1GOYA

Hydrolase(endoribonuclease)ribonuclease bi(g specific endonuclease) (e.c.3.1.27.-) complexed with guanosine-3'-phosphate (3'-gmp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
molecule tags Hydrolase
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1goyA00
3DGYA 1BRSA 1RHLA 1RSNA 1BRJA 1BNIA 2AAEA 1YGWA 4RNTA 1RGCA 1UCKA 1A2PA 1BOXA 1B3SA 1I3IA 1BRNL 1B27A 1UCLA 2KF5A 1FUTA 1JBSA 2KF4A 6RNTA 7GSPA 3AGNA 1GMQA 1T2HA 2KF6A 3D5IA 1FW7A 1GOYA 9RNTA 1RCLA 1JBTA 3BIRA 2F5WA 1MGRA 1YNVX 2F5MA 4GSPA 1BNFA 3BU4A 2SARA 1BIRA 1BRKA 1X1XA 1BSBA 1LOVA 1LNIA 2HOHA 3Q3FA 1BANA 1RGAA 2KF3A 1DE3A 1AY7A 5HOHA 1GOVA 1I3FA 1SARA 3SYUA 1IYYA 1RCKA 1RLSA 1BAOA 3KCHA 1UCJA 1I0VA 4GHOA 3D5GA 1BRHA 4HAAA 2F56A 1B2XA 7RNTA 1RGFA 1TRPA 2BIRA 1BNGA 1RN4A 5GSPA 2BU4A 3GSPA 1RGGA 3AHSA 1B20A 1I8VA 1LOWA 1PY3A 4HOHA 1X1WA 2GSPA 1FYSA 1RGEA 1B2SA 1GMPA 1PYLA 3WR2A 1I2EA 4BIRA 5RNTA 1B21A 1FUSA 2RNTA 1MGWA 1BUJA 4J5GA 1I0XA 1BNJA 3WHOA 8RNTA 1BU4A 1RNTA 1Q9EA 2AADA 1BNRA 1I70A 1T2IA 1RGHA 1FZUA 1RN1A 1TTOA 1RTUA 1ZGXA 1GOUA 1DETA 3AGOA 3HOHA 1HYFA 2F4YA 3RNTA 3D4AA 1BSCA 1BNEA 1YVSA 1BRIA 1LOYA 3URPA 4BU4A 1I2GA 1RDSA 4J5KA 1LRAA 1B2MA 1BSAA 1AQZA 1RGKA 2KAAA 3A5EA 1BRGA 1R4YA 5BIRA 6GSPA 1X1YA 1CH0A 1X1UA 1BGSA 3DH2A 1UCIA 1B2UA 1HZ1A 1RMSA 1BSDA 1BSEA 1TRQA 1I2FA 3AHWA 1RGLA 1BNSA 1GSPA 1BVIA 1GMRA 2C4BA 2RBIA 1C54A 5BU4A 1B2ZA 2ZA4A 1RNBA 1JBRA 1G02A
chains in the Genus database with same CATH superfamily
1RHLA 1ZS7A 3D3LA 2K3DA 2XRXB 1S5AA 1FGMA 2E2UA 5CXOA 5AIIA 2W04A 3GZXB 2D42A 3EN8A 1T5YA 3OV4A 2OOVC 1SJWA 3OW22 4N6UA 3K7CA 1I3IA 3DY5A 4LYLB 2CW9A 3E99A 2ZHXB 1B27A 1UCLA 4L7KA 4FMDA 1FUTA 1D6UA 1LQGC 3FF2A 3UL6A 5G1KA 3J7Yd 4HM5B 4X2OA 2MC8A 1OHOA 4G1MB 7GSPA 2R41A 1K9M4 4DKIA 3QK9A 3WOFB 1U5OA 2BO9B 3DGLA 3FH1A 4EW5A 2L1SA 3DUKA 3UB1A 1W7CA 1RKYA 4LSOA 1VQL3 1O7HB 1JBTA 1RCLA 1O7WB 3MWZA 5TGNA 5AEUB 3FLJA 4MMZB 3BU4A 4R80A 5G1LA 3NBJA 2PZVA 4MEIA 1L5GB 1MOLA 3I563 2PNCA 1K41A 3WDGB 3DGNA 3KE7A 3LTBA 1W02A 2HOHA 3NBBA 1JB2A 1RGAA 1IV9A 2HMKB 1I3FA 3GZRA 1Q814 1W2ZA 1IYYA 3Q90A 1UUVB 1UCJA 4O8SA 1V57A 1I0VA 4KFFA 3CNMA 5AIGA 1OHSA 1YGEA 3D5GA 4HAAA 5G2GA 1VQ53 1LOXA 1JZDA 1TRPA 1AR0A 1GD3A 1RN4A 1STDA 2W56B 1YI23 3I0YA 3N54B 3X3ZA 2XSHB 3AHSA 3EB8A 4FCJA 3WA2X 1LOWA 1STFI 2Z76A 1W4NA 1X1WA 2XFSA 3LZAA 3D9RA 1SIIA 1GMPA 4CDLA 3WR2A 4O3VA 1I2EA 2H0IA 2M7OA 3EE1A 4MJDA 5STDA 3TDGA 5IERA 3F14A 1IQXA 1EUIC 1BUJA 5IG3A 1ROVA 1EEJA 1I0XA 1QVG2 3F8XA 3G4S3 1N5HA 1RNTA 3ALAA 1EQKA 1Q9EA 3LTDA 4HM4B 1I70A 1IQ8A 3VF1A 1FZUA 2XEPA 3H51A 2Z6BA 3KKGA 1AVLA 2JQ5A 1ZGXA 1ISKA 3X40A 3K9MC 5AEWB 3AGOA 2KCDA 2YFIB 3AMOB 3HOHA 3NV0B 2BNGA 3RNTA 2XH9A 4GL6A 3DM8A 5IEPA 1OPYA 4FR9A 1TFOA 1BNEA 4FCZA 3MSOA 1GY6A 1F8NA 4NHFA 3MHEA 3UJMA 2A15A 1OHPA 1UGIA 1V58A 2HMMB 4R4KA 3O8YA 1BRGA 1R4YA 3WODG 2GU3A 6GSPA 3JVCA 2F99A 4HM3B 1B2UA 3CCR3 2F86B 1TUHA 2GEXA 5IENA 4N6TA 3EX9A 3ROBA 1VQ93 3D79A 5BVBA 3G16A 1O7GB 4KVHA 2CFKA 1RGLA 3MG3A 2CFDA 4FMCA 1GMRA 1RNBA 2F98A 3GWRA 1B2ZA 1GS3A 1FGOA 5DRVA 3IPTA 1FUWA 1JBRA 2ML5A 1BRSA 3X41A 4XM4A 3CCL3 1CYUA 3KFQC 4RNTA 3CCJ3 1N9EA 1ZX2A 2XSOB 4MMYB 1PFPA 2WGOA 2Z77A 1W6YA 1NNVA 2GBXB 3B8LA 3F8HA 5CF1A 3DGOA 6STDA 2KXGA 3CCE3 1B3SA 4XDWA 3VGNA 3X3YA 2Z7AA 1BRNL 1IVUA 1NDOB 4EV5A 5IEOA 3CCM3 3NM7A 3DZLA 3SX1A 3F7XA 1IT7A 1WTHA 2XGLA 4NPBA 5JPPA 1GMQA 2C10A 1VQO3 2KF6A 1AVKA 1RRLA 1GOYA 1Q7HA 1FGQA 1VQK3 3PXMA 1QALA 3EF8A 3SXXA 2F5WA 1OF5B 1YNVX 2INXA 4GSPA 3ZG0A 4J8TA 3G713 3S67A 1YHQ3 4WFOA 2P05A 3T0UA 5CLKA 1OGZA 5AI1A 2CG1A 1BRKA 1US1A 3NHXA 4LZIA 1LOVA 2P0MA 1A90A 5M19A 1DVCA 1IK3A 2H0GA 2KF3A 2CX0A 5HOHA 5JPUA 1DE3A 1G96A 1SARA 1O7MB 3GAXA 5D83A 2GEYA 3BB9A 1BAOA 2O9UX 3N9HA 2Q07A 1MWUA 1R4CA 3FSDA 3FGYA 4GHOA 1BRHA 5ELUA 1DMMA 1B2XA 1NB3I 1G0TA 4HM0B 2E2TA 5AIFA 2C11A 1O7NB 7RNTA 5GSPA 4HZBB 3LXUX 2BU4A 3STDA 1FGTA 3ER7A 4BL3A 3NUVA 1NO3A 4WYKA 4HOHA 3U1WA 4R9KA 2XGNA 1Q40A 5DREA 2RFRA 1B2SA 1M1K4 1IT8A 3CNXA 1IQYA 4BIRA 5LC6A 5RNTA 3CD63 2Y74A 3NXJA 1FUSA 4STDA 4XB5A 3G6E3 3NM2A 1MGWA 4R1KA 1MWTA 2YX9A 3ZG5A 1K8A4 4FCMA 3WHOA 2J8XB 1JNQA 1OACA 5CF2A 2AADA 4X2HA 2B1XB 2P38A 1BNRA 1N8R4 4HJLB 4EYCA 2P09A 2QEX3 4HZ9B 2OQEA 3T8NA 1SQWA 1VZZA 1GY7A 3FG4A 2R4IA 1HYFA 2F4YA 4R9LA 4L8OA 3JUMA 3CXC2 3SOYA 1DMNA 1YVSA 3CMA3 3MKIA 5A0OB 1I2GA 1UW1A 4J5KA 2IUJA 2XFTA 2OOVA 1LRAA 1A2KA 1N8QA 3PYJA 1RJOA 4HM8B 4KZ1A 2KAAA 3A5EA 1M904 4XBTA 3KSPA 5BIRA 1FGRA 1SPUA 1CH0A 1W6GA 3SLUA 2B24B 1BGSA 1IDPA 1E3RA 1IVXA 3PCSA 1BSEA 2BMQB 1TRQA 1I2FA 5AYSC 3MPHA 1LNHA 1QAKA 3LMLA 1Q864 3UL5A 3RGRA 2C4BA 2YFLB 1EG9B 1YIJ3 2BT3A 1KC84 1DMQA 2ZA4A 1C7HA 1JB4A 4CPKA 1LXEA 2RCDA 3HIGA 1NWWA 3JUPA 3KSED 2LYXA 3DGYA 4O02B 1BRJA 2AAEA 3HZPA 2CFGA 4KFEA 1RGCA 2CK3H 2CWUA 3K0ZA 1VQ43 4JRFA 3MG1A 3OWSA 4N6OB 2H0HA 3ZFZA 1BOXA 2WGQA 4ILFA 1Q824 4AEQA 2KF5A 3EQQB 3SOAA 1JBSA 4LMIA 3Q2PA 2BHMA 1CYVA 6RNTA 3CPW2 1OH0A 1N9JA 3OX9A 1SIHA 1GD4A 3BLZA 1A67A 1D6YA 2ML6A 3AGNA 2CH9A 1T2HA 3PS8A 7STDA 1QAFA 3NQYA 3D5IA 2CIUA 1FW7A 2CG0A 2L4VA 4RBNA 3Q1CA 2UUGC 3WOEB 4N6V0 1MGRA 1ASKA 1UI8A 1GY5A 2F5MA 2HMLB 2IUKA 3GZYB 4KFDA 1KQS2 4LEHA 3I553 3S5CA 2ZDJA 1K734 1EA2A 1JV2B 5IG0A 3RDEA 1Q42A 1BSBA 1X1XA 4N3VA 1LNIA 5D81A 3KIIA 3DGMA 1OCVA 3K5TA 3Q3FA 1BANA 4HM2B 1AY7A 3OWUA 3OWYA 3V98A 3SYUA 4FMAA 4HKVB 1M1XB 1RCKA 1JKGA 1RLSA 3H3HA 3SEDA 1UDII 1W01A 3RGAA 2W9QA 3EJVA 3BNBA 2F56A 2QA43 1YJ93 1RGFA 4EXRA 2BIRA 1BNGA 1RRHA 3FF0A 4ZM8A 2IMJA 4EV2A 5BXQA 4TX4A 4MMXB 5LC7A 1YVBI 4IIAA 2HMNB 3IJEB 2OTJ3 1I8VA 5IW9A 1NB5I 1TJDA 1UUWB 4FMBA 1VQP3 2WOHA 3B4OA 1KWIA 4XDVA 1IVWA 2E2VA 1RGEA 2GSPA 4I5QA 1VQ63 1KSIA 3V92A 4K1VA 1IVVA 3S29A 2KRTA 3LTAA 4NREA 8CHOA 2OTL3 2RNTA 3KZTA 1MWSA 4ORLA 2WO0A 4GB5A 5KP1A 5EEOA 3SVAA 5IG4A 1BU4A 3JUNA 4CCVA 1MWRA 1E97A 1QMAA 2CWVA 3S27A 4EC6A 1FA3A 2GU1A 1RGHA 3FG3A 1Y4KA 4K61A 1RTUA 1JN5A 2IYJA 1GOUA 3PGBA 1DETA 4RNYA 4LGQA 1W6CA 1O7PB 3FKAA 5IG5A 4H61A 2O3OA 3CC73 4OK0A 1LOYA 1WMOA 3CC23 4BU4A 4N6NB 4H3UA 3GZBA 1UUGB 1CQSA 1WMNA 2HMOB 3V99A 1BSAA 1LQMB 1W2B2 3LYGA 1RGKA 3CME3 4BL2A 3EBYA 2IY2A 3IMAB 4CJNA 1KD14 1D6ZA 2W56A 2I9WA 1M9GA 3DH2A 1BUQA 1HZ1A 2SBLA 1A2VA 1AV4A 1BSDA 1DVDA 3HI7A 5EQLA 1Q7Y4 2HMJB 2BMRB 1UI7A 2RGQA 1W5ZA 2CC3A 3HIIA 1VQN3 1BNSA 2D1WA 4N6LA 2CFWA 3LTCA 5BU4A 4AKYA 4K1UA 1T3BA 3T8UA 2W2CA 1JJ22 1RSNA 3JUOA 1BNIA 3N8BA 1YGWA 3FZWA 3X3XA 1DYUA 1JN5B 2FNQA 5IF6A 3X42A 1UCKA 1A2PA 2XR8B 4EBGA 2K54A 2UGIA 4QWTA 1NU3A 4WYKB 2QGUA 2JDIH 1IV7A 3AMOA 3NV0A 3UNLA 1LVNA 1Q40B 1ROAA 4N6MA 3FG1A 2KF4A 1E3VA 5M1AA 3JUQA 1ULIB 3CCV3 1K28A 3PCRA 3DXOA 1HKXA 5HGRA 2Y73A 3CPOA 4BTYA 5EVHA 9RNTA 3M8CA 2BMOB 3A76A 3BIRA 3CCQ3 3CCU3 5FGOA 1U8CB 1BNFA 3EBTA 4KT3B 3F40A 4JF8A 1TP6A 2SARA 4Q53A 4BTWA 3U97A 3FCSB 3CCS3 5ELJA 1BIRA 3NX0A 2LQVA 1EKMA 1PU4A 1NJI4 3DMCA 4WHAA 2IA7A 1GOVA 1ULJB 1OUNA 3LT8A 3EHCA 3KCHA 2UX0A 1YIT3 3BNCA 1W00A 4XBYA 1CEWI 2W9PA 3S28A 5KP4A 1TU5A 3GSPA 2RSXA 1RGGA 2GBWB 3MG2A 1B20A 2CWTA 4IT7A 4OUQA 2OWPA 4I4KA 4J9AA 2ZL8A 1PY3A 2K0MA 5JBSA 4RZMA 4HVNA 1JRQA 1FYSA 1PYLA 5AYRB 1YJW3 1VQ83 5I97A 3EC9A 1B21A 2FXTA 1WMPA 1UGHI 1VQ73 3NBRA 4HBRA 4J5GA 5M18A 2P0XA 4AKZA 1BNJA 1J2BA 8RNTA 1YJN3 1WNHA 3MYTA 1Z1SA 3B7CA 1OF5A 1N5PA 1OGXA 5FW5A 3HX8A 5KP3A 1T2IA 1TIJA 3F9SA 4L8PA 1RN1A 1TTOA 1WQLB 4PEJA 4XBXA 3WA3A 2YFJB 1RN7A 5CK6A 2W03A 4BTXA 2GXFA 4O2HA 1VQM3 3CU3A 3WMDA 3VSYA 3F7SA 1VQQA 3D4AA 3K63A 4HM7B 1JB5A 1HU9A 3LH4A 1BSCA 1QJGA 1JZOA 1BRIA 3OXAA 4WWUC 3URPA 1TFKA 3CC43 2WOFA 3HK4A 1RDSA 2W6JH 4WP5A 3EN1B 4IPBA 1B2MA 1AQZA 4HM1B 2CHCA 3G0KA 3PZWA 3NQZA 2W0QA 4HYZA 3LOYA 1X1YA 4K90B 1X1UA 1QVF2 2V1LA 3KN4A 1UCIA 1RMSA 1V74A 4U13A 3BNDA 2CX1A 3LT9A 1GYBA 1IU7A 2CFLA 3ECFA 4RNZA 2OCTA 3AHWA 3GRDA 1S723 3B4PA 2FGTA 2QIYA 2XF3A 3G8ZA 1GSPA 1BVIA 2RBIA 5AIHA 4HM6B 2OQEC 1C54A 3L0RA 1ZO2A 3QRDA 2STDA 2CKFB 2MF7A 5D82A 1JKGB 1MNLA 4OVMA 3BNEA 1G02A
chains in the Genus database with same CATH topology
3DGYA 1BRSA 1RHLA 1RSNA 1BRJA 1BNIA 2AAEA 1YGWA 4RNTA 1RGCA 1UCKA 1A2PA 1BOXA 1B3SA 1I3IA 1BRNL 1B27A 1UCLA 2KF5A 1FUTA 1JBSA 2KF4A 6RNTA 7GSPA 3AGNA 1GMQA 1T2HA 2KF6A 3D5IA 1FW7A 1GOYA 9RNTA 1RCLA 1JBTA 3BIRA 2F5WA 1MGRA 1YNVX 2F5MA 4GSPA 1BNFA 3BU4A 2SARA 1BIRA 1BRKA 1X1XA 1BSBA 1LOVA 1LNIA 2HOHA 3Q3FA 1BANA 1RGAA 2KF3A 1DE3A 1AY7A 5HOHA 1GOVA 1I3FA 1SARA 3SYUA 1IYYA 1RCKA 1RLSA 1BAOA 3KCHA 1UCJA 1I0VA 4GHOA 3D5GA 1BRHA 4HAAA 2F56A 1B2XA 7RNTA 1RGFA 1TRPA 2BIRA 1BNGA 1RN4A 5GSPA 2BU4A 3GSPA 1RGGA 3AHSA 1B20A 1I8VA 1LOWA 1PY3A 4HOHA 1X1WA 2GSPA 1FYSA 1RGEA 1B2SA 1GMPA 1PYLA 3WR2A 1I2EA 4BIRA 5RNTA 1B21A 1FUSA 2RNTA 1MGWA 1BUJA 4J5GA 1I0XA 1BNJA 3WHOA 8RNTA 1BU4A 1RNTA 1Q9EA 2AADA 1BNRA 1I70A 1T2IA 1RGHA 1FZUA 1RN1A 1TTOA 1RTUA 1ZGXA 1GOUA 1DETA 3AGOA 3HOHA 1HYFA 2F4YA 3RNTA 3D4AA 1BSCA 1BNEA 1YVSA 1BRIA 1LOYA 3URPA 4BU4A 1I2GA 1RDSA 4J5KA 1LRAA 1B2MA 1BSAA 1AQZA 1RGKA 2KAAA 3A5EA 1BRGA 1R4YA 5BIRA 6GSPA 1X1YA 1CH0A 1X1UA 1BGSA 3DH2A 1UCIA 1B2UA 1HZ1A 1RMSA 1BSDA 1BSEA 1TRQA 1I2FA 3AHWA 1RGLA 1BNSA 1GSPA 1BVIA 1GMRA 2C4BA 2RBIA 1C54A 5BU4A 1B2ZA 2ZA4A 1RNBA 1JBRA 1G02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGY A;  1BRS A;  1RHL A;  1RSN A;  1BRJ A;  1BNI A;  2AAE A;  1YGW A;  4RNT A;  1RGC A;  1UCK A;  1A2P A;  1BOX A;  1B3S A;  1I3I A;  1BRN L;  1B27 A;  1UCL A;  2KF5 A;  1FUT A;  1JBS A;  2KF4 A;  6RNT A;  7GSP A;  3AGN A;  1GMQ A;  1T2H A;  2KF6 A;  3D5I A;  1FW7 A;  1GOY A;  9RNT A;  1RCL A;  1JBT A;  3BIR A;  2F5W A;  1MGR A;  1YNV X;  2F5M A;  4GSP A;  1BNF A;  3BU4 A;  2SAR A;  1BIR A;  1BRK A;  1X1X A;  1BSB A;  1LOV A;  1LNI A;  2HOH A;  3Q3F A;  1BAN A;  1RGA A;  2KF3 A;  1DE3 A;  1AY7 A;  5HOH A;  1GOV A;  1I3F A;  1SAR A;  3SYU A;  1IYY A;  1RCK A;  1RLS A;  1BAO A;  3KCH A;  1UCJ A;  1I0V A;  4GHO A;  3D5G A;  1BRH A;  4HAA A;  2F56 A;  1B2X A;  7RNT A;  1RGF A;  1TRP A;  2BIR A;  1BNG A;  1RN4 A;  5GSP A;  2BU4 A;  3GSP A;  1RGG A;  3AHS A;  1B20 A;  1I8V A;  1LOW A;  1PY3 A;  4HOH A;  1X1W A;  2GSP A;  1FYS A;  1RGE A;  1B2S A;  1GMP A;  1PYL A;  3WR2 A;  1I2E A;  4BIR A;  5RNT A;  1B21 A;  1FUS A;  2RNT A;  1MGW A;  1BUJ A;  4J5G A;  1I0X A;  1BNJ A;  3WHO A;  8RNT A;  1BU4 A;  1RNT A;  1Q9E A;  2AAD A;  1BNR A;  1I70 A;  1T2I A;  1RGH A;  1FZU A;  1RN1 A;  1TTO A;  1RTU A;  1ZGX A;  1GOU A;  1DET A;  3AGO A;  3HOH A;  1HYF A;  2F4Y A;  3RNT A;  3D4A A;  1BSC A;  1BNE A;  1YVS A;  1BRI A;  1LOY A;  3URP A;  4BU4 A;  1I2G A;  1RDS A;  4J5K A;  1LRA A;  1B2M A;  1BSA A;  1AQZ A;  1RGK A;  2KAA A;  3A5E A;  1BRG A;  1R4Y A;  5BIR A;  6GSP A;  1X1Y A;  1CH0 A;  1X1U A;  1BGS A;  3DH2 A;  1UCI A;  1B2U A;  1HZ1 A;  1RMS A;  1BSD A;  1BSE A;  1TRQ A;  1I2F A;  3AHW A;  1RGL A;  1BNS A;  1GSP A;  1BVI A;  1GMR A;  2C4B A;  2RBI A;  1C54 A;  5BU4 A;  1B2Z A;  2ZA4 A;  1RNB A;  1JBR A;  1G02 A; 
#chains in the Genus database with same CATH topology
 1RHL A;  1ZS7 A;  3D3L A;  2K3D A;  2XRX B;  1S5A A;  1FGM A;  2E2U A;  5CXO A;  5AII A;  2W04 A;  3GZX B;  2D42 A;  3EN8 A;  1T5Y A;  3OV4 A;  2OOV C;  1SJW A;  3OW2 2;  4N6U A;  3K7C A;  1I3I A;  3DY5 A;  4LYL B;  2CW9 A;  3E99 A;  2ZHX B;  1B27 A;  1UCL A;  4L7K A;  4FMD A;  1FUT A;  1D6U A;  1LQG C;  3FF2 A;  3UL6 A;  5G1K A;  3J7Y d;  4HM5 B;  4X2O A;  2MC8 A;  1OHO A;  4G1M B;  7GSP A;  2R41 A;  1K9M 4;  4DKI A;  3QK9 A;  3WOF B;  1U5O A;  2BO9 B;  3DGL A;  3FH1 A;  4EW5 A;  2L1S A;  3DUK A;  3UB1 A;  1W7C A;  1RKY A;  4LSO A;  1VQL 3;  1O7H B;  1JBT A;  1RCL A;  1O7W B;  3MWZ A;  5TGN A;  5AEU B;  3FLJ A;  4MMZ B;  3BU4 A;  4R80 A;  5G1L A;  3NBJ A;  2PZV A;  4MEI A;  1L5G B;  1MOL A;  3I56 3;  2PNC A;  1K41 A;  3WDG B;  3DGN A;  3KE7 A;  3LTB A;  1W02 A;  2HOH A;  3NBB A;  1JB2 A;  1RGA A;  1IV9 A;  2HMK B;  1I3F A;  3GZR A;  1Q81 4;  1W2Z A;  1IYY A;  3Q90 A;  1UUV B;  1UCJ A;  4O8S A;  1V57 A;  1I0V A;  4KFF A;  3CNM A;  5AIG A;  1OHS A;  1YGE A;  3D5G A;  4HAA A;  5G2G A;  1VQ5 3;  1LOX A;  1JZD A;  1TRP A;  1AR0 A;  1GD3 A;  1RN4 A;  1STD A;  2W56 B;  1YI2 3;  3I0Y A;  3N54 B;  3X3Z A;  2XSH B;  3AHS A;  3EB8 A;  4FCJ A;  3WA2 X;  1LOW A;  1STF I;  2Z76 A;  1W4N A;  1X1W A;  2XFS A;  3LZA A;  3D9R A;  1SII A;  1GMP A;  4CDL A;  3WR2 A;  4O3V A;  1I2E A;  2H0I A;  2M7O A;  3EE1 A;  4MJD A;  5STD A;  3TDG A;  5IER A;  3F14 A;  1IQX A;  1EUI C;  1BUJ A;  5IG3 A;  1ROV A;  1EEJ A;  1I0X A;  1QVG 2;  3F8X A;  3G4S 3;  1N5H A;  1RNT A;  3ALA A;  1EQK A;  1Q9E A;  3LTD A;  4HM4 B;  1I70 A;  1IQ8 A;  3VF1 A;  1FZU A;  2XEP A;  3H51 A;  2Z6B A;  3KKG A;  1AVL A;  2JQ5 A;  1ZGX A;  1ISK A;  3X40 A;  3K9M C;  5AEW B;  3AGO A;  2KCD A;  2YFI B;  3AMO B;  3HOH A;  3NV0 B;  2BNG A;  3RNT A;  2XH9 A;  4GL6 A;  3DM8 A;  5IEP A;  1OPY A;  4FR9 A;  1TFO A;  1BNE A;  4FCZ A;  3MSO A;  1GY6 A;  1F8N A;  4NHF A;  3MHE A;  3UJM A;  2A15 A;  1OHP A;  1UGI A;  1V58 A;  2HMM B;  4R4K A;  3O8Y A;  1BRG A;  1R4Y A;  3WOD G;  2GU3 A;  6GSP A;  3JVC A;  2F99 A;  4HM3 B;  1B2U A;  3CCR 3;  2F86 B;  1TUH A;  2GEX A;  5IEN A;  4N6T A;  3EX9 A;  3ROB A;  1VQ9 3;  3D79 A;  5BVB A;  3G16 A;  1O7G B;  4KVH A;  2CFK A;  1RGL A;  3MG3 A;  2CFD A;  4FMC A;  1GMR A;  1RNB A;  2F98 A;  3GWR A;  1B2Z A;  1GS3 A;  1FGO A;  5DRV A;  3IPT A;  1FUW A;  1JBR A;  2ML5 A;  1BRS A;  3X41 A;  4XM4 A;  3CCL 3;  1CYU A;  3KFQ C;  4RNT A;  3CCJ 3;  1N9E A;  1ZX2 A;  2XSO B;  4MMY B;  1PFP A;  2WGO A;  2Z77 A;  1W6Y A;  1NNV A;  2GBX B;  3B8L A;  3F8H A;  5CF1 A;  3DGO A;  6STD A;  2KXG A;  3CCE 3;  1B3S A;  4XDW A;  3VGN A;  3X3Y A;  2Z7A A;  1BRN L;  1IVU A;  1NDO B;  4EV5 A;  5IEO A;  3CCM 3;  3NM7 A;  3DZL A;  3SX1 A;  3F7X A;  1IT7 A;  1WTH A;  2XGL A;  4NPB A;  5JPP A;  1GMQ A;  2C10 A;  1VQO 3;  2KF6 A;  1AVK A;  1RRL A;  1GOY A;  1Q7H A;  1FGQ A;  1VQK 3;  3PXM A;  1QAL A;  3EF8 A;  3SXX A;  2F5W A;  1OF5 B;  1YNV X;  2INX A;  4GSP A;  3ZG0 A;  4J8T A;  3G71 3;  3S67 A;  1YHQ 3;  4WFO A;  2P05 A;  3T0U A;  5CLK A;  1OGZ A;  5AI1 A;  2CG1 A;  1BRK A;  1US1 A;  3NHX A;  4LZI A;  1LOV A;  2P0M A;  1A90 A;  5M19 A;  1DVC A;  1IK3 A;  2H0G A;  2KF3 A;  2CX0 A;  5HOH A;  5JPU A;  1DE3 A;  1G96 A;  1SAR A;  1O7M B;  3GAX A;  5D83 A;  2GEY A;  3BB9 A;  1BAO A;  2O9U X;  3N9H A;  2Q07 A;  1MWU A;  1R4C A;  3FSD A;  3FGY A;  4GHO A;  1BRH A;  5ELU A;  1DMM A;  1B2X A;  1NB3 I;  1G0T A;  4HM0 B;  2E2T A;  5AIF A;  2C11 A;  1O7N B;  7RNT A;  5GSP A;  4HZB B;  3LXU X;  2BU4 A;  3STD A;  1FGT A;  3ER7 A;  4BL3 A;  3NUV A;  1NO3 A;  4WYK A;  4HOH A;  3U1W A;  4R9K A;  2XGN A;  1Q40 A;  5DRE A;  2RFR A;  1B2S A;  1M1K 4;  1IT8 A;  3CNX A;  1IQY A;  4BIR A;  5LC6 A;  5RNT A;  3CD6 3;  2Y74 A;  3NXJ A;  1FUS A;  4STD A;  4XB5 A;  3G6E 3;  3NM2 A;  1MGW A;  4R1K A;  1MWT A;  2YX9 A;  3ZG5 A;  1K8A 4;  4FCM A;  3WHO A;  2J8X B;  1JNQ A;  1OAC A;  5CF2 A;  2AAD A;  4X2H A;  2B1X B;  2P38 A;  1BNR A;  1N8R 4;  4HJL B;  4EYC A;  2P09 A;  2QEX 3;  4HZ9 B;  2OQE A;  3T8N A;  1SQW A;  1VZZ A;  1GY7 A;  3FG4 A;  2R4I A;  1HYF A;  2F4Y A;  4R9L A;  4L8O A;  3JUM A;  3CXC 2;  3SOY A;  1DMN A;  1YVS A;  3CMA 3;  3MKI A;  5A0O B;  1I2G A;  1UW1 A;  4J5K A;  2IUJ A;  2XFT A;  2OOV A;  1LRA A;  1A2K A;  1N8Q A;  3PYJ A;  1RJO A;  4HM8 B;  4KZ1 A;  2KAA A;  3A5E A;  1M90 4;  4XBT A;  3KSP A;  5BIR A;  1FGR A;  1SPU A;  1CH0 A;  1W6G A;  3SLU A;  2B24 B;  1BGS A;  1IDP A;  1E3R A;  1IVX A;  3PCS A;  1BSE A;  2BMQ B;  1TRQ A;  1I2F A;  5AYS C;  3MPH A;  1LNH A;  1QAK A;  3LML A;  1Q86 4;  3UL5 A;  3RGR A;  2C4B A;  2YFL B;  1EG9 B;  1YIJ 3;  2BT3 A;  1KC8 4;  1DMQ A;  2ZA4 A;  1C7H A;  1JB4 A;  4CPK A;  1LXE A;  2RCD A;  3HIG A;  1NWW A;  3JUP A;  3KSE D;  2LYX A;  3DGY A;  4O02 B;  1BRJ A;  2AAE A;  3HZP A;  2CFG A;  4KFE A;  1RGC A;  2CK3 H;  2CWU A;  3K0Z A;  1VQ4 3;  4JRF A;  3MG1 A;  3OWS A;  4N6O B;  2H0H A;  3ZFZ A;  1BOX A;  2WGQ A;  4ILF A;  1Q82 4;  4AEQ A;  2KF5 A;  3EQQ B;  3SOA A;  1JBS A;  4LMI A;  3Q2P A;  2BHM A;  1CYV A;  6RNT A;  3CPW 2;  1OH0 A;  1N9J A;  3OX9 A;  1SIH A;  1GD4 A;  3BLZ A;  1A67 A;  1D6Y A;  2ML6 A;  3AGN A;  2CH9 A;  1T2H A;  3PS8 A;  7STD A;  1QAF A;  3NQY A;  3D5I A;  2CIU A;  1FW7 A;  2CG0 A;  2L4V A;  4RBN A;  3Q1C A;  2UUG C;  3WOE B;  4N6V 0;  1MGR A;  1ASK A;  1UI8 A;  1GY5 A;  2F5M A;  2HML B;  2IUK A;  3GZY B;  4KFD A;  1KQS 2;  4LEH A;  3I55 3;  3S5C A;  2ZDJ A;  1K73 4;  1EA2 A;  1JV2 B;  5IG0 A;  3RDE A;  1Q42 A;  1BSB A;  1X1X A;  4N3V A;  1LNI A;  5D81 A;  3KII A;  3DGM A;  1OCV A;  3K5T A;  3Q3F A;  1BAN A;  4HM2 B;  1AY7 A;  3OWU A;  3OWY A;  3V98 A;  3SYU A;  4FMA A;  4HKV B;  1M1X B;  1RCK A;  1JKG A;  1RLS A;  3H3H A;  3SED A;  1UDI I;  1W01 A;  3RGA A;  2W9Q A;  3EJV A;  3BNB A;  2F56 A;  2QA4 3;  1YJ9 3;  1RGF A;  4EXR A;  2BIR A;  1BNG A;  1RRH A;  3FF0 A;  4ZM8 A;  2IMJ A;  4EV2 A;  5BXQ A;  4TX4 A;  4MMX B;  5LC7 A;  1YVB I;  4IIA A;  2HMN B;  3IJE B;  2OTJ 3;  1I8V A;  5IW9 A;  1NB5 I;  1TJD A;  1UUW B;  4FMB A;  1VQP 3;  2WOH A;  3B4O A;  1KWI A;  4XDV A;  1IVW A;  2E2V A;  1RGE A;  2GSP A;  4I5Q A;  1VQ6 3;  1KSI A;  3V92 A;  4K1V A;  1IVV A;  3S29 A;  2KRT A;  3LTA A;  4NRE A;  8CHO A;  2OTL 3;  2RNT A;  3KZT A;  1MWS A;  4ORL A;  2WO0 A;  4GB5 A;  5KP1 A;  5EEO A;  3SVA A;  5IG4 A;  1BU4 A;  3JUN A;  4CCV A;  1MWR A;  1E97 A;  1QMA A;  2CWV A;  3S27 A;  4EC6 A;  1FA3 A;  2GU1 A;  1RGH A;  3FG3 A;  1Y4K A;  4K61 A;  1RTU A;  1JN5 A;  2IYJ A;  1GOU A;  3PGB A;  1DET A;  4RNY A;  4LGQ A;  1W6C A;  1O7P B;  3FKA A;  5IG5 A;  4H61 A;  2O3O A;  3CC7 3;  4OK0 A;  1LOY A;  1WMO A;  3CC2 3;  4BU4 A;  4N6N B;  4H3U A;  3GZB A;  1UUG B;  1CQS A;  1WMN A;  2HMO B;  3V99 A;  1BSA A;  1LQM B;  1W2B 2;  3LYG A;  1RGK A;  3CME 3;  4BL2 A;  3EBY A;  2IY2 A;  3IMA B;  4CJN A;  1KD1 4;  1D6Z A;  2W56 A;  2I9W A;  1M9G A;  3DH2 A;  1BUQ A;  1HZ1 A;  2SBL A;  1A2V A;  1AV4 A;  1BSD A;  1DVD A;  3HI7 A;  5EQL A;  1Q7Y 4;  2HMJ B;  2BMR B;  1UI7 A;  2RGQ A;  1W5Z A;  2CC3 A;  3HII A;  1VQN 3;  1BNS A;  2D1W A;  4N6L A;  2CFW A;  3LTC A;  5BU4 A;  4AKY A;  4K1U A;  1T3B A;  3T8U A;  2W2C A;  1JJ2 2;  1RSN A;  3JUO A;  1BNI A;  3N8B A;  1YGW A;  3FZW A;  3X3X A;  1DYU A;  1JN5 B;  2FNQ A;  5IF6 A;  3X42 A;  1UCK A;  1A2P A;  2XR8 B;  4EBG A;  2K54 A;  2UGI A;  4QWT A;  1NU3 A;  4WYK B;  2QGU A;  2JDI H;  1IV7 A;  3AMO A;  3NV0 A;  3UNL A;  1LVN A;  1Q40 B;  1ROA A;  4N6M A;  3FG1 A;  2KF4 A;  1E3V A;  5M1A A;  3JUQ A;  1ULI B;  3CCV 3;  1K28 A;  3PCR A;  3DXO A;  1HKX A;  5HGR A;  2Y73 A;  3CPO A;  4BTY A;  5EVH A;  9RNT A;  3M8C A;  2BMO B;  3A76 A;  3BIR A;  3CCQ 3;  3CCU 3;  5FGO A;  1U8C B;  1BNF A;  3EBT A;  4KT3 B;  3F40 A;  4JF8 A;  1TP6 A;  2SAR A;  4Q53 A;  4BTW A;  3U97 A;  3FCS B;  3CCS 3;  5ELJ A;  1BIR A;  3NX0 A;  2LQV A;  1EKM A;  1PU4 A;  1NJI 4;  3DMC A;  4WHA A;  2IA7 A;  1GOV A;  1ULJ B;  1OUN A;  3LT8 A;  3EHC A;  3KCH A;  2UX0 A;  1YIT 3;  3BNC A;  1W00 A;  4XBY A;  1CEW I;  2W9P A;  3S28 A;  5KP4 A;  1TU5 A;  3GSP A;  2RSX A;  1RGG A;  2GBW B;  3MG2 A;  1B20 A;  2CWT A;  4IT7 A;  4OUQ A;  2OWP A;  4I4K A;  4J9A A;  2ZL8 A;  1PY3 A;  2K0M A;  5JBS A;  4RZM A;  4HVN A;  1JRQ A;  1FYS A;  1PYL A;  5AYR B;  1YJW 3;  1VQ8 3;  5I97 A;  3EC9 A;  1B21 A;  2FXT A;  1WMP A;  1UGH I;  1VQ7 3;  3NBR A;  4HBR A;  4J5G A;  5M18 A;  2P0X A;  4AKZ A;  1BNJ A;  1J2B A;  8RNT A;  1YJN 3;  1WNH A;  3MYT A;  1Z1S A;  3B7C A;  1OF5 A;  1N5P A;  1OGX A;  5FW5 A;  3HX8 A;  5KP3 A;  1T2I A;  1TIJ A;  3F9S A;  4L8P A;  1RN1 A;  1TTO A;  1WQL B;  4PEJ A;  4XBX A;  3WA3 A;  2YFJ B;  1RN7 A;  5CK6 A;  2W03 A;  4BTX A;  2GXF A;  4O2H A;  1VQM 3;  3CU3 A;  3WMD A;  3VSY A;  3F7S A;  1VQQ A;  3D4A A;  3K63 A;  4HM7 B;  1JB5 A;  1HU9 A;  3LH4 A;  1BSC A;  1QJG A;  1JZO A;  1BRI A;  3OXA A;  4WWU C;  3URP A;  1TFK A;  3CC4 3;  2WOF A;  3HK4 A;  1RDS A;  2W6J H;  4WP5 A;  3EN1 B;  4IPB A;  1B2M A;  1AQZ A;  4HM1 B;  2CHC A;  3G0K A;  3PZW A;  3NQZ A;  2W0Q A;  4HYZ A;  3LOY A;  1X1Y A;  4K90 B;  1X1U A;  1QVF 2;  2V1L A;  3KN4 A;  1UCI A;  1RMS A;  1V74 A;  4U13 A;  3BND A;  2CX1 A;  3LT9 A;  1GYB A;  1IU7 A;  2CFL A;  3ECF A;  4RNZ A;  2OCT A;  3AHW A;  3GRD A;  1S72 3;  3B4P A;  2FGT A;  2QIY A;  2XF3 A;  3G8Z A;  1GSP A;  1BVI A;  2RBI A;  5AIH A;  4HM6 B;  2OQE C;  1C54 A;  3L0R A;  1ZO2 A;  3QRD A;  2STD A;  2CKF B;  2MF7 A;  5D82 A;  1JKG B;  1MNL A;  4OVM A;  3BNE A;  1G02 A; 
#chains in the Genus database with same CATH homology
 3DGY A;  1BRS A;  1RHL A;  1RSN A;  1BRJ A;  1BNI A;  2AAE A;  1YGW A;  4RNT A;  1RGC A;  1UCK A;  1A2P A;  1BOX A;  1B3S A;  1I3I A;  1BRN L;  1B27 A;  1UCL A;  2KF5 A;  1FUT A;  1JBS A;  2KF4 A;  6RNT A;  7GSP A;  3AGN A;  1GMQ A;  1T2H A;  2KF6 A;  3D5I A;  1FW7 A;  1GOY A;  9RNT A;  1RCL A;  1JBT A;  3BIR A;  2F5W A;  1MGR A;  1YNV X;  2F5M A;  4GSP A;  1BNF A;  3BU4 A;  2SAR A;  1BIR A;  1BRK A;  1X1X A;  1BSB A;  1LOV A;  1LNI A;  2HOH A;  3Q3F A;  1BAN A;  1RGA A;  2KF3 A;  1DE3 A;  1AY7 A;  5HOH A;  1GOV A;  1I3F A;  1SAR A;  3SYU A;  1IYY A;  1RCK A;  1RLS A;  1BAO A;  3KCH A;  1UCJ A;  1I0V A;  4GHO A;  3D5G A;  1BRH A;  4HAA A;  2F56 A;  1B2X A;  7RNT A;  1RGF A;  1TRP A;  2BIR A;  1BNG A;  1RN4 A;  5GSP A;  2BU4 A;  3GSP A;  1RGG A;  3AHS A;  1B20 A;  1I8V A;  1LOW A;  1PY3 A;  4HOH A;  1X1W A;  2GSP A;  1FYS A;  1RGE A;  1B2S A;  1GMP A;  1PYL A;  3WR2 A;  1I2E A;  4BIR A;  5RNT A;  1B21 A;  1FUS A;  2RNT A;  1MGW A;  1BUJ A;  4J5G A;  1I0X A;  1BNJ A;  3WHO A;  8RNT A;  1BU4 A;  1RNT A;  1Q9E A;  2AAD A;  1BNR A;  1I70 A;  1T2I A;  1RGH A;  1FZU A;  1RN1 A;  1TTO A;  1RTU A;  1ZGX A;  1GOU A;  1DET A;  3AGO A;  3HOH A;  1HYF A;  2F4Y A;  3RNT A;  3D4A A;  1BSC A;  1BNE A;  1YVS A;  1BRI A;  1LOY A;  3URP A;  4BU4 A;  1I2G A;  1RDS A;  4J5K A;  1LRA A;  1B2M A;  1BSA A;  1AQZ A;  1RGK A;  2KAA A;  3A5E A;  1BRG A;  1R4Y A;  5BIR A;  6GSP A;  1X1Y A;  1CH0 A;  1X1U A;  1BGS A;  3DH2 A;  1UCI A;  1B2U A;  1HZ1 A;  1RMS A;  1BSD A;  1BSE A;  1TRQ A;  1I2F A;  3AHW A;  1RGL A;  1BNS A;  1GSP A;  1BVI A;  1GMR A;  2C4B A;  2RBI A;  1C54 A;  5BU4 A;  1B2Z A;  2ZA4 A;  1RNB A;  1JBR A;  1G02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...