6RNTA

Crystal structure of ribonuclease t1 complexed with adenosine 2'-monophosphate at 1.8-angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of ribonuclease T1 complexed with adenosine 2'-monophosphate at 1.8-A resolution.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 6rntA00
2KF6A 1RNTA 1BNEA 1FZUA 1GMRA 2RBIA 9RNTA 1RNBA 1YGWA 1HZ1A 8RNTA 1RCKA 2BIRA 1TTOA 1B27A 2RNTA 4J5KA 3URPA 3WR2A 6RNTA 1BRKA 1BRHA 1CH0A 1X1UA 1RGLA 1B3SA 1I2FA 2KF4A 3GSPA 1MGWA 1RN1A 4BIRA 1UCIA 2HOHA 7GSPA 1RGFA 1I2EA 1B21A 1X1YA 1I2GA 1MGRA 1UCLA 2F4YA 1YVSA 1B20A 1X1WA 1RDSA 3D5GA 1PYLA 1I8VA 1RGHA 1GMPA 1TRQA 1RSNA 1RGKA 5RNTA 2AADA 1FYSA 2F56A 5HOHA 1I70A 3BU4A 1I0VA 1YNVX 1TRPA 4HOHA 1SARA 3D5IA 5GSPA 1BRGA 1GOUA 2AAEA 3AHSA 1BRIA 5BIRA 1DE3A 1B2UA 1LOVA 1RCLA 1RGGA 1FUTA 1RHLA 1C54A 1BSBA 4HAAA 1A2PA 1BNIA 1AY7A 2F5MA 1G02A 3BIRA 1B2ZA 1B2MA 2F5WA 1DETA 1T2IA 3AGNA 1Q9EA 2GSPA 3DGYA 1LNIA 1JBTA 1BAOA 1BNJA 1RMSA 3AGOA 1BSAA 3WHOA 1T2HA 2KF5A 1X1XA 3Q3FA 1BNFA 1GMQA 1B2XA 1UCKA 1BGSA 1RN4A 4GSPA 1BOXA 1GOYA 4RNTA 1I3IA 1BIRA 3A5EA 1BNGA 1BVIA 1RGCA 1RLSA 3KCHA 1BRNL 2ZA4A 6GSPA 1ZGXA 4GHOA 1RGEA 1LOWA 1BU4A 1RTUA 3AHWA 1GSPA 4J5GA 1BNSA 3HOHA 1JBRA 1BNRA 3RNTA 3SYUA 4BU4A 1BSDA 1PY3A 1BANA 1RGAA 1AQZA 1BRJA 1I3FA 7RNTA 3DH2A 1IYYA 1R4YA 2KAAA 1B2SA 1LOYA 1JBSA 1BRSA 1FW7A 2KF3A 2BU4A 1I0XA 2C4BA 1BUJA 1UCJA 1FUSA 5BU4A 2SARA 1HYFA 1GOVA 1LRAA 1BSCA 1BSEA 3D4AA
chains in the Genus database with same CATH superfamily
3CU3A 1RNTA 4X2OA 1FZUA 4LEHA 1GMRA 2RBIA 2FXTA 5EEOA 3T0UA 2BHMA 1K28A 3WA2X 1TTOA 4J5KA 2IMJA 4XDVA 1JB4A 4XBXA 1X1UA 1RGLA 3S27A 3LTBA 3Q2PA 4U13A 1I2FA 1T5YA 3GSPA 5IEOA 4CCVA 4HVNA 1UI8A 4GB5A 4MMYB 2D1WA 1UCIA 3MYTA 2HOHA 3EBYA 1W6GA 4OUQA 4WYKA 4XB5A 1ROVA 1B21A 4FCJA 1KWIA 1A2VA 1I2GA 4FMCA 3KIIA 4CJNA 4WWUC 4CPKA 4EC6A 1RKYA 3D5GA 1NJI4 1STFI 2K0MA 2FNQA 1UDII 1ZS7A 2W03A 3DMCA 2Z76A 3PCRA 1TJDA 3SLUA 4J8TA 2RGQA 5EQLA 3BNDA 1I0VA 4HM6B 5ELJA 1GY5A 3S5CA 1OF5A 1Q814 1OH0A 1LQGC 2UX0A 1GOUA 3NUVA 1IT8A 1D6YA 5BIRA 1DE3A 1GD4A 1IDPA 1LOVA 2MF7A 1W2ZA 3IJEB 1RGGA 4FMAA 4K1UA 1C54A 2IUKA 1IVXA 1KC84 3DZLA 5JPPA 3JUOA 3RGRA 5M18A 2F5MA 1LOXA 3BIRA 5AIGA 3M8CA 5BVBA 1LVNA 1PU4A 4O3VA 1N8QA 1Q9EA 3BNEA 3FF2A 3WOEB 1L5GB 1W5ZA 1LNIA 1MNLA 1N9JA 1WMOA 3LTDA 3RGAA 1M9GA 1RMSA 1QALA 4CDLA 2Z6BA 4BTXA 4R4KA 1JB2A 2STDA 1VQ63 3FF0A 3GAXA 1X1XA 2CFKA 3MWZA 4N6V0 3FCSB 1YIT3 3CC23 3HIIA 1RN4A 3EHCA 1K41A 1BOXA 1EG9B 1SJWA 4OVMA 2OTL3 3A5EA 4EV2A 2E2TA 1VZZA 1RLSA 4I5QA 1VQO3 5FGOA 3LTAA 3N8BA 1YI23 1YGEA 2PZVA 1FA3A 2W2CA 3LYGA 3PS8A 5KP4A 1RTUA 2W56A 2L4VA 1SPUA 4RNZA 4NHFA 2GEXA 4OK0A 1O7PB 1W7CA 3DGLA 1LNHA 1RRLA 2ZHXB 3QK9A 3NV0A 4WYKB 3UL6A 1IQ8A 4HJLB 1PY3A 3CME3 1BANA 1BRJA 2H0HA 1VQ43 3EN8A 3B7CA 3OWUA 7RNTA 1IV9A 1R4YA 2KAAA 1IYYA 1STDA 2OCTA 1BRSA 2W0QA 3EX9A 1UUGB 3U97A 4EV5A 1GS3A 1YHQ3 1JBSA 2UUGC 2W9QA 3SOYA 1Q7Y4 1VQL3 1IVWA 1FUSA 3OWYA 1OF5B 6STDA 1FGOA 2KRTA 1V57A 4O02B 1VQ73 1GOVA 1LRAA 1GYBA 2B24B 2E2VA 2GU3A 3WA3A 2Z7AA 2B1XB 1VQ83 3QRDA 2F86B 3NQYA 3Q90A 2BO9B 1RNBA 4XBYA 3V92A 4EYCA 3NHXA 4HKVB 3HZPA 2BIRA 2XR8B 2YFIB 3B4PA 3URPA 6RNTA 1JJ22 3OWSA 5G1KA 1IT7A 1NB3I 4WHAA 3F8HA 1BRHA 1NDOB 1Q42A 4PEJA 3X3YA 1OHSA 5EVHA 1B3SA 2KF4A 1UI7A 3ALAA 4FR9A 2CFDA 4L8OA 1MGWA 3U1WA 3DGMA 4JRFA 2CC3A 1F8NA 3DY5A 3GZBA 4L8PA 3PCSA 3UL5A 4KFEA 1I2EA 1EQKA 4K61A 2XGLA 4L7KA 1U8CB 1ISKA 2F4YA 1YVSA 3WMDA 5AEWB 1X1WA 1RDSA 1PYLA 1I8VA 3KN4A 3WODG 1ULIB 1GMPA 1TRQA 3G4S3 1NNVA 1QJGA 3T8NA 3F7XA 1RSNA 5RNTA 3NXJA 4RNYA 1FYSA 2F56A 3CPOA 1I70A 4ILFA 1VQ93 3BNBA 3LT9A 3K5TA 5IG3A 2CH9A 4JF8A 2HMLB 3HK4A 2WO0A 5GSPA 1A67A 2OOVA 1JN5A 3G0KA 2P38A 2XFSA 1BRIA 1Q40A 2CX1A 2XRXB 2W56B 1B2UA 3PZWA 2HMKB 3Q1CA 4BTWA 3MG2A 5AIIA 3I563 3G713 2XSOB 3NV0B 4HAAA 2F98A 5CK6A 1MWTA 1BNIA 3NBJA 5JBSA 2ML5A 1AY7A 1ULJB 3EB8A 1W4NA 4N6LA 3CXC2 2F5WA 2FGTA 1UGIA 4O2HA 3CC43 1DETA 4NPBA 1C7HA 1OGZA 2GSPA 2RFRA 4ORLA 1BAOA 1AVKA 1BSAA 3DXOA 3FG4A 3PYJA 1BNFA 2YFJB 1GMQA 1G0TA 1JZDA 1M1XB 1IVVA 3NBBA 5M1AA 3EC9A 4HM8B 2JDIH 2W9PA 1LQMB 2K3DA 4AEQA 1BIRA 4LSOA 2F99A 5AYSC 1N8R4 1QAKA 1BVIA 1RGCA 3ZFZA 3KCHA 2CWTA 1Q824 1BRNL 1O7NB 2ZA4A 2KCDA 1FGMA 5AEUB 1VQM3 5IG5A 1ZGXA 4FCZA 1LOWA 1BU4A 1RRHA 3ER7A 1OGXA 2C10A 4KT3B 2QA43 2BT3A 2BMOB 3AHWA 4IT7A 2HMJB 1ASKA 4K90B 4LGQA 2CX0A 3PGBA 4J5GA 1UGHI 1SQWA 1UUWB 1BNSA 3CPW2 2HMMB 2BNGA 2ZDJA 3F14A 4N6UA 4GL6A 1MWRA 1NWWA 2XEPA 1AR0A 1BNRA 1IV7A 3CCS3 3LMLA 4R80A 3D3LA 5CLKA 3X3ZA 5CF2A 1YIJ3 1RGAA 2GEYA 1AQZA 2RCDA 4O8SA 2K54A 3H3HA 4FCMA 4HM3B 1HKXA 4LMIA 1B2SA 2CHCA 3FG3A 3D79A 4XBTA 2YX9A 1NO3A 4MEIA 2BU4A 2C4BA 2GBWB 3GZXB 1D6ZA 1JRQA 4KVHA 4N6TA 1UCJA 1S5AA 2Z77A 4G1MB 3UB1A 4LYLB 1UUVB 1HYFA 1JN5B 5ELUA 3EF8A 1VQK3 5CF1A 1R4CA 5M19A 1QVF2 1Q40B 1W02A 3ZG0A 2KF6A 3CC73 1OHPA 1K734 3DGNA 5TGNA 3X42A 1W01A 1W6CA 2WOHA 5AYRB 2W04A 3WR2A 5LC6A 5IG0A 4HM0B 1YVBI 1FGQA 4TX4A 1BRKA 1VQN3 2CKFB 3IPTA 3CCE3 1O7MB 1YJN3 1QVG2 4IIAA 3MG3A 1PFPA 3ROBA 1JB5A 1RN1A 1N5PA 2WGQA 2GU1A 4BIRA 2OWPA 1RGFA 3PXMA 3DM8A 1MGRA 3S29A 1UCLA 5FW5A 3STDA 1NB5I 2OTJ3 1DVCA 3UJMA 5IENA 1YJ93 3GZRA 3DGOA 4BL3A 4HZBB 5IW9A 2CIUA 1QMAA 3MPHA 4FMBA 3FGYA 3L0RA 4IPBA 2AADA 2Q07A 3BU4A 3G8ZA 1YNVX 4HOHA 2V1LA 1SARA 3SVAA 1KSIA 1O7WB 1GD3A 2HMOB 3D5IA 3GZYB 1TFKA 3CD63 1M1K4 5G1LA 2BMRB 3WDGB 1HU9A 3V99A 3OXAA 4N6MA 4R1KA 2P05A 2CW9A 3OW22 1JKGA 5KP3A 3SXXA 1VQP3 1DMMA 3GRDA 3K0ZA 1BSBA 3F40A 3SEDA 2ML6A 1Q864 3OV4A 4HM5B 1G02A 3G16A 3HIGA 2CWUA 1CEWI 1T2IA 1AV4A 2PNCA 5G2GA 3OX9A 5LC7A 4XDWA 2CK3H 3CCU3 2P0XA 1BNJA 3H51A 3NBRA 2XF3A 3AGOA 2R4IA 1E3VA 2CFWA 3Q3FA 1RJOA 2XH9A 3VGNA 4QWTA 1EUIC 1US1A 1Y4KA 2XSHB 3LT8A 1B2XA 3E99A 3AMOA 3DUKA 3LXUX 1UCKA 1BUQA 3FH1A 3NQZA 2M7OA 3KSED 4GSPA 3KZTA 3K63A 2OQEA 1UW1A 8CHOA 2P09A 2H0GA 2GBXB 2O9UX 5AI1A 3JUMA 3B4OA 5D83A 4DKIA 3CNXA 3EQQB 1G96A 4I4KA 4XM4A 2E2UA 4EW5A 1VQQA 3HX8A 2SBLA 1GSPA 3X3XA 3KE7A 2YFLB 5KP1A 1W6YA 2Y74A 4KZ1A 2A15A 5DREA 1JBRA 1MWSA 3RNTA 1N5HA 3CCM3 4RZMA 1OCVA 5CXOA 1WNHA 3N9HA 2R41A 4BU4A 3FKAA 1BSDA 3K7CA 7STDA 2CG1A 3EJVA 1DVDA 3MHEA 1DMNA 3RDEA 3DH2A 2OOVC 1IK3A 3GWRA 4HBRA 1E97A 4BL2A 3ZG5A 3NX0A 5IG4A 3WOFB 4WFOA 3S67A 3JUQA 4MMXB 3B8LA 2OQEC 1CYVA 4BTYA 3V98A 1EA2A 4R9KA 1VQ53 5BU4A 4RBNA 1S723 4N3VA 1T3BA 4MJDA 1BSEA 4STDA 1OACA 1O7GB 3EBTA 3KFQC 1BNEA 2BMQB 3CCV3 9RNTA 1O7HB 1YGWA 4MMZB 3J7Yd 1HZ1A 3KSPA 1JKGB 2L1SA 2QIYA 8RNTA 1RCKA 4NREA 2GXFA 1B27A 2RNTA 3FLJA 3O8YA 4ZM8A 3FG1A 3X41A 5JPUA 1CH0A 2H0IA 4AKZA 1V74A 3LZAA 1FGRA 1Z1SA 1DMQA 2QEX3 3I0YA 3F9SA 3I553 1IQXA 3T8UA 1TFOA 1WTHA 3BB9A 7GSPA 3SOAA 4Q53A 1DYUA 3CNMA 1X1YA 3SX1A 2QGUA 2MC8A 1V58A 2HMNB 1B20A 5AIFA 3AMOB 3LH4A 1RGHA 1JNQA 2WGOA 1GY7A 1N9EA 2CG0A 3A76A 3JUNA 1QAFA 3CCR3 1Q7HA 1RGKA 1ZO2A 4EXRA 5HOHA 4LZIA 2WOFA 2INXA 3NM2A 1TRPA 2LQVA 5IEPA 2I9WA 3MSOA 3F8XA 2LYXA 3K9MC 1BRGA 2AAEA 2C11A 3AHSA 3CCQ3 1J2BA 1W00A 1AVLA 4EBGA 1K8A4 4HM7B 4R9LA 1JZOA 1MOLA 1RCLA 1FUTA 1RHLA 1U5OA 2J8XB 1RN7A 1A2PA 1FGTA 3TDGA 5D82A 4K1VA 4KFFA 1B2ZA 1GY6A 1B2MA 4WP5A 1ROAA 2IYJA 3EE1A 3AGNA 1WMPA 3VF1A 1TUHA 3DGYA 1YJW3 1D6UA 1JBTA 5I97A 2W6JH 1WQLB 3FZWA 4HM2B 3S28A 3KKGA 4J9AA 5IF6A 3WHOA 2XGNA 3ECFA 3CMA3 3F7SA 1T2HA 1SIIA 2KF5A 5D81A 1LXEA 2P0MA 3N54B 5STDA 3BLZA 3IMAB 2CFGA 3CCL3 4N6OB 3UNLA 1BGSA 3JVCA 4HM4B 1GOYA 4RNTA 1I3IA 2RSXA 3EN1B 3HI7A 2Y73A 3LTCA 1CYUA 1TP6A 1BNGA 4HM1B 1M904 1A90A 1W2B2 1FUWA 1EEJA 4H61A 2ZL8A 3JUPA 1KQS2 1SIHA 6GSPA 1NU3A 4GHOA 1RGEA 4FMDA 1ZX2A 3NM7A 3X40A 5IERA 1JV2B 1MWUA 1K9M4 3FSDA 2KXGA 3LOYA 2IY2A 3MG1A 1IVUA 2CWVA 3HOHA 4KFDA 1IU7A 2IUJA 1TIJA 2D42A 3SYUA 5A0OB 2JQ5A 5AIHA 4H3UA 3G6E3 4N6NB 5HGRA 5DRVA 1CQSA 1OHOA 1OPYA 1I3FA 4HZ9B 2IA7A 3VSYA 3MKIA 1LOYA 1E3RA 3CCJ3 1FW7A 2CFLA 4HYZA 2UGIA 2KF3A 4X2HA 1I0XA 4AKYA 1OUNA 2XFTA 1A2KA 1BUJA 1EKMA 2SARA 1KD14 1TU5A 2O3OA 3D9RA 1WMNA 3BNCA 1BSCA 5BXQA 3D4AA 1IQYA
chains in the Genus database with same CATH topology
2KF6A 1RNTA 1BNEA 1FZUA 1GMRA 2RBIA 9RNTA 1RNBA 1YGWA 1HZ1A 8RNTA 1RCKA 2BIRA 1TTOA 1B27A 2RNTA 4J5KA 3URPA 3WR2A 6RNTA 1BRKA 1BRHA 1CH0A 1X1UA 1RGLA 1B3SA 1I2FA 2KF4A 3GSPA 1MGWA 1RN1A 4BIRA 1UCIA 2HOHA 7GSPA 1RGFA 1I2EA 1B21A 1X1YA 1I2GA 1MGRA 1UCLA 2F4YA 1YVSA 1B20A 1X1WA 1RDSA 3D5GA 1PYLA 1I8VA 1RGHA 1GMPA 1TRQA 1RSNA 1RGKA 5RNTA 2AADA 1FYSA 2F56A 5HOHA 1I70A 3BU4A 1I0VA 1YNVX 1TRPA 4HOHA 1SARA 3D5IA 5GSPA 1BRGA 1GOUA 2AAEA 3AHSA 1BRIA 5BIRA 1DE3A 1B2UA 1LOVA 1RCLA 1RGGA 1FUTA 1RHLA 1C54A 1BSBA 4HAAA 1A2PA 1BNIA 1AY7A 2F5MA 1G02A 3BIRA 1B2ZA 1B2MA 2F5WA 1DETA 1T2IA 3AGNA 1Q9EA 2GSPA 3DGYA 1LNIA 1JBTA 1BAOA 1BNJA 1RMSA 3AGOA 1BSAA 3WHOA 1T2HA 2KF5A 1X1XA 3Q3FA 1BNFA 1GMQA 1B2XA 1UCKA 1BGSA 1RN4A 4GSPA 1BOXA 1GOYA 4RNTA 1I3IA 1BIRA 3A5EA 1BNGA 1BVIA 1RGCA 1RLSA 3KCHA 1BRNL 2ZA4A 6GSPA 1ZGXA 4GHOA 1RGEA 1LOWA 1BU4A 1RTUA 3AHWA 1GSPA 4J5GA 1BNSA 3HOHA 1JBRA 1BNRA 3RNTA 3SYUA 4BU4A 1BSDA 1PY3A 1BANA 1RGAA 1AQZA 1BRJA 1I3FA 7RNTA 3DH2A 1IYYA 1R4YA 2KAAA 1B2SA 1LOYA 1JBSA 1BRSA 1FW7A 2KF3A 2BU4A 1I0XA 2C4BA 1BUJA 1UCJA 1FUSA 5BU4A 2SARA 1HYFA 1GOVA 1LRAA 1BSCA 1BSEA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF6 A;  1RNT A;  1BNE A;  1FZU A;  1GMR A;  2RBI A;  9RNT A;  1RNB A;  1YGW A;  1HZ1 A;  8RNT A;  1RCK A;  2BIR A;  1TTO A;  1B27 A;  2RNT A;  4J5K A;  3URP A;  3WR2 A;  6RNT A;  1BRK A;  1BRH A;  1CH0 A;  1X1U A;  1RGL A;  1B3S A;  1I2F A;  2KF4 A;  3GSP A;  1MGW A;  1RN1 A;  4BIR A;  1UCI A;  2HOH A;  7GSP A;  1RGF A;  1I2E A;  1B21 A;  1X1Y A;  1I2G A;  1MGR A;  1UCL A;  2F4Y A;  1YVS A;  1B20 A;  1X1W A;  1RDS A;  3D5G A;  1PYL A;  1I8V A;  1RGH A;  1GMP A;  1TRQ A;  1RSN A;  1RGK A;  5RNT A;  2AAD A;  1FYS A;  2F56 A;  5HOH A;  1I70 A;  3BU4 A;  1I0V A;  1YNV X;  1TRP A;  4HOH A;  1SAR A;  3D5I A;  5GSP A;  1BRG A;  1GOU A;  2AAE A;  3AHS A;  1BRI A;  5BIR A;  1DE3 A;  1B2U A;  1LOV A;  1RCL A;  1RGG A;  1FUT A;  1RHL A;  1C54 A;  1BSB A;  4HAA A;  1A2P A;  1BNI A;  1AY7 A;  2F5M A;  1G02 A;  3BIR A;  1B2Z A;  1B2M A;  2F5W A;  1DET A;  1T2I A;  3AGN A;  1Q9E A;  2GSP A;  3DGY A;  1LNI A;  1JBT A;  1BAO A;  1BNJ A;  1RMS A;  3AGO A;  1BSA A;  3WHO A;  1T2H A;  2KF5 A;  1X1X A;  3Q3F A;  1BNF A;  1GMQ A;  1B2X A;  1UCK A;  1BGS A;  1RN4 A;  4GSP A;  1BOX A;  1GOY A;  4RNT A;  1I3I A;  1BIR A;  3A5E A;  1BNG A;  1BVI A;  1RGC A;  1RLS A;  3KCH A;  1BRN L;  2ZA4 A;  6GSP A;  1ZGX A;  4GHO A;  1RGE A;  1LOW A;  1BU4 A;  1RTU A;  3AHW A;  1GSP A;  4J5G A;  1BNS A;  3HOH A;  1JBR A;  1BNR A;  3RNT A;  3SYU A;  4BU4 A;  1BSD A;  1PY3 A;  1BAN A;  1RGA A;  1AQZ A;  1BRJ A;  1I3F A;  7RNT A;  3DH2 A;  1IYY A;  1R4Y A;  2KAA A;  1B2S A;  1LOY A;  1JBS A;  1BRS A;  1FW7 A;  2KF3 A;  2BU4 A;  1I0X A;  2C4B A;  1BUJ A;  1UCJ A;  1FUS A;  5BU4 A;  2SAR A;  1HYF A;  1GOV A;  1LRA A;  1BSC A;  1BSE A;  3D4A A; 
#chains in the Genus database with same CATH topology
 3CU3 A;  1RNT A;  4X2O A;  1FZU A;  4LEH A;  1GMR A;  2RBI A;  2FXT A;  5EEO A;  3T0U A;  2BHM A;  1K28 A;  3WA2 X;  1TTO A;  4J5K A;  2IMJ A;  4XDV A;  1JB4 A;  4XBX A;  1X1U A;  1RGL A;  3S27 A;  3LTB A;  3Q2P A;  4U13 A;  1I2F A;  1T5Y A;  3GSP A;  5IEO A;  4CCV A;  4HVN A;  1UI8 A;  4GB5 A;  4MMY B;  2D1W A;  1UCI A;  3MYT A;  2HOH A;  3EBY A;  1W6G A;  4OUQ A;  4WYK A;  4XB5 A;  1ROV A;  1B21 A;  4FCJ A;  1KWI A;  1A2V A;  1I2G A;  4FMC A;  3KII A;  4CJN A;  4WWU C;  4CPK A;  4EC6 A;  1RKY A;  3D5G A;  1NJI 4;  1STF I;  2K0M A;  2FNQ A;  1UDI I;  1ZS7 A;  2W03 A;  3DMC A;  2Z76 A;  3PCR A;  1TJD A;  3SLU A;  4J8T A;  2RGQ A;  5EQL A;  3BND A;  1I0V A;  4HM6 B;  5ELJ A;  1GY5 A;  3S5C A;  1OF5 A;  1Q81 4;  1OH0 A;  1LQG C;  2UX0 A;  1GOU A;  3NUV A;  1IT8 A;  1D6Y A;  5BIR A;  1DE3 A;  1GD4 A;  1IDP A;  1LOV A;  2MF7 A;  1W2Z A;  3IJE B;  1RGG A;  4FMA A;  4K1U A;  1C54 A;  2IUK A;  1IVX A;  1KC8 4;  3DZL A;  5JPP A;  3JUO A;  3RGR A;  5M18 A;  2F5M A;  1LOX A;  3BIR A;  5AIG A;  3M8C A;  5BVB A;  1LVN A;  1PU4 A;  4O3V A;  1N8Q A;  1Q9E A;  3BNE A;  3FF2 A;  3WOE B;  1L5G B;  1W5Z A;  1LNI A;  1MNL A;  1N9J A;  1WMO A;  3LTD A;  3RGA A;  1M9G A;  1RMS A;  1QAL A;  4CDL A;  2Z6B A;  4BTX A;  4R4K A;  1JB2 A;  2STD A;  1VQ6 3;  3FF0 A;  3GAX A;  1X1X A;  2CFK A;  3MWZ A;  4N6V 0;  3FCS B;  1YIT 3;  3CC2 3;  3HII A;  1RN4 A;  3EHC A;  1K41 A;  1BOX A;  1EG9 B;  1SJW A;  4OVM A;  2OTL 3;  3A5E A;  4EV2 A;  2E2T A;  1VZZ A;  1RLS A;  4I5Q A;  1VQO 3;  5FGO A;  3LTA A;  3N8B A;  1YI2 3;  1YGE A;  2PZV A;  1FA3 A;  2W2C A;  3LYG A;  3PS8 A;  5KP4 A;  1RTU A;  2W56 A;  2L4V A;  1SPU A;  4RNZ A;  4NHF A;  2GEX A;  4OK0 A;  1O7P B;  1W7C A;  3DGL A;  1LNH A;  1RRL A;  2ZHX B;  3QK9 A;  3NV0 A;  4WYK B;  3UL6 A;  1IQ8 A;  4HJL B;  1PY3 A;  3CME 3;  1BAN A;  1BRJ A;  2H0H A;  1VQ4 3;  3EN8 A;  3B7C A;  3OWU A;  7RNT A;  1IV9 A;  1R4Y A;  2KAA A;  1IYY A;  1STD A;  2OCT A;  1BRS A;  2W0Q A;  3EX9 A;  1UUG B;  3U97 A;  4EV5 A;  1GS3 A;  1YHQ 3;  1JBS A;  2UUG C;  2W9Q A;  3SOY A;  1Q7Y 4;  1VQL 3;  1IVW A;  1FUS A;  3OWY A;  1OF5 B;  6STD A;  1FGO A;  2KRT A;  1V57 A;  4O02 B;  1VQ7 3;  1GOV A;  1LRA A;  1GYB A;  2B24 B;  2E2V A;  2GU3 A;  3WA3 A;  2Z7A A;  2B1X B;  1VQ8 3;  3QRD A;  2F86 B;  3NQY A;  3Q90 A;  2BO9 B;  1RNB A;  4XBY A;  3V92 A;  4EYC A;  3NHX A;  4HKV B;  3HZP A;  2BIR A;  2XR8 B;  2YFI B;  3B4P A;  3URP A;  6RNT A;  1JJ2 2;  3OWS A;  5G1K A;  1IT7 A;  1NB3 I;  4WHA A;  3F8H A;  1BRH A;  1NDO B;  1Q42 A;  4PEJ A;  3X3Y A;  1OHS A;  5EVH A;  1B3S A;  2KF4 A;  1UI7 A;  3ALA A;  4FR9 A;  2CFD A;  4L8O A;  1MGW A;  3U1W A;  3DGM A;  4JRF A;  2CC3 A;  1F8N A;  3DY5 A;  3GZB A;  4L8P A;  3PCS A;  3UL5 A;  4KFE A;  1I2E A;  1EQK A;  4K61 A;  2XGL A;  4L7K A;  1U8C B;  1ISK A;  2F4Y A;  1YVS A;  3WMD A;  5AEW B;  1X1W A;  1RDS A;  1PYL A;  1I8V A;  3KN4 A;  3WOD G;  1ULI B;  1GMP A;  1TRQ A;  3G4S 3;  1NNV A;  1QJG A;  3T8N A;  3F7X A;  1RSN A;  5RNT A;  3NXJ A;  4RNY A;  1FYS A;  2F56 A;  3CPO A;  1I70 A;  4ILF A;  1VQ9 3;  3BNB A;  3LT9 A;  3K5T A;  5IG3 A;  2CH9 A;  4JF8 A;  2HML B;  3HK4 A;  2WO0 A;  5GSP A;  1A67 A;  2OOV A;  1JN5 A;  3G0K A;  2P38 A;  2XFS A;  1BRI A;  1Q40 A;  2CX1 A;  2XRX B;  2W56 B;  1B2U A;  3PZW A;  2HMK B;  3Q1C A;  4BTW A;  3MG2 A;  5AII A;  3I56 3;  3G71 3;  2XSO B;  3NV0 B;  4HAA A;  2F98 A;  5CK6 A;  1MWT A;  1BNI A;  3NBJ A;  5JBS A;  2ML5 A;  1AY7 A;  1ULJ B;  3EB8 A;  1W4N A;  4N6L A;  3CXC 2;  2F5W A;  2FGT A;  1UGI A;  4O2H A;  3CC4 3;  1DET A;  4NPB A;  1C7H A;  1OGZ A;  2GSP A;  2RFR A;  4ORL A;  1BAO A;  1AVK A;  1BSA A;  3DXO A;  3FG4 A;  3PYJ A;  1BNF A;  2YFJ B;  1GMQ A;  1G0T A;  1JZD A;  1M1X B;  1IVV A;  3NBB A;  5M1A A;  3EC9 A;  4HM8 B;  2JDI H;  2W9P A;  1LQM B;  2K3D A;  4AEQ A;  1BIR A;  4LSO A;  2F99 A;  5AYS C;  1N8R 4;  1QAK A;  1BVI A;  1RGC A;  3ZFZ A;  3KCH A;  2CWT A;  1Q82 4;  1BRN L;  1O7N B;  2ZA4 A;  2KCD A;  1FGM A;  5AEU B;  1VQM 3;  5IG5 A;  1ZGX A;  4FCZ A;  1LOW A;  1BU4 A;  1RRH A;  3ER7 A;  1OGX A;  2C10 A;  4KT3 B;  2QA4 3;  2BT3 A;  2BMO B;  3AHW A;  4IT7 A;  2HMJ B;  1ASK A;  4K90 B;  4LGQ A;  2CX0 A;  3PGB A;  4J5G A;  1UGH I;  1SQW A;  1UUW B;  1BNS A;  3CPW 2;  2HMM B;  2BNG A;  2ZDJ A;  3F14 A;  4N6U A;  4GL6 A;  1MWR A;  1NWW A;  2XEP A;  1AR0 A;  1BNR A;  1IV7 A;  3CCS 3;  3LML A;  4R80 A;  3D3L A;  5CLK A;  3X3Z A;  5CF2 A;  1YIJ 3;  1RGA A;  2GEY A;  1AQZ A;  2RCD A;  4O8S A;  2K54 A;  3H3H A;  4FCM A;  4HM3 B;  1HKX A;  4LMI A;  1B2S A;  2CHC A;  3FG3 A;  3D79 A;  4XBT A;  2YX9 A;  1NO3 A;  4MEI A;  2BU4 A;  2C4B A;  2GBW B;  3GZX B;  1D6Z A;  1JRQ A;  4KVH A;  4N6T A;  1UCJ A;  1S5A A;  2Z77 A;  4G1M B;  3UB1 A;  4LYL B;  1UUV B;  1HYF A;  1JN5 B;  5ELU A;  3EF8 A;  1VQK 3;  5CF1 A;  1R4C A;  5M19 A;  1QVF 2;  1Q40 B;  1W02 A;  3ZG0 A;  2KF6 A;  3CC7 3;  1OHP A;  1K73 4;  3DGN A;  5TGN A;  3X42 A;  1W01 A;  1W6C A;  2WOH A;  5AYR B;  2W04 A;  3WR2 A;  5LC6 A;  5IG0 A;  4HM0 B;  1YVB I;  1FGQ A;  4TX4 A;  1BRK A;  1VQN 3;  2CKF B;  3IPT A;  3CCE 3;  1O7M B;  1YJN 3;  1QVG 2;  4IIA A;  3MG3 A;  1PFP A;  3ROB A;  1JB5 A;  1RN1 A;  1N5P A;  2WGQ A;  2GU1 A;  4BIR A;  2OWP A;  1RGF A;  3PXM A;  3DM8 A;  1MGR A;  3S29 A;  1UCL A;  5FW5 A;  3STD A;  1NB5 I;  2OTJ 3;  1DVC A;  3UJM A;  5IEN A;  1YJ9 3;  3GZR A;  3DGO A;  4BL3 A;  4HZB B;  5IW9 A;  2CIU A;  1QMA A;  3MPH A;  4FMB A;  3FGY A;  3L0R A;  4IPB A;  2AAD A;  2Q07 A;  3BU4 A;  3G8Z A;  1YNV X;  4HOH A;  2V1L A;  1SAR A;  3SVA A;  1KSI A;  1O7W B;  1GD3 A;  2HMO B;  3D5I A;  3GZY B;  1TFK A;  3CD6 3;  1M1K 4;  5G1L A;  2BMR B;  3WDG B;  1HU9 A;  3V99 A;  3OXA A;  4N6M A;  4R1K A;  2P05 A;  2CW9 A;  3OW2 2;  1JKG A;  5KP3 A;  3SXX A;  1VQP 3;  1DMM A;  3GRD A;  3K0Z A;  1BSB A;  3F40 A;  3SED A;  2ML6 A;  1Q86 4;  3OV4 A;  4HM5 B;  1G02 A;  3G16 A;  3HIG A;  2CWU A;  1CEW I;  1T2I A;  1AV4 A;  2PNC A;  5G2G A;  3OX9 A;  5LC7 A;  4XDW A;  2CK3 H;  3CCU 3;  2P0X A;  1BNJ A;  3H51 A;  3NBR A;  2XF3 A;  3AGO A;  2R4I A;  1E3V A;  2CFW A;  3Q3F A;  1RJO A;  2XH9 A;  3VGN A;  4QWT A;  1EUI C;  1US1 A;  1Y4K A;  2XSH B;  3LT8 A;  1B2X A;  3E99 A;  3AMO A;  3DUK A;  3LXU X;  1UCK A;  1BUQ A;  3FH1 A;  3NQZ A;  2M7O A;  3KSE D;  4GSP A;  3KZT A;  3K63 A;  2OQE A;  1UW1 A;  8CHO A;  2P09 A;  2H0G A;  2GBX B;  2O9U X;  5AI1 A;  3JUM A;  3B4O A;  5D83 A;  4DKI A;  3CNX A;  3EQQ B;  1G96 A;  4I4K A;  4XM4 A;  2E2U A;  4EW5 A;  1VQQ A;  3HX8 A;  2SBL A;  1GSP A;  3X3X A;  3KE7 A;  2YFL B;  5KP1 A;  1W6Y A;  2Y74 A;  4KZ1 A;  2A15 A;  5DRE A;  1JBR A;  1MWS A;  3RNT A;  1N5H A;  3CCM 3;  4RZM A;  1OCV A;  5CXO A;  1WNH A;  3N9H A;  2R41 A;  4BU4 A;  3FKA A;  1BSD A;  3K7C A;  7STD A;  2CG1 A;  3EJV A;  1DVD A;  3MHE A;  1DMN A;  3RDE A;  3DH2 A;  2OOV C;  1IK3 A;  3GWR A;  4HBR A;  1E97 A;  4BL2 A;  3ZG5 A;  3NX0 A;  5IG4 A;  3WOF B;  4WFO A;  3S67 A;  3JUQ A;  4MMX B;  3B8L A;  2OQE C;  1CYV A;  4BTY A;  3V98 A;  1EA2 A;  4R9K A;  1VQ5 3;  5BU4 A;  4RBN A;  1S72 3;  4N3V A;  1T3B A;  4MJD A;  1BSE A;  4STD A;  1OAC A;  1O7G B;  3EBT A;  3KFQ C;  1BNE A;  2BMQ B;  3CCV 3;  9RNT A;  1O7H B;  1YGW A;  4MMZ B;  3J7Y d;  1HZ1 A;  3KSP A;  1JKG B;  2L1S A;  2QIY A;  8RNT A;  1RCK A;  4NRE A;  2GXF A;  1B27 A;  2RNT A;  3FLJ A;  3O8Y A;  4ZM8 A;  3FG1 A;  3X41 A;  5JPU A;  1CH0 A;  2H0I A;  4AKZ A;  1V74 A;  3LZA A;  1FGR A;  1Z1S A;  1DMQ A;  2QEX 3;  3I0Y A;  3F9S A;  3I55 3;  1IQX A;  3T8U A;  1TFO A;  1WTH A;  3BB9 A;  7GSP A;  3SOA A;  4Q53 A;  1DYU A;  3CNM A;  1X1Y A;  3SX1 A;  2QGU A;  2MC8 A;  1V58 A;  2HMN B;  1B20 A;  5AIF A;  3AMO B;  3LH4 A;  1RGH A;  1JNQ A;  2WGO A;  1GY7 A;  1N9E A;  2CG0 A;  3A76 A;  3JUN A;  1QAF A;  3CCR 3;  1Q7H A;  1RGK A;  1ZO2 A;  4EXR A;  5HOH A;  4LZI A;  2WOF A;  2INX A;  3NM2 A;  1TRP A;  2LQV A;  5IEP A;  2I9W A;  3MSO A;  3F8X A;  2LYX A;  3K9M C;  1BRG A;  2AAE A;  2C11 A;  3AHS A;  3CCQ 3;  1J2B A;  1W00 A;  1AVL A;  4EBG A;  1K8A 4;  4HM7 B;  4R9L A;  1JZO A;  1MOL A;  1RCL A;  1FUT A;  1RHL A;  1U5O A;  2J8X B;  1RN7 A;  1A2P A;  1FGT A;  3TDG A;  5D82 A;  4K1V A;  4KFF A;  1B2Z A;  1GY6 A;  1B2M A;  4WP5 A;  1ROA A;  2IYJ A;  3EE1 A;  3AGN A;  1WMP A;  3VF1 A;  1TUH A;  3DGY A;  1YJW 3;  1D6U A;  1JBT A;  5I97 A;  2W6J H;  1WQL B;  3FZW A;  4HM2 B;  3S28 A;  3KKG A;  4J9A A;  5IF6 A;  3WHO A;  2XGN A;  3ECF A;  3CMA 3;  3F7S A;  1T2H A;  1SII A;  2KF5 A;  5D81 A;  1LXE A;  2P0M A;  3N54 B;  5STD A;  3BLZ A;  3IMA B;  2CFG A;  3CCL 3;  4N6O B;  3UNL A;  1BGS A;  3JVC A;  4HM4 B;  1GOY A;  4RNT A;  1I3I A;  2RSX A;  3EN1 B;  3HI7 A;  2Y73 A;  3LTC A;  1CYU A;  1TP6 A;  1BNG A;  4HM1 B;  1M90 4;  1A90 A;  1W2B 2;  1FUW A;  1EEJ A;  4H61 A;  2ZL8 A;  3JUP A;  1KQS 2;  1SIH A;  6GSP A;  1NU3 A;  4GHO A;  1RGE A;  4FMD A;  1ZX2 A;  3NM7 A;  3X40 A;  5IER A;  1JV2 B;  1MWU A;  1K9M 4;  3FSD A;  2KXG A;  3LOY A;  2IY2 A;  3MG1 A;  1IVU A;  2CWV A;  3HOH A;  4KFD A;  1IU7 A;  2IUJ A;  1TIJ A;  2D42 A;  3SYU A;  5A0O B;  2JQ5 A;  5AIH A;  4H3U A;  3G6E 3;  4N6N B;  5HGR A;  5DRV A;  1CQS A;  1OHO A;  1OPY A;  1I3F A;  4HZ9 B;  2IA7 A;  3VSY A;  3MKI A;  1LOY A;  1E3R A;  3CCJ 3;  1FW7 A;  2CFL A;  4HYZ A;  2UGI A;  2KF3 A;  4X2H A;  1I0X A;  4AKY A;  1OUN A;  2XFT A;  1A2K A;  1BUJ A;  1EKM A;  2SAR A;  1KD1 4;  1TU5 A;  2O3O A;  3D9R A;  1WMN A;  3BNC A;  1BSC A;  5BXQ A;  3D4A A;  1IQY A; 
#chains in the Genus database with same CATH homology
 2KF6 A;  1RNT A;  1BNE A;  1FZU A;  1GMR A;  2RBI A;  9RNT A;  1RNB A;  1YGW A;  1HZ1 A;  8RNT A;  1RCK A;  2BIR A;  1TTO A;  1B27 A;  2RNT A;  4J5K A;  3URP A;  3WR2 A;  6RNT A;  1BRK A;  1BRH A;  1CH0 A;  1X1U A;  1RGL A;  1B3S A;  1I2F A;  2KF4 A;  3GSP A;  1MGW A;  1RN1 A;  4BIR A;  1UCI A;  2HOH A;  7GSP A;  1RGF A;  1I2E A;  1B21 A;  1X1Y A;  1I2G A;  1MGR A;  1UCL A;  2F4Y A;  1YVS A;  1B20 A;  1X1W A;  1RDS A;  3D5G A;  1PYL A;  1I8V A;  1RGH A;  1GMP A;  1TRQ A;  1RSN A;  1RGK A;  5RNT A;  2AAD A;  1FYS A;  2F56 A;  5HOH A;  1I70 A;  3BU4 A;  1I0V A;  1YNV X;  1TRP A;  4HOH A;  1SAR A;  3D5I A;  5GSP A;  1BRG A;  1GOU A;  2AAE A;  3AHS A;  1BRI A;  5BIR A;  1DE3 A;  1B2U A;  1LOV A;  1RCL A;  1RGG A;  1FUT A;  1RHL A;  1C54 A;  1BSB A;  4HAA A;  1A2P A;  1BNI A;  1AY7 A;  2F5M A;  1G02 A;  3BIR A;  1B2Z A;  1B2M A;  2F5W A;  1DET A;  1T2I A;  3AGN A;  1Q9E A;  2GSP A;  3DGY A;  1LNI A;  1JBT A;  1BAO A;  1BNJ A;  1RMS A;  3AGO A;  1BSA A;  3WHO A;  1T2H A;  2KF5 A;  1X1X A;  3Q3F A;  1BNF A;  1GMQ A;  1B2X A;  1UCK A;  1BGS A;  1RN4 A;  4GSP A;  1BOX A;  1GOY A;  4RNT A;  1I3I A;  1BIR A;  3A5E A;  1BNG A;  1BVI A;  1RGC A;  1RLS A;  3KCH A;  1BRN L;  2ZA4 A;  6GSP A;  1ZGX A;  4GHO A;  1RGE A;  1LOW A;  1BU4 A;  1RTU A;  3AHW A;  1GSP A;  4J5G A;  1BNS A;  3HOH A;  1JBR A;  1BNR A;  3RNT A;  3SYU A;  4BU4 A;  1BSD A;  1PY3 A;  1BAN A;  1RGA A;  1AQZ A;  1BRJ A;  1I3F A;  7RNT A;  3DH2 A;  1IYY A;  1R4Y A;  2KAA A;  1B2S A;  1LOY A;  1JBS A;  1BRS A;  1FW7 A;  2KF3 A;  2BU4 A;  1I0X A;  2C4B A;  1BUJ A;  1UCJ A;  1FUS A;  5BU4 A;  2SAR A;  1HYF A;  1GOV A;  1LRA A;  1BSC A;  1BSE A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...