6RNTA

Crystal structure of ribonuclease t1 complexed with adenosine 2'-monophosphate at 1.8-angstroms resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of ribonuclease T1 complexed with adenosine 2'-monophosphate at 1.8-A resolution.
pubmed rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 6rntA00
1X1WA 1RHLA 1BRGA 1BIRA 2KF4A 1C54A 1BVIA 1BU4A 1I70A 4BIRA 1RN4A 2AADA 1BANA 4BU4A 1BRHA 1GOUA 5BIRA 9RNTA 1SARA 3AHWA 6GSPA 1R4YA 1TRPA 1I2FA 1X1XA 2F5MA 3A5EA 7GSPA 1I8VA 1RGFA 1YNVX 2KF5A 3KCHA 3WHOA 1ZGXA 1I3IA 1T2HA 1BRIA 1GOVA 1B3SA 1BNEA 1PY3A 1MGWA 1T2IA 4HOHA 1RDSA 1BAOA 3AGOA 3AHSA 1BSEA 1UCJA 1FW7A 1JBTA 1GMQA 1RGAA 1RSNA 1BSBA 5BU4A 1A2PA 1B27A 1X1YA 1RMSA 4J5KA 6RNTA 1RCKA 1X1UA 2ZA4A 1GMRA 1BNFA 1UCIA 3GSPA 1CH0A 4RNTA 2F5WA 1GSPA 1FUSA 2HOHA 5HOHA 1RNBA 1I2EA 1B2XA 4HAAA 1BOXA 1I2GA 2RNTA 1AY7A 4J5GA 1B2UA 1TTOA 1BNRA 1RGCA 1LOWA 1FZUA 1B2SA 1RGKA 3AGNA 3RNTA 1RN1A 1BSCA 1LRAA 1BNGA 5GSPA 1G02A 1RGLA 3DH2A 1DE3A 7RNTA 2F56A 1BUJA 1RGGA 1BRJA 1BRKA 2C4BA 4GHOA 1AQZA 1BNSA 1YVSA 1IYYA 3DGYA 1TRQA 3BU4A 2F4YA 1B20A 2SARA 2GSPA 1B21A 1RTUA 1UCLA 1I0XA 3HOHA 1RCLA 2RBIA 5RNTA 3URPA 1BSAA 1HYFA 1YGWA 3WR2A 1GOYA 2BIRA 1RNTA 1LOVA 2KF6A 1BNIA 1MGRA 1I3FA 1I0VA 2BU4A 1BGSA 4GSPA 3D5IA 1UCKA 1BRNL 3Q3FA 3SYUA 1DETA 1JBRA 3BIRA 1LNIA 1BRSA 1BNJA 3D5GA 1PYLA 2KAAA 1JBSA 1B2ZA 1RLSA 1RGEA 1FYSA 8RNTA 1BSDA 1GMPA 3D4AA 1Q9EA 2AAEA 1B2MA 1FUTA 1LOYA 1RGHA 1HZ1A 2KF3A
chains in the Genus database with same CATH superfamily
1R4CA 2GBXB 3CME3 3DGMA 2YFJB 1O7NB 2P38A 1WTHA 2KF4A 4O2HA 2A15A 3KN4A 1BU4A 1JKGB 2KRTA 2CFLA 3JUOA 3ZG0A 3LOYA 1A2VA 3G16A 1GOUA 4MMZB 1STDA 1DVCA 2CWTA 3AHWA 6GSPA 1TRPA 1JN5B 2CK3H 9RNTA 3K9MC 1LXEA 2HMOB 1I8VA 1W6GA 1JKGA 1RGFA 4FMDA 3LT8A 3OXAA 4WWUC 2Z7AA 3KCHA 5IEPA 3LTBA 1FGOA 2OOVA 1KQS2 1UW1A 1SPUA 1TFOA 1HKXA 1ZO2A 1UGIA 3FH1A 3K63A 3N54B 4N6OB 7STDA 3HX8A 1MGWA 4STDA 1TFKA 3DGLA 3HIGA 3PYJA 1IV7A 4LGQA 2F99A 2HMJB 4OVMA 1JN5A 2W03A 5JPUA 1NB5I 1VQL3 2IMJA 3UB1A 1VQN3 4N6TA 1K734 4FCMA 1QVG2 3TDGA 1UCJA 2MC8A 1RSNA 2R41A 4BTWA 2FGTA 2GU1A 4ORLA 1O7GB 2R4IA 1B27A 4XDWA 2P09A 1RMSA 3H3HA 1X1UA 3PCSA 1C7HA 1GMRA 1UCIA 1JZOA 1STFI 3GSPA 5KP4A 2ZDJA 5IG3A 1VQK3 5LC7A 1OPYA 4HM2B 1UUGB 3Q2PA 1VQ43 1EG9B 3EN1B 5G1LA 1GSPA 2HOHA 2OCTA 4LMIA 2XFTA 1I2EA 1WNHA 3MG2A 3QRDA 1BOXA 1KC84 5D82A 3NXJA 4J5GA 2RSXA 1TTOA 1BNRA 1QVF2 3ALAA 1LOWA 1YJW3 4N6MA 1B2SA 1O7MB 3F7SA 5KP3A 3RNTA 4DKIA 5IG4A 2BMRB 1G0TA 1LRAA 3FF2A 3OWUA 5GSPA 1JJ22 5CXOA 1G02A 1LQGC 2F98A 4O02B 1BUJA 1K8A4 4N3VA 4GHOA 4HJLB 2IYJA 4HZ9B 3GRDA 3WA3A 4KVHA 2XRXB 2H0HA 2E2VA 1IYYA 1DMNA 2LYXA 3RGAA 3GAXA 2C11A 4LSOA 1TIJA 3JUNA 2GSPA 2XSOB 5ELJA 1RTUA 3EB8A 1JB4A 3HOHA 3U1WA 3ZG5A 3UL6A 5M1AA 1WMNA 1OACA 1W7CA 1W2B2 1VQ63 2CH9A 3OWYA 1RJOA 2Q07A 3KE7A 2XEPA 1A2KA 1GOYA 2W0QA 1GYBA 1DMMA 3DM8A 4K61A 2KF6A 3EX9A 3WOFB 3X3ZA 1OCVA 1A67A 4U13A 3LTCA 4OK0A 1BRNL 2XFSA 2STDA 4HZBB 5A0OB 1V57A 1DETA 8CHOA 2Y74A 1LNIA 3S27A 4GB5A 4N6UA 1VQ73 3G8ZA 4BTXA 5AYSC 1PYLA 1RRHA 3I553 2BO9B 4X2OA 1LVNA 1U8CB 1FYSA 1Y4KA 8RNTA 2BMQB 2FXTA 2P0XA 4R1KA 2CIUA 3D4AA 5G2GA 4XBTA 5AIIA 1FUTA 1UI7A 1LOYA 3JUPA 2WGQA 4HYZA 1HZ1A 1M9GA 4L7KA 3BNBA 1K41A 3CCV3 1NB3I 2UGIA 4MMYB 5DREA 2GEYA 2V1LA 3B4OA 4BIRA 1MWTA 1UDII 2HMMB 3CNXA 3M8CA 2AADA 3LYGA 1VQ53 1G96A 3DZLA 5BIRA 2WOFA 1AVKA 1I2FA 2XGNA 1Q824 1IVWA 5EQLA 2CWVA 1V74A 2KF5A 3WHOA 1SIIA 4BTYA 4BL2A 3ECFA 1GY5A 4KFDA 1CQSA 1B3SA 3B8LA 2OTJ3 1E97A 1JNQA 1O7WB 1ROVA 3STDA 1SQWA 3I563 1QAFA 2SBLA 2CWUA 3EE1A 4CPKA 3J7Yd 3X42A 1W5ZA 5KP1A 1RN7A 2PNCA 3MWZA 1IDPA 1RGAA 1VQO3 1YIT3 1F8NA 3B4PA 4K90B 3CC73 1A2PA 5EEOA 3G6E3 1X1YA 1SJWA 1K28A 3SLUA 3EJVA 2OQEA 4RZMA 5IF6A 2UX0A 3OV4A 4XBXA 1UI8A 1L5GB 2F5WA 1SIHA 3D79A 3CCM3 2PZVA 3X3XA 5HOHA 4GL6A 3CCL3 5IEOA 2Z6BA 1GS3A 5JPPA 1B2XA 1E3VA 1I2GA 1ZS7A 3G713 2B24B 5IERA 2UUGC 1VQQA 1D6YA 1FZUA 3CCJ3 3MG1A 5CF1A 1YVBI 2CW9A 4NHFA 1IVXA 2W9QA 3EQQB 1K9M4 1KWIA 4TX4A 3DH2A 1RGLA 1GD4A 2BNGA 5BVBA 3EHCA 4WYKB 1OGZA 2XH9A 1RGGA 1BRJA 4K1VA 1BRKA 1UUWB 4RBNA 1IQXA 2Z77A 2ML5A 3FG4A 1RRLA 1IU7A 1BNSA 3GZBA 2IUJA 3BU4A 3BNDA 1FGRA 3KIIA 5FGOA 4WYKA 3RDEA 1B21A 1W01A 2CFWA 1UCLA 2K54A 3F8HA 1VQM3 3HK4A 3S67A 2INXA 5G1KA 2MF7A 2CKFB 3NUVA 1YGWA 4Q53A 3WR2A 1FGTA 4EYCA 4HM8B 1MWSA 2KCDA 1MGRA 1I3FA 1DMQA 1I0VA 2BU4A 1N5HA 2W9PA 3KKGA 1VQ83 3I0YA 4EW5A 3D5IA 1VQ93 4R4KA 1UCKA 3D3LA 4HVNA 3NBBA 1ULJB 2BT3A 1N9JA 2I9WA 2K0MA 5JBSA 3G4S3 2CG0A 3BNEA 4K1UA 1TUHA 2O9UX 1JBRA 2W2CA 3FGYA 2O3OA 3FLJA 4FCJA 4MEIA 1OGXA 4IPBA 3CMA3 1BRSA 4HM1B 4FMCA 3D5GA 4RNYA 2HMNB 2KAAA 1MOLA 3FSDA 1EQKA 3K5TA 4XBYA 1JZDA 1OF5B 2LQVA 3CPOA 4ILFA 1GMPA 3L0RA 3NBRA 3NQYA 4QWTA 1IQ8A 1QMAA 4NPBA 3EC9A 2AAEA 1ASKA 5LC6A 1YJN3 1OHSA 1PFPA 2CHCA 1RGHA 2W04A 4HM5B 1TJDA 3F8XA 4CDLA 3FCSB 3KSPA 1RHLA 1A90A 1NWWA 1OF5A 3FKAA 3WODG 1BRGA 1BIRA 3B7CA 1C54A 1BVIA 2GU3A 2CX0A 3DY5A 3GZRA 5FW5A 3VF1A 1RN4A 1D6ZA 1N9EA 4HM7B 4CCVA 3LTDA 4H3UA 1BANA 3DGOA 4BU4A 1BRHA 2OWPA 2XR8B 4N6NB 3A5EA 2F5MA 4WFOA 1NU3A 3CC23 3JVCA 1YNVX 3NX0A 3QK9A 4FCZA 1VQP3 3FG1A 1FGQA 4L8PA 3NHXA 4R9KA 1Q40B 2YX9A 3LMLA 1PU4A 1TU5A 3ZFZA 2W56B 3VSYA 3H51A 3PZWA 3Q1CA 4HOHA 3WA2X 1RDSA 2CFDA 3KFQC 3ROBA 3AHSA 3WMDA 1W6YA 1FW7A 1GMQA 3SEDA 1BSBA 1Q40A 3JUQA 3DUKA 2XF3A 1US1A 2W56A 1D6UA 4J5KA 2CC3A 1RCKA 6RNTA 4JRFA 2HMKB 5STDA 2D1WA 5IG0A 1CH0A 1JB2A 1HU9A 3BLZA 3KSED 5TGNA 1NJI4 3NBJA 1IV9A 2XGLA 4KFEA 1FUSA 1JRQA 3WOEB 1S5AA 1AV4A 3DGNA 4HAAA 3SVAA 3HZPA 3CCQ3 1AY7A 5CLKA 1YJ93 4LEHA 2JDIH 2XSHB 4I5QA 2CG1A 3SXXA 1RGCA 1U5OA 3CCS3 2W6JH 1YHQ3 3IJEB 1ZX2A 4R9LA 1RGKA 3AGNA 3CNMA 3GWRA 4HM3B 1RN1A 4J8TA 2E2TA 3WDGB 1BNGA 1LQMB 1UUVB 2Y73A 1QJGA 3SOYA 1DE3A 2YFLB 1AVLA 1WQLB 3CPW2 1KD14 3MYTA 4ZM8A 1RKYA 1MWRA 3UL5A 1Q7HA 1IT8A 2RFRA 3DMCA 2IUKA 1AQZA 1VZZA 1YVSA 1FA3A 2C10A 4BL3A 3OW22 3UJMA 1B20A 1CYUA 3FG3A 3LTAA 4IIAA 1EUIC 1T5YA 5AIGA 3S5CA 1I0XA 2KXGA 1W00A 1WMPA 3AMOB 3URPA 5M18A 1Z1SA 3GZXB 4AEQA 3RGRA 1YIJ3 2J8XB 4MMXB 1RNTA 2RGQA 4N6V0 4J9AA 1BNIA 4EXRA 2ZL8A 3E99A 4HKVB 1YGEA 4GSPA 4O8SA 4EV2A 3AMOA 3MHEA 4N6LA 2P05A 5AIFA 3LH4A 3A76A 1OUNA 2OTL3 4IT7A 3SYUA 1KSIA 3O8YA 3G0KA 2OOVC 3BIRA 1E3RA 2BMOB 3NV0B 1QAKA 3LZAA 1IVUA 1GY7A 4I4KA 2WOHA 4XB5A 1N5PA 3X40A 2L1SA 3CC43 1B2ZA 1RGEA 4L8OA 5AEUB 1M1K4 5AYRB 3UNLA 3CCE3 1BSDA 1OH0A 3CU3A 3NV0A 2D42A 3HIIA 1Q9EA 3CCU3 1EKMA 2ZHXB 1WMOA 1ISKA 2Z76A 4R80A 1ULIB 1MWUA 3BB9A 3EF8A 3SX1A 1X1WA 2JQ5A 3IMAB 3CD63 1W2ZA 3PXMA 4AKZA 1BUQA 4PEJA 1W6CA 4RNZA 1I70A 1JV2B 3PS8A 3V99A 4JF8A 2YFIB 4G1MB 3MPHA 3MG3A 3CCR3 3K7CA 4XM4A 4HM4B 3FF0A 3V92A 1JBSA 3Q90A 1SARA 3F14A 1R4YA 1X1XA 4FR9A 7GSPA 5ELUA 1J2BA 1ZGXA 2CX1A 4H61A 3F7XA 1I3IA 1T2HA 1Q814 1BRIA 1GOVA 1BNEA 1PY3A 2IA7A 3OWSA 4XDVA 1OHOA 3NM7A 1T2IA 1UGHI 2WGOA 1FUWA 2QA43 1NO3A 1BAOA 1NDOB 1V58A 3AGOA 4LZIA 2H0IA 3OX9A 1BSEA 1JBTA 5BXQA 5BU4A 3S29A 2GBWB 1W4NA 1NNVA 1IK3A 1N8R4 1LNHA 2ZA4A 1BNFA 3LT9A 4HBRA 1LOXA 1IT7A 4RNTA 3N9HA 1EA2A 5D83A 2M7OA 4KT3B 3NQZA 3T8NA 2QEX3 1RNBA 4X2HA 4MJDA 5AI1A 3PGBA 4AKYA 2RNTA 3JUMA 1Q864 4FMAA 4O3VA 1Q7Y4 4HM6B 1GD3A 1B2UA 1N8QA 1CEWI 5I97A 5M19A 4HM0B 3X3YA 3U97A 2BHMA 3EBTA 3PCRA 1BSCA 1EEJA 5HGRA 1M904 1O7PB 7RNTA 3BNCA 2F56A 2P0MA 3ER7A 3DXOA 3S28A 1S723 3T0UA 2E2UA 2C4BA 2GEXA 1MNLA 4OUQA 1W02A 2QGUA 1JB5A 3DGYA 1TRQA 2F4YA 2FNQA 1YI23 1FGMA 2SARA 4KFFA 2L4VA 5D81A 4WP5A 4EC6A 1RCLA 3T8UA 5RNTA 3GZYB 1AR0A 2RCDA 4LYLB 1BSAA 1O7HB 1CYVA 1QALA 2CFGA 5CK6A 1HYFA 4FMBA 2B1XB 4EBGA 5AEWB 2BIRA 2ML6A 1LOVA 5AIHA 4CJNA 3D9RA 3K0ZA 3V98A 1BGSA 1T3BA 2IY2A 4EV5A 1OHPA 3NM2A 1Q42A 3MKIA 1GY6A 2CFKA 2H0GA 3Q3FA 3N8BA 4WHAA 1IVVA 2GXFA 3X41A 3CXC2 5EVHA 1BNJA 1M1XB 4NREA 5CF2A 2WO0A 3EBYA 3F40A 2F86B 3EN8A 1TP6A 5IG5A 1RLSA 3LXUX 3VGNA 3IPTA 3MSOA 4KZ1A 1DVDA 3FZWA 2QIYA 2K3DA 5IENA 2HMLB 1ROAA 6STDA 1IQYA 1DYUA 1B2MA 3KZTA 3SOAA 3HI7A 5DRVA 3F9SA 2RBIA 2OQEC 2KF3A 5IW9A
chains in the Genus database with same CATH topology
1X1WA 1RHLA 1BRGA 1BIRA 2KF4A 1C54A 1BVIA 1BU4A 1I70A 4BIRA 1RN4A 2AADA 1BANA 4BU4A 1BRHA 1GOUA 5BIRA 9RNTA 1SARA 3AHWA 6GSPA 1R4YA 1TRPA 1I2FA 1X1XA 2F5MA 3A5EA 7GSPA 1I8VA 1RGFA 1YNVX 2KF5A 3KCHA 3WHOA 1ZGXA 1I3IA 1T2HA 1BRIA 1GOVA 1B3SA 1BNEA 1PY3A 1MGWA 1T2IA 4HOHA 1RDSA 1BAOA 3AGOA 3AHSA 1BSEA 1UCJA 1FW7A 1JBTA 1GMQA 1RGAA 1RSNA 1BSBA 5BU4A 1A2PA 1B27A 1X1YA 1RMSA 4J5KA 6RNTA 1RCKA 1X1UA 2ZA4A 1GMRA 1BNFA 1UCIA 3GSPA 1CH0A 4RNTA 2F5WA 1GSPA 1FUSA 2HOHA 5HOHA 1RNBA 1I2EA 1B2XA 4HAAA 1BOXA 1I2GA 2RNTA 1AY7A 4J5GA 1B2UA 1TTOA 1BNRA 1RGCA 1LOWA 1FZUA 1B2SA 1RGKA 3AGNA 3RNTA 1RN1A 1BSCA 1LRAA 1BNGA 5GSPA 1G02A 1RGLA 3DH2A 1DE3A 7RNTA 2F56A 1BUJA 1RGGA 1BRJA 1BRKA 2C4BA 4GHOA 1AQZA 1BNSA 1YVSA 1IYYA 3DGYA 1TRQA 3BU4A 2F4YA 1B20A 2SARA 2GSPA 1B21A 1RTUA 1UCLA 1I0XA 3HOHA 1RCLA 2RBIA 5RNTA 3URPA 1BSAA 1HYFA 1YGWA 3WR2A 1GOYA 2BIRA 1RNTA 1LOVA 2KF6A 1BNIA 1MGRA 1I3FA 1I0VA 2BU4A 1BGSA 4GSPA 3D5IA 1UCKA 1BRNL 3Q3FA 3SYUA 1DETA 1JBRA 3BIRA 1LNIA 1BRSA 1BNJA 3D5GA 1PYLA 2KAAA 1JBSA 1B2ZA 1RLSA 1RGEA 1FYSA 8RNTA 1BSDA 1GMPA 3D4AA 1Q9EA 2AAEA 1B2MA 1FUTA 1LOYA 1RGHA 1HZ1A 2KF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1W A;  1RHL A;  1BRG A;  1BIR A;  2KF4 A;  1C54 A;  1BVI A;  1BU4 A;  1I70 A;  4BIR A;  1RN4 A;  2AAD A;  1BAN A;  4BU4 A;  1BRH A;  1GOU A;  5BIR A;  9RNT A;  1SAR A;  3AHW A;  6GSP A;  1R4Y A;  1TRP A;  1I2F A;  1X1X A;  2F5M A;  3A5E A;  7GSP A;  1I8V A;  1RGF A;  1YNV X;  2KF5 A;  3KCH A;  3WHO A;  1ZGX A;  1I3I A;  1T2H A;  1BRI A;  1GOV A;  1B3S A;  1BNE A;  1PY3 A;  1MGW A;  1T2I A;  4HOH A;  1RDS A;  1BAO A;  3AGO A;  3AHS A;  1BSE A;  1UCJ A;  1FW7 A;  1JBT A;  1GMQ A;  1RGA A;  1RSN A;  1BSB A;  5BU4 A;  1A2P A;  1B27 A;  1X1Y A;  1RMS A;  4J5K A;  6RNT A;  1RCK A;  1X1U A;  2ZA4 A;  1GMR A;  1BNF A;  1UCI A;  3GSP A;  1CH0 A;  4RNT A;  2F5W A;  1GSP A;  1FUS A;  2HOH A;  5HOH A;  1RNB A;  1I2E A;  1B2X A;  4HAA A;  1BOX A;  1I2G A;  2RNT A;  1AY7 A;  4J5G A;  1B2U A;  1TTO A;  1BNR A;  1RGC A;  1LOW A;  1FZU A;  1B2S A;  1RGK A;  3AGN A;  3RNT A;  1RN1 A;  1BSC A;  1LRA A;  1BNG A;  5GSP A;  1G02 A;  1RGL A;  3DH2 A;  1DE3 A;  7RNT A;  2F56 A;  1BUJ A;  1RGG A;  1BRJ A;  1BRK A;  2C4B A;  4GHO A;  1AQZ A;  1BNS A;  1YVS A;  1IYY A;  3DGY A;  1TRQ A;  3BU4 A;  2F4Y A;  1B20 A;  2SAR A;  2GSP A;  1B21 A;  1RTU A;  1UCL A;  1I0X A;  3HOH A;  1RCL A;  2RBI A;  5RNT A;  3URP A;  1BSA A;  1HYF A;  1YGW A;  3WR2 A;  1GOY A;  2BIR A;  1RNT A;  1LOV A;  2KF6 A;  1BNI A;  1MGR A;  1I3F A;  1I0V A;  2BU4 A;  1BGS A;  4GSP A;  3D5I A;  1UCK A;  1BRN L;  3Q3F A;  3SYU A;  1DET A;  1JBR A;  3BIR A;  1LNI A;  1BRS A;  1BNJ A;  3D5G A;  1PYL A;  2KAA A;  1JBS A;  1B2Z A;  1RLS A;  1RGE A;  1FYS A;  8RNT A;  1BSD A;  1GMP A;  3D4A A;  1Q9E A;  2AAE A;  1B2M A;  1FUT A;  1LOY A;  1RGH A;  1HZ1 A;  2KF3 A; 
#chains in the Genus database with same CATH topology
 1R4C A;  2GBX B;  3CME 3;  3DGM A;  2YFJ B;  1O7N B;  2P38 A;  1WTH A;  2KF4 A;  4O2H A;  2A15 A;  3KN4 A;  1BU4 A;  1JKG B;  2KRT A;  2CFL A;  3JUO A;  3ZG0 A;  3LOY A;  1A2V A;  3G16 A;  1GOU A;  4MMZ B;  1STD A;  1DVC A;  2CWT A;  3AHW A;  6GSP A;  1TRP A;  1JN5 B;  2CK3 H;  9RNT A;  3K9M C;  1LXE A;  2HMO B;  1I8V A;  1W6G A;  1JKG A;  1RGF A;  4FMD A;  3LT8 A;  3OXA A;  4WWU C;  2Z7A A;  3KCH A;  5IEP A;  3LTB A;  1FGO A;  2OOV A;  1KQS 2;  1UW1 A;  1SPU A;  1TFO A;  1HKX A;  1ZO2 A;  1UGI A;  3FH1 A;  3K63 A;  3N54 B;  4N6O B;  7STD A;  3HX8 A;  1MGW A;  4STD A;  1TFK A;  3DGL A;  3HIG A;  3PYJ A;  1IV7 A;  4LGQ A;  2F99 A;  2HMJ B;  4OVM A;  1JN5 A;  2W03 A;  5JPU A;  1NB5 I;  1VQL 3;  2IMJ A;  3UB1 A;  1VQN 3;  4N6T A;  1K73 4;  4FCM A;  1QVG 2;  3TDG A;  1UCJ A;  2MC8 A;  1RSN A;  2R41 A;  4BTW A;  2FGT A;  2GU1 A;  4ORL A;  1O7G B;  2R4I A;  1B27 A;  4XDW A;  2P09 A;  1RMS A;  3H3H A;  1X1U A;  3PCS A;  1C7H A;  1GMR A;  1UCI A;  1JZO A;  1STF I;  3GSP A;  5KP4 A;  2ZDJ A;  5IG3 A;  1VQK 3;  5LC7 A;  1OPY A;  4HM2 B;  1UUG B;  3Q2P A;  1VQ4 3;  1EG9 B;  3EN1 B;  5G1L A;  1GSP A;  2HOH A;  2OCT A;  4LMI A;  2XFT A;  1I2E A;  1WNH A;  3MG2 A;  3QRD A;  1BOX A;  1KC8 4;  5D82 A;  3NXJ A;  4J5G A;  2RSX A;  1TTO A;  1BNR A;  1QVF 2;  3ALA A;  1LOW A;  1YJW 3;  4N6M A;  1B2S A;  1O7M B;  3F7S A;  5KP3 A;  3RNT A;  4DKI A;  5IG4 A;  2BMR B;  1G0T A;  1LRA A;  3FF2 A;  3OWU A;  5GSP A;  1JJ2 2;  5CXO A;  1G02 A;  1LQG C;  2F98 A;  4O02 B;  1BUJ A;  1K8A 4;  4N3V A;  4GHO A;  4HJL B;  2IYJ A;  4HZ9 B;  3GRD A;  3WA3 A;  4KVH A;  2XRX B;  2H0H A;  2E2V A;  1IYY A;  1DMN A;  2LYX A;  3RGA A;  3GAX A;  2C11 A;  4LSO A;  1TIJ A;  3JUN A;  2GSP A;  2XSO B;  5ELJ A;  1RTU A;  3EB8 A;  1JB4 A;  3HOH A;  3U1W A;  3ZG5 A;  3UL6 A;  5M1A A;  1WMN A;  1OAC A;  1W7C A;  1W2B 2;  1VQ6 3;  2CH9 A;  3OWY A;  1RJO A;  2Q07 A;  3KE7 A;  2XEP A;  1A2K A;  1GOY A;  2W0Q A;  1GYB A;  1DMM A;  3DM8 A;  4K61 A;  2KF6 A;  3EX9 A;  3WOF B;  3X3Z A;  1OCV A;  1A67 A;  4U13 A;  3LTC A;  4OK0 A;  1BRN L;  2XFS A;  2STD A;  4HZB B;  5A0O B;  1V57 A;  1DET A;  8CHO A;  2Y74 A;  1LNI A;  3S27 A;  4GB5 A;  4N6U A;  1VQ7 3;  3G8Z A;  4BTX A;  5AYS C;  1PYL A;  1RRH A;  3I55 3;  2BO9 B;  4X2O A;  1LVN A;  1U8C B;  1FYS A;  1Y4K A;  8RNT A;  2BMQ B;  2FXT A;  2P0X A;  4R1K A;  2CIU A;  3D4A A;  5G2G A;  4XBT A;  5AII A;  1FUT A;  1UI7 A;  1LOY A;  3JUP A;  2WGQ A;  4HYZ A;  1HZ1 A;  1M9G A;  4L7K A;  3BNB A;  1K41 A;  3CCV 3;  1NB3 I;  2UGI A;  4MMY B;  5DRE A;  2GEY A;  2V1L A;  3B4O A;  4BIR A;  1MWT A;  1UDI I;  2HMM B;  3CNX A;  3M8C A;  2AAD A;  3LYG A;  1VQ5 3;  1G96 A;  3DZL A;  5BIR A;  2WOF A;  1AVK A;  1I2F A;  2XGN A;  1Q82 4;  1IVW A;  5EQL A;  2CWV A;  1V74 A;  2KF5 A;  3WHO A;  1SII A;  4BTY A;  4BL2 A;  3ECF A;  1GY5 A;  4KFD A;  1CQS A;  1B3S A;  3B8L A;  2OTJ 3;  1E97 A;  1JNQ A;  1O7W B;  1ROV A;  3STD A;  1SQW A;  3I56 3;  1QAF A;  2SBL A;  2CWU A;  3EE1 A;  4CPK A;  3J7Y d;  3X42 A;  1W5Z A;  5KP1 A;  1RN7 A;  2PNC A;  3MWZ A;  1IDP A;  1RGA A;  1VQO 3;  1YIT 3;  1F8N A;  3B4P A;  4K90 B;  3CC7 3;  1A2P A;  5EEO A;  3G6E 3;  1X1Y A;  1SJW A;  1K28 A;  3SLU A;  3EJV A;  2OQE A;  4RZM A;  5IF6 A;  2UX0 A;  3OV4 A;  4XBX A;  1UI8 A;  1L5G B;  2F5W A;  1SIH A;  3D79 A;  3CCM 3;  2PZV A;  3X3X A;  5HOH A;  4GL6 A;  3CCL 3;  5IEO A;  2Z6B A;  1GS3 A;  5JPP A;  1B2X A;  1E3V A;  1I2G A;  1ZS7 A;  3G71 3;  2B24 B;  5IER A;  2UUG C;  1VQQ A;  1D6Y A;  1FZU A;  3CCJ 3;  3MG1 A;  5CF1 A;  1YVB I;  2CW9 A;  4NHF A;  1IVX A;  2W9Q A;  3EQQ B;  1K9M 4;  1KWI A;  4TX4 A;  3DH2 A;  1RGL A;  1GD4 A;  2BNG A;  5BVB A;  3EHC A;  4WYK B;  1OGZ A;  2XH9 A;  1RGG A;  1BRJ A;  4K1V A;  1BRK A;  1UUW B;  4RBN A;  1IQX A;  2Z77 A;  2ML5 A;  3FG4 A;  1RRL A;  1IU7 A;  1BNS A;  3GZB A;  2IUJ A;  3BU4 A;  3BND A;  1FGR A;  3KII A;  5FGO A;  4WYK A;  3RDE A;  1B21 A;  1W01 A;  2CFW A;  1UCL A;  2K54 A;  3F8H A;  1VQM 3;  3HK4 A;  3S67 A;  2INX A;  5G1K A;  2MF7 A;  2CKF B;  3NUV A;  1YGW A;  4Q53 A;  3WR2 A;  1FGT A;  4EYC A;  4HM8 B;  1MWS A;  2KCD A;  1MGR A;  1I3F A;  1DMQ A;  1I0V A;  2BU4 A;  1N5H A;  2W9P A;  3KKG A;  1VQ8 3;  3I0Y A;  4EW5 A;  3D5I A;  1VQ9 3;  4R4K A;  1UCK A;  3D3L A;  4HVN A;  3NBB A;  1ULJ B;  2BT3 A;  1N9J A;  2I9W A;  2K0M A;  5JBS A;  3G4S 3;  2CG0 A;  3BNE A;  4K1U A;  1TUH A;  2O9U X;  1JBR A;  2W2C A;  3FGY A;  2O3O A;  3FLJ A;  4FCJ A;  4MEI A;  1OGX A;  4IPB A;  3CMA 3;  1BRS A;  4HM1 B;  4FMC A;  3D5G A;  4RNY A;  2HMN B;  2KAA A;  1MOL A;  3FSD A;  1EQK A;  3K5T A;  4XBY A;  1JZD A;  1OF5 B;  2LQV A;  3CPO A;  4ILF A;  1GMP A;  3L0R A;  3NBR A;  3NQY A;  4QWT A;  1IQ8 A;  1QMA A;  4NPB A;  3EC9 A;  2AAE A;  1ASK A;  5LC6 A;  1YJN 3;  1OHS A;  1PFP A;  2CHC A;  1RGH A;  2W04 A;  4HM5 B;  1TJD A;  3F8X A;  4CDL A;  3FCS B;  3KSP A;  1RHL A;  1A90 A;  1NWW A;  1OF5 A;  3FKA A;  3WOD G;  1BRG A;  1BIR A;  3B7C A;  1C54 A;  1BVI A;  2GU3 A;  2CX0 A;  3DY5 A;  3GZR A;  5FW5 A;  3VF1 A;  1RN4 A;  1D6Z A;  1N9E A;  4HM7 B;  4CCV A;  3LTD A;  4H3U A;  1BAN A;  3DGO A;  4BU4 A;  1BRH A;  2OWP A;  2XR8 B;  4N6N B;  3A5E A;  2F5M A;  4WFO A;  1NU3 A;  3CC2 3;  3JVC A;  1YNV X;  3NX0 A;  3QK9 A;  4FCZ A;  1VQP 3;  3FG1 A;  1FGQ A;  4L8P A;  3NHX A;  4R9K A;  1Q40 B;  2YX9 A;  3LML A;  1PU4 A;  1TU5 A;  3ZFZ A;  2W56 B;  3VSY A;  3H51 A;  3PZW A;  3Q1C A;  4HOH A;  3WA2 X;  1RDS A;  2CFD A;  3KFQ C;  3ROB A;  3AHS A;  3WMD A;  1W6Y A;  1FW7 A;  1GMQ A;  3SED A;  1BSB A;  1Q40 A;  3JUQ A;  3DUK A;  2XF3 A;  1US1 A;  2W56 A;  1D6U A;  4J5K A;  2CC3 A;  1RCK A;  6RNT A;  4JRF A;  2HMK B;  5STD A;  2D1W A;  5IG0 A;  1CH0 A;  1JB2 A;  1HU9 A;  3BLZ A;  3KSE D;  5TGN A;  1NJI 4;  3NBJ A;  1IV9 A;  2XGL A;  4KFE A;  1FUS A;  1JRQ A;  3WOE B;  1S5A A;  1AV4 A;  3DGN A;  4HAA A;  3SVA A;  3HZP A;  3CCQ 3;  1AY7 A;  5CLK A;  1YJ9 3;  4LEH A;  2JDI H;  2XSH B;  4I5Q A;  2CG1 A;  3SXX A;  1RGC A;  1U5O A;  3CCS 3;  2W6J H;  1YHQ 3;  3IJE B;  1ZX2 A;  4R9L A;  1RGK A;  3AGN A;  3CNM A;  3GWR A;  4HM3 B;  1RN1 A;  4J8T A;  2E2T A;  3WDG B;  1BNG A;  1LQM B;  1UUV B;  2Y73 A;  1QJG A;  3SOY A;  1DE3 A;  2YFL B;  1AVL A;  1WQL B;  3CPW 2;  1KD1 4;  3MYT A;  4ZM8 A;  1RKY A;  1MWR A;  3UL5 A;  1Q7H A;  1IT8 A;  2RFR A;  3DMC A;  2IUK A;  1AQZ A;  1VZZ A;  1YVS A;  1FA3 A;  2C10 A;  4BL3 A;  3OW2 2;  3UJM A;  1B20 A;  1CYU A;  3FG3 A;  3LTA A;  4IIA A;  1EUI C;  1T5Y A;  5AIG A;  3S5C A;  1I0X A;  2KXG A;  1W00 A;  1WMP A;  3AMO B;  3URP A;  5M18 A;  1Z1S A;  3GZX B;  4AEQ A;  3RGR A;  1YIJ 3;  2J8X B;  4MMX B;  1RNT A;  2RGQ A;  4N6V 0;  4J9A A;  1BNI A;  4EXR A;  2ZL8 A;  3E99 A;  4HKV B;  1YGE A;  4GSP A;  4O8S A;  4EV2 A;  3AMO A;  3MHE A;  4N6L A;  2P05 A;  5AIF A;  3LH4 A;  3A76 A;  1OUN A;  2OTL 3;  4IT7 A;  3SYU A;  1KSI A;  3O8Y A;  3G0K A;  2OOV C;  3BIR A;  1E3R A;  2BMO B;  3NV0 B;  1QAK A;  3LZA A;  1IVU A;  1GY7 A;  4I4K A;  2WOH A;  4XB5 A;  1N5P A;  3X40 A;  2L1S A;  3CC4 3;  1B2Z A;  1RGE A;  4L8O A;  5AEU B;  1M1K 4;  5AYR B;  3UNL A;  3CCE 3;  1BSD A;  1OH0 A;  3CU3 A;  3NV0 A;  2D42 A;  3HII A;  1Q9E A;  3CCU 3;  1EKM A;  2ZHX B;  1WMO A;  1ISK A;  2Z76 A;  4R80 A;  1ULI B;  1MWU A;  3BB9 A;  3EF8 A;  3SX1 A;  1X1W A;  2JQ5 A;  3IMA B;  3CD6 3;  1W2Z A;  3PXM A;  4AKZ A;  1BUQ A;  4PEJ A;  1W6C A;  4RNZ A;  1I70 A;  1JV2 B;  3PS8 A;  3V99 A;  4JF8 A;  2YFI B;  4G1M B;  3MPH A;  3MG3 A;  3CCR 3;  3K7C A;  4XM4 A;  4HM4 B;  3FF0 A;  3V92 A;  1JBS A;  3Q90 A;  1SAR A;  3F14 A;  1R4Y A;  1X1X A;  4FR9 A;  7GSP A;  5ELU A;  1J2B A;  1ZGX A;  2CX1 A;  4H61 A;  3F7X A;  1I3I A;  1T2H A;  1Q81 4;  1BRI A;  1GOV A;  1BNE A;  1PY3 A;  2IA7 A;  3OWS A;  4XDV A;  1OHO A;  3NM7 A;  1T2I A;  1UGH I;  2WGO A;  1FUW A;  2QA4 3;  1NO3 A;  1BAO A;  1NDO B;  1V58 A;  3AGO A;  4LZI A;  2H0I A;  3OX9 A;  1BSE A;  1JBT A;  5BXQ A;  5BU4 A;  3S29 A;  2GBW B;  1W4N A;  1NNV A;  1IK3 A;  1N8R 4;  1LNH A;  2ZA4 A;  1BNF A;  3LT9 A;  4HBR A;  1LOX A;  1IT7 A;  4RNT A;  3N9H A;  1EA2 A;  5D83 A;  2M7O A;  4KT3 B;  3NQZ A;  3T8N A;  2QEX 3;  1RNB A;  4X2H A;  4MJD A;  5AI1 A;  3PGB A;  4AKY A;  2RNT A;  3JUM A;  1Q86 4;  4FMA A;  4O3V A;  1Q7Y 4;  4HM6 B;  1GD3 A;  1B2U A;  1N8Q A;  1CEW I;  5I97 A;  5M19 A;  4HM0 B;  3X3Y A;  3U97 A;  2BHM A;  3EBT A;  3PCR A;  1BSC A;  1EEJ A;  5HGR A;  1M90 4;  1O7P B;  7RNT A;  3BNC A;  2F56 A;  2P0M A;  3ER7 A;  3DXO A;  3S28 A;  1S72 3;  3T0U A;  2E2U A;  2C4B A;  2GEX A;  1MNL A;  4OUQ A;  1W02 A;  2QGU A;  1JB5 A;  3DGY A;  1TRQ A;  2F4Y A;  2FNQ A;  1YI2 3;  1FGM A;  2SAR A;  4KFF A;  2L4V A;  5D81 A;  4WP5 A;  4EC6 A;  1RCL A;  3T8U A;  5RNT A;  3GZY B;  1AR0 A;  2RCD A;  4LYL B;  1BSA A;  1O7H B;  1CYV A;  1QAL A;  2CFG A;  5CK6 A;  1HYF A;  4FMB A;  2B1X B;  4EBG A;  5AEW B;  2BIR A;  2ML6 A;  1LOV A;  5AIH A;  4CJN A;  3D9R A;  3K0Z A;  3V98 A;  1BGS A;  1T3B A;  2IY2 A;  4EV5 A;  1OHP A;  3NM2 A;  1Q42 A;  3MKI A;  1GY6 A;  2CFK A;  2H0G A;  3Q3F A;  3N8B A;  4WHA A;  1IVV A;  2GXF A;  3X41 A;  3CXC 2;  5EVH A;  1BNJ A;  1M1X B;  4NRE A;  5CF2 A;  2WO0 A;  3EBY A;  3F40 A;  2F86 B;  3EN8 A;  1TP6 A;  5IG5 A;  1RLS A;  3LXU X;  3VGN A;  3IPT A;  3MSO A;  4KZ1 A;  1DVD A;  3FZW A;  2QIY A;  2K3D A;  5IEN A;  2HML B;  1ROA A;  6STD A;  1IQY A;  1DYU A;  1B2M A;  3KZT A;  3SOA A;  3HI7 A;  5DRV A;  3F9S A;  2RBI A;  2OQE C;  2KF3 A;  5IW9 A; 
#chains in the Genus database with same CATH homology
 1X1W A;  1RHL A;  1BRG A;  1BIR A;  2KF4 A;  1C54 A;  1BVI A;  1BU4 A;  1I70 A;  4BIR A;  1RN4 A;  2AAD A;  1BAN A;  4BU4 A;  1BRH A;  1GOU A;  5BIR A;  9RNT A;  1SAR A;  3AHW A;  6GSP A;  1R4Y A;  1TRP A;  1I2F A;  1X1X A;  2F5M A;  3A5E A;  7GSP A;  1I8V A;  1RGF A;  1YNV X;  2KF5 A;  3KCH A;  3WHO A;  1ZGX A;  1I3I A;  1T2H A;  1BRI A;  1GOV A;  1B3S A;  1BNE A;  1PY3 A;  1MGW A;  1T2I A;  4HOH A;  1RDS A;  1BAO A;  3AGO A;  3AHS A;  1BSE A;  1UCJ A;  1FW7 A;  1JBT A;  1GMQ A;  1RGA A;  1RSN A;  1BSB A;  5BU4 A;  1A2P A;  1B27 A;  1X1Y A;  1RMS A;  4J5K A;  6RNT A;  1RCK A;  1X1U A;  2ZA4 A;  1GMR A;  1BNF A;  1UCI A;  3GSP A;  1CH0 A;  4RNT A;  2F5W A;  1GSP A;  1FUS A;  2HOH A;  5HOH A;  1RNB A;  1I2E A;  1B2X A;  4HAA A;  1BOX A;  1I2G A;  2RNT A;  1AY7 A;  4J5G A;  1B2U A;  1TTO A;  1BNR A;  1RGC A;  1LOW A;  1FZU A;  1B2S A;  1RGK A;  3AGN A;  3RNT A;  1RN1 A;  1BSC A;  1LRA A;  1BNG A;  5GSP A;  1G02 A;  1RGL A;  3DH2 A;  1DE3 A;  7RNT A;  2F56 A;  1BUJ A;  1RGG A;  1BRJ A;  1BRK A;  2C4B A;  4GHO A;  1AQZ A;  1BNS A;  1YVS A;  1IYY A;  3DGY A;  1TRQ A;  3BU4 A;  2F4Y A;  1B20 A;  2SAR A;  2GSP A;  1B21 A;  1RTU A;  1UCL A;  1I0X A;  3HOH A;  1RCL A;  2RBI A;  5RNT A;  3URP A;  1BSA A;  1HYF A;  1YGW A;  3WR2 A;  1GOY A;  2BIR A;  1RNT A;  1LOV A;  2KF6 A;  1BNI A;  1MGR A;  1I3F A;  1I0V A;  2BU4 A;  1BGS A;  4GSP A;  3D5I A;  1UCK A;  1BRN L;  3Q3F A;  3SYU A;  1DET A;  1JBR A;  3BIR A;  1LNI A;  1BRS A;  1BNJ A;  3D5G A;  1PYL A;  2KAA A;  1JBS A;  1B2Z A;  1RLS A;  1RGE A;  1FYS A;  8RNT A;  1BSD A;  1GMP A;  3D4A A;  1Q9E A;  2AAE A;  1B2M A;  1FUT A;  1LOY A;  1RGH A;  1HZ1 A;  2KF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...