3OWYA

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m105c-cn from p. putida with bound equilenin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPFRVEMVWNGQPSALDVIDVRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 34
structure length 128
sequence length 129
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3owyA00
5KP1A 3WMDA 3BLZA 3RGRA 1AR0A 3MSOA 1OF5B 4XBTA 2R4IA 1DMQA 1JB2A 2GBXB 1O7HB 3B8LA 2STDA 2A15A 3MYTA 1GS3A 1DMNA 1NDOB 2XSHB 3GZRA 4HZ9B 2JQ5A 5IG3A 5IF6A 3H51A 1SJWA 1STDA 2GEXA 5BXQA 1QJGA 4X2HA 1ULIB 4HVNA 3SOYA 1WQLB 5CF2A 2BNGA 5FW5A 2Z7AA 3SOAA 3MG3A 2F99A 3OX9A 3Q90A 1OPYA 4N3VA 1DMMA 4HM2B 3E99A 5IEPA 2HMLB 3FLJA 3FSDA 2YFLB 4KVHA 2GEYA 4I4KA 4MJDA 1GYBA 3VGNA 3K0ZA 3OWUA 3FF0A 3T8NA 2BMRB 2QGUA 4K1UA 3GZYB 3OXAA 3FKAA 2F98A 3KE7A 2OWPA 1Q40A 1JB5A 1E3VA 5AIGA 5IERA 3B7CA 4HM3B 3GWRA 3JUPA 3CPOA 4HM7B 6STDA 3NV0A 3B4PA 5EVHA 3MKIA 1JKGA 1OCVA 3EN8A 4HM5B 2K54A 3G8ZA 1GY7A 3OWSA 4HKVB 3KKGA 5CXOA 4RZMA 3F7SA 5D82A 2UX0A 5IG5A 4J8TA 1VZZA 3GZXB 4HM4B 5KP4A 3ECFA 2GBWB 1NWWA 3LYGA 1QMAA 1U5OA 2QIYA 1EG9B 3OV4A 4WYKB 3EC9A 1JN5B 3CU3A 1TP6A 3KZTA 4HM6B 3F8HA 5AEUB 2PZVA 1OHSA 3MHEA 5G2GA 5CK6A 5D83A 3CNXA 4Q53A 5JPPA 4XBYA 5IEOA 1W6YA 5JPUA 7STDA 1NU3A 5AIHA 2IMJA 1W00A 1EA2A 1W02A 2GXFA 3BB9A 4HZBB 1E97A 1OGZA 5HGRA 1O7GB 5DREA 3JUNA 3DXOA 4HM1B 4XDWA 4U13A 3D9RA 2HMKB 1OF5A 3NM2A 3FZWA 3JUOA 2HMMB 3DUKA 4XB5A 3HX8A 3SEDA 3EF8A 3EQQB 1ZO2A 3JUQA 5DRVA 1ZX2A 3GZBA 5D81A 4HM8B 4R9KA 3T8UA 4R1KA 3EBYA 8CHOA 1OHOA 5IENA 5IG0A 4XBXA 3F7XA 5CLKA 3A76A 4X2OA 3G16A 3LZAA 1CQSA 4IIAA 1TUHA 2B1XB 1OHPA 4L8PA 1GY5A 4CDLA 2HMNB 3MG2A 3H3HA 4XM4A 3JUMA 3EHCA 4FCMA 4L8OA 2YFIB 3OWYA 3NUVA 3UNLA 2CKFB 4LEHA 3HZPA 2XRXB 3ROBA 5AIIA 4FCJA 3EN1B 1IDPA 3EX9A 2CHCA 4J9AA 5IG4A 3NBRA 5AEWB 2Z77A 1UUVB 3F9SA 2BMQB 2XR8B 3GRDA 3K7CA 4HJLB 2W2CA 3B4OA 5KP3A 1Q40B 4ORLA 1Z1SA 3F14A 2Z76A 2HMJB 4PEJA 3VSYA 3FH1A 4LMIA 3EJVA 4L7KA 3NV0B 3DZLA 2RCDA 1JKGB 1O7PB 4HM0B 3I0YA 1JB4A 3EBTA 4OUQA 4OVMA 2RFRA 4STDA 3MG1A 3UJMA 1A2KA 3G0KA 1OH0A 3HK4A 1ULJB 4H3UA 3F8XA 3NHXA 4GB5A 5AIFA 3RGAA 3IPTA 4LGQA 2BMOB 3DM8A 1ASKA 3NXJA 5AI1A 2RGQA 2HMOB 5STDA 2B24B 1OUNA 1GY6A 5BVBA 3CNMA 1C7HA 1Q42A 3KSPA 1UUWB 1S5AA 2XSOB 4XDVA 2INXA 3M8CA 4WYKA 1JN5A 1O7MB 3FGYA 5TGNA 1E3RA 1ISKA 3ER7A 1BUQA 2F86B 3STDA 3FF2A 2I9WA 1O7WB 1K41A 5CF1A 1HKXA 3DMCA 1OGXA 3F40A 4R9LA 4WP5A 2YFJB 1W01A 3S5CA 4K1VA 1O7NB 4WWUC
chains in the Genus database with same CATH superfamily
4HYZA 5KP1A 3VF1A 3D5IA 4NHFA 3WMDA 3BLZA 3RGRA 1AR0A 3U97A 1FGMA 3MSOA 1Q814 1A2VA 1GMPA 1OF5B 4XBTA 1MOLA 5ELUA 5BIRA 1N5HA 2R4IA 2P0MA 3V92A 3Q3FA 1DMQA 2CK3H 2WO0A 2F56A 1BSAA 1JB2A 1Q7HA 2GBXB 4HAAA 1O7HB 3K9MC 3LTBA 1N9EA 3A5EA 3B8LA 1V57A 3S28A 4N6MA 3IMAB 2KCDA 3G713 2STDA 1AVLA 1VQ73 2A15A 2Q07A 3MYTA 2CFGA 1MWSA 1GS3A 1Q9EA 2W04A 4LSOA 1DMNA 1IV7A 2D1WA 1FGOA 1NDOB 3PCRA 2XSHB 3GZRA 4HZ9B 3CC23 5AYSC 1FGTA 2JQ5A 5IG3A 1YJW3 1JZOA 3AGNA 7GSPA 5IF6A 5FGOA 3NBBA 3H51A 1SJWA 3CPW2 2GU3A 1IQXA 3RDEA 1STDA 2F5WA 1RGKA 1IU7A 2GEXA 5BXQA 1QJGA 4X2HA 2RSXA 4BTWA 2BT3A 4ILFA 1AVKA 2LQVA 3ZFZA 1BANA 1FA3A 5EQLA 1ULIB 2L4VA 3S27A 3EE1A 3D79A 3WDGB 1CYVA 2WOHA 1N5PA 1RN4A 4HVNA 3PS8A 3SOYA 4CPKA 1WQLB 1T5YA 5CF2A 2BNGA 3UB1A 1BNJA 5FW5A 4CCVA 2UGIA 2Z7AA 1JRQA 2PNCA 3I553 2WOFA 1QAFA 1M904 3SOAA 2CFWA 1ZS7A 3MG3A 2F99A 2MF7A 2R41A 1GMQA 3OX9A 4O2HA 1BOXA 3Q90A 1SPUA 1YJ93 1V74A 1BUJA 1GOUA 1RJOA 1OPYA 3SXXA 3I563 1FUSA 3LTCA 1L5GB 4N3VA 1DMMA 4NPBA 1MWTA 4HM2B 1EQKA 1RN1A 1TJDA 2XF3A 1G02A 2CWVA 2IY2A 1JBTA 1HZ1A 1RGHA 3E99A 5IEPA 3X3YA 4J5KA 3QRDA 4BU4A 1MWRA 2HMLB 3FLJA 3NM7A 1I3IA 1MWUA 3FSDA 2YFLB 2AAEA 4KVHA 3OW22 3K63A 3KSED 3CCM3 4N6LA 4AEQA 2GEYA 4I4KA 1IK3A 1I0XA 1WNHA 3HIGA 1NB3I 1GYBA 4MJDA 3VGNA 2KF5A 3K0ZA 1BRHA 3DH2A 4AKZA 3OWUA 3KCHA 1RGCA 3FF0A 3T8NA 4EC6A 2BMRB 1D6YA 3HIIA 3WA3A 2QGUA 4K1UA 3GZYB 1GOYA 1T2IA 3OXAA 3FKAA 1UW1A 2F98A 2KF6A 2W9QA 2ML6A 2C10A 1X1YA 3KE7A 2QA43 2O9UX 2OWPA 1VQO3 2HOHA 3FG4A 2W56B 4G1MB 4RBNA 3SLUA 1FUWA 1TFOA 4KFDA 4KFFA 1BNFA 2CH9A 2CC3A 2E2TA 1GSPA 3MPHA 1Q40A 1I0VA 1MNLA 3RNTA 1JB5A 1E3VA 1DE3A 5AIGA 4IPBA 3WODG 5IERA 1B2ZA 4CJNA 1B3SA 3B7CA 1GOVA 1BRNL 4HM3B 3V99A 3NX0A 2F5MA 1D6UA 3CXC2 3GWRA 3NBJA 3JUPA 2XH9A 4FMBA 3CPOA 3X40A 1B27A 4HM7B 1IT8A 6STDA 2LYXA 2CIUA 3NV0A 4MEIA 1IYYA 2RNTA 3B4PA 5EVHA 3MKIA 1GMRA 1JKGA 3Q1CA 1DVDA 4N6V0 1VQL3 1OCVA 1W6CA 1DETA 3EN8A 4HM5B 4GL6A 1RSNA 1Y4KA 2K54A 3G8ZA 3O8YA 1GY7A 2Z6BA 3OWSA 4HKVB 3SYUA 3KKGA 1Q864 2OTJ3 4KZ1A 3G4S3 5CXOA 4RZMA 3F7SA 4I5QA 1K9M4 2W6JH 1T3BA 5D82A 6RNTA 3URPA 1VQP3 2UX0A 3LOYA 5IG5A 1KWIA 5ELJA 1RCKA 2K3DA 1YIJ3 6GSPA 3BIRA 4FCZA 4J8TA 1VZZA 1M1K4 3GZXB 4HM4B 5KP4A 4AKYA 1US1A 1X1XA 3ECFA 1I2FA 3AGOA 3CC43 1LRAA 1UUGB 1TRPA 2GBWB 1KSIA 1JJ22 3AMOB 1NWWA 1K8A4 4IT7A 1OACA 3LYGA 1VQK3 2W0QA 1QMAA 1VQQA 2ZA4A 3GSPA 1U5OA 1HYFA 2O3OA 4N6NB 1C54A 1BNGA 2QIYA 3FG1A 3CCU3 1EG9B 3TDGA 3OV4A 1V58A 4WYKB 3EC9A 1JN5B 1LOWA 3ZG0A 3CCQ3 2XGLA 1BSEA 1TTOA 1LXEA 2QEX3 1KD14 1RRLA 3SX1A 3CU3A 4N6TA 4EBGA 1A67A 1TP6A 3KZTA 2P09A 4HM6B 1YIT3 2OOVC 1UCKA 1NO3A 2J8XB 3F8HA 4JRFA 5IW9A 3EB8A 2OOVA 2CG0A 4N6UA 1U8CB 2PZVA 5AEUB 8RNTA 1OHSA 1YNVX 1YVSA 3MHEA 5G2GA 3CC73 1I2GA 3BU4A 2XEPA 1EKMA 3SVAA 1N8R4 5CK6A 5D83A 3CNXA 1SQWA 4Q53A 5JPPA 1GD4A 4XBYA 1GD3A 3FCSB 2CW9A 3NQYA 1K734 1VQ63 1B21A 4BTYA 4JF8A 4EV5A 3PGBA 1YGEA 2KF3A 1JV2B 3UL5A 1SARA 1RHLA 1SIIA 1AV4A 5IEOA 1W6YA 1RGFA 5JPUA 1IT7A 2IUJA 3DY5A 4FMDA 1NU3A 1UI7A 2IMJA 4LZIA 5AIHA 7STDA 1TU5A 1LOXA 1W00A 2W03A 2ZL8A 3K5TA 1EA2A 3LXUX 1W02A 2C11A 2CFKA 3N9HA 2CFLA 2GXFA 3CMA3 2CFDA 1QVG2 3LMLA 3BB9A 1BRJA 4HZBB 3KIIA 1E97A 4QWTA 1B20A 3CD63 1OGZA 3WHOA 5HGRA 1S723 2ML5A 3KN4A 4K61A 3D4AA 1VQ43 1O7GB 5LC6A 2CG1A 5DREA 3JUNA 4LYLB 3UL6A 3DXOA 1AY7A 1RTUA 1VQN3 5A0OB 3IJEB 7RNTA 3ZG5A 2ZHXB 1ROVA 1SIHA 1DVCA 4HM1B 1BNSA 4TX4A 4XDWA 3J7Yd 2BU4A 4U13A 1PY3A 3D9RA 2HMKB 1NNVA 1T2HA 1OF5A 1X1WA 3FZWA 3NM2A 4MMZB 3CCJ3 3JUOA 1VQ93 1ZGXA 2HMMB 3DUKA 4XB5A 2W9PA 3HX8A 4O3VA 3PCSA 1UGIA 3CCE3 1FYSA 4H61A 1STFI 1N9JA 3SEDA 3QK9A 1MGWA 2CWUA 1MGRA 1YHQ3 2SBLA 3EF8A 3EQQB 1G96A 1UCIA 1ZO2A 3X41A 5M19A 3JUQA 4O8SA 5DRVA 2JDIH 1ROAA 3X3XA 1NJI4 1ZX2A 1R4YA 1BRKA 2XFTA 3GZBA 3NQZA 4NREA 5D81A 4HOHA 2H0IA 2MC8A 4BL2A 4HM8B 1BIRA 1BSCA 4R9KA 3T8UA 1RGAA 1IVXA 3KFQC 4R1KA 3EBYA 8CHOA 4R80A 1OHOA 1RCLA 1RKYA 1B2MA 5IENA 1TFKA 5IG0A 3WOFB 1RGEA 4KFEA 4XBXA 3U1WA 1PU4A 2GU1A 3F7XA 5CLKA 1FZUA 3A76A 4X2OA 5I97A 1AQZA 2KAAA 3G16A 3LZAA 5BU4A 1CQSA 4IIAA 1D6ZA 1TUHA 4R4KA 3T0UA 3FG3A 1M9GA 1FGRA 2B1XB 3G6E3 3DGNA 1OHPA 2KXGA 1RRHA 4L8PA 4MMYB 5AYRB 1N8QA 1GY5A 4CDLA 2HMNB 3CCS3 2H0GA 3DGMA 3X3ZA 3MG2A 1LVNA 2GSPA 1UCJA 2UUGC 3H3HA 3X42A 4XM4A 1BNEA 1JNQA 3D3LA 3HOHA 4EYCA 1M1XB 1VQM3 1LQMB 3JUMA 2SARA 2P05A 1FW7A 1K28A 2BO9B 3EHCA 3V98A 4FCMA 2L1SA 4RNZA 1W5ZA 4FMAA 1RNTA 4L8OA 2YFIB 3OWYA 3NUVA 2YX9A 3UNLA 2CKFB 1B2UA 4LEHA 3HZPA 3N8BA 4GHOA 2XRXB 3ROBA 3PXMA 5AIIA 4FCJA 3EN1B 1CYUA 1BVIA 1IDPA 2CHCA 2K0MA 1RN7A 3DGYA 3EX9A 4J9AA 5LC7A 3N54B 2CWTA 5IG4A 1BRSA 1RDSA 3Q2PA 4MMXB 1BAOA 3NBRA 2Z77A 5AEWB 1UUVB 1IVUA 3F9SA 5JBSA 3BNEA 1F8NA 1WTHA 2BMQB 4BL3A 3D5GA 1PYLA 2XR8B 1BGSA 3GRDA 3S29A 1CH0A 1W4NA 3DGOA 3K7CA 4HJLB 2W2CA 3B4OA 5G1LA 5KP3A 1Q40B 3LH4A 1DYUA 4GSPA 1B2XA 2OQEC 4ORLA 1NB5I 2OQEA 1KC84 1Z1SA 1HU9A 1WMNA 3F14A 3WR2A 4BTXA 1VQ53 3PZWA 2Z76A 2FGTA 3ALAA 3JVCA 1YJN3 1UGHI 1BNIA 2HMJB 2W56A 3BNBA 3BNDA 4PEJA 3VSYA 2IUKA 3FH1A 3CCV3 1YI23 4LMIA 5M18A 2IA7A 3EJVA 1QVF2 4L7KA 2XFSA 1LOVA 3NV0B 3DZLA 3CCR3 2RCDA 1EEJA 3LT8A 1JKGB 1O7PB 4HM0B 3I0YA 1JB4A 1W6GA 2AADA 3EBTA 4HBRA 4OUQA 1I2EA 4OK0A 3CME3 4OVMA 2FNQA 1LQGC 3BNCA 1YVBI 1EUIC 1UDII 3L0RA 1LNHA 2RFRA 1IQYA 4STDA 1RNBA 5GSPA 3MG1A 3UJMA 1A2KA 9RNTA 1BNRA 1UCLA 3G0KA 1OH0A 1JBRA 2ZDJA 3HK4A 1FUTA 1ULJB 4H3UA 3F8XA 1WMOA 3NHXA 2Y74A 4GB5A 4FMCA 5AIFA 1G0TA 1FGQA 3RGAA 1PFPA 4WHAA 1Q824 2RBIA 1CEWI 3IPTA 4LGQA 2BHMA 2V1LA 2WGOA 5HOHA 2BIRA 2BMOB 1A90A 3CCL3 1BRIA 3DM8A 1ASKA 1LNIA 3NXJA 2OCTA 4DKIA 1RGLA 2WGQA 2Y73A 5AI1A 3WA2X 1J2BA 2RGQA 4RNYA 4BIRA 2HMOB 4ZM8A 2CX0A 1UI8A 1RGGA 5STDA 2B24B 4N6OB 1OUNA 4RNTA 1GY6A 3DGLA 3AHWA 1IVWA 1TIJA 1QAKA 1WMPA 1IQ8A 2H0HA 3AMOA 5BVBA 3WOEB 4J5GA 1YGWA 1JZDA 1C7HA 3CNMA 1A2PA 1Q42A 1W2B2 1LOYA 3KSPA 1UUWB 3PYJA 1S5AA 2P0XA 4WFOA 2KRTA 2E2VA 2E2UA 3AHSA 5RNTA 2FXTA 1KQS2 2XSOB 4XDVA 1JBSA 2INXA 2KF4A 3M8CA 4EXRA 1BRGA 3LT9A 4WYKA 1JN5A 5M1AA 1RLSA 1I3FA 1O7MB 1W2ZA 2M7OA 3S67A 3FGYA 5TGNA 1E3RA 1ISKA 1IVVA 4O02B 5G1KA 1I70A 3ER7A 1TRQA 1BUQA 1X1UA 1W7CA 2F86B 4FR9A 3STDA 3FF2A 2F4YA 2OTL3 2I9WA 1O7WB 1K41A 4KT3B 5CF1A 4K90B 1HKXA 2P38A 1BSBA 3DMCA 4EW5A 1OGXA 3F40A 3LTAA 1Q7Y4 2IYJA 4R9LA 1IV9A 4WP5A 1VQ83 1BU4A 1RMSA 2YFJB 1B2SA 2CX1A 1W01A 3HI7A 2C4BA 3S5CA 1R4CA 4K1VA 1QALA 4EV2A 1BSDA 3GAXA 2XGNA 1O7NB 4WWUC 1I8VA 5EEOA 3MWZA 2D42A 3LTDA
chains in the Genus database with same CATH topology
4HYZA 5KP1A 3VF1A 4NHFA 3WMDA 3BLZA 3RGRA 1AR0A 3U97A 1FGMA 3MSOA 1Q814 1A2VA 1OF5B 4XBTA 5ELUA 1MOLA 1N5HA 2R4IA 2P0MA 3V92A 1DMQA 2CK3H 2WO0A 1JB2A 2GBXB 1O7HB 3K9MC 3LTBA 1N9EA 3B8LA 3S28A 4N6MA 3IMAB 2KCDA 3G713 2STDA 1AVLA 1VQ73 2A15A 2Q07A 3MYTA 2CFGA 1GS3A 2W04A 4LSOA 1DMNA 1IV7A 2D1WA 1FGOA 1NDOB 3PCRA 2XSHB 3GZRA 4HZ9B 3CC23 5AYSC 1FGTA 2JQ5A 5IG3A 1YJW3 5IF6A 3CPW2 5FGOA 3NBBA 3H51A 1SJWA 2GU3A 1IQXA 3RDEA 1STDA 1IU7A 2GEXA 5BXQA 1QJGA 4X2HA 2RSXA 4BTWA 2BT3A 1AVKA 2LQVA 1FA3A 5EQLA 1ULIB 2L4VA 3S27A 3EE1A 3WDGB 1CYVA 2WOHA 1N5PA 4HVNA 3PS8A 3SOYA 1WQLB 1T5YA 5CF2A 2BNGA 3UB1A 5FW5A 4CCVA 2Z7AA 1JRQA 2PNCA 3I553 2WOFA 1QAFA 1M904 3SOAA 2CFWA 3MG3A 2F99A 2MF7A 3OX9A 4O2HA 3Q90A 1SPUA 1YJ93 1V74A 1RJOA 1OPYA 3SXXA 3I563 3LTCA 1L5GB 4N3VA 1DMMA 4HM2B 1EQKA 2XF3A 2CWVA 3E99A 5IEPA 3X3YA 3QRDA 2HMLB 3FLJA 3NM7A 3FSDA 2YFLB 4KVHA 3OW22 3K63A 3KSED 3CCM3 4N6LA 4AEQA 2GEYA 4I4KA 1IK3A 1WNHA 3HIGA 1NB3I 1GYBA 4MJDA 3VGNA 3K0ZA 4AKZA 3OWUA 3FF0A 3T8NA 4EC6A 2BMRB 1D6YA 3HIIA 3WA3A 2QGUA 4K1UA 3GZYB 3OXAA 3FKAA 1UW1A 2F98A 2W9QA 2ML6A 2C10A 3KE7A 2QA43 2OWPA 2O9UX 1VQO3 1FUWA 3FG4A 2W56B 4G1MB 4RBNA 3SLUA 1TFOA 4KFDA 4KFFA 2CH9A 2CC3A 2E2TA 3MPHA 1Q40A 1MNLA 1JB5A 1E3VA 5AIGA 4IPBA 3WODG 5IERA 3B7CA 4HM3B 3V99A 3NX0A 1D6UA 3CXC2 3GWRA 3NBJA 3JUPA 2XH9A 4FMBA 3CPOA 3X40A 4HM7B 1IT8A 6STDA 2LYXA 2CIUA 3NV0A 4MEIA 3B4PA 5EVHA 3MKIA 1JKGA 3Q1CA 1DVDA 4N6V0 1VQL3 1OCVA 1W6CA 3EN8A 4HM5B 4GL6A 1Y4KA 2K54A 3G8ZA 3O8YA 1GY7A 2Z6BA 3OWSA 4HKVB 1Q864 3KKGA 2OTJ3 4KZ1A 3G4S3 5CXOA 4RZMA 3F7SA 1K9M4 2W6JH 1VQP3 5D82A 2UX0A 3LOYA 5IG5A 1KWIA 5ELJA 1YIJ3 4FCZA 4J8TA 1VZZA 1M1K4 3GZXB 4HM4B 5KP4A 4AKYA 1US1A 3ECFA 3CC43 2GBWB 1KSIA 1JJ22 3AMOB 1NWWA 1K8A4 4IT7A 1OACA 3LYGA 1VQK3 2W0QA 1QMAA 4N6NB 1U5OA 2O3OA 2QIYA 3FG1A 3CCU3 1EG9B 3TDGA 3OV4A 4WYKB 3EC9A 1JN5B 3CCQ3 2XGLA 1LXEA 2QEX3 1KD14 1RRLA 3SX1A 3CU3A 4N6TA 4EBGA 1TP6A 3KZTA 2P09A 4HM6B 1YIT3 2OOVC 1NO3A 3F8HA 4JRFA 5IW9A 3EB8A 2OOVA 2CG0A 4N6UA 1U8CB 2PZVA 5AEUB 1KQS2 1OHSA 3MHEA 5G2GA 3CC73 1A67A 2XEPA 1EKMA 3SVAA 1N8R4 5CK6A 5D83A 3CNXA 1SQWA 4Q53A 5JPPA 1GD4A 4XBYA 1GD3A 3FCSB 2CW9A 3NQYA 1K734 1VQ63 4EV5A 4BTYA 4JF8A 3PGBA 1YGEA 1JV2B 3UL5A 1SIIA 1AV4A 5IEOA 1W6YA 5JPUA 1IT7A 2IUJA 3DY5A 4FMDA 1NU3A 1UI7A 2IMJA 4LZIA 5AIHA 7STDA 1TU5A 1LOXA 1W00A 2W03A 2ZL8A 3K5TA 1EA2A 3LXUX 1W02A 2C11A 2CFKA 3N9HA 2CFLA 2GXFA 3CMA3 2CFDA 1QVG2 3LMLA 3BB9A 4HZBB 3KIIA 1E97A 4QWTA 3CD63 1OGZA 5HGRA 1S723 2ML5A 3KN4A 4K61A 1VQ43 1O7GB 5LC6A 2CG1A 5DREA 3JUNA 3UL6A 3DXOA 1VQN3 5A0OB 3IJEB 1ROVA 1SIHA 1DVCA 4HM1B 4TX4A 4XDWA 3J7Yd 4U13A 3D9RA 2HMKB 1OF5A 3NM2A 3FZWA 4MMZB 3CCJ3 3JUOA 1VQ93 2HMMB 3DUKA 4XB5A 2W9PA 3HX8A 4O3VA 3PCSA 3CCE3 4H61A 1STFI 1N9JA 3SEDA 3QK9A 2CWUA 1YHQ3 2SBLA 3EF8A 3EQQB 1G96A 1ZO2A 3X41A 3JUQA 4O8SA 5DRVA 2JDIH 1ROAA 3X3XA 1NJI4 1ZX2A 2XFTA 3GZBA 4NREA 3NQZA 5D81A 2MC8A 4HM8B 4R9KA 3T8UA 1IVXA 3KFQC 4R1KA 3EBYA 8CHOA 4R80A 1OHOA 1RKYA 5IENA 1TFKA 5IG0A 3WOFB 4XBXA 4KFEA 3U1WA 1PU4A 2GU1A 3F7XA 5CLKA 3A76A 4X2OA 5I97A 3G16A 3LZAA 1CQSA 4IIAA 1D6ZA 1TUHA 4R4KA 3T0UA 3FG3A 1M9GA 1FGRA 2B1XB 3G6E3 3DGNA 1OHPA 2KXGA 1RRHA 4L8PA 4MMYB 5AYRB 1N8QA 1GY5A 4CDLA 2HMNB 3CCS3 3DGMA 3X3ZA 3MG2A 1LVNA 3X42A 3H3HA 4XM4A 3D3LA 1JNQA 4EYCA 1M1XB 1VQM3 3JUMA 2P05A 1K28A 2BO9B 3EHCA 3V98A 4FCMA 4RNZA 1W5ZA 4FMAA 4L8OA 2YFIB 3OWYA 3NUVA 2YX9A 3UNLA 2CKFB 4LEHA 3HZPA 3N8BA 2XRXB 3ROBA 3PXMA 5AIIA 4FCJA 3EN1B 1CYUA 1IDPA 2K0MA 2CHCA 3EX9A 1RN7A 4J9AA 5LC7A 3N54B 2CWTA 5IG4A 3Q2PA 4MMXB 3NBRA 5AEWB 2Z77A 1UUVB 1IVUA 3F9SA 5JBSA 3BNEA 1F8NA 1WTHA 2BMQB 2XR8B 3GRDA 3S29A 1W4NA 3DGOA 3K7CA 4HJLB 2W2CA 3B4OA 5KP3A 1Q40B 3LH4A 1DYUA 4ORLA 2OQEC 1NB5I 2OQEA 1KC84 1Z1SA 1HU9A 1WMNA 3F14A 4BTXA 1VQ53 3PZWA 2Z76A 2FGTA 3ALAA 3JVCA 1YJN3 3BNBA 2HMJB 2W56A 3BNDA 4PEJA 3VSYA 2IUKA 3FH1A 3CCV3 1YI23 4LMIA 2IA7A 3EJVA 1QVF2 4L7KA 2XFSA 3NV0B 3DZLA 3CCR3 2RCDA 3LT8A 1JKGB 1O7PB 4HM0B 3I0YA 1JB4A 1W6GA 3EBTA 4HBRA 4OUQA 4OK0A 3CME3 4OVMA 2FNQA 3BNCA 1YVBI 3L0RA 1LNHA 2RFRA 1IQYA 4STDA 3MG1A 3UJMA 1A2KA 3G0KA 1OH0A 2ZDJA 3HK4A 1ULJB 4H3UA 3F8XA 1WMOA 3NHXA 2Y74A 4GB5A 4FMCA 5AIFA 1FGQA 3RGAA 1PFPA 4WHAA 1Q824 1CEWI 3IPTA 4LGQA 2BHMA 2V1LA 2WGOA 2BMOB 1A90A 3CCL3 3DM8A 1ASKA 3NXJA 2OCTA 5AI1A 2WGQA 2Y73A 3WA2X 1J2BA 2RGQA 4RNYA 2HMOB 4ZM8A 1UI8A 5STDA 2B24B 4N6OB 1OUNA 1GY6A 3DGLA 1IVWA 1TIJA 1QAKA 1WMPA 1IQ8A 3AMOA 5BVBA 3WOEB 3CNMA 1C7HA 1Q42A 1W2B2 3KSPA 3PYJA 1UUWB 4WFOA 1S5AA 2P0XA 2KRTA 2E2VA 2E2UA 2FXTA 2XSOB 4XDVA 2INXA 3M8CA 4EXRA 3LT9A 4WYKA 1JN5A 1O7MB 1W2ZA 2M7OA 3S67A 3FGYA 5TGNA 1E3RA 1ISKA 1IVVA 4O02B 3ER7A 1BUQA 1W7CA 2F86B 4FR9A 3STDA 3FF2A 2OTL3 2I9WA 1O7WB 1K41A 5CF1A 4K90B 1HKXA 2P38A 3DMCA 1OGXA 3F40A 3LTAA 1Q7Y4 4R9LA 1IV9A 4WP5A 1VQ83 2YFJB 1W01A 3HI7A 3S5CA 1R4CA 4K1VA 1QALA 4EV2A 3GAXA 2XGNA 1O7NB 4WWUC 5EEOA 3MWZA 2D42A 3LTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP1 A;  3WMD A;  3BLZ A;  3RGR A;  1AR0 A;  3MSO A;  1OF5 B;  4XBT A;  2R4I A;  1DMQ A;  1JB2 A;  2GBX B;  1O7H B;  3B8L A;  2STD A;  2A15 A;  3MYT A;  1GS3 A;  1DMN A;  1NDO B;  2XSH B;  3GZR A;  4HZ9 B;  2JQ5 A;  5IG3 A;  5IF6 A;  3H51 A;  1SJW A;  1STD A;  2GEX A;  5BXQ A;  1QJG A;  4X2H A;  1ULI B;  4HVN A;  3SOY A;  1WQL B;  5CF2 A;  2BNG A;  5FW5 A;  2Z7A A;  3SOA A;  3MG3 A;  2F99 A;  3OX9 A;  3Q90 A;  1OPY A;  4N3V A;  1DMM A;  4HM2 B;  3E99 A;  5IEP A;  2HML B;  3FLJ A;  3FSD A;  2YFL B;  4KVH A;  2GEY A;  4I4K A;  4MJD A;  1GYB A;  3VGN A;  3K0Z A;  3OWU A;  3FF0 A;  3T8N A;  2BMR B;  2QGU A;  4K1U A;  3GZY B;  3OXA A;  3FKA A;  2F98 A;  3KE7 A;  2OWP A;  1Q40 A;  1JB5 A;  1E3V A;  5AIG A;  5IER A;  3B7C A;  4HM3 B;  3GWR A;  3JUP A;  3CPO A;  4HM7 B;  6STD A;  3NV0 A;  3B4P A;  5EVH A;  3MKI A;  1JKG A;  1OCV A;  3EN8 A;  4HM5 B;  2K54 A;  3G8Z A;  1GY7 A;  3OWS A;  4HKV B;  3KKG A;  5CXO A;  4RZM A;  3F7S A;  5D82 A;  2UX0 A;  5IG5 A;  4J8T A;  1VZZ A;  3GZX B;  4HM4 B;  5KP4 A;  3ECF A;  2GBW B;  1NWW A;  3LYG A;  1QMA A;  1U5O A;  2QIY A;  1EG9 B;  3OV4 A;  4WYK B;  3EC9 A;  1JN5 B;  3CU3 A;  1TP6 A;  3KZT A;  4HM6 B;  3F8H A;  5AEU B;  2PZV A;  1OHS A;  3MHE A;  5G2G A;  5CK6 A;  5D83 A;  3CNX A;  4Q53 A;  5JPP A;  4XBY A;  5IEO A;  1W6Y A;  5JPU A;  7STD A;  1NU3 A;  5AIH A;  2IMJ A;  1W00 A;  1EA2 A;  1W02 A;  2GXF A;  3BB9 A;  4HZB B;  1E97 A;  1OGZ A;  5HGR A;  1O7G B;  5DRE A;  3JUN A;  3DXO A;  4HM1 B;  4XDW A;  4U13 A;  3D9R A;  2HMK B;  1OF5 A;  3NM2 A;  3FZW A;  3JUO A;  2HMM B;  3DUK A;  4XB5 A;  3HX8 A;  3SED A;  3EF8 A;  3EQQ B;  1ZO2 A;  3JUQ A;  5DRV A;  1ZX2 A;  3GZB A;  5D81 A;  4HM8 B;  4R9K A;  3T8U A;  4R1K A;  3EBY A;  8CHO A;  1OHO A;  5IEN A;  5IG0 A;  4XBX A;  3F7X A;  5CLK A;  3A76 A;  4X2O A;  3G16 A;  3LZA A;  1CQS A;  4IIA A;  1TUH A;  2B1X B;  1OHP A;  4L8P A;  1GY5 A;  4CDL A;  2HMN B;  3MG2 A;  3H3H A;  4XM4 A;  3JUM A;  3EHC A;  4FCM A;  4L8O A;  2YFI B;  3OWY A;  3NUV A;  3UNL A;  2CKF B;  4LEH A;  3HZP A;  2XRX B;  3ROB A;  5AII A;  4FCJ A;  3EN1 B;  1IDP A;  3EX9 A;  2CHC A;  4J9A A;  5IG4 A;  3NBR A;  5AEW B;  2Z77 A;  1UUV B;  3F9S A;  2BMQ B;  2XR8 B;  3GRD A;  3K7C A;  4HJL B;  2W2C A;  3B4O A;  5KP3 A;  1Q40 B;  4ORL A;  1Z1S A;  3F14 A;  2Z76 A;  2HMJ B;  4PEJ A;  3VSY A;  3FH1 A;  4LMI A;  3EJV A;  4L7K A;  3NV0 B;  3DZL A;  2RCD A;  1JKG B;  1O7P B;  4HM0 B;  3I0Y A;  1JB4 A;  3EBT A;  4OUQ A;  4OVM A;  2RFR A;  4STD A;  3MG1 A;  3UJM A;  1A2K A;  3G0K A;  1OH0 A;  3HK4 A;  1ULJ B;  4H3U A;  3F8X A;  3NHX A;  4GB5 A;  5AIF A;  3RGA A;  3IPT A;  4LGQ A;  2BMO B;  3DM8 A;  1ASK A;  3NXJ A;  5AI1 A;  2RGQ A;  2HMO B;  5STD A;  2B24 B;  1OUN A;  1GY6 A;  5BVB A;  3CNM A;  1C7H A;  1Q42 A;  3KSP A;  1UUW B;  1S5A A;  2XSO B;  4XDV A;  2INX A;  3M8C A;  4WYK A;  1JN5 A;  1O7M B;  3FGY A;  5TGN A;  1E3R A;  1ISK A;  3ER7 A;  1BUQ A;  2F86 B;  3STD A;  3FF2 A;  2I9W A;  1O7W B;  1K41 A;  5CF1 A;  1HKX A;  3DMC A;  1OGX A;  3F40 A;  4R9L A;  4WP5 A;  2YFJ B;  1W01 A;  3S5C A;  4K1V A;  1O7N B;  4WWU C; 
#chains in the Genus database with same CATH topology
 4HYZ A;  5KP1 A;  3VF1 A;  3D5I A;  4NHF A;  3WMD A;  3BLZ A;  3RGR A;  1AR0 A;  3U97 A;  1FGM A;  3MSO A;  1Q81 4;  1A2V A;  1GMP A;  1OF5 B;  4XBT A;  1MOL A;  5ELU A;  5BIR A;  1N5H A;  2R4I A;  2P0M A;  3V92 A;  3Q3F A;  1DMQ A;  2CK3 H;  2WO0 A;  2F56 A;  1BSA A;  1JB2 A;  1Q7H A;  2GBX B;  4HAA A;  1O7H B;  3K9M C;  3LTB A;  1N9E A;  3A5E A;  3B8L A;  1V57 A;  3S28 A;  4N6M A;  3IMA B;  2KCD A;  3G71 3;  2STD A;  1AVL A;  1VQ7 3;  2A15 A;  2Q07 A;  3MYT A;  2CFG A;  1MWS A;  1GS3 A;  1Q9E A;  2W04 A;  4LSO A;  1DMN A;  1IV7 A;  2D1W A;  1FGO A;  1NDO B;  3PCR A;  2XSH B;  3GZR A;  4HZ9 B;  3CC2 3;  5AYS C;  1FGT A;  2JQ5 A;  5IG3 A;  1YJW 3;  1JZO A;  3AGN A;  7GSP A;  5IF6 A;  5FGO A;  3NBB A;  3H51 A;  1SJW A;  3CPW 2;  2GU3 A;  1IQX A;  3RDE A;  1STD A;  2F5W A;  1RGK A;  1IU7 A;  2GEX A;  5BXQ A;  1QJG A;  4X2H A;  2RSX A;  4BTW A;  2BT3 A;  4ILF A;  1AVK A;  2LQV A;  3ZFZ A;  1BAN A;  1FA3 A;  5EQL A;  1ULI B;  2L4V A;  3S27 A;  3EE1 A;  3D79 A;  3WDG B;  1CYV A;  2WOH A;  1N5P A;  1RN4 A;  4HVN A;  3PS8 A;  3SOY A;  4CPK A;  1WQL B;  1T5Y A;  5CF2 A;  2BNG A;  3UB1 A;  1BNJ A;  5FW5 A;  4CCV A;  2UGI A;  2Z7A A;  1JRQ A;  2PNC A;  3I55 3;  2WOF A;  1QAF A;  1M90 4;  3SOA A;  2CFW A;  1ZS7 A;  3MG3 A;  2F99 A;  2MF7 A;  2R41 A;  1GMQ A;  3OX9 A;  4O2H A;  1BOX A;  3Q90 A;  1SPU A;  1YJ9 3;  1V74 A;  1BUJ A;  1GOU A;  1RJO A;  1OPY A;  3SXX A;  3I56 3;  1FUS A;  3LTC A;  1L5G B;  4N3V A;  1DMM A;  4NPB A;  1MWT A;  4HM2 B;  1EQK A;  1RN1 A;  1TJD A;  2XF3 A;  1G02 A;  2CWV A;  2IY2 A;  1JBT A;  1HZ1 A;  1RGH A;  3E99 A;  5IEP A;  3X3Y A;  4J5K A;  3QRD A;  4BU4 A;  1MWR A;  2HML B;  3FLJ A;  3NM7 A;  1I3I A;  1MWU A;  3FSD A;  2YFL B;  2AAE A;  4KVH A;  3OW2 2;  3K63 A;  3KSE D;  3CCM 3;  4N6L A;  4AEQ A;  2GEY A;  4I4K A;  1IK3 A;  1I0X A;  1WNH A;  3HIG A;  1NB3 I;  1GYB A;  4MJD A;  3VGN A;  2KF5 A;  3K0Z A;  1BRH A;  3DH2 A;  4AKZ A;  3OWU A;  3KCH A;  1RGC A;  3FF0 A;  3T8N A;  4EC6 A;  2BMR B;  1D6Y A;  3HII A;  3WA3 A;  2QGU A;  4K1U A;  3GZY B;  1GOY A;  1T2I A;  3OXA A;  3FKA A;  1UW1 A;  2F98 A;  2KF6 A;  2W9Q A;  2ML6 A;  2C10 A;  1X1Y A;  3KE7 A;  2QA4 3;  2O9U X;  2OWP A;  1VQO 3;  2HOH A;  3FG4 A;  2W56 B;  4G1M B;  4RBN A;  3SLU A;  1FUW A;  1TFO A;  4KFD A;  4KFF A;  1BNF A;  2CH9 A;  2CC3 A;  2E2T A;  1GSP A;  3MPH A;  1Q40 A;  1I0V A;  1MNL A;  3RNT A;  1JB5 A;  1E3V A;  1DE3 A;  5AIG A;  4IPB A;  3WOD G;  5IER A;  1B2Z A;  4CJN A;  1B3S A;  3B7C A;  1GOV A;  1BRN L;  4HM3 B;  3V99 A;  3NX0 A;  2F5M A;  1D6U A;  3CXC 2;  3GWR A;  3NBJ A;  3JUP A;  2XH9 A;  4FMB A;  3CPO A;  3X40 A;  1B27 A;  4HM7 B;  1IT8 A;  6STD A;  2LYX A;  2CIU A;  3NV0 A;  4MEI A;  1IYY A;  2RNT A;  3B4P A;  5EVH A;  3MKI A;  1GMR A;  1JKG A;  3Q1C A;  1DVD A;  4N6V 0;  1VQL 3;  1OCV A;  1W6C A;  1DET A;  3EN8 A;  4HM5 B;  4GL6 A;  1RSN A;  1Y4K A;  2K54 A;  3G8Z A;  3O8Y A;  1GY7 A;  2Z6B A;  3OWS A;  4HKV B;  3SYU A;  3KKG A;  1Q86 4;  2OTJ 3;  4KZ1 A;  3G4S 3;  5CXO A;  4RZM A;  3F7S A;  4I5Q A;  1K9M 4;  2W6J H;  1T3B A;  5D82 A;  6RNT A;  3URP A;  1VQP 3;  2UX0 A;  3LOY A;  5IG5 A;  1KWI A;  5ELJ A;  1RCK A;  2K3D A;  1YIJ 3;  6GSP A;  3BIR A;  4FCZ A;  4J8T A;  1VZZ A;  1M1K 4;  3GZX B;  4HM4 B;  5KP4 A;  4AKY A;  1US1 A;  1X1X A;  3ECF A;  1I2F A;  3AGO A;  3CC4 3;  1LRA A;  1UUG B;  1TRP A;  2GBW B;  1KSI A;  1JJ2 2;  3AMO B;  1NWW A;  1K8A 4;  4IT7 A;  1OAC A;  3LYG A;  1VQK 3;  2W0Q A;  1QMA A;  1VQQ A;  2ZA4 A;  3GSP A;  1U5O A;  1HYF A;  2O3O A;  4N6N B;  1C54 A;  1BNG A;  2QIY A;  3FG1 A;  3CCU 3;  1EG9 B;  3TDG A;  3OV4 A;  1V58 A;  4WYK B;  3EC9 A;  1JN5 B;  1LOW A;  3ZG0 A;  3CCQ 3;  2XGL A;  1BSE A;  1TTO A;  1LXE A;  2QEX 3;  1KD1 4;  1RRL A;  3SX1 A;  3CU3 A;  4N6T A;  4EBG A;  1A67 A;  1TP6 A;  3KZT A;  2P09 A;  4HM6 B;  1YIT 3;  2OOV C;  1UCK A;  1NO3 A;  2J8X B;  3F8H A;  4JRF A;  5IW9 A;  3EB8 A;  2OOV A;  2CG0 A;  4N6U A;  1U8C B;  2PZV A;  5AEU B;  8RNT A;  1OHS A;  1YNV X;  1YVS A;  3MHE A;  5G2G A;  3CC7 3;  1I2G A;  3BU4 A;  2XEP A;  1EKM A;  3SVA A;  1N8R 4;  5CK6 A;  5D83 A;  3CNX A;  1SQW A;  4Q53 A;  5JPP A;  1GD4 A;  4XBY A;  1GD3 A;  3FCS B;  2CW9 A;  3NQY A;  1K73 4;  1VQ6 3;  1B21 A;  4BTY A;  4JF8 A;  4EV5 A;  3PGB A;  1YGE A;  2KF3 A;  1JV2 B;  3UL5 A;  1SAR A;  1RHL A;  1SII A;  1AV4 A;  5IEO A;  1W6Y A;  1RGF A;  5JPU A;  1IT7 A;  2IUJ A;  3DY5 A;  4FMD A;  1NU3 A;  1UI7 A;  2IMJ A;  4LZI A;  5AIH A;  7STD A;  1TU5 A;  1LOX A;  1W00 A;  2W03 A;  2ZL8 A;  3K5T A;  1EA2 A;  3LXU X;  1W02 A;  2C11 A;  2CFK A;  3N9H A;  2CFL A;  2GXF A;  3CMA 3;  2CFD A;  1QVG 2;  3LML A;  3BB9 A;  1BRJ A;  4HZB B;  3KII A;  1E97 A;  4QWT A;  1B20 A;  3CD6 3;  1OGZ A;  3WHO A;  5HGR A;  1S72 3;  2ML5 A;  3KN4 A;  4K61 A;  3D4A A;  1VQ4 3;  1O7G B;  5LC6 A;  2CG1 A;  5DRE A;  3JUN A;  4LYL B;  3UL6 A;  3DXO A;  1AY7 A;  1RTU A;  1VQN 3;  5A0O B;  3IJE B;  7RNT A;  3ZG5 A;  2ZHX B;  1ROV A;  1SIH A;  1DVC A;  4HM1 B;  1BNS A;  4TX4 A;  4XDW A;  3J7Y d;  2BU4 A;  4U13 A;  1PY3 A;  3D9R A;  2HMK B;  1NNV A;  1T2H A;  1OF5 A;  1X1W A;  3FZW A;  3NM2 A;  4MMZ B;  3CCJ 3;  3JUO A;  1VQ9 3;  1ZGX A;  2HMM B;  3DUK A;  4XB5 A;  2W9P A;  3HX8 A;  4O3V A;  3PCS A;  1UGI A;  3CCE 3;  1FYS A;  4H61 A;  1STF I;  1N9J A;  3SED A;  3QK9 A;  1MGW A;  2CWU A;  1MGR A;  1YHQ 3;  2SBL A;  3EF8 A;  3EQQ B;  1G96 A;  1UCI A;  1ZO2 A;  3X41 A;  5M19 A;  3JUQ A;  4O8S A;  5DRV A;  2JDI H;  1ROA A;  3X3X A;  1NJI 4;  1ZX2 A;  1R4Y A;  1BRK A;  2XFT A;  3GZB A;  3NQZ A;  4NRE A;  5D81 A;  4HOH A;  2H0I A;  2MC8 A;  4BL2 A;  4HM8 B;  1BIR A;  1BSC A;  4R9K A;  3T8U A;  1RGA A;  1IVX A;  3KFQ C;  4R1K A;  3EBY A;  8CHO A;  4R80 A;  1OHO A;  1RCL A;  1RKY A;  1B2M A;  5IEN A;  1TFK A;  5IG0 A;  3WOF B;  1RGE A;  4KFE A;  4XBX A;  3U1W A;  1PU4 A;  2GU1 A;  3F7X A;  5CLK A;  1FZU A;  3A76 A;  4X2O A;  5I97 A;  1AQZ A;  2KAA A;  3G16 A;  3LZA A;  5BU4 A;  1CQS A;  4IIA A;  1D6Z A;  1TUH A;  4R4K A;  3T0U A;  3FG3 A;  1M9G A;  1FGR A;  2B1X B;  3G6E 3;  3DGN A;  1OHP A;  2KXG A;  1RRH A;  4L8P A;  4MMY B;  5AYR B;  1N8Q A;  1GY5 A;  4CDL A;  2HMN B;  3CCS 3;  2H0G A;  3DGM A;  3X3Z A;  3MG2 A;  1LVN A;  2GSP A;  1UCJ A;  2UUG C;  3H3H A;  3X42 A;  4XM4 A;  1BNE A;  1JNQ A;  3D3L A;  3HOH A;  4EYC A;  1M1X B;  1VQM 3;  1LQM B;  3JUM A;  2SAR A;  2P05 A;  1FW7 A;  1K28 A;  2BO9 B;  3EHC A;  3V98 A;  4FCM A;  2L1S A;  4RNZ A;  1W5Z A;  4FMA A;  1RNT A;  4L8O A;  2YFI B;  3OWY A;  3NUV A;  2YX9 A;  3UNL A;  2CKF B;  1B2U A;  4LEH A;  3HZP A;  3N8B A;  4GHO A;  2XRX B;  3ROB A;  3PXM A;  5AII A;  4FCJ A;  3EN1 B;  1CYU A;  1BVI A;  1IDP A;  2CHC A;  2K0M A;  1RN7 A;  3DGY A;  3EX9 A;  4J9A A;  5LC7 A;  3N54 B;  2CWT A;  5IG4 A;  1BRS A;  1RDS A;  3Q2P A;  4MMX B;  1BAO A;  3NBR A;  2Z77 A;  5AEW B;  1UUV B;  1IVU A;  3F9S A;  5JBS A;  3BNE A;  1F8N A;  1WTH A;  2BMQ B;  4BL3 A;  3D5G A;  1PYL A;  2XR8 B;  1BGS A;  3GRD A;  3S29 A;  1CH0 A;  1W4N A;  3DGO A;  3K7C A;  4HJL B;  2W2C A;  3B4O A;  5G1L A;  5KP3 A;  1Q40 B;  3LH4 A;  1DYU A;  4GSP A;  1B2X A;  2OQE C;  4ORL A;  1NB5 I;  2OQE A;  1KC8 4;  1Z1S A;  1HU9 A;  1WMN A;  3F14 A;  3WR2 A;  4BTX A;  1VQ5 3;  3PZW A;  2Z76 A;  2FGT A;  3ALA A;  3JVC A;  1YJN 3;  1UGH I;  1BNI A;  2HMJ B;  2W56 A;  3BNB A;  3BND A;  4PEJ A;  3VSY A;  2IUK A;  3FH1 A;  3CCV 3;  1YI2 3;  4LMI A;  5M18 A;  2IA7 A;  3EJV A;  1QVF 2;  4L7K A;  2XFS A;  1LOV A;  3NV0 B;  3DZL A;  3CCR 3;  2RCD A;  1EEJ A;  3LT8 A;  1JKG B;  1O7P B;  4HM0 B;  3I0Y A;  1JB4 A;  1W6G A;  2AAD A;  3EBT A;  4HBR A;  4OUQ A;  1I2E A;  4OK0 A;  3CME 3;  4OVM A;  2FNQ A;  1LQG C;  3BNC A;  1YVB I;  1EUI C;  1UDI I;  3L0R A;  1LNH A;  2RFR A;  1IQY A;  4STD A;  1RNB A;  5GSP A;  3MG1 A;  3UJM A;  1A2K A;  9RNT A;  1BNR A;  1UCL A;  3G0K A;  1OH0 A;  1JBR A;  2ZDJ A;  3HK4 A;  1FUT A;  1ULJ B;  4H3U A;  3F8X A;  1WMO A;  3NHX A;  2Y74 A;  4GB5 A;  4FMC A;  5AIF A;  1G0T A;  1FGQ A;  3RGA A;  1PFP A;  4WHA A;  1Q82 4;  2RBI A;  1CEW I;  3IPT A;  4LGQ A;  2BHM A;  2V1L A;  2WGO A;  5HOH A;  2BIR A;  2BMO B;  1A90 A;  3CCL 3;  1BRI A;  3DM8 A;  1ASK A;  1LNI A;  3NXJ A;  2OCT A;  4DKI A;  1RGL A;  2WGQ A;  2Y73 A;  5AI1 A;  3WA2 X;  1J2B A;  2RGQ A;  4RNY A;  4BIR A;  2HMO B;  4ZM8 A;  2CX0 A;  1UI8 A;  1RGG A;  5STD A;  2B24 B;  4N6O B;  1OUN A;  4RNT A;  1GY6 A;  3DGL A;  3AHW A;  1IVW A;  1TIJ A;  1QAK A;  1WMP A;  1IQ8 A;  2H0H A;  3AMO A;  5BVB A;  3WOE B;  4J5G A;  1YGW A;  1JZD A;  1C7H A;  3CNM A;  1A2P A;  1Q42 A;  1W2B 2;  1LOY A;  3KSP A;  1UUW B;  3PYJ A;  1S5A A;  2P0X A;  4WFO A;  2KRT A;  2E2V A;  2E2U A;  3AHS A;  5RNT A;  2FXT A;  1KQS 2;  2XSO B;  4XDV A;  1JBS A;  2INX A;  2KF4 A;  3M8C A;  4EXR A;  1BRG A;  3LT9 A;  4WYK A;  1JN5 A;  5M1A A;  1RLS A;  1I3F A;  1O7M B;  1W2Z A;  2M7O A;  3S67 A;  3FGY A;  5TGN A;  1E3R A;  1ISK A;  1IVV A;  4O02 B;  5G1K A;  1I70 A;  3ER7 A;  1TRQ A;  1BUQ A;  1X1U A;  1W7C A;  2F86 B;  4FR9 A;  3STD A;  3FF2 A;  2F4Y A;  2OTL 3;  2I9W A;  1O7W B;  1K41 A;  4KT3 B;  5CF1 A;  4K90 B;  1HKX A;  2P38 A;  1BSB A;  3DMC A;  4EW5 A;  1OGX A;  3F40 A;  3LTA A;  1Q7Y 4;  2IYJ A;  4R9L A;  1IV9 A;  4WP5 A;  1VQ8 3;  1BU4 A;  1RMS A;  2YFJ B;  1B2S A;  2CX1 A;  1W01 A;  3HI7 A;  2C4B A;  3S5C A;  1R4C A;  4K1V A;  1QAL A;  4EV2 A;  1BSD A;  3GAX A;  2XGN A;  1O7N B;  4WWU C;  1I8V A;  5EEO A;  3MWZ A;  2D42 A;  3LTD A; 
#chains in the Genus database with same CATH homology
 4HYZ A;  5KP1 A;  3VF1 A;  4NHF A;  3WMD A;  3BLZ A;  3RGR A;  1AR0 A;  3U97 A;  1FGM A;  3MSO A;  1Q81 4;  1A2V A;  1OF5 B;  4XBT A;  5ELU A;  1MOL A;  1N5H A;  2R4I A;  2P0M A;  3V92 A;  1DMQ A;  2CK3 H;  2WO0 A;  1JB2 A;  2GBX B;  1O7H B;  3K9M C;  3LTB A;  1N9E A;  3B8L A;  3S28 A;  4N6M A;  3IMA B;  2KCD A;  3G71 3;  2STD A;  1AVL A;  1VQ7 3;  2A15 A;  2Q07 A;  3MYT A;  2CFG A;  1GS3 A;  2W04 A;  4LSO A;  1DMN A;  1IV7 A;  2D1W A;  1FGO A;  1NDO B;  3PCR A;  2XSH B;  3GZR A;  4HZ9 B;  3CC2 3;  5AYS C;  1FGT A;  2JQ5 A;  5IG3 A;  1YJW 3;  5IF6 A;  3CPW 2;  5FGO A;  3NBB A;  3H51 A;  1SJW A;  2GU3 A;  1IQX A;  3RDE A;  1STD A;  1IU7 A;  2GEX A;  5BXQ A;  1QJG A;  4X2H A;  2RSX A;  4BTW A;  2BT3 A;  1AVK A;  2LQV A;  1FA3 A;  5EQL A;  1ULI B;  2L4V A;  3S27 A;  3EE1 A;  3WDG B;  1CYV A;  2WOH A;  1N5P A;  4HVN A;  3PS8 A;  3SOY A;  1WQL B;  1T5Y A;  5CF2 A;  2BNG A;  3UB1 A;  5FW5 A;  4CCV A;  2Z7A A;  1JRQ A;  2PNC A;  3I55 3;  2WOF A;  1QAF A;  1M90 4;  3SOA A;  2CFW A;  3MG3 A;  2F99 A;  2MF7 A;  3OX9 A;  4O2H A;  3Q90 A;  1SPU A;  1YJ9 3;  1V74 A;  1RJO A;  1OPY A;  3SXX A;  3I56 3;  3LTC A;  1L5G B;  4N3V A;  1DMM A;  4HM2 B;  1EQK A;  2XF3 A;  2CWV A;  3E99 A;  5IEP A;  3X3Y A;  3QRD A;  2HML B;  3FLJ A;  3NM7 A;  3FSD A;  2YFL B;  4KVH A;  3OW2 2;  3K63 A;  3KSE D;  3CCM 3;  4N6L A;  4AEQ A;  2GEY A;  4I4K A;  1IK3 A;  1WNH A;  3HIG A;  1NB3 I;  1GYB A;  4MJD A;  3VGN A;  3K0Z A;  4AKZ A;  3OWU A;  3FF0 A;  3T8N A;  4EC6 A;  2BMR B;  1D6Y A;  3HII A;  3WA3 A;  2QGU A;  4K1U A;  3GZY B;  3OXA A;  3FKA A;  1UW1 A;  2F98 A;  2W9Q A;  2ML6 A;  2C10 A;  3KE7 A;  2QA4 3;  2OWP A;  2O9U X;  1VQO 3;  1FUW A;  3FG4 A;  2W56 B;  4G1M B;  4RBN A;  3SLU A;  1TFO A;  4KFD A;  4KFF A;  2CH9 A;  2CC3 A;  2E2T A;  3MPH A;  1Q40 A;  1MNL A;  1JB5 A;  1E3V A;  5AIG A;  4IPB A;  3WOD G;  5IER A;  3B7C A;  4HM3 B;  3V99 A;  3NX0 A;  1D6U A;  3CXC 2;  3GWR A;  3NBJ A;  3JUP A;  2XH9 A;  4FMB A;  3CPO A;  3X40 A;  4HM7 B;  1IT8 A;  6STD A;  2LYX A;  2CIU A;  3NV0 A;  4MEI A;  3B4P A;  5EVH A;  3MKI A;  1JKG A;  3Q1C A;  1DVD A;  4N6V 0;  1VQL 3;  1OCV A;  1W6C A;  3EN8 A;  4HM5 B;  4GL6 A;  1Y4K A;  2K54 A;  3G8Z A;  3O8Y A;  1GY7 A;  2Z6B A;  3OWS A;  4HKV B;  1Q86 4;  3KKG A;  2OTJ 3;  4KZ1 A;  3G4S 3;  5CXO A;  4RZM A;  3F7S A;  1K9M 4;  2W6J H;  1VQP 3;  5D82 A;  2UX0 A;  3LOY A;  5IG5 A;  1KWI A;  5ELJ A;  1YIJ 3;  4FCZ A;  4J8T A;  1VZZ A;  1M1K 4;  3GZX B;  4HM4 B;  5KP4 A;  4AKY A;  1US1 A;  3ECF A;  3CC4 3;  2GBW B;  1KSI A;  1JJ2 2;  3AMO B;  1NWW A;  1K8A 4;  4IT7 A;  1OAC A;  3LYG A;  1VQK 3;  2W0Q A;  1QMA A;  4N6N B;  1U5O A;  2O3O A;  2QIY A;  3FG1 A;  3CCU 3;  1EG9 B;  3TDG A;  3OV4 A;  4WYK B;  3EC9 A;  1JN5 B;  3CCQ 3;  2XGL A;  1LXE A;  2QEX 3;  1KD1 4;  1RRL A;  3SX1 A;  3CU3 A;  4N6T A;  4EBG A;  1TP6 A;  3KZT A;  2P09 A;  4HM6 B;  1YIT 3;  2OOV C;  1NO3 A;  3F8H A;  4JRF A;  5IW9 A;  3EB8 A;  2OOV A;  2CG0 A;  4N6U A;  1U8C B;  2PZV A;  5AEU B;  1KQS 2;  1OHS A;  3MHE A;  5G2G A;  3CC7 3;  1A67 A;  2XEP A;  1EKM A;  3SVA A;  1N8R 4;  5CK6 A;  5D83 A;  3CNX A;  1SQW A;  4Q53 A;  5JPP A;  1GD4 A;  4XBY A;  1GD3 A;  3FCS B;  2CW9 A;  3NQY A;  1K73 4;  1VQ6 3;  4EV5 A;  4BTY A;  4JF8 A;  3PGB A;  1YGE A;  1JV2 B;  3UL5 A;  1SII A;  1AV4 A;  5IEO A;  1W6Y A;  5JPU A;  1IT7 A;  2IUJ A;  3DY5 A;  4FMD A;  1NU3 A;  1UI7 A;  2IMJ A;  4LZI A;  5AIH A;  7STD A;  1TU5 A;  1LOX A;  1W00 A;  2W03 A;  2ZL8 A;  3K5T A;  1EA2 A;  3LXU X;  1W02 A;  2C11 A;  2CFK A;  3N9H A;  2CFL A;  2GXF A;  3CMA 3;  2CFD A;  1QVG 2;  3LML A;  3BB9 A;  4HZB B;  3KII A;  1E97 A;  4QWT A;  3CD6 3;  1OGZ A;  5HGR A;  1S72 3;  2ML5 A;  3KN4 A;  4K61 A;  1VQ4 3;  1O7G B;  5LC6 A;  2CG1 A;  5DRE A;  3JUN A;  3UL6 A;  3DXO A;  1VQN 3;  5A0O B;  3IJE B;  1ROV A;  1SIH A;  1DVC A;  4HM1 B;  4TX4 A;  4XDW A;  3J7Y d;  4U13 A;  3D9R A;  2HMK B;  1OF5 A;  3NM2 A;  3FZW A;  4MMZ B;  3CCJ 3;  3JUO A;  1VQ9 3;  2HMM B;  3DUK A;  4XB5 A;  2W9P A;  3HX8 A;  4O3V A;  3PCS A;  3CCE 3;  4H61 A;  1STF I;  1N9J A;  3SED A;  3QK9 A;  2CWU A;  1YHQ 3;  2SBL A;  3EF8 A;  3EQQ B;  1G96 A;  1ZO2 A;  3X41 A;  3JUQ A;  4O8S A;  5DRV A;  2JDI H;  1ROA A;  3X3X A;  1NJI 4;  1ZX2 A;  2XFT A;  3GZB A;  4NRE A;  3NQZ A;  5D81 A;  2MC8 A;  4HM8 B;  4R9K A;  3T8U A;  1IVX A;  3KFQ C;  4R1K A;  3EBY A;  8CHO A;  4R80 A;  1OHO A;  1RKY A;  5IEN A;  1TFK A;  5IG0 A;  3WOF B;  4XBX A;  4KFE A;  3U1W A;  1PU4 A;  2GU1 A;  3F7X A;  5CLK A;  3A76 A;  4X2O A;  5I97 A;  3G16 A;  3LZA A;  1CQS A;  4IIA A;  1D6Z A;  1TUH A;  4R4K A;  3T0U A;  3FG3 A;  1M9G A;  1FGR A;  2B1X B;  3G6E 3;  3DGN A;  1OHP A;  2KXG A;  1RRH A;  4L8P A;  4MMY B;  5AYR B;  1N8Q A;  1GY5 A;  4CDL A;  2HMN B;  3CCS 3;  3DGM A;  3X3Z A;  3MG2 A;  1LVN A;  3X42 A;  3H3H A;  4XM4 A;  3D3L A;  1JNQ A;  4EYC A;  1M1X B;  1VQM 3;  3JUM A;  2P05 A;  1K28 A;  2BO9 B;  3EHC A;  3V98 A;  4FCM A;  4RNZ A;  1W5Z A;  4FMA A;  4L8O A;  2YFI B;  3OWY A;  3NUV A;  2YX9 A;  3UNL A;  2CKF B;  4LEH A;  3HZP A;  3N8B A;  2XRX B;  3ROB A;  3PXM A;  5AII A;  4FCJ A;  3EN1 B;  1CYU A;  1IDP A;  2K0M A;  2CHC A;  3EX9 A;  1RN7 A;  4J9A A;  5LC7 A;  3N54 B;  2CWT A;  5IG4 A;  3Q2P A;  4MMX B;  3NBR A;  5AEW B;  2Z77 A;  1UUV B;  1IVU A;  3F9S A;  5JBS A;  3BNE A;  1F8N A;  1WTH A;  2BMQ B;  2XR8 B;  3GRD A;  3S29 A;  1W4N A;  3DGO A;  3K7C A;  4HJL B;  2W2C A;  3B4O A;  5KP3 A;  1Q40 B;  3LH4 A;  1DYU A;  4ORL A;  2OQE C;  1NB5 I;  2OQE A;  1KC8 4;  1Z1S A;  1HU9 A;  1WMN A;  3F14 A;  4BTX A;  1VQ5 3;  3PZW A;  2Z76 A;  2FGT A;  3ALA A;  3JVC A;  1YJN 3;  3BNB A;  2HMJ B;  2W56 A;  3BND A;  4PEJ A;  3VSY A;  2IUK A;  3FH1 A;  3CCV 3;  1YI2 3;  4LMI A;  2IA7 A;  3EJV A;  1QVF 2;  4L7K A;  2XFS A;  3NV0 B;  3DZL A;  3CCR 3;  2RCD A;  3LT8 A;  1JKG B;  1O7P B;  4HM0 B;  3I0Y A;  1JB4 A;  1W6G A;  3EBT A;  4HBR A;  4OUQ A;  4OK0 A;  3CME 3;  4OVM A;  2FNQ A;  3BNC A;  1YVB I;  3L0R A;  1LNH A;  2RFR A;  1IQY A;  4STD A;  3MG1 A;  3UJM A;  1A2K A;  3G0K A;  1OH0 A;  2ZDJ A;  3HK4 A;  1ULJ B;  4H3U A;  3F8X A;  1WMO A;  3NHX A;  2Y74 A;  4GB5 A;  4FMC A;  5AIF A;  1FGQ A;  3RGA A;  1PFP A;  4WHA A;  1Q82 4;  1CEW I;  3IPT A;  4LGQ A;  2BHM A;  2V1L A;  2WGO A;  2BMO B;  1A90 A;  3CCL 3;  3DM8 A;  1ASK A;  3NXJ A;  2OCT A;  5AI1 A;  2WGQ A;  2Y73 A;  3WA2 X;  1J2B A;  2RGQ A;  4RNY A;  2HMO B;  4ZM8 A;  1UI8 A;  5STD A;  2B24 B;  4N6O B;  1OUN A;  1GY6 A;  3DGL A;  1IVW A;  1TIJ A;  1QAK A;  1WMP A;  1IQ8 A;  3AMO A;  5BVB A;  3WOE B;  3CNM A;  1C7H A;  1Q42 A;  1W2B 2;  3KSP A;  3PYJ A;  1UUW B;  4WFO A;  1S5A A;  2P0X A;  2KRT A;  2E2V A;  2E2U A;  2FXT A;  2XSO B;  4XDV A;  2INX A;  3M8C A;  4EXR A;  3LT9 A;  4WYK A;  1JN5 A;  1O7M B;  1W2Z A;  2M7O A;  3S67 A;  3FGY A;  5TGN A;  1E3R A;  1ISK A;  1IVV A;  4O02 B;  3ER7 A;  1BUQ A;  1W7C A;  2F86 B;  4FR9 A;  3STD A;  3FF2 A;  2OTL 3;  2I9W A;  1O7W B;  1K41 A;  5CF1 A;  4K90 B;  1HKX A;  2P38 A;  3DMC A;  1OGX A;  3F40 A;  3LTA A;  1Q7Y 4;  4R9L A;  1IV9 A;  4WP5 A;  1VQ8 3;  2YFJ B;  1W01 A;  3HI7 A;  3S5C A;  1R4C A;  4K1V A;  1QAL A;  4EV2 A;  3GAX A;  2XGN A;  1O7N B;  4WWU C;  5EEO A;  3MWZ A;  2D42 A;  3LTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...