3OWYA

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m105c-cn from p. putida with bound equilenin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPFRVEMVWNGQPSALDVIDVRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 34
structure length 128
sequence length 129
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3owyA00
2Z76A 3NV0A 4HZBB 1JKGB 3DUKA 5CF2A 1SJWA 3KE7A 5BVBA 5IEOA 3CNXA 1EA2A 3ECFA 1JKGA 2F98A 4XDVA 3BLZA 3DZLA 1WQLB 4X2HA 3EX9A 1HKXA 3IPTA 4HM0B 5D82A 1VZZA 2IMJA 5KP1A 2XSOB 3FGYA 1S5AA 4XM4A 4STDA 1O7NB 1W00A 5D83A 3VSYA 3CNMA 3S5CA 5KP4A 1Q40B 5AEWB 2QGUA 2R4IA 4X2OA 1OH0A 4N3VA 1OPYA 1K41A 3D9RA 1NDOB 3OWUA 3GWRA 4WYKA 5STDA 3GZRA 3T8UA 4MJDA 2BMRB 5IENA 2HMLB 4XB5A 5TGNA 3STDA 5JPUA 4HJLB 1JN5B 1ZX2A 1AR0A 2A15A 1GY6A 3OWSA 2Z7AA 3F40A 2B1XB 3EJVA 4L7KA 4HZ9B 1JN5A 5AIFA 4XDWA 1GYBA 1W02A 2GBXB 3CPOA 5CLKA 2HMKB 3DM8A 2GEXA 2RCDA 2UX0A 3FKAA 3OXAA 3K0ZA 4FCMA 3K7CA 4XBYA 3GRDA 3F9SA 2CHCA 4L8PA 3FF2A 2JQ5A 3F7XA 3HK4A 3OX9A 1IDPA 4HM8B 3EN8A 3MG1A 3MHEA 1QJGA 2YFLB 3MKIA 5CK6A 1OF5B 4R9KA 5BXQA 5IG5A 7STDA 1ISKA 1DMMA 3EF8A 4R9LA 3UNLA 3H3HA 1OUNA 1OF5A 2RGQA 3GZYB 4IIAA 3UJMA 3JUNA 2QIYA 3JUMA 5AIGA 1O7GB 3RGAA 4HM2B 5G2GA 4L8OA 4K1VA 4HVNA 5IF6A 4U13A 3OV4A 3BB9A 1W01A 2BMOB 3VGNA 5IERA 3B4OA 3DXOA 1QMAA 2GBWB 6STDA 3RGRA 3MSOA 1Q42A 2BNGA 1Q40A 4J9AA 4CDLA 4WP5A 1ULIB 5IG3A 1Z1SA 3M8CA 5IG0A 1OGXA 1O7WB 3HZPA 4LGQA 2F99A 2B24B 3MG2A 4LEHA 4ORLA 4HKVB 2YFIB 3FZWA 3G0KA 4Q53A 1O7HB 1NWWA 1GY7A 1O7MB 3NM2A 4R1KA 2PZVA 4J8TA 3F8XA 3G16A 5DREA 5AIIA 3MYTA 3WMDA 1STDA 3EN1B 3EBYA 4GB5A 1A2KA 4K1UA 2XRXB 4WWUC 3CU3A 1W6YA 4HM6B 2XR8B 5HGRA 4OUQA 3SOAA 2INXA 1ZO2A 2GXFA 3GZBA 3ER7A 4FCJA 2K54A 3JUPA 1TUHA 4HM7B 5IG4A 4HM4B 5AIHA 5DRVA 2Z77A 5JPPA 1UUWB 3FF0A 1GY5A 1NU3A 1E97A 1JB4A 3KZTA 4HM5B 1OCVA 2I9WA 4RZMA 3A76A 1JB2A 1U5OA 2BMQB 4HM3B 3FSDA 5EVHA 5AEUB 1C7HA 1CQSA 3NUVA 2HMOB 1GS3A 1JB5A 1ULJB 2XSHB 3NXJA 3I0YA 1TP6A 2OWPA 3LZAA 5CF1A 2HMMB 3OWYA 3ROBA 2F86B 2CKFB 1DMNA 4PEJA 3EHCA 3H51A 3KKGA 5D81A 1O7PB 3MG3A 5CXOA 1E3VA 4WYKB 1UUVB 2YFJB 3B4PA 3SOYA 1OHSA 1OHOA 3E99A 3SEDA 1EG9B 3G8ZA 3GZXB 2HMJB 3T8NA 2RFRA 3F14A 3HX8A 3EBTA 3NHXA 5FW5A 4LMIA 3LYGA 3DMCA 4OVMA 1OHPA 3B8LA 4I4KA 2W2CA 5IEPA 3F7SA 3NBRA 2GEYA 3EC9A 1DMQA 1OGZA 2HMNB 1E3RA 4H3UA 5KP3A 2STDA 3FH1A 3EQQB 4XBTA 1BUQA 5AI1A 3JUOA 3KSPA 4XBXA 3Q90A 4HM1B 3B7CA 4KVHA 3F8HA 3NV0B 1ASKA 8CHOA 3FLJA 3JUQA
chains in the Genus database with same CATH superfamily
3AHWA 2Z76A 1FGOA 2CWVA 4KFDA 3NV0A 3EE1A 5M1AA 4EYCA 4HZBB 1GD3A 2QA43 1A90A 1W4NA 1JKGB 3WA3A 2MF7A 3DUKA 1W2B2 3SYUA 1N5HA 2WOFA 3AMOA 3IJEB 3NQZA 5CF2A 2CWUA 1SJWA 3KE7A 1IQ8A 1QAKA 1IVXA 1BUJA 5BVBA 3UL5A 5IEOA 2W9QA 3CNXA 1YJ93 1EA2A 3LXUX 4WFOA 4J5GA 3ECFA 1EQKA 1JKGA 2IUKA 2F98A 2CG0A 2OOVC 3LT9A 1SQWA 4XDVA 3CPW2 3BLZA 4BL3A 3AHSA 4FMDA 2SBLA 1WQLB 1GOUA 1LQMB 1RGEA 3DZLA 3Q2PA 4X2HA 3D5GA 3BNEA 2XFTA 1JZOA 1NJI4 4J5KA 2O9UX 3EX9A 1IT7A 1HKXA 3D4AA 1BU4A 3HIGA 2CX1A 4I5QA 1I2EA 1IVWA 2CC3A 1VQL3 3N8BA 1YJW3 1YVBI 3IPTA 1QVF2 4LZIA 3K63A 5A0OB 1VQ93 4HM0B 1TU5A 1BNRA 5D82A 1NNVA 1RNTA 4MMZB 1VZZA 2IMJA 2F56A 2CFLA 2V1LA 5KP1A 1UGIA 2XSOB 3FGYA 2W6JH 1S5AA 2D42A 4XM4A 4STDA 1O7NB 1W00A 3N54B 5D83A 1IVUA 3HOHA 3K5TA 3MWZA 4N6NB 5EEOA 4MMYB 1RGCA 2KF5A 4NHFA 2CK3H 3VSYA 2ZA4A 1QVG2 3CNMA 1IQYA 3PXMA 3S5CA 2UUGC 1Q40B 5KP4A 4MMXB 5AEWB 2CWTA 2SARA 2QGUA 2R4IA 1BRKA 4X2OA 1OH0A 1RMSA 1OPYA 1K41A 4N3VA 2GU3A 3WHOA 4CPKA 3L0RA 1BRHA 3D9RA 1EUIC 1NDOB 2OQEA 3V98A 3Q1CA 3PCSA 3G4S3 3OWUA 5HOHA 4H61A 3AGOA 1S723 2RBIA 3GWRA 3LTCA 2OOVA 4WYKA 3X3ZA 1QALA 5STDA 3GZRA 1RGKA 5GSPA 1LQGC 3KSED 3T8UA 2JDIH 1FGQA 5M19A 4MJDA 2BMRB 4HOHA 4N6MA 1R4CA 3KN4A 3IMAB 5IENA 2HMLB 1STFI 4XB5A 5TGNA 1I3FA 3S27A 3STDA 2W56A 5JPUA 2FXTA 3DGLA 4HJLB 3BNCA 4BTXA 3AGNA 5JBSA 1JN5B 1ZX2A 1AR0A 1WNHA 2A15A 3X3YA 3CD63 3CCE3 1M1K4 1GY6A 3OWSA 2Z7AA 3WODG 3F40A 4WHAA 2B1XB 1BNSA 3EJVA 1VQP3 4L7KA 1M9GA 4HZ9B 1JN5A 5AIFA 4XDWA 1GYBA 3X3XA 1W02A 1YNVX 5M18A 2GBXB 1YGEA 2RNTA 3CPOA 3FG1A 5CLKA 1BSBA 1D6ZA 2CFDA 2H0HA 2HMKB 1LNHA 2P38A 1RGLA 2OTL3 3DM8A 2GEXA 1W6GA 2RCDA 3N9HA 2UX0A 3FKAA 1K28A 3MPHA 1TFKA 3NM7A 3OXAA 3K0ZA 4FCMA 1BNEA 7RNTA 1RCKA 1ROVA 1W2ZA 2E2VA 4TX4A 4AKYA 2ZDJA 3K7CA 4XBYA 3X42A 3GRDA 1MNLA 3F9SA 1TIJA 2XF3A 1MOLA 3CCQ3 2CHCA 4L8PA 3FF2A 2F5MA 3KCHA 2JQ5A 3FG3A 2XFSA 3F7XA 3HK4A 3OX9A 1IYYA 2ML6A 1LOVA 1IDPA 3LOYA 4O3VA 4O2HA 1BNJA 3I553 3RDEA 4HM8B 2BIRA 3EN8A 1VQ83 1I0XA 3MG1A 3PCRA 1IVVA 1Q824 4AKZA 3OW22 2CIUA 3MHEA 3SXXA 1GOVA 1QJGA 2YFLB 3MKIA 4HYZA 5CK6A 4NPBA 4G1MB 1OF5B 1BIRA 2CFWA 1AVLA 1GD4A 1JV2B 2K3DA 4R9KA 4BU4A 3LTAA 5BXQA 7STDA 5IG5A 1ISKA 2F4YA 1DMMA 1MWRA 3EF8A 4R9LA 1Q7HA 4KT3B 3CCM3 2GSPA 1BRNL 3UNLA 3H3HA 4R80A 1MGRA 1OUNA 3CCU3 1OF5A 2RGQA 3GZYB 4IIAA 3UJMA 1B2ZA 3JUNA 1BRJA 2QIYA 4FMAA 1B2MA 3TDGA 1UDII 3JUMA 5AIGA 1PFPA 1O7GB 3RGAA 1I0VA 4HM2B 5IW9A 5G2GA 1K734 2KCDA 2C4BA 4L8OA 2PNCA 1VQK3 4EV5A 4FR9A 2BT3A 3URPA 3BNDA 1RSNA 3DY5A 3BU4A 1BSAA 3HI7A 1NO3A 4K1VA 1U8CB 3BIRA 3WR2A 1UCKA 5EQLA 4HVNA 5IF6A 1FYSA 1F8NA 1RNBA 1V57A 4U13A 3OV4A 3EB8A 3BB9A 1I2FA 1W01A 2BMOB 2O3OA 5I97A 1IT8A 1RRHA 1R4YA 1IK3A 1BANA 3LMLA 3VGNA 2P0XA 2KF3A 1G02A 4N6OB 4BTWA 5IERA 3WOFB 1UCLA 4KFEA 3B4OA 3DH2A 1UUGB 2BHMA 5RNTA 1PY3A 1EEJA 1M1XB 1BOXA 3DXOA 1QMAA 3DGYA 2GBWB 2WO0A 4GHOA 4AEQA 3ZG5A 1LOXA 1SARA 1WMPA 1YIJ3 1EKMA 6STDA 4ZM8A 1N5PA 4N6LA 3RGRA 1RDSA 5AYRB 1RRLA 1YJN3 2XH9A 3MSOA 4CCVA 3HIIA 1JNQA 3K9MC 1UCIA 3KFQC 3WA2X 1N8R4 2AADA 1Q42A 2BNGA 1Q40A 4J9AA 4CDLA 2OTJ3 3ZFZA 4WP5A 7GSPA 4N6UA 3X41A 1ULIB 1BVIA 1WTHA 3U97A 5IG3A 1B20A 1RN1A 1Z1SA 1FGTA 3M8CA 4LSOA 4N6TA 2IUJA 1JJ22 4BIRA 2K0MA 5IG0A 3SVAA 3CC73 4O02B 1OGXA 1O7WB 1IU7A 2F5WA 1TFOA 3FG4A 4DKIA 1KC84 1MWUA 1N9JA 3Q3FA 3HZPA 2OCTA 1RGGA 1IV7A 2L4VA 1SPUA 1G96A 1I70A 1UI8A 2F99A 2B24B 4LGQA 1DE3A 1BGSA 3MG2A 4LEHA 4QWTA 4ORLA 4N6V0 3CCV3 1BRIA 2BU4A 1W6CA 4HKVB 2YFIB 2E2UA 4EW5A 2GU1A 4NREA 1JZDA 2H0IA 3FZWA 3T0UA 2KXGA 3G0KA 4Q53A 1VQ53 3V99A 1DVDA 4O8SA 1VQM3 1WMNA 1RCLA 2XGNA 1O7HB 1W5ZA 1NWWA 2QEX3 1N8QA 2WGOA 4IT7A 6GSPA 3CC43 1UI7A 3KIIA 1SIHA 2L1SA 3SLUA 4HAAA 1GY7A 1O7MB 3NM2A 4R1KA 2PZVA 4J8TA 3UL6A 1CH0A 1BNIA 3F8XA 3G16A 3BNBA 3LT8A 4KFFA 4KZ1A 1PYLA 5DREA 1JBSA 5AIIA 2W03A 3MYTA 4K61A 1STDA 3WMDA 3EN1B 1QAFA 3O8YA 3EBYA 1B2UA 4GB5A 1A2KA 2ML5A 5LC7A 1US1A 1LOWA 1LRAA 3D3LA 5G1KA 3V92A 1LNIA 2CX0A 4K1UA 1T2HA 4FMBA 3X40A 1T2IA 1BRGA 1FGMA 2XRXB 3QRDA 4WWUC 3CU3A 1RGFA 2Z6BA 1RTUA 1BRSA 1W6YA 2XGLA 2CH9A 1YIT3 1FUSA 4HM6B 1BSCA 2XR8B 5HGRA 4OUQA 1KSIA 3SOAA 5ELJA 2LYXA 1BNFA 1VQ63 2INXA 1ZO2A 2GXFA 3ZG0A 3GZBA 2W0QA 3ER7A 4FCJA 3U1WA 1ZS7A 2K54A 1AQZA 3SX1A 3JUPA 1TUHA 1YI23 2CFGA 2XEPA 4HM7B 3DGOA 1ZGXA 2W04A 2MC8A 5IG4A 2J8XB 4HM4B 5AIHA 2IA7A 9RNTA 4RNYA 2E2TA 1IQXA 2C10A 3G6E3 5DRVA 2Z77A 1CEWI 4RNTA 4GL6A 1HZ1A 1UUWB 5JPPA 1TRPA 1DETA 2FNQA 1RN4A 1DVCA 1I8VA 1JRQA 3PYJA 1B2XA 1B2SA 3FF0A 1BSDA 1X1YA 3LTBA 1GY5A 1Q814 1MWSA 1JBTA 3GAXA 1TRQA 1Y4KA 1NU3A 2HOHA 1V74A 3CCR3 1E97A 1HYFA 2P09A 1JB4A 2IY2A 1MWTA 3KZTA 1OCVA 2LQVA 4HM5B 1VQO3 2I9WA 3PZWA 1I3IA 2OQEC 4RZMA 1BSEA 1CYVA 1VQ73 1KWIA 1JB2A 1RGAA 1LOYA 1U5OA 1I2GA 2BMQB 2KAAA 3A76A 1VQN3 1Q7Y4 3PS8A 4HM3B 3FSDA 4EXRA 3WDGB 5EVHA 2CG1A 5AEUB 1GMPA 1C7HA 1CQSA 2D1WA 4K90B 3CCS3 3NUVA 3JVCA 2HMOB 1GS3A 3CME3 1JB5A 1D6UA 1ULJB 2XSHB 3NXJA 1AY7A 1LXEA 1RHLA 4MEIA 3I0YA 1TP6A 2OWPA 3LH4A 4R4KA 1AV4A 3LZAA 1NB5I 2C11A 3I563 1GOYA 3NBBA 3DGMA 5CF1A 2HMMB 3OWYA 1D6YA 3WOEB 6RNTA 3ROBA 1FGRA 1B3SA 2UGIA 2W9PA 3UB1A 1VQ43 1RN7A 2F86B 1YHQ3 2CKFB 3PGBA 1DMNA 1X1UA 4PEJA 1MGWA 2M7OA 1RJOA 3EHCA 3S29A 5BIRA 1Q864 2IYJA 3VF1A 3H51A 3KKGA 2AAEA 1HU9A 3RNTA 5D81A 1O7PB 3D5IA 3MG3A 2WOHA 1GMRA 3LTDA 3QK9A 5CXOA 2ZL8A 1E3VA 1X1WA 1DYUA 4WYKB 3A5EA 3GSPA 1GSPA 1IV9A 1UUVB 4EBGA 1C54A 1YGWA 3G713 2YFJB 3B4PA 1CYUA 3SOYA 1OHSA 1UGHI 2KF6A 1A67A 1OHOA 3E99A 3S67A 2Y74A 3SEDA 1ROAA 3FCSB 1EG9B 1YVSA 1KQS2 3NX0A 1BNGA 2W56B 4JF8A 3G8ZA 1B27A 3GZXB 5BU4A 2HMJB 2ZHXB 3T8NA 4IPBA 3NBJA 2RFRA 2KF4A 3F14A 3HX8A 2H0GA 2R41A 5FGOA 5AYSC 2RSXA 2P0MA 1RLSA 1RGHA 1UCJA 2YX9A 3DGNA 3EBTA 1M904 4CJNA 1T5YA 4JRFA 3CMA3 1UW1A 4BL2A 3D79A 3NHXA 5ELUA 1TTOA 5FW5A 1GMQA 1VQQA 4LMIA 3LYGA 3DMCA 1AVKA 1OHPA 4OVMA 3B8LA 1KD14 4HBRA 1JBRA 4I4KA 5LC6A 1FA3A 2W2CA 5IEPA 3F7SA 4OK0A 1FUTA 1L5GB 3NBRA 1Q9EA 2GEYA 3ALAA 3EC9A 1DMQA 1OGZA 2HMNB 1TJDA 1W7CA 3S28A 3J7Yd 1E3RA 1K8A4 1SIIA 3CXC2 8RNTA 4LYLB 1LVNA 4H3UA 5KP3A 1FW7A 2STDA 2KRTA 4FMCA 3FH1A 1A2PA 1PU4A 3EQQB 2CW9A 4XBTA 1G0TA 1BUQA 1WMOA 5AI1A 3JUOA 3KSPA 4XBXA 3Q90A 4BTYA 1B21A 2WGQA 3CC23 1V58A 1BAOA 5G1LA 2Y73A 1OACA 3CCL3 1FUWA 1J2BA 4EC6A 4EV2A 4HM1B 1K9M4 3NQYA 4FCZA 3B7CA 1NB3I 1X1XA 3F8HA 4KVHA 3NV0B 1RKYA 4RBNA 2P05A 4ILFA 1T3BA 1ASKA 3CCJ3 2CFKA 1FZUA 2BO9B 3AMOB 4RNZA 1N9EA 1A2VA 3FLJA 8CHOA 3JUQA 2FGTA 2Q07A 4GSPA
chains in the Genus database with same CATH topology
2Z76A 1FGOA 2CWVA 4KFDA 3NV0A 3EE1A 4EYCA 4HZBB 1GD3A 2QA43 1A90A 1W4NA 1JKGB 3WA3A 2MF7A 3DUKA 1W2B2 1N5HA 2WOFA 3AMOA 3IJEB 3NQZA 5CF2A 2CWUA 1SJWA 3KE7A 1IQ8A 1QAKA 1IVXA 5BVBA 3UL5A 5IEOA 2W9QA 3CNXA 1YJ93 1EA2A 3LXUX 4WFOA 3ECFA 1EQKA 1JKGA 2IUKA 2F98A 2CG0A 2OOVC 3LT9A 1SQWA 4XDVA 3CPW2 3BLZA 4FMDA 2SBLA 1WQLB 3DZLA 3Q2PA 4X2HA 3BNEA 2XFTA 1NJI4 2O9UX 3EX9A 1IT7A 1HKXA 3HIGA 2CC3A 1IVWA 1VQL3 3N8BA 1YJW3 1YVBI 3IPTA 1QVF2 4LZIA 3K63A 5A0OB 1VQ93 4HM0B 1TU5A 5D82A 4MMZB 1VZZA 2IMJA 2CFLA 2V1LA 5KP1A 2XSOB 3FGYA 2W6JH 1S5AA 2D42A 4XM4A 4STDA 1O7NB 1W00A 3N54B 5D83A 1IVUA 3K5TA 3MWZA 4N6NB 5EEOA 4MMYB 4NHFA 2CK3H 3VSYA 1QVG2 3CNMA 1IQYA 3PXMA 3S5CA 5KP4A 1Q40B 4MMXB 5AEWB 2CWTA 2QGUA 2R4IA 4X2OA 1OH0A 4N3VA 1OPYA 1K41A 2GU3A 3L0RA 3D9RA 2OQEA 1NDOB 3V98A 3Q1CA 3PCSA 3G4S3 3OWUA 4H61A 1S723 3GWRA 3LTCA 2OOVA 3X3ZA 4WYKA 1QALA 5STDA 3GZRA 3KSED 3T8UA 2JDIH 1FGQA 4MJDA 2BMRB 4N6MA 1R4CA 3KN4A 3IMAB 5IENA 2HMLB 1STFI 4XB5A 5TGNA 3S27A 3STDA 2W56A 5JPUA 2FXTA 3DGLA 4HJLB 3BNCA 4BTXA 5JBSA 1JN5B 1ZX2A 1AR0A 1WNHA 2A15A 3X3YA 3CD63 3CCE3 1M1K4 1GY6A 3OWSA 2Z7AA 3WODG 3F40A 4WHAA 2B1XB 3EJVA 1VQP3 4L7KA 1M9GA 4HZ9B 1JN5A 5AIFA 4XDWA 1GYBA 3X3XA 1W02A 2GBXB 1YGEA 3CPOA 3FG1A 5CLKA 1D6ZA 2CFDA 2HMKB 2P38A 1LNHA 2OTL3 3DM8A 2GEXA 1W6GA 2RCDA 3N9HA 2UX0A 3FKAA 1K28A 3MPHA 1TFKA 3NM7A 3OXAA 3K0ZA 4FCMA 1ROVA 1W2ZA 2E2VA 4TX4A 4AKYA 2ZDJA 3K7CA 4XBYA 3X42A 3GRDA 1MNLA 3F9SA 1TIJA 2XF3A 1MOLA 3CCQ3 2CHCA 4L8PA 3FF2A 2JQ5A 3FG3A 2XFSA 3F7XA 3HK4A 3OX9A 2ML6A 1IDPA 3LOYA 4O3VA 4O2HA 3I553 3RDEA 4HM8B 3EN8A 1VQ83 3MG1A 3PCRA 1IVVA 1Q824 4AKZA 3OW22 2CIUA 3MHEA 3SXXA 1QJGA 2YFLB 3MKIA 4HYZA 5CK6A 4G1MB 1OF5B 2CFWA 1AVLA 1GD4A 1JV2B 4R9KA 3LTAA 5BXQA 7STDA 5IG5A 1ISKA 1DMMA 3EF8A 4R9LA 3CCM3 3UNLA 3H3HA 4R80A 1OUNA 3CCU3 1OF5A 2RGQA 3GZYB 4IIAA 3UJMA 3JUNA 2QIYA 4FMAA 3TDGA 3JUMA 5AIGA 1PFPA 1O7GB 3RGAA 4HM2B 5IW9A 5G2GA 1K734 2KCDA 4L8OA 2PNCA 1VQK3 4EV5A 4FR9A 2BT3A 3BNDA 3DY5A 3HI7A 1NO3A 4K1VA 1U8CB 5EQLA 4HVNA 5IF6A 1F8NA 4U13A 3OV4A 3EB8A 3BB9A 1W01A 2BMOB 2O3OA 5I97A 1IT8A 1RRHA 1IK3A 3VGNA 3LMLA 2P0XA 4N6OB 4BTWA 5IERA 3WOFB 4KFEA 3B4OA 2BHMA 1M1XB 3DXOA 1QMAA 2GBWB 2WO0A 4AEQA 1LOXA 1WMPA 1YIJ3 1EKMA 6STDA 4ZM8A 1N5PA 4N6LA 3RGRA 5AYRB 1RRLA 1YJN3 2XH9A 3MSOA 4CCVA 3HIIA 1JNQA 3K9MC 3KFQC 3WA2X 1N8R4 1Q42A 2BNGA 1Q40A 4J9AA 4CDLA 2OTJ3 4WP5A 4N6UA 3X41A 1ULIB 1WTHA 3U97A 5IG3A 1Z1SA 1FGTA 3M8CA 4LSOA 4N6TA 2IUJA 1JJ22 2K0MA 5IG0A 3SVAA 3CC73 4O02B 1OGXA 1O7WB 1IU7A 1TFOA 3FG4A 1KC84 1N9JA 3HZPA 2OCTA 1IV7A 2L4VA 1SPUA 1G96A 1UI8A 2F99A 4LGQA 2B24B 3MG2A 4LEHA 4QWTA 4ORLA 4N6V0 3CCV3 1W6CA 4HKVB 2YFIB 2E2UA 2GU1A 4NREA 3FZWA 3T0UA 2KXGA 3G0KA 4Q53A 1VQ53 3V99A 1DVDA 4O8SA 1VQM3 1WMNA 2XGNA 1O7HB 1W5ZA 1NWWA 2QEX3 1N8QA 2WGOA 4IT7A 3CC43 1UI7A 3KIIA 1SIHA 3SLUA 1GY7A 1O7MB 3NM2A 4R1KA 2PZVA 4J8TA 3UL6A 3F8XA 3G16A 3BNBA 3LT8A 4KFFA 4KZ1A 5DREA 5AIIA 2W03A 3MYTA 4K61A 1STDA 3WMDA 3EN1B 1QAFA 3O8YA 3EBYA 4GB5A 1A2KA 2ML5A 5LC7A 1US1A 3V92A 3D3LA 4K1UA 4FMBA 3X40A 3QRDA 1FGMA 2XRXB 4WWUC 3CU3A 2Z6BA 1W6YA 2XGLA 2CH9A 1YIT3 4HM6B 2XR8B 5HGRA 4OUQA 1KSIA 3SOAA 5ELJA 2LYXA 1VQ63 2INXA 1ZO2A 2GXFA 3GZBA 2W0QA 3ER7A 4FCJA 3U1WA 2K54A 3SX1A 3JUPA 1TUHA 1YI23 2CFGA 2XEPA 4HM7B 3DGOA 2W04A 2MC8A 5IG4A 4HM4B 5AIHA 2IA7A 4RNYA 2E2TA 1IQXA 2C10A 3G6E3 5DRVA 2Z77A 1CEWI 5JPPA 4GL6A 1UUWB 2FNQA 1DVCA 1JRQA 3PYJA 3FF0A 3LTBA 1GY5A 1Q814 3GAXA 1Y4KA 1NU3A 3CCR3 1V74A 1E97A 2P09A 1JB4A 3KZTA 4HM5B 1VQO3 1OCVA 2LQVA 2I9WA 3PZWA 2OQEC 4RZMA 1CYVA 1VQ73 1KWIA 1JB2A 3A76A 1U5OA 2BMQB 1VQN3 1Q7Y4 3PS8A 4HM3B 3FSDA 4EXRA 3WDGB 5EVHA 2CG1A 5AEUB 1C7HA 1CQSA 2D1WA 4K90B 3CCS3 3NUVA 3JVCA 2HMOB 1GS3A 3CME3 1JB5A 1D6UA 1ULJB 2XSHB 3NXJA 4MEIA 1LXEA 3I0YA 1TP6A 2OWPA 3LH4A 4R4KA 1AV4A 3LZAA 1NB5I 2C11A 3I563 3NBBA 3DGMA 5CF1A 2HMMB 3OWYA 1D6YA 3WOEB 3ROBA 1FGRA 2W9PA 3UB1A 1VQ43 1RN7A 2F86B 1YHQ3 2CKFB 3PGBA 1DMNA 4PEJA 2M7OA 1RJOA 3EHCA 3S29A 1Q864 3VF1A 3H51A 3KKGA 1HU9A 5D81A 1O7PB 3MG3A 2WOHA 3LTDA 3QK9A 5CXOA 2ZL8A 1E3VA 4WYKB 1DYUA 1IV9A 1UUVB 4EBGA 3G713 2YFJB 3B4PA 1CYUA 3SOYA 1OHSA 1A67A 1OHOA 3E99A 3S67A 2Y74A 3SEDA 1ROAA 3FCSB 1EG9B 1KQS2 3NX0A 2W56B 4JF8A 3G8ZA 3GZXB 2HMJB 3T8NA 4IPBA 3NBJA 2RFRA 3F14A 3HX8A 5FGOA 5AYSC 2RSXA 2P0MA 2YX9A 3DGNA 3EBTA 1M904 1T5YA 4JRFA 3CMA3 1UW1A 3NHXA 5ELUA 5FW5A 4LMIA 3LYGA 3DMCA 1AVKA 1OHPA 4OVMA 3B8LA 1KD14 4HBRA 4I4KA 5LC6A 1FA3A 2W2CA 5IEPA 3F7SA 4OK0A 1L5GB 3NBRA 2GEYA 3ALAA 3EC9A 1DMQA 1OGZA 2HMNB 1W7CA 3S28A 3J7Yd 1E3RA 1K8A4 1SIIA 3CXC2 1LVNA 4H3UA 5KP3A 2STDA 2KRTA 4FMCA 3FH1A 1PU4A 3EQQB 2CW9A 4XBTA 1BUQA 1WMOA 5AI1A 3JUOA 3KSPA 4XBXA 3Q90A 4BTYA 2WGQA 3CC23 2Y73A 1OACA 3CCL3 1FUWA 1J2BA 4EC6A 4EV2A 4HM1B 1K9M4 3NQYA 4FCZA 3B7CA 1NB3I 4KVHA 3F8HA 3NV0B 1RKYA 4RBNA 2P05A 1ASKA 3CCJ3 2CFKA 2BO9B 3AMOB 4RNZA 1N9EA 1A2VA 3FLJA 8CHOA 3JUQA 2FGTA 2Q07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z76 A;  3NV0 A;  4HZB B;  1JKG B;  3DUK A;  5CF2 A;  1SJW A;  3KE7 A;  5BVB A;  5IEO A;  3CNX A;  1EA2 A;  3ECF A;  1JKG A;  2F98 A;  4XDV A;  3BLZ A;  3DZL A;  1WQL B;  4X2H A;  3EX9 A;  1HKX A;  3IPT A;  4HM0 B;  5D82 A;  1VZZ A;  2IMJ A;  5KP1 A;  2XSO B;  3FGY A;  1S5A A;  4XM4 A;  4STD A;  1O7N B;  1W00 A;  5D83 A;  3VSY A;  3CNM A;  3S5C A;  5KP4 A;  1Q40 B;  5AEW B;  2QGU A;  2R4I A;  4X2O A;  1OH0 A;  4N3V A;  1OPY A;  1K41 A;  3D9R A;  1NDO B;  3OWU A;  3GWR A;  4WYK A;  5STD A;  3GZR A;  3T8U A;  4MJD A;  2BMR B;  5IEN A;  2HML B;  4XB5 A;  5TGN A;  3STD A;  5JPU A;  4HJL B;  1JN5 B;  1ZX2 A;  1AR0 A;  2A15 A;  1GY6 A;  3OWS A;  2Z7A A;  3F40 A;  2B1X B;  3EJV A;  4L7K A;  4HZ9 B;  1JN5 A;  5AIF A;  4XDW A;  1GYB A;  1W02 A;  2GBX B;  3CPO A;  5CLK A;  2HMK B;  3DM8 A;  2GEX A;  2RCD A;  2UX0 A;  3FKA A;  3OXA A;  3K0Z A;  4FCM A;  3K7C A;  4XBY A;  3GRD A;  3F9S A;  2CHC A;  4L8P A;  3FF2 A;  2JQ5 A;  3F7X A;  3HK4 A;  3OX9 A;  1IDP A;  4HM8 B;  3EN8 A;  3MG1 A;  3MHE A;  1QJG A;  2YFL B;  3MKI A;  5CK6 A;  1OF5 B;  4R9K A;  5BXQ A;  5IG5 A;  7STD A;  1ISK A;  1DMM A;  3EF8 A;  4R9L A;  3UNL A;  3H3H A;  1OUN A;  1OF5 A;  2RGQ A;  3GZY B;  4IIA A;  3UJM A;  3JUN A;  2QIY A;  3JUM A;  5AIG A;  1O7G B;  3RGA A;  4HM2 B;  5G2G A;  4L8O A;  4K1V A;  4HVN A;  5IF6 A;  4U13 A;  3OV4 A;  3BB9 A;  1W01 A;  2BMO B;  3VGN A;  5IER A;  3B4O A;  3DXO A;  1QMA A;  2GBW B;  6STD A;  3RGR A;  3MSO A;  1Q42 A;  2BNG A;  1Q40 A;  4J9A A;  4CDL A;  4WP5 A;  1ULI B;  5IG3 A;  1Z1S A;  3M8C A;  5IG0 A;  1OGX A;  1O7W B;  3HZP A;  4LGQ A;  2F99 A;  2B24 B;  3MG2 A;  4LEH A;  4ORL A;  4HKV B;  2YFI B;  3FZW A;  3G0K A;  4Q53 A;  1O7H B;  1NWW A;  1GY7 A;  1O7M B;  3NM2 A;  4R1K A;  2PZV A;  4J8T A;  3F8X A;  3G16 A;  5DRE A;  5AII A;  3MYT A;  3WMD A;  1STD A;  3EN1 B;  3EBY A;  4GB5 A;  1A2K A;  4K1U A;  2XRX B;  4WWU C;  3CU3 A;  1W6Y A;  4HM6 B;  2XR8 B;  5HGR A;  4OUQ A;  3SOA A;  2INX A;  1ZO2 A;  2GXF A;  3GZB A;  3ER7 A;  4FCJ A;  2K54 A;  3JUP A;  1TUH A;  4HM7 B;  5IG4 A;  4HM4 B;  5AIH A;  5DRV A;  2Z77 A;  5JPP A;  1UUW B;  3FF0 A;  1GY5 A;  1NU3 A;  1E97 A;  1JB4 A;  3KZT A;  4HM5 B;  1OCV A;  2I9W A;  4RZM A;  3A76 A;  1JB2 A;  1U5O A;  2BMQ B;  4HM3 B;  3FSD A;  5EVH A;  5AEU B;  1C7H A;  1CQS A;  3NUV A;  2HMO B;  1GS3 A;  1JB5 A;  1ULJ B;  2XSH B;  3NXJ A;  3I0Y A;  1TP6 A;  2OWP A;  3LZA A;  5CF1 A;  2HMM B;  3OWY A;  3ROB A;  2F86 B;  2CKF B;  1DMN A;  4PEJ A;  3EHC A;  3H51 A;  3KKG A;  5D81 A;  1O7P B;  3MG3 A;  5CXO A;  1E3V A;  4WYK B;  1UUV B;  2YFJ B;  3B4P A;  3SOY A;  1OHS A;  1OHO A;  3E99 A;  3SED A;  1EG9 B;  3G8Z A;  3GZX B;  2HMJ B;  3T8N A;  2RFR A;  3F14 A;  3HX8 A;  3EBT A;  3NHX A;  5FW5 A;  4LMI A;  3LYG A;  3DMC A;  4OVM A;  1OHP A;  3B8L A;  4I4K A;  2W2C A;  5IEP A;  3F7S A;  3NBR A;  2GEY A;  3EC9 A;  1DMQ A;  1OGZ A;  2HMN B;  1E3R A;  4H3U A;  5KP3 A;  2STD A;  3FH1 A;  3EQQ B;  4XBT A;  1BUQ A;  5AI1 A;  3JUO A;  3KSP A;  4XBX A;  3Q90 A;  4HM1 B;  3B7C A;  4KVH A;  3F8H A;  3NV0 B;  1ASK A;  8CHO A;  3FLJ A;  3JUQ A; 
#chains in the Genus database with same CATH topology
 3AHW A;  2Z76 A;  1FGO A;  2CWV A;  4KFD A;  3NV0 A;  3EE1 A;  5M1A A;  4EYC A;  4HZB B;  1GD3 A;  2QA4 3;  1A90 A;  1W4N A;  1JKG B;  3WA3 A;  2MF7 A;  3DUK A;  1W2B 2;  3SYU A;  1N5H A;  2WOF A;  3AMO A;  3IJE B;  3NQZ A;  5CF2 A;  2CWU A;  1SJW A;  3KE7 A;  1IQ8 A;  1QAK A;  1IVX A;  1BUJ A;  5BVB A;  3UL5 A;  5IEO A;  2W9Q A;  3CNX A;  1YJ9 3;  1EA2 A;  3LXU X;  4WFO A;  4J5G A;  3ECF A;  1EQK A;  1JKG A;  2IUK A;  2F98 A;  2CG0 A;  2OOV C;  3LT9 A;  1SQW A;  4XDV A;  3CPW 2;  3BLZ A;  4BL3 A;  3AHS A;  4FMD A;  2SBL A;  1WQL B;  1GOU A;  1LQM B;  1RGE A;  3DZL A;  3Q2P A;  4X2H A;  3D5G A;  3BNE A;  2XFT A;  1JZO A;  1NJI 4;  4J5K A;  2O9U X;  3EX9 A;  1IT7 A;  1HKX A;  3D4A A;  1BU4 A;  3HIG A;  2CX1 A;  4I5Q A;  1I2E A;  1IVW A;  2CC3 A;  1VQL 3;  3N8B A;  1YJW 3;  1YVB I;  3IPT A;  1QVF 2;  4LZI A;  3K63 A;  5A0O B;  1VQ9 3;  4HM0 B;  1TU5 A;  1BNR A;  5D82 A;  1NNV A;  1RNT A;  4MMZ B;  1VZZ A;  2IMJ A;  2F56 A;  2CFL A;  2V1L A;  5KP1 A;  1UGI A;  2XSO B;  3FGY A;  2W6J H;  1S5A A;  2D42 A;  4XM4 A;  4STD A;  1O7N B;  1W00 A;  3N54 B;  5D83 A;  1IVU A;  3HOH A;  3K5T A;  3MWZ A;  4N6N B;  5EEO A;  4MMY B;  1RGC A;  2KF5 A;  4NHF A;  2CK3 H;  3VSY A;  2ZA4 A;  1QVG 2;  3CNM A;  1IQY A;  3PXM A;  3S5C A;  2UUG C;  1Q40 B;  5KP4 A;  4MMX B;  5AEW B;  2CWT A;  2SAR A;  2QGU A;  2R4I A;  1BRK A;  4X2O A;  1OH0 A;  1RMS A;  1OPY A;  1K41 A;  4N3V A;  2GU3 A;  3WHO A;  4CPK A;  3L0R A;  1BRH A;  3D9R A;  1EUI C;  1NDO B;  2OQE A;  3V98 A;  3Q1C A;  3PCS A;  3G4S 3;  3OWU A;  5HOH A;  4H61 A;  3AGO A;  1S72 3;  2RBI A;  3GWR A;  3LTC A;  2OOV A;  4WYK A;  3X3Z A;  1QAL A;  5STD A;  3GZR A;  1RGK A;  5GSP A;  1LQG C;  3KSE D;  3T8U A;  2JDI H;  1FGQ A;  5M19 A;  4MJD A;  2BMR B;  4HOH A;  4N6M A;  1R4C A;  3KN4 A;  3IMA B;  5IEN A;  2HML B;  1STF I;  4XB5 A;  5TGN A;  1I3F A;  3S27 A;  3STD A;  2W56 A;  5JPU A;  2FXT A;  3DGL A;  4HJL B;  3BNC A;  4BTX A;  3AGN A;  5JBS A;  1JN5 B;  1ZX2 A;  1AR0 A;  1WNH A;  2A15 A;  3X3Y A;  3CD6 3;  3CCE 3;  1M1K 4;  1GY6 A;  3OWS A;  2Z7A A;  3WOD G;  3F40 A;  4WHA A;  2B1X B;  1BNS A;  3EJV A;  1VQP 3;  4L7K A;  1M9G A;  4HZ9 B;  1JN5 A;  5AIF A;  4XDW A;  1GYB A;  3X3X A;  1W02 A;  1YNV X;  5M18 A;  2GBX B;  1YGE A;  2RNT A;  3CPO A;  3FG1 A;  5CLK A;  1BSB A;  1D6Z A;  2CFD A;  2H0H A;  2HMK B;  1LNH A;  2P38 A;  1RGL A;  2OTL 3;  3DM8 A;  2GEX A;  1W6G A;  2RCD A;  3N9H A;  2UX0 A;  3FKA A;  1K28 A;  3MPH A;  1TFK A;  3NM7 A;  3OXA A;  3K0Z A;  4FCM A;  1BNE A;  7RNT A;  1RCK A;  1ROV A;  1W2Z A;  2E2V A;  4TX4 A;  4AKY A;  2ZDJ A;  3K7C A;  4XBY A;  3X42 A;  3GRD A;  1MNL A;  3F9S A;  1TIJ A;  2XF3 A;  1MOL A;  3CCQ 3;  2CHC A;  4L8P A;  3FF2 A;  2F5M A;  3KCH A;  2JQ5 A;  3FG3 A;  2XFS A;  3F7X A;  3HK4 A;  3OX9 A;  1IYY A;  2ML6 A;  1LOV A;  1IDP A;  3LOY A;  4O3V A;  4O2H A;  1BNJ A;  3I55 3;  3RDE A;  4HM8 B;  2BIR A;  3EN8 A;  1VQ8 3;  1I0X A;  3MG1 A;  3PCR A;  1IVV A;  1Q82 4;  4AKZ A;  3OW2 2;  2CIU A;  3MHE A;  3SXX A;  1GOV A;  1QJG A;  2YFL B;  3MKI A;  4HYZ A;  5CK6 A;  4NPB A;  4G1M B;  1OF5 B;  1BIR A;  2CFW A;  1AVL A;  1GD4 A;  1JV2 B;  2K3D A;  4R9K A;  4BU4 A;  3LTA A;  5BXQ A;  7STD A;  5IG5 A;  1ISK A;  2F4Y A;  1DMM A;  1MWR A;  3EF8 A;  4R9L A;  1Q7H A;  4KT3 B;  3CCM 3;  2GSP A;  1BRN L;  3UNL A;  3H3H A;  4R80 A;  1MGR A;  1OUN A;  3CCU 3;  1OF5 A;  2RGQ A;  3GZY B;  4IIA A;  3UJM A;  1B2Z A;  3JUN A;  1BRJ A;  2QIY A;  4FMA A;  1B2M A;  3TDG A;  1UDI I;  3JUM A;  5AIG A;  1PFP A;  1O7G B;  3RGA A;  1I0V A;  4HM2 B;  5IW9 A;  5G2G A;  1K73 4;  2KCD A;  2C4B A;  4L8O A;  2PNC A;  1VQK 3;  4EV5 A;  4FR9 A;  2BT3 A;  3URP A;  3BND A;  1RSN A;  3DY5 A;  3BU4 A;  1BSA A;  3HI7 A;  1NO3 A;  4K1V A;  1U8C B;  3BIR A;  3WR2 A;  1UCK A;  5EQL A;  4HVN A;  5IF6 A;  1FYS A;  1F8N A;  1RNB A;  1V57 A;  4U13 A;  3OV4 A;  3EB8 A;  3BB9 A;  1I2F A;  1W01 A;  2BMO B;  2O3O A;  5I97 A;  1IT8 A;  1RRH A;  1R4Y A;  1IK3 A;  1BAN A;  3LML A;  3VGN A;  2P0X A;  2KF3 A;  1G02 A;  4N6O B;  4BTW A;  5IER A;  3WOF B;  1UCL A;  4KFE A;  3B4O A;  3DH2 A;  1UUG B;  2BHM A;  5RNT A;  1PY3 A;  1EEJ A;  1M1X B;  1BOX A;  3DXO A;  1QMA A;  3DGY A;  2GBW B;  2WO0 A;  4GHO A;  4AEQ A;  3ZG5 A;  1LOX A;  1SAR A;  1WMP A;  1YIJ 3;  1EKM A;  6STD A;  4ZM8 A;  1N5P A;  4N6L A;  3RGR A;  1RDS A;  5AYR B;  1RRL A;  1YJN 3;  2XH9 A;  3MSO A;  4CCV A;  3HII A;  1JNQ A;  3K9M C;  1UCI A;  3KFQ C;  3WA2 X;  1N8R 4;  2AAD A;  1Q42 A;  2BNG A;  1Q40 A;  4J9A A;  4CDL A;  2OTJ 3;  3ZFZ A;  4WP5 A;  7GSP A;  4N6U A;  3X41 A;  1ULI B;  1BVI A;  1WTH A;  3U97 A;  5IG3 A;  1B20 A;  1RN1 A;  1Z1S A;  1FGT A;  3M8C A;  4LSO A;  4N6T A;  2IUJ A;  1JJ2 2;  4BIR A;  2K0M A;  5IG0 A;  3SVA A;  3CC7 3;  4O02 B;  1OGX A;  1O7W B;  1IU7 A;  2F5W A;  1TFO A;  3FG4 A;  4DKI A;  1KC8 4;  1MWU A;  1N9J A;  3Q3F A;  3HZP A;  2OCT A;  1RGG A;  1IV7 A;  2L4V A;  1SPU A;  1G96 A;  1I70 A;  1UI8 A;  2F99 A;  2B24 B;  4LGQ A;  1DE3 A;  1BGS A;  3MG2 A;  4LEH A;  4QWT A;  4ORL A;  4N6V 0;  3CCV 3;  1BRI A;  2BU4 A;  1W6C A;  4HKV B;  2YFI B;  2E2U A;  4EW5 A;  2GU1 A;  4NRE A;  1JZD A;  2H0I A;  3FZW A;  3T0U A;  2KXG A;  3G0K A;  4Q53 A;  1VQ5 3;  3V99 A;  1DVD A;  4O8S A;  1VQM 3;  1WMN A;  1RCL A;  2XGN A;  1O7H B;  1W5Z A;  1NWW A;  2QEX 3;  1N8Q A;  2WGO A;  4IT7 A;  6GSP A;  3CC4 3;  1UI7 A;  3KII A;  1SIH A;  2L1S A;  3SLU A;  4HAA A;  1GY7 A;  1O7M B;  3NM2 A;  4R1K A;  2PZV A;  4J8T A;  3UL6 A;  1CH0 A;  1BNI A;  3F8X A;  3G16 A;  3BNB A;  3LT8 A;  4KFF A;  4KZ1 A;  1PYL A;  5DRE A;  1JBS A;  5AII A;  2W03 A;  3MYT A;  4K61 A;  1STD A;  3WMD A;  3EN1 B;  1QAF A;  3O8Y A;  3EBY A;  1B2U A;  4GB5 A;  1A2K A;  2ML5 A;  5LC7 A;  1US1 A;  1LOW A;  1LRA A;  3D3L A;  5G1K A;  3V92 A;  1LNI A;  2CX0 A;  4K1U A;  1T2H A;  4FMB A;  3X40 A;  1T2I A;  1BRG A;  1FGM A;  2XRX B;  3QRD A;  4WWU C;  3CU3 A;  1RGF A;  2Z6B A;  1RTU A;  1BRS A;  1W6Y A;  2XGL A;  2CH9 A;  1YIT 3;  1FUS A;  4HM6 B;  1BSC A;  2XR8 B;  5HGR A;  4OUQ A;  1KSI A;  3SOA A;  5ELJ A;  2LYX A;  1BNF A;  1VQ6 3;  2INX A;  1ZO2 A;  2GXF A;  3ZG0 A;  3GZB A;  2W0Q A;  3ER7 A;  4FCJ A;  3U1W A;  1ZS7 A;  2K54 A;  1AQZ A;  3SX1 A;  3JUP A;  1TUH A;  1YI2 3;  2CFG A;  2XEP A;  4HM7 B;  3DGO A;  1ZGX A;  2W04 A;  2MC8 A;  5IG4 A;  2J8X B;  4HM4 B;  5AIH A;  2IA7 A;  9RNT A;  4RNY A;  2E2T A;  1IQX A;  2C10 A;  3G6E 3;  5DRV A;  2Z77 A;  1CEW I;  4RNT A;  4GL6 A;  1HZ1 A;  1UUW B;  5JPP A;  1TRP A;  1DET A;  2FNQ A;  1RN4 A;  1DVC A;  1I8V A;  1JRQ A;  3PYJ A;  1B2X A;  1B2S A;  3FF0 A;  1BSD A;  1X1Y A;  3LTB A;  1GY5 A;  1Q81 4;  1MWS A;  1JBT A;  3GAX A;  1TRQ A;  1Y4K A;  1NU3 A;  2HOH A;  1V74 A;  3CCR 3;  1E97 A;  1HYF A;  2P09 A;  1JB4 A;  2IY2 A;  1MWT A;  3KZT A;  1OCV A;  2LQV A;  4HM5 B;  1VQO 3;  2I9W A;  3PZW A;  1I3I A;  2OQE C;  4RZM A;  1BSE A;  1CYV A;  1VQ7 3;  1KWI A;  1JB2 A;  1RGA A;  1LOY A;  1U5O A;  1I2G A;  2BMQ B;  2KAA A;  3A76 A;  1VQN 3;  1Q7Y 4;  3PS8 A;  4HM3 B;  3FSD A;  4EXR A;  3WDG B;  5EVH A;  2CG1 A;  5AEU B;  1GMP A;  1C7H A;  1CQS A;  2D1W A;  4K90 B;  3CCS 3;  3NUV A;  3JVC A;  2HMO B;  1GS3 A;  3CME 3;  1JB5 A;  1D6U A;  1ULJ B;  2XSH B;  3NXJ A;  1AY7 A;  1LXE A;  1RHL A;  4MEI A;  3I0Y A;  1TP6 A;  2OWP A;  3LH4 A;  4R4K A;  1AV4 A;  3LZA A;  1NB5 I;  2C11 A;  3I56 3;  1GOY A;  3NBB A;  3DGM A;  5CF1 A;  2HMM B;  3OWY A;  1D6Y A;  3WOE B;  6RNT A;  3ROB A;  1FGR A;  1B3S A;  2UGI A;  2W9P A;  3UB1 A;  1VQ4 3;  1RN7 A;  2F86 B;  1YHQ 3;  2CKF B;  3PGB A;  1DMN A;  1X1U A;  4PEJ A;  1MGW A;  2M7O A;  1RJO A;  3EHC A;  3S29 A;  5BIR A;  1Q86 4;  2IYJ A;  3VF1 A;  3H51 A;  3KKG A;  2AAE A;  1HU9 A;  3RNT A;  5D81 A;  1O7P B;  3D5I A;  3MG3 A;  2WOH A;  1GMR A;  3LTD A;  3QK9 A;  5CXO A;  2ZL8 A;  1E3V A;  1X1W A;  1DYU A;  4WYK B;  3A5E A;  3GSP A;  1GSP A;  1IV9 A;  1UUV B;  4EBG A;  1C54 A;  1YGW A;  3G71 3;  2YFJ B;  3B4P A;  1CYU A;  3SOY A;  1OHS A;  1UGH I;  2KF6 A;  1A67 A;  1OHO A;  3E99 A;  3S67 A;  2Y74 A;  3SED A;  1ROA A;  3FCS B;  1EG9 B;  1YVS A;  1KQS 2;  3NX0 A;  1BNG A;  2W56 B;  4JF8 A;  3G8Z A;  1B27 A;  3GZX B;  5BU4 A;  2HMJ B;  2ZHX B;  3T8N A;  4IPB A;  3NBJ A;  2RFR A;  2KF4 A;  3F14 A;  3HX8 A;  2H0G A;  2R41 A;  5FGO A;  5AYS C;  2RSX A;  2P0M A;  1RLS A;  1RGH A;  1UCJ A;  2YX9 A;  3DGN A;  3EBT A;  1M90 4;  4CJN A;  1T5Y A;  4JRF A;  3CMA 3;  1UW1 A;  4BL2 A;  3D79 A;  3NHX A;  5ELU A;  1TTO A;  5FW5 A;  1GMQ A;  1VQQ A;  4LMI A;  3LYG A;  3DMC A;  1AVK A;  1OHP A;  4OVM A;  3B8L A;  1KD1 4;  4HBR A;  1JBR A;  4I4K A;  5LC6 A;  1FA3 A;  2W2C A;  5IEP A;  3F7S A;  4OK0 A;  1FUT A;  1L5G B;  3NBR A;  1Q9E A;  2GEY A;  3ALA A;  3EC9 A;  1DMQ A;  1OGZ A;  2HMN B;  1TJD A;  1W7C A;  3S28 A;  3J7Y d;  1E3R A;  1K8A 4;  1SII A;  3CXC 2;  8RNT A;  4LYL B;  1LVN A;  4H3U A;  5KP3 A;  1FW7 A;  2STD A;  2KRT A;  4FMC A;  3FH1 A;  1A2P A;  1PU4 A;  3EQQ B;  2CW9 A;  4XBT A;  1G0T A;  1BUQ A;  1WMO A;  5AI1 A;  3JUO A;  3KSP A;  4XBX A;  3Q90 A;  4BTY A;  1B21 A;  2WGQ A;  3CC2 3;  1V58 A;  1BAO A;  5G1L A;  2Y73 A;  1OAC A;  3CCL 3;  1FUW A;  1J2B A;  4EC6 A;  4EV2 A;  4HM1 B;  1K9M 4;  3NQY A;  4FCZ A;  3B7C A;  1NB3 I;  1X1X A;  3F8H A;  4KVH A;  3NV0 B;  1RKY A;  4RBN A;  2P05 A;  4ILF A;  1T3B A;  1ASK A;  3CCJ 3;  2CFK A;  1FZU A;  2BO9 B;  3AMO B;  4RNZ A;  1N9E A;  1A2V A;  3FLJ A;  8CHO A;  3JUQ A;  2FGT A;  2Q07 A;  4GSP A; 
#chains in the Genus database with same CATH homology
 2Z76 A;  1FGO A;  2CWV A;  4KFD A;  3NV0 A;  3EE1 A;  4EYC A;  4HZB B;  1GD3 A;  2QA4 3;  1A90 A;  1W4N A;  1JKG B;  3WA3 A;  2MF7 A;  3DUK A;  1W2B 2;  1N5H A;  2WOF A;  3AMO A;  3IJE B;  3NQZ A;  5CF2 A;  2CWU A;  1SJW A;  3KE7 A;  1IQ8 A;  1QAK A;  1IVX A;  5BVB A;  3UL5 A;  5IEO A;  2W9Q A;  3CNX A;  1YJ9 3;  1EA2 A;  3LXU X;  4WFO A;  3ECF A;  1EQK A;  1JKG A;  2IUK A;  2F98 A;  2CG0 A;  2OOV C;  3LT9 A;  1SQW A;  4XDV A;  3CPW 2;  3BLZ A;  4FMD A;  2SBL A;  1WQL B;  3DZL A;  3Q2P A;  4X2H A;  3BNE A;  2XFT A;  1NJI 4;  2O9U X;  3EX9 A;  1IT7 A;  1HKX A;  3HIG A;  2CC3 A;  1IVW A;  1VQL 3;  3N8B A;  1YJW 3;  1YVB I;  3IPT A;  1QVF 2;  4LZI A;  3K63 A;  5A0O B;  1VQ9 3;  4HM0 B;  1TU5 A;  5D82 A;  4MMZ B;  1VZZ A;  2IMJ A;  2CFL A;  2V1L A;  5KP1 A;  2XSO B;  3FGY A;  2W6J H;  1S5A A;  2D42 A;  4XM4 A;  4STD A;  1O7N B;  1W00 A;  3N54 B;  5D83 A;  1IVU A;  3K5T A;  3MWZ A;  4N6N B;  5EEO A;  4MMY B;  4NHF A;  2CK3 H;  3VSY A;  1QVG 2;  3CNM A;  1IQY A;  3PXM A;  3S5C A;  5KP4 A;  1Q40 B;  4MMX B;  5AEW B;  2CWT A;  2QGU A;  2R4I A;  4X2O A;  1OH0 A;  4N3V A;  1OPY A;  1K41 A;  2GU3 A;  3L0R A;  3D9R A;  2OQE A;  1NDO B;  3V98 A;  3Q1C A;  3PCS A;  3G4S 3;  3OWU A;  4H61 A;  1S72 3;  3GWR A;  3LTC A;  2OOV A;  3X3Z A;  4WYK A;  1QAL A;  5STD A;  3GZR A;  3KSE D;  3T8U A;  2JDI H;  1FGQ A;  4MJD A;  2BMR B;  4N6M A;  1R4C A;  3KN4 A;  3IMA B;  5IEN A;  2HML B;  1STF I;  4XB5 A;  5TGN A;  3S27 A;  3STD A;  2W56 A;  5JPU A;  2FXT A;  3DGL A;  4HJL B;  3BNC A;  4BTX A;  5JBS A;  1JN5 B;  1ZX2 A;  1AR0 A;  1WNH A;  2A15 A;  3X3Y A;  3CD6 3;  3CCE 3;  1M1K 4;  1GY6 A;  3OWS A;  2Z7A A;  3WOD G;  3F40 A;  4WHA A;  2B1X B;  3EJV A;  1VQP 3;  4L7K A;  1M9G A;  4HZ9 B;  1JN5 A;  5AIF A;  4XDW A;  1GYB A;  3X3X A;  1W02 A;  2GBX B;  1YGE A;  3CPO A;  3FG1 A;  5CLK A;  1D6Z A;  2CFD A;  2HMK B;  2P38 A;  1LNH A;  2OTL 3;  3DM8 A;  2GEX A;  1W6G A;  2RCD A;  3N9H A;  2UX0 A;  3FKA A;  1K28 A;  3MPH A;  1TFK A;  3NM7 A;  3OXA A;  3K0Z A;  4FCM A;  1ROV A;  1W2Z A;  2E2V A;  4TX4 A;  4AKY A;  2ZDJ A;  3K7C A;  4XBY A;  3X42 A;  3GRD A;  1MNL A;  3F9S A;  1TIJ A;  2XF3 A;  1MOL A;  3CCQ 3;  2CHC A;  4L8P A;  3FF2 A;  2JQ5 A;  3FG3 A;  2XFS A;  3F7X A;  3HK4 A;  3OX9 A;  2ML6 A;  1IDP A;  3LOY A;  4O3V A;  4O2H A;  3I55 3;  3RDE A;  4HM8 B;  3EN8 A;  1VQ8 3;  3MG1 A;  3PCR A;  1IVV A;  1Q82 4;  4AKZ A;  3OW2 2;  2CIU A;  3MHE A;  3SXX A;  1QJG A;  2YFL B;  3MKI A;  4HYZ A;  5CK6 A;  4G1M B;  1OF5 B;  2CFW A;  1AVL A;  1GD4 A;  1JV2 B;  4R9K A;  3LTA A;  5BXQ A;  7STD A;  5IG5 A;  1ISK A;  1DMM A;  3EF8 A;  4R9L A;  3CCM 3;  3UNL A;  3H3H A;  4R80 A;  1OUN A;  3CCU 3;  1OF5 A;  2RGQ A;  3GZY B;  4IIA A;  3UJM A;  3JUN A;  2QIY A;  4FMA A;  3TDG A;  3JUM A;  5AIG A;  1PFP A;  1O7G B;  3RGA A;  4HM2 B;  5IW9 A;  5G2G A;  1K73 4;  2KCD A;  4L8O A;  2PNC A;  1VQK 3;  4EV5 A;  4FR9 A;  2BT3 A;  3BND A;  3DY5 A;  3HI7 A;  1NO3 A;  4K1V A;  1U8C B;  5EQL A;  4HVN A;  5IF6 A;  1F8N A;  4U13 A;  3OV4 A;  3EB8 A;  3BB9 A;  1W01 A;  2BMO B;  2O3O A;  5I97 A;  1IT8 A;  1RRH A;  1IK3 A;  3VGN A;  3LML A;  2P0X A;  4N6O B;  4BTW A;  5IER A;  3WOF B;  4KFE A;  3B4O A;  2BHM A;  1M1X B;  3DXO A;  1QMA A;  2GBW B;  2WO0 A;  4AEQ A;  1LOX A;  1WMP A;  1YIJ 3;  1EKM A;  6STD A;  4ZM8 A;  1N5P A;  4N6L A;  3RGR A;  5AYR B;  1RRL A;  1YJN 3;  2XH9 A;  3MSO A;  4CCV A;  3HII A;  1JNQ A;  3K9M C;  3KFQ C;  3WA2 X;  1N8R 4;  1Q42 A;  2BNG A;  1Q40 A;  4J9A A;  4CDL A;  2OTJ 3;  4WP5 A;  4N6U A;  3X41 A;  1ULI B;  1WTH A;  3U97 A;  5IG3 A;  1Z1S A;  1FGT A;  3M8C A;  4LSO A;  4N6T A;  2IUJ A;  1JJ2 2;  2K0M A;  5IG0 A;  3SVA A;  3CC7 3;  4O02 B;  1OGX A;  1O7W B;  1IU7 A;  1TFO A;  3FG4 A;  1KC8 4;  1N9J A;  3HZP A;  2OCT A;  1IV7 A;  2L4V A;  1SPU A;  1G96 A;  1UI8 A;  2F99 A;  4LGQ A;  2B24 B;  3MG2 A;  4LEH A;  4QWT A;  4ORL A;  4N6V 0;  3CCV 3;  1W6C A;  4HKV B;  2YFI B;  2E2U A;  2GU1 A;  4NRE A;  3FZW A;  3T0U A;  2KXG A;  3G0K A;  4Q53 A;  1VQ5 3;  3V99 A;  1DVD A;  4O8S A;  1VQM 3;  1WMN A;  2XGN A;  1O7H B;  1W5Z A;  1NWW A;  2QEX 3;  1N8Q A;  2WGO A;  4IT7 A;  3CC4 3;  1UI7 A;  3KII A;  1SIH A;  3SLU A;  1GY7 A;  1O7M B;  3NM2 A;  4R1K A;  2PZV A;  4J8T A;  3UL6 A;  3F8X A;  3G16 A;  3BNB A;  3LT8 A;  4KFF A;  4KZ1 A;  5DRE A;  5AII A;  2W03 A;  3MYT A;  4K61 A;  1STD A;  3WMD A;  3EN1 B;  1QAF A;  3O8Y A;  3EBY A;  4GB5 A;  1A2K A;  2ML5 A;  5LC7 A;  1US1 A;  3V92 A;  3D3L A;  4K1U A;  4FMB A;  3X40 A;  3QRD A;  1FGM A;  2XRX B;  4WWU C;  3CU3 A;  2Z6B A;  1W6Y A;  2XGL A;  2CH9 A;  1YIT 3;  4HM6 B;  2XR8 B;  5HGR A;  4OUQ A;  1KSI A;  3SOA A;  5ELJ A;  2LYX A;  1VQ6 3;  2INX A;  1ZO2 A;  2GXF A;  3GZB A;  2W0Q A;  3ER7 A;  4FCJ A;  3U1W A;  2K54 A;  3SX1 A;  3JUP A;  1TUH A;  1YI2 3;  2CFG A;  2XEP A;  4HM7 B;  3DGO A;  2W04 A;  2MC8 A;  5IG4 A;  4HM4 B;  5AIH A;  2IA7 A;  4RNY A;  2E2T A;  1IQX A;  2C10 A;  3G6E 3;  5DRV A;  2Z77 A;  1CEW I;  5JPP A;  4GL6 A;  1UUW B;  2FNQ A;  1DVC A;  1JRQ A;  3PYJ A;  3FF0 A;  3LTB A;  1GY5 A;  1Q81 4;  3GAX A;  1Y4K A;  1NU3 A;  3CCR 3;  1V74 A;  1E97 A;  2P09 A;  1JB4 A;  3KZT A;  4HM5 B;  1VQO 3;  1OCV A;  2LQV A;  2I9W A;  3PZW A;  2OQE C;  4RZM A;  1CYV A;  1VQ7 3;  1KWI A;  1JB2 A;  3A76 A;  1U5O A;  2BMQ B;  1VQN 3;  1Q7Y 4;  3PS8 A;  4HM3 B;  3FSD A;  4EXR A;  3WDG B;  5EVH A;  2CG1 A;  5AEU B;  1C7H A;  1CQS A;  2D1W A;  4K90 B;  3CCS 3;  3NUV A;  3JVC A;  2HMO B;  1GS3 A;  3CME 3;  1JB5 A;  1D6U A;  1ULJ B;  2XSH B;  3NXJ A;  4MEI A;  1LXE A;  3I0Y A;  1TP6 A;  2OWP A;  3LH4 A;  4R4K A;  1AV4 A;  3LZA A;  1NB5 I;  2C11 A;  3I56 3;  3NBB A;  3DGM A;  5CF1 A;  2HMM B;  3OWY A;  1D6Y A;  3WOE B;  3ROB A;  1FGR A;  2W9P A;  3UB1 A;  1VQ4 3;  1RN7 A;  2F86 B;  1YHQ 3;  2CKF B;  3PGB A;  1DMN A;  4PEJ A;  2M7O A;  1RJO A;  3EHC A;  3S29 A;  1Q86 4;  3VF1 A;  3H51 A;  3KKG A;  1HU9 A;  5D81 A;  1O7P B;  3MG3 A;  2WOH A;  3LTD A;  3QK9 A;  5CXO A;  2ZL8 A;  1E3V A;  4WYK B;  1DYU A;  1IV9 A;  1UUV B;  4EBG A;  3G71 3;  2YFJ B;  3B4P A;  1CYU A;  3SOY A;  1OHS A;  1A67 A;  1OHO A;  3E99 A;  3S67 A;  2Y74 A;  3SED A;  1ROA A;  3FCS B;  1EG9 B;  1KQS 2;  3NX0 A;  2W56 B;  4JF8 A;  3G8Z A;  3GZX B;  2HMJ B;  3T8N A;  4IPB A;  3NBJ A;  2RFR A;  3F14 A;  3HX8 A;  5FGO A;  5AYS C;  2RSX A;  2P0M A;  2YX9 A;  3DGN A;  3EBT A;  1M90 4;  1T5Y A;  4JRF A;  3CMA 3;  1UW1 A;  3NHX A;  5ELU A;  5FW5 A;  4LMI A;  3LYG A;  3DMC A;  1AVK A;  1OHP A;  4OVM A;  3B8L A;  1KD1 4;  4HBR A;  4I4K A;  5LC6 A;  1FA3 A;  2W2C A;  5IEP A;  3F7S A;  4OK0 A;  1L5G B;  3NBR A;  2GEY A;  3ALA A;  3EC9 A;  1DMQ A;  1OGZ A;  2HMN B;  1W7C A;  3S28 A;  3J7Y d;  1E3R A;  1K8A 4;  1SII A;  3CXC 2;  1LVN A;  4H3U A;  5KP3 A;  2STD A;  2KRT A;  4FMC A;  3FH1 A;  1PU4 A;  3EQQ B;  2CW9 A;  4XBT A;  1BUQ A;  1WMO A;  5AI1 A;  3JUO A;  3KSP A;  4XBX A;  3Q90 A;  4BTY A;  2WGQ A;  3CC2 3;  2Y73 A;  1OAC A;  3CCL 3;  1FUW A;  1J2B A;  4EC6 A;  4EV2 A;  4HM1 B;  1K9M 4;  3NQY A;  4FCZ A;  3B7C A;  1NB3 I;  4KVH A;  3F8H A;  3NV0 B;  1RKY A;  4RBN A;  2P05 A;  1ASK A;  3CCJ 3;  2CFK A;  2BO9 B;  3AMO B;  4RNZ A;  1N9E A;  1A2V A;  3FLJ A;  8CHO A;  3JUQ A;  2FGT A;  2Q07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...