1GOYA

Hydrolase(endoribonuclease)ribonuclease bi(g specific endonuclease) (e.c.3.1.27.-) complexed with guanosine-3'-phosphate (3'-gmp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
molecule tags Hydrolase
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1goyA00
1HZ1A 3DH2A 1GSPA 1LOWA 1I2GA 3AGOA 3DGYA 1B20A 1BSEA 1CH0A 4HAAA 1B2ZA 1I70A 1UCKA 1GOYA 2KF6A 2RNTA 3AHSA 1I0VA 3RNTA 1SARA 3D5GA 1RCKA 3D4AA 2HOHA 4HOHA 1LOYA 4BU4A 1BU4A 1JBRA 1BNIA 1BNEA 2ZA4A 4J5GA 1B2UA 1YNVX 1GMQA 1GOUA 1BRKA 1I2FA 1MGRA 1I0XA 1RNTA 3BU4A 3GSPA 1FYSA 1T2IA 5BIRA 1RN1A 1DE3A 1BSBA 5GSPA 1RGLA 2F4YA 3Q3FA 2KF3A 1FUTA 1B27A 1X1WA 1BNGA 1TRQA 8RNTA 1JBSA 1RGEA 6RNTA 1B2MA 1LNIA 1RDSA 2KAAA 4RNTA 2F56A 1UCLA 1LOVA 3WR2A 1BANA 1BVIA 3D5IA 1MGWA 1UCJA 1I3FA 1RTUA 2SARA 4GSPA 1BNRA 1T2HA 1RN4A 2F5WA 1HYFA 1FW7A 1B2SA 1BNFA 9RNTA 1AQZA 1RSNA 1TTOA 2KF4A 1FUSA 4GHOA 3URPA 3SYUA 2KF5A 1A2PA 1BRJA 1I2EA 6GSPA 2BIRA 1TRPA 1X1YA 1BNJA 1BSAA 1DETA 1X1XA 7GSPA 1BIRA 5BU4A 1FZUA 1IYYA 1B2XA 1B3SA 3BIRA 1I8VA 1BRHA 1RMSA 1RGFA 1BUJA 4BIRA 1C54A 1BAOA 1RLSA 1PY3A 1GMPA 2F5MA 5HOHA 1RCLA 1YGWA 3HOHA 1G02A 1BRSA 2GSPA 3KCHA 1BGSA 1I3IA 1R4YA 2AAEA 1RHLA 1B21A 5RNTA 1BRIA 7RNTA 1RGAA 1GOVA 1YVSA 1RGKA 4J5KA 1RGCA 2AADA 1ZGXA 1BRGA 1UCIA 1RNBA 3A5EA 1BSDA 1BOXA 1BSCA 1BNSA 2RBIA 1BRNL 1AY7A 1X1UA 1RGHA 1PYLA 1GMRA 1Q9EA 2BU4A 2C4BA 1JBTA 3AGNA 1LRAA 3WHOA 1RGGA 3AHWA
chains in the Genus database with same CATH superfamily
3SEDA 3V98A 2W03A 1OHSA 1I2GA 1ZS7A 2Z6BA 3AGOA 4EC6A 5LC6A 2QA43 4K90B 3HZPA 4EW5A 1CH0A 4AKZA 4AKYA 1LQGC 1UW1A 1IDPA 1YHQ3 2GBXB 5A0OB 1CEWI 3X42A 1GOYA 2Q07A 1SARA 3D5GA 1RCKA 3N54B 1VQ63 3D4AA 5KP1A 3VF1A 3FG3A 4BTYA 1YI23 3QRDA 2CFLA 5TGNA 1ASKA 5EQLA 3CCR3 5KP4A 1BNEA 4MJDA 4J5GA 1UUWB 2P09A 1GOUA 5FW5A 1RNTA 2IMJA 1I0XA 3GSPA 2HMLB 3F7XA 3LYGA 4DKIA 1OPYA 1T2IA 2P38A 3MWZA 2LYXA 1RN1A 3KN4A 4O3VA 2K54A 4HKVB 2FGTA 1RGLA 2CFWA 3BB9A 2KF3A 2CHCA 1X1WA 3FG4A 8RNTA 1JBSA 3NHXA 1EEJA 1ROAA 1UUVB 3DMCA 3FGYA 3QK9A 3VSYA 1VQM3 1A90A 2CK3H 4L8PA 1DMQA 1LXEA 3HIIA 4ORLA 4HBRA 1EQKA 5D81A 1EG9B 3MG1A 1M1K4 4NHFA 3GZRA 3Q1CA 3EJVA 1QAFA 1MGWA 3D5IA 3ZG0A 5IG4A 2R4IA 2D1WA 2L1SA 2L4VA 1OF5B 4QWTA 1I3FA 2PNCA 1TUHA 1BNRA 4I4KA 5IENA 1IQYA 2B24B 1S723 1Q42A 4XBYA 1RN4A 2GBWB 1IK3A 5IF6A 1FW7A 1ROVA 2W04A 2O9UX 5HGRA 5CK6A 2B1XB 3SXXA 1O7MB 5JPUA 3KZTA 3FF2A 1AVKA 4N6TA 3CC73 4K61A 1E97A 5IERA 1OH0A 3EF8A 3JUQA 4KZ1A 3FLJA 1DETA 3UNLA 1K734 3CC43 7GSPA 4WFOA 1GD4A 1FZUA 5BU4A 1YVBI 3PS8A 3B4PA 1QVF2 1TFOA 4EV5A 3CD63 3JUPA 1MWTA 3G0KA 3IJEB 3CC23 4RBNA 1FA3A 1O7GB 2W56A 5CF2A 1J2BA 4OUQA 2CH9A 1JZOA 1WMOA 3AMOA 1RCLA 2CKFB 6STDA 4LEHA 1YGWA 1SIIA 5ELJA 3BNBA 2GSPA 3RGAA 3KCHA 3T8NA 1R4YA 2A15A 3HK4A 1IV9A 1N5HA 4IIAA 2JDIH 3GZBA 1STFI 1RGAA 4BTWA 3DGNA 2MC8A 3NV0A 2KCDA 1JJ22 1GOVA 1WTHA 3AHWA 1CYUA 1BRGA 2YX9A 1IT7A 5AIHA 5D82A 2LQVA 4EBGA 1RNBA 1OHPA 5BVBA 1BNSA 4KFEA 1AY7A 2UX0A 8CHOA 3GZYB 1ZO2A 3OWYA 4PEJA 1N9EA 1RGHA 1GMRA 2Z77A 4HM2B 3U1WA 1JBTA 4WYKA 4N6OB 5AYRB 2CIUA 3FZWA 4TX4A 3SLUA 1K9M4 3DH2A 1UDII 4CPKA 3A76A 1YIJ3 4HZ9B 1D6UA 1B20A 3O8YA 1JB4A 3BNEA 4HYZA 4I5QA 4MMZB 3MPHA 1AR0A 2CC3A 2I9WA 2QIYA 1GS3A 4HM3B 3CPOA 4XBTA 2KRTA 4HM7B 3MYTA 3PZWA 1UCKA 4RZMA 2WGOA 1WMNA 4CDLA 3AHSA 4HM6B 1VQO3 4RNYA 3WOEB 3DZLA 1W01A 1DVCA 1ZX2A 3E99A 3EC9A 1WMPA 1YJW3 2OQEA 1JKGB 1DMNA 2XF3A 5FGOA 3CU3A 1MGRA 3BU4A 3LTCA 2PZVA 3F7SA 2KXGA 4N6V0 5BIRA 2WOFA 3LMLA 2INXA 3CCE3 5G1KA 3EE1A 3G4S3 3CMA3 3PXMA 2OTJ3 1LNHA 1BSBA 3LTBA 1JB2A 5GSPA 3STDA 2F4YA 2W9PA 3HI7A 5JPPA 4BL2A 1FUTA 2F98A 1B27A 2H0IA 1TRQA 1W6GA 3SX1A 3JUOA 4OK0A 3LOYA 4G1MB 6RNTA 1W6YA 1JN5B 1LNIA 2CFGA 3FSDA 1G0TA 1EUIC 4IT7A 4FCZA 1RN7A 2M7OA 3EQQB 2F56A 1TIJA 4K1UA 3U97A 3WMDA 3WR2A 5CF1A 3GZXB 1BVIA 1W6CA 3L0RA 3NBRA 1Q40B 1T5YA 2F99A 3F9SA 4O02B 3MKIA 5D83A 1RTUA 4H61A 1OHOA 4WHAA 4AEQA 3X3YA 3S5CA 4LGQA 1K41A 3RGRA 1T2HA 3ROBA 2F5WA 3NXJA 3M8CA 3GAXA 1KSIA 3WA2X 3WA3A 1TTOA 1W4NA 2KF4A 1WQLB 4GHOA 3SOAA 1G96A 3S29A 1ISKA 1GYBA 3CCU3 1E3RA 2V1LA 1I2EA 3PYJA 1OACA 1PU4A 2Y74A 3NM2A 1F8NA 1V74A 3EN1B 3WODG 1PFPA 1MWUA 1FUWA 1B2XA 3F14A 4WP5A 1A2VA 2RSXA 1KWIA 3CNMA 3NUVA 3H51A 1I8VA 1BRHA 1RMSA 3NV0B 1BUJA 3F8HA 1BAOA 3N9HA 4KVHA 5M18A 1RRHA 3EB8A 3OX9A 2XGLA 2OOVC 5CXOA 3CXC2 3CCJ3 1G02A 4WWUC 5AEUB 4JRFA 1NWWA 1ULJB 2AAEA 3IMAB 1B21A 3X41A 3LTDA 1YIT3 3KKGA 1D6YA 4R4KA 3WDGB 3G6E3 5G1LA 3KSED 1Q7Y4 1LOXA 4J5KA 4X2HA 1MNLA 2AADA 1NO3A 1QMAA 3SOYA 3CCL3 5IEOA 1W00A 1IVVA 1SQWA 2BT3A 5G2GA 1BRNL 2C10A 3CCM3 3KE7A 1WNHA 1X1UA 3KSPA 2ML5A 1T3BA 3JVCA 2W9QA 2YFLB 3AGNA 2E2UA 1LRAA 1FGRA 4XM4A 1QJGA 2C11A 1LOWA 2CFKA 1GY7A 1Q864 3ECFA 1TU5A 1BSEA 3PCRA 4FR9A 2W0QA 4BTXA 1MOLA 2CG0A 4FMCA 4HVNA 1B2ZA 4R9LA 1SPUA 2HMNB 1I70A 4FCJA 2ZHXB 2KF6A 4GL6A 3X40A 2ZL8A 1W02A 2RNTA 3MG3A 5I97A 3RNTA 4XDVA 2K0MA 5IG3A 5BXQA 4HOHA 1YJ93 1FGMA 3KFQC 4BU4A 1A67A 1BU4A 1CYVA 2UUGC 2XH9A 1JBRA 1BNIA 4GB5A 3X3ZA 3FG1A 1JV2B 1YNVX 2OCTA 1GMQA 1IVUA 3DGMA 5M1AA 1QALA 1M9GA 3ER7A 1DE3A 1RKYA 1VZZA 3MHEA 1NB5I 1US1A 1K28A 2ML6A 1R4CA 1AVLA 1FGTA 1FGOA 1FGQA 1SIHA 1IQ8A 1Z1SA 3PGBA 5AEWB 4FMDA 1OF5A 1BNGA 3WOFB 4N6LA 2BMOB 1NJI4 3NQYA 4OVMA 2OTL3 1UI8A 5JBSA 2BHMA 5M19A 5AIIA 4EXRA 3G8ZA 4Q53A 1LOVA 5AYSC 1HKXA 3LZAA 2Y73A 4GSPA 3MG2A 3VGNA 1OGZA 2YFIB 2GEYA 1O7NB 2RFRA 1B2SA 1BNFA 3LT9A 3T8UA 1Y4KA 1AQZA 1EA2A 1IVWA 2RGQA 3URPA 2HMKB 1W2B2 2STDA 4LSOA 1A2PA 4U13A 2CX1A 2XFSA 2CW9A 3JUNA 1CQSA 1SJWA 3N8BA 5DREA 3I553 4XB5A 1V58A 2WGQA 1BNJA 2GU1A 1N8R4 1UUGB 2BNGA 1VQP3 3BIRA 4LZIA 3T0UA 3B4OA 4N6UA 2CX0A 2HMJB 2XSOB 3EX9A 4HM1B 2RCDA 3ALAA 4FMBA 3K0ZA 3JUMA 4MMXB 1L5GB 1GD3A 3ZFZA 3G713 1VQ83 1PY3A 4J9AA 4BL3A 1STDA 3CPW2 1GMPA 5HOHA 4HM4B 5IW9A 5DRVA 3CCS3 3HX8A 1VQN3 1MWRA 1BUQA 3B7CA 2HMOB 2J8XB 3HOHA 3OV4A 1BGSA 1DVDA 1RHLA 3DY5A 5LC7A 5RNTA 2ZDJA 5IG0A 1NNVA 3DM8A 4HM5B 2FXTA 3ZG5A 1GY6A 2XFTA 1RGCA 2W56B 3LH4A 1UCIA 4L8OA 3D79A 3AMOB 3B8LA 3A5EA 1BSDA 1BOXA 1BSCA 2RBIA 1C7HA 1VQQA 2CWVA 1UGIA 3DGOA 3NM7A 1M1XB 1LVNA 1Q814 1PYLA 2GU3A 1Q9EA 2UGIA 3LXUX 3V92A 2H0HA 2C4BA 2OQEC 1N9JA 1S5AA 4MEIA 1UGHI 7STDA 3WHOA 1RGGA 2XEPA 1HZ1A 3BLZA 1GSPA 3DGYA 2WOHA 3CNXA 1W2ZA 1OCVA 2XRXB 1JKGA 5IEPA 2WO0A 1JB5A 1DMMA 3Q2PA 4R1KA 1YJN3 4N3VA 2IY2A 1YGEA 4HAAA 1VQ53 1TP6A 3HIGA 3I0YA 3NBBA 2QEX3 3GWRA 3Q90A 2CFDA 1TFKA 4LMIA 1KQS2 3CCV3 2XGNA 5IG5A 3FCSB 4K1VA 4N6MA 4CJNA 2IUJA 2IYJA 4WYKB 1I0VA 2GEXA 2HMMB 2W6JH 3K7CA 2BO9B 3BNCA 4J8TA 2HOHA 1VQ73 3D3LA 3NX0A 4X2OA 1IVXA 1HU9A 1LOYA 4ILFA 2CWTA 3DGLA 3NQZA 1NDOB 3RDEA 2ZA4A 1TJDA 1B2UA 1JN5A 2P0MA 1I2FA 2GXFA 1BRKA 3OXAA 4XBXA 2W2CA 5AIGA 1FYSA 3FF0A 4R80A 4FCMA 1UI7A 1U8CB 3SVAA 2P0XA 2XSHB 1N5PA 3DXOA 4IPBA 4L7KA 2MF7A 1KD14 3G16A 4N6NB 1Q40A 3Q3FA 1EKMA 4EYCA 4KFFA 3FKAA 3DUKA 5AI1A 1RGEA 1B2MA 3OW22 4HM0B 4MMYB 3S27A 1RDSA 1W5ZA 1Q7HA 3K5TA 2KAAA 4RNTA 5ELUA 5STDA 1W7CA 3H3HA 1VQK3 1KC84 1NU3A 1OGXA 2E2VA 1UCLA 5EVHA 3NBJA 3OWSA 1BANA 3I563 3IPTA 4H3UA 4STDA 3S67A 3K63A 1N8QA 1M904 1UCJA 1O7HB 1O7WB 2CWUA 4ZM8A 1VQL3 1A2KA 2BMQB 3S28A 1Q824 1JNQA 1HYFA 1OUNA 4JF8A 2XR8B 2JQ5A 4HM8B 3V99A 9RNTA 1RSNA 4FMAA 4LYLB 5CLKA 1FUSA 3TDGA 1MWSA 3SYUA 1IU7A 2KF5A 2F86B 3PCSA 1IT8A 3F8XA 1GY5A 2IUKA 1BRJA 2QGUA 2SBLA 1O7PB 3EHCA 2BIRA 1TRPA 3UL5A 6GSPA 1X1YA 2YFJB 3EBYA 1QVG2 2FNQA 3LTAA 3MSOA 2R41A 1BSAA 1X1XA 3D9RA 4CCVA 1E3VA 1BIRA 1RRLA 3EBTA 1IYYA 5EEOA 2K3DA 1B3SA 2IA7A 1K8A4 3UB1A 1VQ43 4XDWA 3J7Yd 1RJOA 3UJMA 1IV7A 1JRQA 1RGFA 4BIRA 1C54A 1RLSA 1JZDA 3UL6A 3FH1A 4KFDA 2F5MA 4O8SA 2BMRB 2Z76A 1BRSA 1I3IA 2E2TA 3K9MC 4O2HA 5KP3A 5AIFA 1BRIA 7RNTA 3EN8A 3BNDA 3F40A 1AV4A 1U5OA 1ULIB 4R9KA 2CG1A 1NB3I 1YVSA 3X3XA 4NREA 1RGKA 1VQ93 3KIIA 3LT8A 4KT3B 3GRDA 1ZGXA 1QAKA 1V57A 2P05A 3OWUA 2O3OA 2D42A 1LQMB 1DYUA 4HZBB 3CME3 4HJLB 4RNZA 2H0GA 4EV2A 4NPBA 3CCQ3 2BU4A 2OOVA 1D6ZA 2OWPA 2Z7AA 2SARA 1IQXA
chains in the Genus database with same CATH topology
1HZ1A 3DH2A 1GSPA 1LOWA 1I2GA 3AGOA 3DGYA 1B20A 1BSEA 1CH0A 4HAAA 1B2ZA 1I70A 1UCKA 1GOYA 2KF6A 2RNTA 3AHSA 1I0VA 3RNTA 1SARA 3D5GA 1RCKA 3D4AA 2HOHA 4HOHA 1LOYA 4BU4A 1BU4A 1JBRA 1BNIA 1BNEA 2ZA4A 4J5GA 1B2UA 1YNVX 1GMQA 1GOUA 1BRKA 1I2FA 1MGRA 1I0XA 1RNTA 3BU4A 3GSPA 1FYSA 1T2IA 5BIRA 1RN1A 1DE3A 1BSBA 5GSPA 1RGLA 2F4YA 3Q3FA 2KF3A 1FUTA 1B27A 1X1WA 1BNGA 1TRQA 8RNTA 1JBSA 1RGEA 6RNTA 1B2MA 1LNIA 1RDSA 2KAAA 4RNTA 2F56A 1UCLA 1LOVA 3WR2A 1BANA 1BVIA 3D5IA 1MGWA 1UCJA 1I3FA 1RTUA 2SARA 4GSPA 1BNRA 1T2HA 1RN4A 2F5WA 1HYFA 1FW7A 1B2SA 1BNFA 9RNTA 1AQZA 1RSNA 1TTOA 2KF4A 1FUSA 4GHOA 3URPA 3SYUA 2KF5A 1A2PA 1BRJA 1I2EA 6GSPA 2BIRA 1TRPA 1X1YA 1BNJA 1BSAA 1DETA 1X1XA 7GSPA 1BIRA 5BU4A 1FZUA 1IYYA 1B2XA 1B3SA 3BIRA 1I8VA 1BRHA 1RMSA 1RGFA 1BUJA 4BIRA 1C54A 1BAOA 1RLSA 1PY3A 1GMPA 2F5MA 5HOHA 1RCLA 1YGWA 3HOHA 1G02A 1BRSA 2GSPA 3KCHA 1BGSA 1I3IA 1R4YA 2AAEA 1RHLA 1B21A 5RNTA 1BRIA 7RNTA 1RGAA 1GOVA 1YVSA 1RGKA 4J5KA 1RGCA 2AADA 1ZGXA 1BRGA 1UCIA 1RNBA 3A5EA 1BSDA 1BOXA 1BSCA 1BNSA 2RBIA 1BRNL 1AY7A 1X1UA 1RGHA 1PYLA 1GMRA 1Q9EA 2BU4A 2C4BA 1JBTA 3AGNA 1LRAA 3WHOA 1RGGA 3AHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  3DH2 A;  1GSP A;  1LOW A;  1I2G A;  3AGO A;  3DGY A;  1B20 A;  1BSE A;  1CH0 A;  4HAA A;  1B2Z A;  1I70 A;  1UCK A;  1GOY A;  2KF6 A;  2RNT A;  3AHS A;  1I0V A;  3RNT A;  1SAR A;  3D5G A;  1RCK A;  3D4A A;  2HOH A;  4HOH A;  1LOY A;  4BU4 A;  1BU4 A;  1JBR A;  1BNI A;  1BNE A;  2ZA4 A;  4J5G A;  1B2U A;  1YNV X;  1GMQ A;  1GOU A;  1BRK A;  1I2F A;  1MGR A;  1I0X A;  1RNT A;  3BU4 A;  3GSP A;  1FYS A;  1T2I A;  5BIR A;  1RN1 A;  1DE3 A;  1BSB A;  5GSP A;  1RGL A;  2F4Y A;  3Q3F A;  2KF3 A;  1FUT A;  1B27 A;  1X1W A;  1BNG A;  1TRQ A;  8RNT A;  1JBS A;  1RGE A;  6RNT A;  1B2M A;  1LNI A;  1RDS A;  2KAA A;  4RNT A;  2F56 A;  1UCL A;  1LOV A;  3WR2 A;  1BAN A;  1BVI A;  3D5I A;  1MGW A;  1UCJ A;  1I3F A;  1RTU A;  2SAR A;  4GSP A;  1BNR A;  1T2H A;  1RN4 A;  2F5W A;  1HYF A;  1FW7 A;  1B2S A;  1BNF A;  9RNT A;  1AQZ A;  1RSN A;  1TTO A;  2KF4 A;  1FUS A;  4GHO A;  3URP A;  3SYU A;  2KF5 A;  1A2P A;  1BRJ A;  1I2E A;  6GSP A;  2BIR A;  1TRP A;  1X1Y A;  1BNJ A;  1BSA A;  1DET A;  1X1X A;  7GSP A;  1BIR A;  5BU4 A;  1FZU A;  1IYY A;  1B2X A;  1B3S A;  3BIR A;  1I8V A;  1BRH A;  1RMS A;  1RGF A;  1BUJ A;  4BIR A;  1C54 A;  1BAO A;  1RLS A;  1PY3 A;  1GMP A;  2F5M A;  5HOH A;  1RCL A;  1YGW A;  3HOH A;  1G02 A;  1BRS A;  2GSP A;  3KCH A;  1BGS A;  1I3I A;  1R4Y A;  2AAE A;  1RHL A;  1B21 A;  5RNT A;  1BRI A;  7RNT A;  1RGA A;  1GOV A;  1YVS A;  1RGK A;  4J5K A;  1RGC A;  2AAD A;  1ZGX A;  1BRG A;  1UCI A;  1RNB A;  3A5E A;  1BSD A;  1BOX A;  1BSC A;  1BNS A;  2RBI A;  1BRN L;  1AY7 A;  1X1U A;  1RGH A;  1PYL A;  1GMR A;  1Q9E A;  2BU4 A;  2C4B A;  1JBT A;  3AGN A;  1LRA A;  3WHO A;  1RGG A;  3AHW A; 
#chains in the Genus database with same CATH topology
 3SED A;  3V98 A;  2W03 A;  1OHS A;  1I2G A;  1ZS7 A;  2Z6B A;  3AGO A;  4EC6 A;  5LC6 A;  2QA4 3;  4K90 B;  3HZP A;  4EW5 A;  1CH0 A;  4AKZ A;  4AKY A;  1LQG C;  1UW1 A;  1IDP A;  1YHQ 3;  2GBX B;  5A0O B;  1CEW I;  3X42 A;  1GOY A;  2Q07 A;  1SAR A;  3D5G A;  1RCK A;  3N54 B;  1VQ6 3;  3D4A A;  5KP1 A;  3VF1 A;  3FG3 A;  4BTY A;  1YI2 3;  3QRD A;  2CFL A;  5TGN A;  1ASK A;  5EQL A;  3CCR 3;  5KP4 A;  1BNE A;  4MJD A;  4J5G A;  1UUW B;  2P09 A;  1GOU A;  5FW5 A;  1RNT A;  2IMJ A;  1I0X A;  3GSP A;  2HML B;  3F7X A;  3LYG A;  4DKI A;  1OPY A;  1T2I A;  2P38 A;  3MWZ A;  2LYX A;  1RN1 A;  3KN4 A;  4O3V A;  2K54 A;  4HKV B;  2FGT A;  1RGL A;  2CFW A;  3BB9 A;  2KF3 A;  2CHC A;  1X1W A;  3FG4 A;  8RNT A;  1JBS A;  3NHX A;  1EEJ A;  1ROA A;  1UUV B;  3DMC A;  3FGY A;  3QK9 A;  3VSY A;  1VQM 3;  1A90 A;  2CK3 H;  4L8P A;  1DMQ A;  1LXE A;  3HII A;  4ORL A;  4HBR A;  1EQK A;  5D81 A;  1EG9 B;  3MG1 A;  1M1K 4;  4NHF A;  3GZR A;  3Q1C A;  3EJV A;  1QAF A;  1MGW A;  3D5I A;  3ZG0 A;  5IG4 A;  2R4I A;  2D1W A;  2L1S A;  2L4V A;  1OF5 B;  4QWT A;  1I3F A;  2PNC A;  1TUH A;  1BNR A;  4I4K A;  5IEN A;  1IQY A;  2B24 B;  1S72 3;  1Q42 A;  4XBY A;  1RN4 A;  2GBW B;  1IK3 A;  5IF6 A;  1FW7 A;  1ROV A;  2W04 A;  2O9U X;  5HGR A;  5CK6 A;  2B1X B;  3SXX A;  1O7M B;  5JPU A;  3KZT A;  3FF2 A;  1AVK A;  4N6T A;  3CC7 3;  4K61 A;  1E97 A;  5IER A;  1OH0 A;  3EF8 A;  3JUQ A;  4KZ1 A;  3FLJ A;  1DET A;  3UNL A;  1K73 4;  3CC4 3;  7GSP A;  4WFO A;  1GD4 A;  1FZU A;  5BU4 A;  1YVB I;  3PS8 A;  3B4P A;  1QVF 2;  1TFO A;  4EV5 A;  3CD6 3;  3JUP A;  1MWT A;  3G0K A;  3IJE B;  3CC2 3;  4RBN A;  1FA3 A;  1O7G B;  2W56 A;  5CF2 A;  1J2B A;  4OUQ A;  2CH9 A;  1JZO A;  1WMO A;  3AMO A;  1RCL A;  2CKF B;  6STD A;  4LEH A;  1YGW A;  1SII A;  5ELJ A;  3BNB A;  2GSP A;  3RGA A;  3KCH A;  3T8N A;  1R4Y A;  2A15 A;  3HK4 A;  1IV9 A;  1N5H A;  4IIA A;  2JDI H;  3GZB A;  1STF I;  1RGA A;  4BTW A;  3DGN A;  2MC8 A;  3NV0 A;  2KCD A;  1JJ2 2;  1GOV A;  1WTH A;  3AHW A;  1CYU A;  1BRG A;  2YX9 A;  1IT7 A;  5AIH A;  5D82 A;  2LQV A;  4EBG A;  1RNB A;  1OHP A;  5BVB A;  1BNS A;  4KFE A;  1AY7 A;  2UX0 A;  8CHO A;  3GZY B;  1ZO2 A;  3OWY A;  4PEJ A;  1N9E A;  1RGH A;  1GMR A;  2Z77 A;  4HM2 B;  3U1W A;  1JBT A;  4WYK A;  4N6O B;  5AYR B;  2CIU A;  3FZW A;  4TX4 A;  3SLU A;  1K9M 4;  3DH2 A;  1UDI I;  4CPK A;  3A76 A;  1YIJ 3;  4HZ9 B;  1D6U A;  1B20 A;  3O8Y A;  1JB4 A;  3BNE A;  4HYZ A;  4I5Q A;  4MMZ B;  3MPH A;  1AR0 A;  2CC3 A;  2I9W A;  2QIY A;  1GS3 A;  4HM3 B;  3CPO A;  4XBT A;  2KRT A;  4HM7 B;  3MYT A;  3PZW A;  1UCK A;  4RZM A;  2WGO A;  1WMN A;  4CDL A;  3AHS A;  4HM6 B;  1VQO 3;  4RNY A;  3WOE B;  3DZL A;  1W01 A;  1DVC A;  1ZX2 A;  3E99 A;  3EC9 A;  1WMP A;  1YJW 3;  2OQE A;  1JKG B;  1DMN A;  2XF3 A;  5FGO A;  3CU3 A;  1MGR A;  3BU4 A;  3LTC A;  2PZV A;  3F7S A;  2KXG A;  4N6V 0;  5BIR A;  2WOF A;  3LML A;  2INX A;  3CCE 3;  5G1K A;  3EE1 A;  3G4S 3;  3CMA 3;  3PXM A;  2OTJ 3;  1LNH A;  1BSB A;  3LTB A;  1JB2 A;  5GSP A;  3STD A;  2F4Y A;  2W9P A;  3HI7 A;  5JPP A;  4BL2 A;  1FUT A;  2F98 A;  1B27 A;  2H0I A;  1TRQ A;  1W6G A;  3SX1 A;  3JUO A;  4OK0 A;  3LOY A;  4G1M B;  6RNT A;  1W6Y A;  1JN5 B;  1LNI A;  2CFG A;  3FSD A;  1G0T A;  1EUI C;  4IT7 A;  4FCZ A;  1RN7 A;  2M7O A;  3EQQ B;  2F56 A;  1TIJ A;  4K1U A;  3U97 A;  3WMD A;  3WR2 A;  5CF1 A;  3GZX B;  1BVI A;  1W6C A;  3L0R A;  3NBR A;  1Q40 B;  1T5Y A;  2F99 A;  3F9S A;  4O02 B;  3MKI A;  5D83 A;  1RTU A;  4H61 A;  1OHO A;  4WHA A;  4AEQ A;  3X3Y A;  3S5C A;  4LGQ A;  1K41 A;  3RGR A;  1T2H A;  3ROB A;  2F5W A;  3NXJ A;  3M8C A;  3GAX A;  1KSI A;  3WA2 X;  3WA3 A;  1TTO A;  1W4N A;  2KF4 A;  1WQL B;  4GHO A;  3SOA A;  1G96 A;  3S29 A;  1ISK A;  1GYB A;  3CCU 3;  1E3R A;  2V1L A;  1I2E A;  3PYJ A;  1OAC A;  1PU4 A;  2Y74 A;  3NM2 A;  1F8N A;  1V74 A;  3EN1 B;  3WOD G;  1PFP A;  1MWU A;  1FUW A;  1B2X A;  3F14 A;  4WP5 A;  1A2V A;  2RSX A;  1KWI A;  3CNM A;  3NUV A;  3H51 A;  1I8V A;  1BRH A;  1RMS A;  3NV0 B;  1BUJ A;  3F8H A;  1BAO A;  3N9H A;  4KVH A;  5M18 A;  1RRH A;  3EB8 A;  3OX9 A;  2XGL A;  2OOV C;  5CXO A;  3CXC 2;  3CCJ 3;  1G02 A;  4WWU C;  5AEU B;  4JRF A;  1NWW A;  1ULJ B;  2AAE A;  3IMA B;  1B21 A;  3X41 A;  3LTD A;  1YIT 3;  3KKG A;  1D6Y A;  4R4K A;  3WDG B;  3G6E 3;  5G1L A;  3KSE D;  1Q7Y 4;  1LOX A;  4J5K A;  4X2H A;  1MNL A;  2AAD A;  1NO3 A;  1QMA A;  3SOY A;  3CCL 3;  5IEO A;  1W00 A;  1IVV A;  1SQW A;  2BT3 A;  5G2G A;  1BRN L;  2C10 A;  3CCM 3;  3KE7 A;  1WNH A;  1X1U A;  3KSP A;  2ML5 A;  1T3B A;  3JVC A;  2W9Q A;  2YFL B;  3AGN A;  2E2U A;  1LRA A;  1FGR A;  4XM4 A;  1QJG A;  2C11 A;  1LOW A;  2CFK A;  1GY7 A;  1Q86 4;  3ECF A;  1TU5 A;  1BSE A;  3PCR A;  4FR9 A;  2W0Q A;  4BTX A;  1MOL A;  2CG0 A;  4FMC A;  4HVN A;  1B2Z A;  4R9L A;  1SPU A;  2HMN B;  1I70 A;  4FCJ A;  2ZHX B;  2KF6 A;  4GL6 A;  3X40 A;  2ZL8 A;  1W02 A;  2RNT A;  3MG3 A;  5I97 A;  3RNT A;  4XDV A;  2K0M A;  5IG3 A;  5BXQ A;  4HOH A;  1YJ9 3;  1FGM A;  3KFQ C;  4BU4 A;  1A67 A;  1BU4 A;  1CYV A;  2UUG C;  2XH9 A;  1JBR A;  1BNI A;  4GB5 A;  3X3Z A;  3FG1 A;  1JV2 B;  1YNV X;  2OCT A;  1GMQ A;  1IVU A;  3DGM A;  5M1A A;  1QAL A;  1M9G A;  3ER7 A;  1DE3 A;  1RKY A;  1VZZ A;  3MHE A;  1NB5 I;  1US1 A;  1K28 A;  2ML6 A;  1R4C A;  1AVL A;  1FGT A;  1FGO A;  1FGQ A;  1SIH A;  1IQ8 A;  1Z1S A;  3PGB A;  5AEW B;  4FMD A;  1OF5 A;  1BNG A;  3WOF B;  4N6L A;  2BMO B;  1NJI 4;  3NQY A;  4OVM A;  2OTL 3;  1UI8 A;  5JBS A;  2BHM A;  5M19 A;  5AII A;  4EXR A;  3G8Z A;  4Q53 A;  1LOV A;  5AYS C;  1HKX A;  3LZA A;  2Y73 A;  4GSP A;  3MG2 A;  3VGN A;  1OGZ A;  2YFI B;  2GEY A;  1O7N B;  2RFR A;  1B2S A;  1BNF A;  3LT9 A;  3T8U A;  1Y4K A;  1AQZ A;  1EA2 A;  1IVW A;  2RGQ A;  3URP A;  2HMK B;  1W2B 2;  2STD A;  4LSO A;  1A2P A;  4U13 A;  2CX1 A;  2XFS A;  2CW9 A;  3JUN A;  1CQS A;  1SJW A;  3N8B A;  5DRE A;  3I55 3;  4XB5 A;  1V58 A;  2WGQ A;  1BNJ A;  2GU1 A;  1N8R 4;  1UUG B;  2BNG A;  1VQP 3;  3BIR A;  4LZI A;  3T0U A;  3B4O A;  4N6U A;  2CX0 A;  2HMJ B;  2XSO B;  3EX9 A;  4HM1 B;  2RCD A;  3ALA A;  4FMB A;  3K0Z A;  3JUM A;  4MMX B;  1L5G B;  1GD3 A;  3ZFZ A;  3G71 3;  1VQ8 3;  1PY3 A;  4J9A A;  4BL3 A;  1STD A;  3CPW 2;  1GMP A;  5HOH A;  4HM4 B;  5IW9 A;  5DRV A;  3CCS 3;  3HX8 A;  1VQN 3;  1MWR A;  1BUQ A;  3B7C A;  2HMO B;  2J8X B;  3HOH A;  3OV4 A;  1BGS A;  1DVD A;  1RHL A;  3DY5 A;  5LC7 A;  5RNT A;  2ZDJ A;  5IG0 A;  1NNV A;  3DM8 A;  4HM5 B;  2FXT A;  3ZG5 A;  1GY6 A;  2XFT A;  1RGC A;  2W56 B;  3LH4 A;  1UCI A;  4L8O A;  3D79 A;  3AMO B;  3B8L A;  3A5E A;  1BSD A;  1BOX A;  1BSC A;  2RBI A;  1C7H A;  1VQQ A;  2CWV A;  1UGI A;  3DGO A;  3NM7 A;  1M1X B;  1LVN A;  1Q81 4;  1PYL A;  2GU3 A;  1Q9E A;  2UGI A;  3LXU X;  3V92 A;  2H0H A;  2C4B A;  2OQE C;  1N9J A;  1S5A A;  4MEI A;  1UGH I;  7STD A;  3WHO A;  1RGG A;  2XEP A;  1HZ1 A;  3BLZ A;  1GSP A;  3DGY A;  2WOH A;  3CNX A;  1W2Z A;  1OCV A;  2XRX B;  1JKG A;  5IEP A;  2WO0 A;  1JB5 A;  1DMM A;  3Q2P A;  4R1K A;  1YJN 3;  4N3V A;  2IY2 A;  1YGE A;  4HAA A;  1VQ5 3;  1TP6 A;  3HIG A;  3I0Y A;  3NBB A;  2QEX 3;  3GWR A;  3Q90 A;  2CFD A;  1TFK A;  4LMI A;  1KQS 2;  3CCV 3;  2XGN A;  5IG5 A;  3FCS B;  4K1V A;  4N6M A;  4CJN A;  2IUJ A;  2IYJ A;  4WYK B;  1I0V A;  2GEX A;  2HMM B;  2W6J H;  3K7C A;  2BO9 B;  3BNC A;  4J8T A;  2HOH A;  1VQ7 3;  3D3L A;  3NX0 A;  4X2O A;  1IVX A;  1HU9 A;  1LOY A;  4ILF A;  2CWT A;  3DGL A;  3NQZ A;  1NDO B;  3RDE A;  2ZA4 A;  1TJD A;  1B2U A;  1JN5 A;  2P0M A;  1I2F A;  2GXF A;  1BRK A;  3OXA A;  4XBX A;  2W2C A;  5AIG A;  1FYS A;  3FF0 A;  4R80 A;  4FCM A;  1UI7 A;  1U8C B;  3SVA A;  2P0X A;  2XSH B;  1N5P A;  3DXO A;  4IPB A;  4L7K A;  2MF7 A;  1KD1 4;  3G16 A;  4N6N B;  1Q40 A;  3Q3F A;  1EKM A;  4EYC A;  4KFF A;  3FKA A;  3DUK A;  5AI1 A;  1RGE A;  1B2M A;  3OW2 2;  4HM0 B;  4MMY B;  3S27 A;  1RDS A;  1W5Z A;  1Q7H A;  3K5T A;  2KAA A;  4RNT A;  5ELU A;  5STD A;  1W7C A;  3H3H A;  1VQK 3;  1KC8 4;  1NU3 A;  1OGX A;  2E2V A;  1UCL A;  5EVH A;  3NBJ A;  3OWS A;  1BAN A;  3I56 3;  3IPT A;  4H3U A;  4STD A;  3S67 A;  3K63 A;  1N8Q A;  1M90 4;  1UCJ A;  1O7H B;  1O7W B;  2CWU A;  4ZM8 A;  1VQL 3;  1A2K A;  2BMQ B;  3S28 A;  1Q82 4;  1JNQ A;  1HYF A;  1OUN A;  4JF8 A;  2XR8 B;  2JQ5 A;  4HM8 B;  3V99 A;  9RNT A;  1RSN A;  4FMA A;  4LYL B;  5CLK A;  1FUS A;  3TDG A;  1MWS A;  3SYU A;  1IU7 A;  2KF5 A;  2F86 B;  3PCS A;  1IT8 A;  3F8X A;  1GY5 A;  2IUK A;  1BRJ A;  2QGU A;  2SBL A;  1O7P B;  3EHC A;  2BIR A;  1TRP A;  3UL5 A;  6GSP A;  1X1Y A;  2YFJ B;  3EBY A;  1QVG 2;  2FNQ A;  3LTA A;  3MSO A;  2R41 A;  1BSA A;  1X1X A;  3D9R A;  4CCV A;  1E3V A;  1BIR A;  1RRL A;  3EBT A;  1IYY A;  5EEO A;  2K3D A;  1B3S A;  2IA7 A;  1K8A 4;  3UB1 A;  1VQ4 3;  4XDW A;  3J7Y d;  1RJO A;  3UJM A;  1IV7 A;  1JRQ A;  1RGF A;  4BIR A;  1C54 A;  1RLS A;  1JZD A;  3UL6 A;  3FH1 A;  4KFD A;  2F5M A;  4O8S A;  2BMR B;  2Z76 A;  1BRS A;  1I3I A;  2E2T A;  3K9M C;  4O2H A;  5KP3 A;  5AIF A;  1BRI A;  7RNT A;  3EN8 A;  3BND A;  3F40 A;  1AV4 A;  1U5O A;  1ULI B;  4R9K A;  2CG1 A;  1NB3 I;  1YVS A;  3X3X A;  4NRE A;  1RGK A;  1VQ9 3;  3KII A;  3LT8 A;  4KT3 B;  3GRD A;  1ZGX A;  1QAK A;  1V57 A;  2P05 A;  3OWU A;  2O3O A;  2D42 A;  1LQM B;  1DYU A;  4HZB B;  3CME 3;  4HJL B;  4RNZ A;  2H0G A;  4EV2 A;  4NPB A;  3CCQ 3;  2BU4 A;  2OOV A;  1D6Z A;  2OWP A;  2Z7A A;  2SAR A;  1IQX A; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  3DH2 A;  1GSP A;  1LOW A;  1I2G A;  3AGO A;  3DGY A;  1B20 A;  1BSE A;  1CH0 A;  4HAA A;  1B2Z A;  1I70 A;  1UCK A;  1GOY A;  2KF6 A;  2RNT A;  3AHS A;  1I0V A;  3RNT A;  1SAR A;  3D5G A;  1RCK A;  3D4A A;  2HOH A;  4HOH A;  1LOY A;  4BU4 A;  1BU4 A;  1JBR A;  1BNI A;  1BNE A;  2ZA4 A;  4J5G A;  1B2U A;  1YNV X;  1GMQ A;  1GOU A;  1BRK A;  1I2F A;  1MGR A;  1I0X A;  1RNT A;  3BU4 A;  3GSP A;  1FYS A;  1T2I A;  5BIR A;  1RN1 A;  1DE3 A;  1BSB A;  5GSP A;  1RGL A;  2F4Y A;  3Q3F A;  2KF3 A;  1FUT A;  1B27 A;  1X1W A;  1BNG A;  1TRQ A;  8RNT A;  1JBS A;  1RGE A;  6RNT A;  1B2M A;  1LNI A;  1RDS A;  2KAA A;  4RNT A;  2F56 A;  1UCL A;  1LOV A;  3WR2 A;  1BAN A;  1BVI A;  3D5I A;  1MGW A;  1UCJ A;  1I3F A;  1RTU A;  2SAR A;  4GSP A;  1BNR A;  1T2H A;  1RN4 A;  2F5W A;  1HYF A;  1FW7 A;  1B2S A;  1BNF A;  9RNT A;  1AQZ A;  1RSN A;  1TTO A;  2KF4 A;  1FUS A;  4GHO A;  3URP A;  3SYU A;  2KF5 A;  1A2P A;  1BRJ A;  1I2E A;  6GSP A;  2BIR A;  1TRP A;  1X1Y A;  1BNJ A;  1BSA A;  1DET A;  1X1X A;  7GSP A;  1BIR A;  5BU4 A;  1FZU A;  1IYY A;  1B2X A;  1B3S A;  3BIR A;  1I8V A;  1BRH A;  1RMS A;  1RGF A;  1BUJ A;  4BIR A;  1C54 A;  1BAO A;  1RLS A;  1PY3 A;  1GMP A;  2F5M A;  5HOH A;  1RCL A;  1YGW A;  3HOH A;  1G02 A;  1BRS A;  2GSP A;  3KCH A;  1BGS A;  1I3I A;  1R4Y A;  2AAE A;  1RHL A;  1B21 A;  5RNT A;  1BRI A;  7RNT A;  1RGA A;  1GOV A;  1YVS A;  1RGK A;  4J5K A;  1RGC A;  2AAD A;  1ZGX A;  1BRG A;  1UCI A;  1RNB A;  3A5E A;  1BSD A;  1BOX A;  1BSC A;  1BNS A;  2RBI A;  1BRN L;  1AY7 A;  1X1U A;  1RGH A;  1PYL A;  1GMR A;  1Q9E A;  2BU4 A;  2C4B A;  1JBT A;  3AGN A;  1LRA A;  3WHO A;  1RGG A;  3AHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...