A;  1FGM A;  2D42 A;  7RNT A;  2MF7 A;  2BO9 B;  3GAX A;  1JV2 B;  3PZW A;  4IPB A;  4J5K A;  3S29 A;  1BIR A;  2F5W A;  3IJE B;  5BVB A;  1M1X B;  2IY2 A;  2Z6B A;  3FG4 A;  1BNI A;  2XEP A;  1B21 A;  3A76 A;  5HGR A;  3V92 A;  1RGK A;  3FCS B;  5EQL A;  1KQS 2;  1JJ2 2;  5D83 A;  1R4C A;  1RTU A;  3X42 A;  1JNQ A;  1LRA A;  3X40 A;  4K90 B;  2JQ5 A;  2PZV A;  2HML B;  4HZB B;  2CG0 A;  4LMI A;  1A67 A;  2FGT A;  1VQQ A;  1UCK A;  3HK4 A;  6RNT A;  1CEW I;  1F8N A;  3PCS A;  5I97 A;  2BMR B;  3CMA 3;  3I55 3;  2F86 B;  3AMO A;  1I3I A;  1GY7 A;  3KSP A;  2UUG C;  2Q07 A;  5AEU B;  1ZS7 A;  3LOY A;  3K7C A;  4JRF A;  1RMS A;  2CFW A;  3KII A;  1FGO A;  3EBT A;  2HMK B;  3HIG A;  1UGI A;  1SJW A;  1T2H A;  3GWR A;  3GZR A;  6STD A;  2C10 A;  5AIH A;  1FUT A;  1C7H A;  1ULJ B;  1IT8 A;  1D6U A;  1GOY A;  1Q81 4;  1Q82 4;  3G6E 3;  1GS3 A;  3WOD G;  4HZ9 B;  1LNI A;  2Y73 A;  3CPW 2;  1BOX A;  4KT3 B;  1LOX A;  1RSN A;  1QMA A;  4R4K A;  5AII A;  4WHA A;  5JPP A;  3PS8 A;  5G2G A;  3S5C A;  4LSO A;  1BSD A;  4HAA A;  3EJV A;  1IT7 A;  1RGE A;  2OQE C;  3K63 A;  1D6Y A;  2OTJ 3;  1T5Y A;  4N3V A;  3G4S 3;  2W9P A;  3ALA A;  8RNT A;  1VQ5 3;  1YGE A;  1X1X A;  3GZY B;  4I4K A;  1IYY A;  4MMZ B;  1QAL A;  1FA3 A;  1WMN A;  5IG5 A;  1AQZ A;  1GD3 A;  2CC3 A;  5CK6 A;  1Z1S A;  1RCL A;  1EQK A;  3MG1 A;  4EXR A;  4Q53 A;  1TU5 A;  1WQL B;  3HOH A;  3FF0 A;  2C4B A;  1AY7 A;  2INX A;  3QRD A;  3LT8 A;  4BU4 A;  2LYX A;  2QIY A;  3KSE D;  3EX9 A;  3MSO A;  3JUO A;  5D81 A;  1LOY A;  1RNT A;  2IYJ A;  1W02 A;  3E99 A;  4HJL B;  2W56 B;  2CFL A;  4J8T A;  4KFE A;  1Q40 B;  5IER A;  1EKM A;  4IT7 A;  1OPY A;  1MWT A;  3NV0 A;  4MJD A;  4HVN A;  4FCM A;  2CFG A;  1RJO A;  2ML5 A;  4XBX A;  1DVC A;  1YVS A;  2SAR A;  4OUQ A;  5LC6 A;  2MC8 A;  3KCH A;  2P0X A;  2YFJ B;  1Q7H A;  2I9W A;  2E2V A;  1X1W A;  2HMJ B;  2GBW B;  4HBR A;  4O2H A;  4NRE A;  2ZL8 A;  3OWY A;  1JBS A;  3X3Z A;  1B2X A;  4N6U A;  4ZM8 A;  1TP6 A;  1YGW A;  1UCJ A;  5JPU A;  1L5G B;  2W9Q A;  3VSY A;  2BHM A;  2CKF B;  2XSH B;  3CCU 3;  3FH1 A;  4BTY A;  1IVU A;  2H0I A;  2SBL A;  1IVX A;  1K41 A;  1RNB A;  1V58 A;  1V57 A;  1G02 A;  1A2V A;  2K54 A;  2CWT A;  1UW1 A;  2CH9 A;  4KVH A;  4WFO A;  1Q42 A;  2KAA A;  3BB9 A;  4NPB A;  5BXQ A;  5IEP A;  1S72 3;  4FCZ A;  1FUS A;  4FMA A;  1W00 A;  5KP4 A;  2O3O A;  5EVH A;  1YIT 3;  3LTB A;  3NX0 A;  3Q3F A;  2OOV C;  3EHC A;  2CWV A;  4CJN A;  2HMO B;  2WOF A;  4BTX A;  1JRQ A;  4EV2 A;  2P38 A;  4EBG A;  5IG3 A;  2ML6 A;  2FNQ A;  1BGS A;  1MGW A;  2KF5 A;  2A15 A;  1DVD A;  3EF8 A;  3F8H A;  1G96 A;  1T2I A;  2W56 A;  4HOH A;  4RNY A;  2FXT A;  3S27 A;  1B27 A;  5BU4 A;  3RDE A;  1CQS A;  1BNF A;  3OWS A;  3LXU X;  1YIJ 3;  1RLS A;  1LQG C;  1WNH A;  3CNX A;  2KF3 A;  5FW5 A;  7GSP A;  2W0Q A;  3OV4 A;  2BNG A;  2L4V A;  3PYJ A;  2BMO B;  3LTA A;  2IUK A;  3D5I A;  1KD1 4;  1IQX A;  4STD A;  5EEO A;  2GSP A;  3MG3 A;  4HM0 B;  3AGO A;  4LEH A;  1N9J A;  2GEX A;  3RGA A;  3CCL 3;  1DYU A;  3BU4 A;  4L8O A;  1OH0 A;  1RGL A;  5KP1 A;  1UI7 A;  2GU3 A;  3EN8 A;  2IMJ A;  3CCS 3;  3SOY A;  3K0Z A;  5M18 A;  4RNT A;  4R1K A;  2BT3 A;  1ROA A;  3B4P A;  3G8Z A;  2XGL A;  5IG4 A;  1O7G B;  2RCD A;  1BRG A;  1AVL A;  3DM8 A;  5AYS C;  3X41 A;  3SOA A;  2XH9 A;  5G1L A;  4G1M B;  4XBT A;  4GHO A;  2YFL B;  1BRJ A;  3NHX A;  1BUJ A;  1X1Y A;  3HI7 A;  2JDI H;  3G16 A;  1Q7Y 4;  3NV0 B;  1N5P A;  2CX0 A;  2CG1 A;  1ZX2 A;  1KC8 4;  2F4Y A;  4AKY A;  1I70 A;  5CXO A;  1EA2 A;  2KCD A;  1VQL 3;  3DZL A;  3DGL A;  1KWI A;  4FR9 A;  3GSP A;  4IIA A;  1A2P A;  1IV9 A;  2V1L A;  2CX1 A;  5AIG A;  3UL6 A;  3JUQ A;  1M90 4;  5A0O B;  4KFF A;  3LML A;  1SAR A;  2GEY A;  2XF3 A;  2F99 A;  4HM3 B;  4L8P A;  1RN7 A;  5RNT A;  1YJ9 3;  3BLZ A;  1ASK A;  2HMN B;  3O8Y A;  4N6M A;  4HM5 B;  3ZG5 A;  1YVB I;  2P09 A;  1HU9 A;  3SX1 A;  3RNT A;  3WOE B;  3D79 A;  1PYL A;  3F9S A;  3SVA A;  1DMN A;  1RN4 A;  2H0G A;  1SIH A;  3OXA A;  3T0U A;  3JUM A;  3MHE A;  4HM1 B;  3ROB A;  1GY6 A;  3NM2 A;  1FGQ A;  4HYZ A;  1W2B 2;  4XDW A;  1IV7 A;  1JKG B;  1DE3 A;  1SII A;  3ECF A;  3T8U A;  3IMA B;  2C11 A;  2GU1 A;  4K1V A;  1MWS A;  2Z76 A;  2F56 A;  4QWT A;  1O7P B;  2B1X B;  3Q90 A;  1BRI A;  3WDG B;  1VQN 3;  3CCQ 3;  2ZA4 A;  3AHS A;  4NHF A;  2K0M A;  2J8X B;  4XB5 A;  1BNS A;  3S67 A;  1N8R 4;  3D9R A;  1FUW A;  3LYG A;  1IDP A;  1ULI B;  4DKI A;  4K61 A;  1ISK A;  2R4I A;  1QAK A;  1DET A;  3NXJ A;  3DGN A;  4HM8 B;  1VQ6 3;  2OCT A;  3LH4 A;  1DMM A;  1I0V A;  2AAE A;  3CC4 3;  1UGH I;  1O7H B;  3MG2 A;  1IK3 A;  1N9E A;  3N54 B;  2M7O A;  1E3R A;  1MWR A;  4BL2 A;  2D1W A;  5DRE A;  1VQK 3;  1IVV A;  1RGG A;  3U1W A;  2HOH A;  2XRX B;  4KFD A;  2K3D A;  3UB1 A;  4I5Q A;  3Q1C A;  1GMP A;  1UCI A;  4CDL A;  1SQW A;  3EBY A;  3FF2 A;  3SED A;  1I8V A;  5AYR B;  3HII A;  1W6G A;  1BAN A;  1OAC A;  5HOH A;  3J7Y d;  1OF5 A;  1BU4 A;  1GOV A;  4ORL A;  1B2Z A;  1NB3 I;  3KN4 A;  4H61 A;  3GZB A;  4MMY B;  3JUP A;  5AIF A;  1UCL A;  1OGZ A;  2WOH A;  5IEO A;  4RZM A;  1VQ7 3;  3FG1 A;  2WO0 A;  1K73 4;  1MNL A;  1BRK A;  1Q40 A;  2BU4 A;  2KF4 A;  2OWP A;  1IQ8 A;  4LGQ A;  5CLK A;  3V99 A;  3X3Y A;  3DY5 A;  1GYB A;  1W2Z A;  1TFK A;  9RNT A;  1NNV A;  3EB8 A;  3N8B A;  1FGR A;  1NWW A;  3SLU A;  3SYU A;  1JB4 A;  1W01 A;  3CU3 A;  5DRV A;  1TIJ A;  3GZX B;  1FZU A;  4FMB A;  3WOF B;  3JUN A;  2IUJ A;  4BIR A;  3NUV A;  1QVF 2;  4XBY A;  1Q9E A;  1VQP 3;  1MWU A;  1JBR A;  1BAO A;  2AAD A;  3EC9 A;  3LT9 A;  1W4N A;  3LTD A;  1B20 A;  1US1 A;  3PGB A;  4X2O A;  1W6C A;  2CW9 A;  3G0K A;  1N8Q A;  1RKY A;  3DGO A;  3MKI A;  1JN5 B;  2LQV A;  2W2C A;  3LTC A;  3WA3 A;  3CCR 3;  4R9K A;  4ILF A;  2BIR A;  1M1K 4;  1EG9 B;  3ZG0 A;  3NQY A;  1TJD A;  2CWU A;  4X2H A;  1BNJ A;  1LNH A;  1BNR A;  1QVG 2;  1VQ4 3;  5M1A A;  4WYK B;  4HM7 B;  4EYC A;  1RGA A;  4OVM A;  1BSA A;  1AVK A;  3WA2 X;  5IW9 A;  1WMP A;  1OHS A;  2ZDJ A;  3M8C A;  1EEJ A;  3AMO B;  5CF2 A;  1IQY A;  1TRP A;  4HM2 B;  1B3S A;  1JZO A;  3H3H A;  4U13 A;  1DMQ A;  1AV4 A;  5AI1 A;  3FLJ A;  1I2F A;  2STD A;  3CME 3;  1O7N B;  1Y4K A;  1OGX A;  2ZHX B;  2Z77 A;  3V98 A;  3VF1 A;  1AR0 A;  1FGT A;  1UUV B;  4EW5 A;  2O9U X;  1JBT A;  1GOU A;  1RRL A;  1BRN L;  1S5A A;  3FGY A;  1I0X A;  1HKX A;  3PCR A;  3OWU A;  4HKV B;  2Y74 A;  5IG0 A;  5ELJ A;  3F8X A;  5JBS A;  2W03 A;  3STD A;  1PU4 A;  4KZ1 A;  3QK9 A;  1LOV A;  1E97 A;  2QGU A;  1BNG A;  3I0Y A;  4N6V 0;  1BNE A;  4OK0 A;  5KP3 A;  1YHQ 3;  3NBJ A;  3T8N A;  2RSX A;  3BNE A;  3NBB A;  1WMO A;  1VQO 3;  1K9M 4;  5M19 A;  1RN1 A;  1ZO2 A;  1K8A 4;  1GMQ A;  4WYK A;  3CCE 3;  2QEX 3;  1RGF A;  1B2U A;  1B2M A;  3DMC A;  3F14 A;  1O7W B;  3FG3 A;  1GD4 A;  1GMR A;  3DXO A;  3L0R A;  1TTO A;  2BMQ B;  3H51 A;  3NQZ A;  5TGN A;  1X1U A;  2XR8 B;  4N6N B;  1U5O A;  1CYU A;  3EN1 B;  1JKG A;  1W6Y A;  3BNC A;  2QA4 3;  2OQE A;  2Z7A A;  3BIR A;  1SPU A;  1U8C B;  1ZGX A;  4XDV A;  3RGR A;  3CC2 3;  3AGN A;  3CNM A;  1W5Z A;  1N5H A;  2CFK A;  2PNC A;  3CXC 2;  2W6J H;  3HX8 A;  4N6L A;  1NO3 A;  3DGY A;  4O3V A;  3OW2 2;  1D6Z A;  2RBI A;  2YX9 A;  1YJW 3;  1Q86 4;  1JB2 A;  1NDO B;  1JZD A;  1OHP A;  1GY5 A;  3NBR A;  2XFT A;  3TDG A;  3CC7 3;  2XSO B;  8CHO A;  3CCM 3;  3UNL A;  4MEI A;  4N6T A;  1UI8 A;  3BND A;  3KZT A;  3NM7 A;  1MGR A;  1LQM B;  1YJN 3;  3SXX A;  4HM6 B;  1B2S A;  3KFQ C;  4GSP A;  5BIR A;  1KSI A;  1BRH A;  1W7C A;  1TRQ A;  4RBN A;  3Q2P A;  1T3B A;  3GRD A;  1I3F A;  3F40 A;  4GL6 A;  1UUW B;  1RCK A;  4JF8 A;  1J2B A;  4J9A A;  4FMD A;  3K5T A;  1LXE A;  5D82 A;  6GSP A;  1HZ1 A;  1FYS A;  1NU3 A;  2E2T A;  2HMM B;  2KRT A;  3BNB A;  3K9M C;  3CCJ 3;  4GB5 A;  3F7S A;  1RHL A;  2W04 A;  1UUG B;  1STD A;  4RNZ A;  3MPH A;  3MYT A;  3X3X A;  5IEN A;  2KF6 A;  1UDI I;  1WTH A;  5CF1 A;  1IVW A;  1IU7 A;  3LZA A;  1I2G A;  2R41 A;  1EUI C;  2WGO A;  1A90 A;  2E2U A;  4O02 B;  1OUN A;  1LOW A;  1CH0 A;  1OCV A;  1TUH A;  3FZW A;  3KE7 A;  3KKG A;  4WP5 A;  3FSD A;  4CPK A;  1HYF A;  3D4A A;  1BSB A;  2UX0 A;  5GSP A;  1R4Y A;  3DH2 A;  4EV5 A;  3URP A;  1OHO A;  3G71 3;  1BRS A;  1E3V A;  3IPT A;  3UJM A;  4CCV A;  4EC6 A;  5FGO A;  4AKZ A;  3OX9 A;  2WGQ A;  2H0H A;  2YFI B;  3ZFZ A;  3A5E A;  4BL3 A;  4BTW A;  5ELU A;  1MOL A;  1YI2 3;  3CPO A;  2P0M A;  2KXG A;  3VGN A;  2CFD A;  2RGQ A;  4MMX B;  3B7C A;  5G1K A;  1GSP A;  1NJI 4;  4LYL B;  3PXM A;  4L7K A;  1C54 A;  3ER7 A;  4XM4 A;  5LC7 A;  2RFR A;  1TFO A;  1FW7 A; 
#chains in the Genus database with same CATH homology
 1I2F A;  4BU4 A;  3D5G A;  3RNT A;  1PYL A;  1JBT A;  1LOY A;  1GOU A;  1RNT A;  1RGH A;  1RN4 A;  1BRN L;  1I0X A;  5RNT A;  1LOV A;  1DE3 A;  1BNG A;  2RNT A;  1BNE A;  1YVS A;  2F56 A;  2SAR A;  1BVI A;  3AHW A;  3KCH A;  1BRI A;  1X1W A;  2ZA4 A;  3AHS A;  1I2E A;  1RN1 A;  1JBS A;  1B2X A;  1BNS A;  1BSE A;  1GMQ A;  1YGW A;  1UCJ A;  1RGF A;  1B2U A;  1B2M A;  2C4B A;  3WHO A;  1RNB A;  1GMR A;  1TTO A;  1DET A;  1G02 A;  1BSC A;  1X1U A;  1YNV X;  1RDS A;  1PY3 A;  1I0V A;  2KAA A;  2AAE A;  3BIR A;  2F5M A;  1ZGX A;  1FUS A;  1RGC A;  3AGN A;  4J5G A;  3Q3F A;  3WR2 A;  1RGG A;  2HOH A;  7RNT A;  3DGY A;  2RBI A;  1GMP A;  4J5K A;  1BIR A;  1UCI A;  2F5W A;  1BGS A;  1MGW A;  2KF5 A;  1I8V A;  1BNI A;  1B21 A;  1RGK A;  1BAN A;  5HOH A;  1T2I A;  4HOH A;  1MGR A;  1BU4 A;  1RTU A;  1B27 A;  1B2S A;  1GOV A;  5BU4 A;  1B2Z A;  4GSP A;  1LRA A;  5BIR A;  1BRH A;  1UCL A;  1TRQ A;  1BNF A;  1I3F A;  1RCK A;  1UCK A;  1RLS A;  6RNT A;  1BRK A;  2KF4 A;  2BU4 A;  2KF3 A;  7GSP A;  6GSP A;  3D5I A;  1HZ1 A;  1FYS A;  1I3I A;  9RNT A;  1RHL A;  2GSP A;  3AGO A;  1RMS A;  3SYU A;  2KF6 A;  3BU4 A;  1RGL A;  1FZU A;  1T2H A;  4BIR A;  1FUT A;  1I2G A;  1GOY A;  1Q9E A;  4RNT A;  1LOW A;  1CH0 A;  1JBR A;  1BAO A;  1LNI A;  2AAD A;  1BOX A;  1HYF A;  1B20 A;  3D4A A;  1BSB A;  1RSN A;  5GSP A;  1BRG A;  1R4Y A;  3DH2 A;  3URP A;  1BSD A;  4HAA A;  1BRS A;  4GHO A;  1BRJ A;  1BUJ A;  1RGE A;  1X1Y A;  2BIR A;  8RNT A;  2F4Y A;  1BNJ A;  1X1X A;  1I70 A;  1BNR A;  3A5E A;  1RGA A;  1BSA A;  3GSP A;  1AQZ A;  1A2P A;  1RCL A;  1GSP A;  1C54 A;  1TRP A;  1IYY A;  1SAR A;  1B3S A;  3HOH A;  1FW7 A;  1AY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...