1GOYA

Hydrolase(endoribonuclease)ribonuclease bi(g specific endonuclease) (e.c.3.1.27.-) complexed with guanosine-3'-phosphate (3'-gmp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1goyA00
1I2FA 1G02A 5GSPA 1LRAA 1YNVX 1X1XA 1BNGA 1BRHA 1TTOA 4J5KA 1PY3A 1BSAA 1R4YA 1DE3A 1LOVA 1RGHA 1JBTA 5RNTA 1RTUA 1BRNL 1RCLA 3KCHA 2KF6A 1BSEA 1B2XA 1JBSA 3SYUA 2AADA 4GHOA 1X1UA 1TRPA 3GSPA 1YGWA 1X1YA 3AGOA 1B3SA 2GSPA 8RNTA 1BGSA 2SARA 3URPA 4GSPA 6GSPA 5BU4A 1GOUA 2HOHA 1RLSA 4HOHA 1UCLA 2KF4A 1TRQA 1BIRA 1BSCA 3DGYA 4HAAA 1JBRA 1GOVA 1RGCA 3DH2A 4BIRA 3AHWA 2F5MA 1GSPA 2ZA4A 1RGLA 2F56A 1UCJA 1FUSA 4J5GA 1I3IA 1I2EA 1RDSA 1BVIA 1T2HA 1GMQA 2F5WA 1BUJA 1RGFA 7GSPA 1GMPA 1RN4A 1I70A 3WR2A 2RBIA 2RNTA 2BIRA 1YVSA 1RSNA 1X1WA 1B2ZA 1BNJA 2F4YA 1BRSA 1MGWA 1AY7A 1BNFA 5HOHA 1IYYA 3Q3FA 1LOWA 9RNTA 1RHLA 1GMRA 1I0XA 1I2GA 2KF3A 1BSDA 1LNIA 7RNTA 1BSBA 1T2IA 1I3FA 1RNBA 2AAEA 1BANA 1BOXA 1A2PA 1RNTA 6RNTA 1I0VA 1FW7A 1BAOA 1RGAA 1FZUA 5BIRA 1BRIA 1BRKA 1C54A 1B2MA 1BRJA 3WHOA 3BIRA 1FYSA 3D5IA 1B21A 1B27A 1FUTA 1Q9EA 1UCKA 3RNTA 1BNSA 3AGNA 1I8VA 3BU4A 1BNEA 1RN1A 2KF5A 3HOHA 1LOYA 1AQZA 1B20A 1RCKA 1RGGA 4BU4A 1RGEA 1HYFA 1DETA 1B2UA 2KAAA 1MGRA 1BRGA 1ZGXA 1SARA 1B2SA 1PYLA 1RGKA 1GOYA 3D5GA 3A5EA 4RNTA 1BU4A 1CH0A 2C4BA 3D4AA 1BNRA 1BNIA 1RMSA 3AHSA 1UCIA 1HZ1A 2BU4A
chains in the Genus database with same CATH superfamily
5GSPA 1UUGB 2W03A 3DGOA 4PEJA 2JDIH 4HZBB 1BNGA 3DXOA 1TTOA 3G16A 1LQMB 4J5KA 1O7GB 1R4YA 1AR0A 4WP5A 1OHPA 5AI1A 1DE3A 5FW5A 1UGIA 1EG9B 1RTUA 5IG5A 2CW9A 2KF6A 1B2XA 2W9PA 2GEXA 2CKFB 1JZDA 3CXC2 3WA3A 3BNDA 1VQ63 1X1YA 1DVCA 4U13A 2ZDJA 4O3VA 3G713 4O02B 5JPUA 3X42A 6GSPA 3KN4A 1Q42A 1OPYA 1DMNA 2RSXA 1K41A 5ELJA 2HOHA 2P09A 1JRQA 1NB3I 1RLSA 1YJ93 2IYJA 1MNLA 3X3XA 3B7CA 1Q814 4RZMA 3SX1A 7STDA 1RGCA 3DH2A 2MC8A 1RGLA 2F56A 3JUQA 3OWYA 8CHOA 4J5GA 2BT3A 5D83A 2F99A 1CQSA 1ZX2A 3MG2A 2CWUA 2PZVA 2F5WA 2GXFA 2XGNA 1JN5A 4HM7B 5G1LA 1LOXA 2CHCA 4BTWA 2RBIA 3EBTA 4GL6A 1RSNA 1O7HB 1JKGA 3CPOA 2W04A 3G8ZA 1B2ZA 1YIJ3 1TP6A 1TU5A 1BRSA 2Z77A 1ULIB 4IT7A 1N5HA 3ZG0A 4CDLA 1K8A4 1VQN3 5IENA 5EVHA 1D6UA 1RHLA 3FLJA 2YFJB 3D3LA 4OK0A 3WA2X 1I2GA 1KQS2 3PCSA 1IV9A 2BNGA 1GD4A 2BMOB 3OWSA 2H0GA 3NX0A 3DMCA 1I3FA 2E2VA 4I4KA 3UJMA 1M9GA 2AAEA 1JV2B 1SIIA 4N6UA 1W4NA 1ZS7A 1CEWI 3BB9A 2GEYA 3DGNA 4O8SA 1BRKA 1WTHA 3WDGB 1B2MA 1C54A 3CC73 3GWRA 1GD3A 4I5QA 4R4KA 3F40A 3D5IA 2CFKA 2Z76A 3HIIA 3Q1CA 4WYKB 5M1AA 1ULJB 4MMYB 2W6JH 1FUTA 4L8OA 2KCDA 4L7KA 3CD63 3BU4A 4K1VA 1BNEA 1U8CB 1O7PB 2KF5A 1SIHA 3NBJA 3F7XA 4ILFA 3EJVA 1IVWA 1RGEA 3CU3A 1M904 2OOVA 3X41A 3B8LA 5AIIA 1A90A 1PFPA 1MGRA 4KFDA 4N6MA 3S29A 2E2UA 3D9RA 2XF3A 3ER7A 3WOFB 2HMJB 2F86B 3S28A 1FA3A 4BL3A 3A5EA 5D81A 4RNTA 4X2OA 4LSOA 1YGEA 1RMSA 1W01A 3AHSA 3MSOA 3LTBA 3NQYA 2B1XB 3VSYA 5CF1A 1YJW3 1VQ93 3MG3A 4J8TA 4EV5A 4EV2A 3JUMA 4R9KA 2W56A 1RRHA 1ISKA 1YNVX 1M1XB 3MPHA 1PY3A 1BSAA 3NM2A 4LYLB 4FMBA 4R80A 3EN1B 4HYZA 3URPA 1JB4A 1CYUA 1E97A 1U5OA 5AIFA 1DMQA 1BRNL 2CX1A 4EBGA 3B4PA 2OCTA 3CNMA 1JNQA 5IF6A 4GHOA 1X1UA 1Z1SA 2STDA 1A67A 1TRPA 4O2HA 5IW9A 3OV4A 4HM4B 3H51A 1WQLB 8RNTA 1BUQA 3EN8A 1S723 1DVDA 3HK4A 3N8BA 1NWWA 3HZPA 1OHSA 2CWTA 5BU4A 1IQXA 1LQGC 2CIUA 3LT8A 3TDGA 1EEJA 3NV0B 1VQO3 1TRQA 1BIRA 2HMNB 2YX9A 3DGYA 3KSPA 4HAAA 2MF7A 1PU4A 3CC43 3Q90A 1N9JA 5D82A 3CCL3 2R4IA 1FGOA 4K61A 5AYRB 2ZA4A 3K9MC 3VF1A 3EHCA 4CPKA 1WMNA 3PXMA 1I3IA 1I2EA 1RDSA 1N8QA 1J2BA 1BVIA 1ROAA 3UL5A 1OHOA 1SJWA 3LTAA 5FGOA 2GU1A 1ROVA 1FUWA 3KKGA 3T8NA 3CNXA 4N6TA 1IT8A 4NPBA 7GSPA 1KD14 1RN4A 1IQYA 4NREA 2RNTA 1D6ZA 2HMLB 4BTXA 3EC9A 3FH1A 5CLKA 1QJGA 3AMOB 3DGLA 4FCMA 5AEWB 1IQ8A 3CCM3 4AEQA 3FG1A 4DKIA 1OACA 3SOAA 1AY7A 1BNFA 3A76A 5CXOA 5HOHA 1VQ43 2GBWB 1JB5A 4N6LA 2KF3A 1TFKA 2Z7AA 1EKMA 4HVNA 1BSBA 3DUKA 5G2GA 1GYBA 4RNZA 2PNCA 1NO3A 1BANA 1BOXA 2IY2A 1A2PA 4MJDA 3F14A 1O7NB 1RNTA 1LVNA 1FW7A 1SQWA 1UW1A 1RGAA 5IERA 1MOLA 1EQKA 1Q40B 5ELUA 2J8XB 4KT3B 1VQ83 3BIRA 1STDA 2IUKA 4WWUC 4XBXA 1L5GB 1RN7A 3I563 1Q824 2ML5A 2OTJ3 5STDA 5LC7A 1FGTA 4BTYA 1B27A 3B4OA 3F8XA 2M7OA 2CG1A 5IEOA 1IU7A 3NBBA 1IT7A 3RGRA 1RN1A 1W5ZA 2D1WA 3FZWA 5BXQA 4EW5A 4ZM8A 1IK3A 2HMOB 1IVUA 4XDVA 1B20A 1RGGA 4H61A 3CME3 3LTCA 3FG3A 1WMPA 2BO9B 2WOFA 3BNEA 2KAAA 3PGBA 2Q07A 2L1SA 2KXGA 4IPBA 1ZGXA 5IG4A 1SARA 1B2SA 1GOYA 2HMMB 1CH0A 4KFFA 1IVVA 1S5AA 3G6E3 3ALAA 1BNIA 3OXAA 2GBXB 2UUGC 3VGNA 1A2KA 1HZ1A 1W02A 2BMRB 2Y73A 3OWUA 1K28A 1O7MB 2K3DA 2P0MA 3JUOA 3MYTA 4WYKA 3MG1A 2IUJA 2CK3H 3T0UA 1I2FA 1G02A 3GZYB 1LRAA 4N6NB 1IVXA 4EYCA 1X1XA 1BRHA 4CCVA 2XR8B 4N6V0 3O8YA 1RRLA 3UNLA 4AKZA 3K63A 3KE7A 1RGHA 1JBTA 5RNTA 1DMMA 1OF5B 2O3OA 3LT9A 4HM5B 4XBYA 2A15A 1JBSA 3ZG5A 3NXJA 4XBTA 4HZ9B 4R9LA 2AADA 3SYUA 5KP1A 1K9M4 4LEHA 1UUVB 4FCZA 2IMJA 4QWTA 3WODG 1K734 3GSPA 5EEOA 1YGWA 1JJ22 3LZAA 2GSPA 4XM4A 3JUPA 2QIYA 3SVAA 1Q7HA 1OGXA 1W7CA 4X2HA 1IDPA 4L8PA 4LMIA 2D42A 2QA43 1W2B2 1OGZA 4FMAA 3WMDA 5BVBA 2UGIA 3NHXA 4XB5A 1A2VA 2KF4A 2K0MA 5CK6A 1W00A 1V57A 3EX9A 4HM2B 2V1LA 6STDA 1RJOA 1STFI 1JBRA 2XSOB 3JUNA 4BIRA 2CWVA 3BNBA 3AHWA 2F5MA 3M8CA 3KIIA 3EQQB 4WHAA 1UCJA 1FUSA 1CYVA 1OH0A 1UUWB 2CH9A 5DREA 5M18A 3GZXB 1KWIA 1T2HA 1T3BA 3LMLA 4HM0B 4EC6A 3KZTA 4K1UA 3KSED 1FGMA 1GY5A 3EF8A 1BUJA 2C10A 3FGYA 1ASKA 1Q864 3MWZA 3S5CA 1YJN3 1GMPA 1I70A 1HU9A 3WR2A 1TUHA 1Y4KA 2B24B 3ZFZA 3I553 1YVSA 5IG0A 4JRFA 2CFDA 3S27A 1AV4A 4MEIA 3GRDA 3NV0A 3QK9A 1MWTA 2K54A 1LOWA 4K90B 1FGRA 2QGUA 2Y74A 4LZIA 2W2CA 1GS3A 3QRDA 5M19A 1W6GA 1BSDA 2LYXA 1GY7A 3T8UA 3G0KA 2OQEC 1JZOA 2CG0A 1QALA 3G4S3 2W0QA 1W6YA 2R41A 3CCV3 3OW22 1W2ZA 3PZWA 3CCS3 2CX0A 1KC84 1BAOA 5A0OB 1FZUA 5BIRA 1BRIA 1E3RA 1YHQ3 1KSIA 2XSHB 1N8R4 2C11A 2CFLA 2KRTA 4HJLB 4CJNA 3WHOA 1FYSA 2CFWA 3BNCA 1E3VA 2XRXB 4XDWA 5JPPA 2HMKB 1B21A 2WGQA 2WO0A 1QMAA 1VQM3 3DZLA 1TIJA 3AMOA 1Q9EA 1UCKA 3CCE3 1BNSA 2CFGA 2INXA 1N5PA 1GY6A 3S67A 3HX8A 1LOYA 2RGQA 1AQZA 1TJDA 4R1KA 3CPW2 1Q7Y4 3OX9A 1VQ53 3F7SA 1LNHA 1VZZA 3LTDA 3UL6A 2GU3A 3FKAA 1DETA 2FXTA 1B2UA 4NHFA 4WFOA 2P05A 1M1K4 1ZO2A 2WOHA 4OVMA 3U1WA 1O7WB 1BRGA 2CC3A 2UX0A 5HGRA 1YIT3 1RGKA 3RDEA 3CC23 4OUQA 4HM8B 4N3VA 1BU4A 1Q40A 2C4BA 4FMDA 2P0XA 3D4AA 1BNRA 1MWRA 3IPTA 1QAFA 1YVBI 1NDOB 2RFRA 1EA2A 4G1MB 2BU4A 4FCJA 1R4CA 3SXXA 3IMAB 4FMCA 3H3HA 1YI23 3IJEB 5KP3A 3FSDA 1FGQA 1UI8A 3CCU3 2H0IA 3Q2PA 3I0YA 5EQLA 2YFLB 4KVHA 1LOVA 3LXUX 3FG4A 1EUIC 2BHMA 1RCLA 1WNHA 3FF2A 2XH9A 3KCHA 5AYSC 1BSEA 5IG3A 1DYUA 1VQ73 1JN5B 4MMZB 2OWPA 3V98A 3WOEB 3U97A 5AIGA 3AGOA 3CMA3 1B3SA 3K5TA 1VQQA 1BGSA 1F8NA 1OCVA 2SARA 4GSPA 3NUVA 1MWUA 1SPUA 4HBRA 1JKGB 2JQ5A 3K0ZA 4J9AA 1GOUA 4GB5A 1NB5I 1N9EA 2ML6A 4HOHA 1UCLA 2E2TA 3DGMA 1BSCA 5IEPA 3N54B 3E99A 4EXRA 3GZRA 4N6OB 3X40A 1TFOA 4MMXB 3CCR3 1GOVA 4HM3B 3ROBA 1NJI4 2OTL3 1QVF2 1GSPA 3DM8A 3RGAA 1VQP3 5LC6A 1D6YA 3CCJ3 3PS8A 4FR9A 2RCDA 3K7CA 1W6CA 1OF5A 4HM6B 4RNYA 1GMQA 1NU3A 2I9WA 1WMOA 3EE1A 1MWSA 1VQL3 2XFSA 4TX4A 1RGFA 3KFQC 3SEDA 2P38A 3EB8A 3V92A 2BIRA 3SOYA 3UB1A 2OOVC 3NQZA 1UI7A 1X1WA 2LQVA 4RBNA 4BL2A 5I97A 1BNJA 1LXEA 3LOYA 2F4YA 3FCSB 2IA7A 4STDA 5AIHA 1MGWA 4KFEA 1VQK3 1IYYA 3Q3FA 2FNQA 1G0TA 2FGTA 9RNTA 1GMRA 2H0HA 4IIAA 3BLZA 1I0XA 2WGOA 7RNTA 1LNIA 2ZL8A 3JVCA 3D79A 1T2IA 4HKVB 1IV7A 1RNBA 2O9UX 3STDA 2XGLA 1G96A 4JF8A 1I0VA 6RNTA 3CCQ3 1C7HA 1NNVA 2L4VA 4HM1B 4LGQA 3NBRA 1BRJA 2QEX3 3V99A 3X3ZA 3MKIA 1OUNA 3F8HA 3HIGA 2YFIB 3HI7A 1HKXA 3NM7A 5CF2A 3SLUA 2W56B 2Z6BA 2SBLA 3RNTA 4AKYA 3GAXA 5DRVA 3MHEA 3J7Yd 3AGNA 1I8VA 4H3UA 2W9QA 3HOHA 4ORLA 2ZHXB 1RCKA 4BU4A 4KZ1A 1AVKA 1HYFA 5KP4A 2XEPA 1RKYA 5G1KA 1UDII 1QVG2 2F98A 3PCRA 1JB2A 1US1A 1PYLA 1QAKA 3L0RA 3D5GA 1V58A 1T5YA 3N9HA 3FF0A 3GZBA 3EBYA 3X3YA 1V74A 3LYGA 2XFTA 3ECFA 2OQEA 5AEUB 1UCIA 3DY5A 3F9SA 3LH4A 3PYJA 1AVLA 5TGNA 5JBSA 2BMQB 1UGHI 4Q53A
chains in the Genus database with same CATH topology
1I2FA 1G02A 5GSPA 1LRAA 1YNVX 1X1XA 1BNGA 1BRHA 1TTOA 4J5KA 1PY3A 1BSAA 1R4YA 1DE3A 1LOVA 1RGHA 1JBTA 5RNTA 1RTUA 1BRNL 1RCLA 3KCHA 2KF6A 1BSEA 1B2XA 1JBSA 3SYUA 2AADA 4GHOA 1X1UA 1TRPA 3GSPA 1YGWA 1X1YA 3AGOA 1B3SA 2GSPA 8RNTA 1BGSA 2SARA 3URPA 4GSPA 6GSPA 5BU4A 1GOUA 2HOHA 1RLSA 4HOHA 1UCLA 2KF4A 1TRQA 1BIRA 1BSCA 3DGYA 4HAAA 1JBRA 1GOVA 1RGCA 3DH2A 4BIRA 3AHWA 2F5MA 1GSPA 2ZA4A 1RGLA 2F56A 1UCJA 1FUSA 4J5GA 1I3IA 1I2EA 1RDSA 1BVIA 1T2HA 1GMQA 2F5WA 1BUJA 1RGFA 7GSPA 1GMPA 1RN4A 1I70A 3WR2A 2RBIA 2RNTA 2BIRA 1YVSA 1RSNA 1X1WA 1B2ZA 1BNJA 2F4YA 1BRSA 1MGWA 1AY7A 1BNFA 5HOHA 1IYYA 3Q3FA 1LOWA 9RNTA 1RHLA 1GMRA 1I0XA 1I2GA 2KF3A 1BSDA 1LNIA 7RNTA 1BSBA 1T2IA 1I3FA 1RNBA 2AAEA 1BANA 1BOXA 1A2PA 1RNTA 6RNTA 1I0VA 1FW7A 1BAOA 1RGAA 1FZUA 5BIRA 1BRIA 1BRKA 1C54A 1B2MA 1BRJA 3WHOA 3BIRA 1FYSA 3D5IA 1B21A 1B27A 1FUTA 1Q9EA 1UCKA 3RNTA 1BNSA 3AGNA 1I8VA 3BU4A 1BNEA 1RN1A 2KF5A 3HOHA 1LOYA 1AQZA 1B20A 1RCKA 1RGGA 4BU4A 1RGEA 1HYFA 1DETA 1B2UA 2KAAA 1MGRA 1BRGA 1ZGXA 1SARA 1B2SA 1PYLA 1RGKA 1GOYA 3D5GA 3A5EA 4RNTA 1BU4A 1CH0A 2C4BA 3D4AA 1BNRA 1BNIA 1RMSA 3AHSA 1UCIA 1HZ1A 2BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  1G02 A;  5GSP A;  1LRA A;  1YNV X;  1X1X A;  1BNG A;  1BRH A;  1TTO A;  4J5K A;  1PY3 A;  1BSA A;  1R4Y A;  1DE3 A;  1LOV A;  1RGH A;  1JBT A;  5RNT A;  1RTU A;  1BRN L;  1RCL A;  3KCH A;  2KF6 A;  1BSE A;  1B2X A;  1JBS A;  3SYU A;  2AAD A;  4GHO A;  1X1U A;  1TRP A;  3GSP A;  1YGW A;  1X1Y A;  3AGO A;  1B3S A;  2GSP A;  8RNT A;  1BGS A;  2SAR A;  3URP A;  4GSP A;  6GSP A;  5BU4 A;  1GOU A;  2HOH A;  1RLS A;  4HOH A;  1UCL A;  2KF4 A;  1TRQ A;  1BIR A;  1BSC A;  3DGY A;  4HAA A;  1JBR A;  1GOV A;  1RGC A;  3DH2 A;  4BIR A;  3AHW A;  2F5M A;  1GSP A;  2ZA4 A;  1RGL A;  2F56 A;  1UCJ A;  1FUS A;  4J5G A;  1I3I A;  1I2E A;  1RDS A;  1BVI A;  1T2H A;  1GMQ A;  2F5W A;  1BUJ A;  1RGF A;  7GSP A;  1GMP A;  1RN4 A;  1I70 A;  3WR2 A;  2RBI A;  2RNT A;  2BIR A;  1YVS A;  1RSN A;  1X1W A;  1B2Z A;  1BNJ A;  2F4Y A;  1BRS A;  1MGW A;  1AY7 A;  1BNF A;  5HOH A;  1IYY A;  3Q3F A;  1LOW A;  9RNT A;  1RHL A;  1GMR A;  1I0X A;  1I2G A;  2KF3 A;  1BSD A;  1LNI A;  7RNT A;  1BSB A;  1T2I A;  1I3F A;  1RNB A;  2AAE A;  1BAN A;  1BOX A;  1A2P A;  1RNT A;  6RNT A;  1I0V A;  1FW7 A;  1BAO A;  1RGA A;  1FZU A;  5BIR A;  1BRI A;  1BRK A;  1C54 A;  1B2M A;  1BRJ A;  3WHO A;  3BIR A;  1FYS A;  3D5I A;  1B21 A;  1B27 A;  1FUT A;  1Q9E A;  1UCK A;  3RNT A;  1BNS A;  3AGN A;  1I8V A;  3BU4 A;  1BNE A;  1RN1 A;  2KF5 A;  3HOH A;  1LOY A;  1AQZ A;  1B20 A;  1RCK A;  1RGG A;  4BU4 A;  1RGE A;  1HYF A;  1DET A;  1B2U A;  2KAA A;  1MGR A;  1BRG A;  1ZGX A;  1SAR A;  1B2S A;  1PYL A;  1RGK A;  1GOY A;  3D5G A;  3A5E A;  4RNT A;  1BU4 A;  1CH0 A;  2C4B A;  3D4A A;  1BNR A;  1BNI A;  1RMS A;  3AHS A;  1UCI A;  1HZ1 A;  2BU4 A; 
#chains in the Genus database with same CATH topology
 5GSP A;  1UUG B;  2W03 A;  3DGO A;  4PEJ A;  2JDI H;  4HZB B;  1BNG A;  3DXO A;  1TTO A;  3G16 A;  1LQM B;  4J5K A;  1O7G B;  1R4Y A;  1AR0 A;  4WP5 A;  1OHP A;  5AI1 A;  1DE3 A;  5FW5 A;  1UGI A;  1EG9 B;  1RTU A;  5IG5 A;  2CW9 A;  2KF6 A;  1B2X A;  2W9P A;  2GEX A;  2CKF B;  1JZD A;  3CXC 2;  3WA3 A;  3BND A;  1VQ6 3;  1X1Y A;  1DVC A;  4U13 A;  2ZDJ A;  4O3V A;  3G71 3;  4O02 B;  5JPU A;  3X42 A;  6GSP A;  3KN4 A;  1Q42 A;  1OPY A;  1DMN A;  2RSX A;  1K41 A;  5ELJ A;  2HOH A;  2P09 A;  1JRQ A;  1NB3 I;  1RLS A;  1YJ9 3;  2IYJ A;  1MNL A;  3X3X A;  3B7C A;  1Q81 4;  4RZM A;  3SX1 A;  7STD A;  1RGC A;  3DH2 A;  2MC8 A;  1RGL A;  2F56 A;  3JUQ A;  3OWY A;  8CHO A;  4J5G A;  2BT3 A;  5D83 A;  2F99 A;  1CQS A;  1ZX2 A;  3MG2 A;  2CWU A;  2PZV A;  2F5W A;  2GXF A;  2XGN A;  1JN5 A;  4HM7 B;  5G1L A;  1LOX A;  2CHC A;  4BTW A;  2RBI A;  3EBT A;  4GL6 A;  1RSN A;  1O7H B;  1JKG A;  3CPO A;  2W04 A;  3G8Z A;  1B2Z A;  1YIJ 3;  1TP6 A;  1TU5 A;  1BRS A;  2Z77 A;  1ULI B;  4IT7 A;  1N5H A;  3ZG0 A;  4CDL A;  1K8A 4;  1VQN 3;  5IEN A;  5EVH A;  1D6U A;  1RHL A;  3FLJ A;  2YFJ B;  3D3L A;  4OK0 A;  3WA2 X;  1I2G A;  1KQS 2;  3PCS A;  1IV9 A;  2BNG A;  1GD4 A;  2BMO B;  3OWS A;  2H0G A;  3NX0 A;  3DMC A;  1I3F A;  2E2V A;  4I4K A;  3UJM A;  1M9G A;  2AAE A;  1JV2 B;  1SII A;  4N6U A;  1W4N A;  1ZS7 A;  1CEW I;  3BB9 A;  2GEY A;  3DGN A;  4O8S A;  1BRK A;  1WTH A;  3WDG B;  1B2M A;  1C54 A;  3CC7 3;  3GWR A;  1GD3 A;  4I5Q A;  4R4K A;  3F40 A;  3D5I A;  2CFK A;  2Z76 A;  3HII A;  3Q1C A;  4WYK B;  5M1A A;  1ULJ B;  4MMY B;  2W6J H;  1FUT A;  4L8O A;  2KCD A;  4L7K A;  3CD6 3;  3BU4 A;  4K1V A;  1BNE A;  1U8C B;  1O7P B;  2KF5 A;  1SIH A;  3NBJ A;  3F7X A;  4ILF A;  3EJV A;  1IVW A;  1RGE A;  3CU3 A;  1M90 4;  2OOV A;  3X41 A;  3B8L A;  5AII A;  1A90 A;  1PFP A;  1MGR A;  4KFD A;  4N6M A;  3S29 A;  2E2U A;  3D9R A;  2XF3 A;  3ER7 A;  3WOF B;  2HMJ B;  2F86 B;  3S28 A;  1FA3 A;  4BL3 A;  3A5E A;  5D81 A;  4RNT A;  4X2O A;  4LSO A;  1YGE A;  1RMS A;  1W01 A;  3AHS A;  3MSO A;  3LTB A;  3NQY A;  2B1X B;  3VSY A;  5CF1 A;  1YJW 3;  1VQ9 3;  3MG3 A;  4J8T A;  4EV5 A;  4EV2 A;  3JUM A;  4R9K A;  2W56 A;  1RRH A;  1ISK A;  1YNV X;  1M1X B;  3MPH A;  1PY3 A;  1BSA A;  3NM2 A;  4LYL B;  4FMB A;  4R80 A;  3EN1 B;  4HYZ A;  3URP A;  1JB4 A;  1CYU A;  1E97 A;  1U5O A;  5AIF A;  1DMQ A;  1BRN L;  2CX1 A;  4EBG A;  3B4P A;  2OCT A;  3CNM A;  1JNQ A;  5IF6 A;  4GHO A;  1X1U A;  1Z1S A;  2STD A;  1A67 A;  1TRP A;  4O2H A;  5IW9 A;  3OV4 A;  4HM4 B;  3H51 A;  1WQL B;  8RNT A;  1BUQ A;  3EN8 A;  1S72 3;  1DVD A;  3HK4 A;  3N8B A;  1NWW A;  3HZP A;  1OHS A;  2CWT A;  5BU4 A;  1IQX A;  1LQG C;  2CIU A;  3LT8 A;  3TDG A;  1EEJ A;  3NV0 B;  1VQO 3;  1TRQ A;  1BIR A;  2HMN B;  2YX9 A;  3DGY A;  3KSP A;  4HAA A;  2MF7 A;  1PU4 A;  3CC4 3;  3Q90 A;  1N9J A;  5D82 A;  3CCL 3;  2R4I A;  1FGO A;  4K61 A;  5AYR B;  2ZA4 A;  3K9M C;  3VF1 A;  3EHC A;  4CPK A;  1WMN A;  3PXM A;  1I3I A;  1I2E A;  1RDS A;  1N8Q A;  1J2B A;  1BVI A;  1ROA A;  3UL5 A;  1OHO A;  1SJW A;  3LTA A;  5FGO A;  2GU1 A;  1ROV A;  1FUW A;  3KKG A;  3T8N A;  3CNX A;  4N6T A;  1IT8 A;  4NPB A;  7GSP A;  1KD1 4;  1RN4 A;  1IQY A;  4NRE A;  2RNT A;  1D6Z A;  2HML B;  4BTX A;  3EC9 A;  3FH1 A;  5CLK A;  1QJG A;  3AMO B;  3DGL A;  4FCM A;  5AEW B;  1IQ8 A;  3CCM 3;  4AEQ A;  3FG1 A;  4DKI A;  1OAC A;  3SOA A;  1AY7 A;  1BNF A;  3A76 A;  5CXO A;  5HOH A;  1VQ4 3;  2GBW B;  1JB5 A;  4N6L A;  2KF3 A;  1TFK A;  2Z7A A;  1EKM A;  4HVN A;  1BSB A;  3DUK A;  5G2G A;  1GYB A;  4RNZ A;  2PNC A;  1NO3 A;  1BAN A;  1BOX A;  2IY2 A;  1A2P A;  4MJD A;  3F14 A;  1O7N B;  1RNT A;  1LVN A;  1FW7 A;  1SQW A;  1UW1 A;  1RGA A;  5IER A;  1MOL A;  1EQK A;  1Q40 B;  5ELU A;  2J8X B;  4KT3 B;  1VQ8 3;  3BIR A;  1STD A;  2IUK A;  4WWU C;  4XBX A;  1L5G B;  1RN7 A;  3I56 3;  1Q82 4;  2ML5 A;  2OTJ 3;  5STD A;  5LC7 A;  1FGT A;  4BTY A;  1B27 A;  3B4O A;  3F8X A;  2M7O A;  2CG1 A;  5IEO A;  1IU7 A;  3NBB A;  1IT7 A;  3RGR A;  1RN1 A;  1W5Z A;  2D1W A;  3FZW A;  5BXQ A;  4EW5 A;  4ZM8 A;  1IK3 A;  2HMO B;  1IVU A;  4XDV A;  1B20 A;  1RGG A;  4H61 A;  3CME 3;  3LTC A;  3FG3 A;  1WMP A;  2BO9 B;  2WOF A;  3BNE A;  2KAA A;  3PGB A;  2Q07 A;  2L1S A;  2KXG A;  4IPB A;  1ZGX A;  5IG4 A;  1SAR A;  1B2S A;  1GOY A;  2HMM B;  1CH0 A;  4KFF A;  1IVV A;  1S5A A;  3G6E 3;  3ALA A;  1BNI A;  3OXA A;  2GBX B;  2UUG C;  3VGN A;  1A2K A;  1HZ1 A;  1W02 A;  2BMR B;  2Y73 A;  3OWU A;  1K28 A;  1O7M B;  2K3D A;  2P0M A;  3JUO A;  3MYT A;  4WYK A;  3MG1 A;  2IUJ A;  2CK3 H;  3T0U A;  1I2F A;  1G02 A;  3GZY B;  1LRA A;  4N6N B;  1IVX A;  4EYC A;  1X1X A;  1BRH A;  4CCV A;  2XR8 B;  4N6V 0;  3O8Y A;  1RRL A;  3UNL A;  4AKZ A;  3K63 A;  3KE7 A;  1RGH A;  1JBT A;  5RNT A;  1DMM A;  1OF5 B;  2O3O A;  3LT9 A;  4HM5 B;  4XBY A;  2A15 A;  1JBS A;  3ZG5 A;  3NXJ A;  4XBT A;  4HZ9 B;  4R9L A;  2AAD A;  3SYU A;  5KP1 A;  1K9M 4;  4LEH A;  1UUV B;  4FCZ A;  2IMJ A;  4QWT A;  3WOD G;  1K73 4;  3GSP A;  5EEO A;  1YGW A;  1JJ2 2;  3LZA A;  2GSP A;  4XM4 A;  3JUP A;  2QIY A;  3SVA A;  1Q7H A;  1OGX A;  1W7C A;  4X2H A;  1IDP A;  4L8P A;  4LMI A;  2D42 A;  2QA4 3;  1W2B 2;  1OGZ A;  4FMA A;  3WMD A;  5BVB A;  2UGI A;  3NHX A;  4XB5 A;  1A2V A;  2KF4 A;  2K0M A;  5CK6 A;  1W00 A;  1V57 A;  3EX9 A;  4HM2 B;  2V1L A;  6STD A;  1RJO A;  1STF I;  1JBR A;  2XSO B;  3JUN A;  4BIR A;  2CWV A;  3BNB A;  3AHW A;  2F5M A;  3M8C A;  3KII A;  3EQQ B;  4WHA A;  1UCJ A;  1FUS A;  1CYV A;  1OH0 A;  1UUW B;  2CH9 A;  5DRE A;  5M18 A;  3GZX B;  1KWI A;  1T2H A;  1T3B A;  3LML A;  4HM0 B;  4EC6 A;  3KZT A;  4K1U A;  3KSE D;  1FGM A;  1GY5 A;  3EF8 A;  1BUJ A;  2C10 A;  3FGY A;  1ASK A;  1Q86 4;  3MWZ A;  3S5C A;  1YJN 3;  1GMP A;  1I70 A;  1HU9 A;  3WR2 A;  1TUH A;  1Y4K A;  2B24 B;  3ZFZ A;  3I55 3;  1YVS A;  5IG0 A;  4JRF A;  2CFD A;  3S27 A;  1AV4 A;  4MEI A;  3GRD A;  3NV0 A;  3QK9 A;  1MWT A;  2K54 A;  1LOW A;  4K90 B;  1FGR A;  2QGU A;  2Y74 A;  4LZI A;  2W2C A;  1GS3 A;  3QRD A;  5M19 A;  1W6G A;  1BSD A;  2LYX A;  1GY7 A;  3T8U A;  3G0K A;  2OQE C;  1JZO A;  2CG0 A;  1QAL A;  3G4S 3;  2W0Q A;  1W6Y A;  2R41 A;  3CCV 3;  3OW2 2;  1W2Z A;  3PZW A;  3CCS 3;  2CX0 A;  1KC8 4;  1BAO A;  5A0O B;  1FZU A;  5BIR A;  1BRI A;  1E3R A;  1YHQ 3;  1KSI A;  2XSH B;  1N8R 4;  2C11 A;  2CFL A;  2KRT A;  4HJL B;  4CJN A;  3WHO A;  1FYS A;  2CFW A;  3BNC A;  1E3V A;  2XRX B;  4XDW A;  5JPP A;  2HMK B;  1B21 A;  2WGQ A;  2WO0 A;  1QMA A;  1VQM 3;  3DZL A;  1TIJ A;  3AMO A;  1Q9E A;  1UCK A;  3CCE 3;  1BNS A;  2CFG A;  2INX A;  1N5P A;  1GY6 A;  3S67 A;  3HX8 A;  1LOY A;  2RGQ A;  1AQZ A;  1TJD A;  4R1K A;  3CPW 2;  1Q7Y 4;  3OX9 A;  1VQ5 3;  3F7S A;  1LNH A;  1VZZ A;  3LTD A;  3UL6 A;  2GU3 A;  3FKA A;  1DET A;  2FXT A;  1B2U A;  4NHF A;  4WFO A;  2P05 A;  1M1K 4;  1ZO2 A;  2WOH A;  4OVM A;  3U1W A;  1O7W B;  1BRG A;  2CC3 A;  2UX0 A;  5HGR A;  1YIT 3;  1RGK A;  3RDE A;  3CC2 3;  4OUQ A;  4HM8 B;  4N3V A;  1BU4 A;  1Q40 A;  2C4B A;  4FMD A;  2P0X A;  3D4A A;  1BNR A;  1MWR A;  3IPT A;  1QAF A;  1YVB I;  1NDO B;  2RFR A;  1EA2 A;  4G1M B;  2BU4 A;  4FCJ A;  1R4C A;  3SXX A;  3IMA B;  4FMC A;  3H3H A;  1YI2 3;  3IJE B;  5KP3 A;  3FSD A;  1FGQ A;  1UI8 A;  3CCU 3;  2H0I A;  3Q2P A;  3I0Y A;  5EQL A;  2YFL B;  4KVH A;  1LOV A;  3LXU X;  3FG4 A;  1EUI C;  2BHM A;  1RCL A;  1WNH A;  3FF2 A;  2XH9 A;  3KCH A;  5AYS C;  1BSE A;  5IG3 A;  1DYU A;  1VQ7 3;  1JN5 B;  4MMZ B;  2OWP A;  3V98 A;  3WOE B;  3U97 A;  5AIG A;  3AGO A;  3CMA 3;  1B3S A;  3K5T A;  1VQQ A;  1BGS A;  1F8N A;  1OCV A;  2SAR A;  4GSP A;  3NUV A;  1MWU A;  1SPU A;  4HBR A;  1JKG B;  2JQ5 A;  3K0Z A;  4J9A A;  1GOU A;  4GB5 A;  1NB5 I;  1N9E A;  2ML6 A;  4HOH A;  1UCL A;  2E2T A;  3DGM A;  1BSC A;  5IEP A;  3N54 B;  3E99 A;  4EXR A;  3GZR A;  4N6O B;  3X40 A;  1TFO A;  4MMX B;  3CCR 3;  1GOV A;  4HM3 B;  3ROB A;  1NJI 4;  2OTL 3;  1QVF 2;  1GSP A;  3DM8 A;  3RGA A;  1VQP 3;  5LC6 A;  1D6Y A;  3CCJ 3;  3PS8 A;  4FR9 A;  2RCD A;  3K7C A;  1W6C A;  1OF5 A;  4HM6 B;  4RNY A;  1GMQ A;  1NU3 A;  2I9W A;  1WMO A;  3EE1 A;  1MWS A;  1VQL 3;  2XFS A;  4TX4 A;  1RGF A;  3KFQ C;  3SED A;  2P38 A;  3EB8 A;  3V92 A;  2BIR A;  3SOY A;  3UB1 A;  2OOV C;  3NQZ A;  1UI7 A;  1X1W A;  2LQV A;  4RBN A;  4BL2 A;  5I97 A;  1BNJ A;  1LXE A;  3LOY A;  2F4Y A;  3FCS B;  2IA7 A;  4STD A;  5AIH A;  1MGW A;  4KFE A;  1VQK 3;  1IYY A;  3Q3F A;  2FNQ A;  1G0T A;  2FGT A;  9RNT A;  1GMR A;  2H0H A;  4IIA A;  3BLZ A;  1I0X A;  2WGO A;  7RNT A;  1LNI A;  2ZL8 A;  3JVC A;  3D79 A;  1T2I A;  4HKV B;  1IV7 A;  1RNB A;  2O9U X;  3STD A;  2XGL A;  1G96 A;  4JF8 A;  1I0V A;  6RNT A;  3CCQ 3;  1C7H A;  1NNV A;  2L4V A;  4HM1 B;  4LGQ A;  3NBR A;  1BRJ A;  2QEX 3;  3V99 A;  3X3Z A;  3MKI A;  1OUN A;  3F8H A;  3HIG A;  2YFI B;  3HI7 A;  1HKX A;  3NM7 A;  5CF2 A;  3SLU A;  2W56 B;  2Z6B A;  2SBL A;  3RNT A;  4AKY A;  3GAX A;  5DRV A;  3MHE A;  3J7Y d;  3AGN A;  1I8V A;  4H3U A;  2W9Q A;  3HOH A;  4ORL A;  2ZHX B;  1RCK A;  4BU4 A;  4KZ1 A;  1AVK A;  1HYF A;  5KP4 A;  2XEP A;  1RKY A;  5G1K A;  1UDI I;  1QVG 2;  2F98 A;  3PCR A;  1JB2 A;  1US1 A;  1PYL A;  1QAK A;  3L0R A;  3D5G A;  1V58 A;  1T5Y A;  3N9H A;  3FF0 A;  3GZB A;  3EBY A;  3X3Y A;  1V74 A;  3LYG A;  2XFT A;  3ECF A;  2OQE A;  5AEU B;  1UCI A;  3DY5 A;  3F9S A;  3LH4 A;  3PYJ A;  1AVL A;  5TGN A;  5JBS A;  2BMQ B;  1UGH I;  4Q53 A; 
#chains in the Genus database with same CATH homology
 1I2F A;  1G02 A;  5GSP A;  1LRA A;  1YNV X;  1X1X A;  1BNG A;  1BRH A;  1TTO A;  4J5K A;  1PY3 A;  1BSA A;  1R4Y A;  1DE3 A;  1LOV A;  1RGH A;  1JBT A;  5RNT A;  1RTU A;  1BRN L;  1RCL A;  3KCH A;  2KF6 A;  1BSE A;  1B2X A;  1JBS A;  3SYU A;  2AAD A;  4GHO A;  1X1U A;  1TRP A;  3GSP A;  1YGW A;  1X1Y A;  3AGO A;  1B3S A;  2GSP A;  8RNT A;  1BGS A;  2SAR A;  3URP A;  4GSP A;  6GSP A;  5BU4 A;  1GOU A;  2HOH A;  1RLS A;  4HOH A;  1UCL A;  2KF4 A;  1TRQ A;  1BIR A;  1BSC A;  3DGY A;  4HAA A;  1JBR A;  1GOV A;  1RGC A;  3DH2 A;  4BIR A;  3AHW A;  2F5M A;  1GSP A;  2ZA4 A;  1RGL A;  2F56 A;  1UCJ A;  1FUS A;  4J5G A;  1I3I A;  1I2E A;  1RDS A;  1BVI A;  1T2H A;  1GMQ A;  2F5W A;  1BUJ A;  1RGF A;  7GSP A;  1GMP A;  1RN4 A;  1I70 A;  3WR2 A;  2RBI A;  2RNT A;  2BIR A;  1YVS A;  1RSN A;  1X1W A;  1B2Z A;  1BNJ A;  2F4Y A;  1BRS A;  1MGW A;  1AY7 A;  1BNF A;  5HOH A;  1IYY A;  3Q3F A;  1LOW A;  9RNT A;  1RHL A;  1GMR A;  1I0X A;  1I2G A;  2KF3 A;  1BSD A;  1LNI A;  7RNT A;  1BSB A;  1T2I A;  1I3F A;  1RNB A;  2AAE A;  1BAN A;  1BOX A;  1A2P A;  1RNT A;  6RNT A;  1I0V A;  1FW7 A;  1BAO A;  1RGA A;  1FZU A;  5BIR A;  1BRI A;  1BRK A;  1C54 A;  1B2M A;  1BRJ A;  3WHO A;  3BIR A;  1FYS A;  3D5I A;  1B21 A;  1B27 A;  1FUT A;  1Q9E A;  1UCK A;  3RNT A;  1BNS A;  3AGN A;  1I8V A;  3BU4 A;  1BNE A;  1RN1 A;  2KF5 A;  3HOH A;  1LOY A;  1AQZ A;  1B20 A;  1RCK A;  1RGG A;  4BU4 A;  1RGE A;  1HYF A;  1DET A;  1B2U A;  2KAA A;  1MGR A;  1BRG A;  1ZGX A;  1SAR A;  1B2S A;  1PYL A;  1RGK A;  1GOY A;  3D5G A;  3A5E A;  4RNT A;  1BU4 A;  1CH0 A;  2C4B A;  3D4A A;  1BNR A;  1BNI A;  1RMS A;  3AHS A;  1UCI A;  1HZ1 A;  2BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...