4IPBA

Crystal structure of a duf2874 family protein (bacova_02504) from bacteroides ovatus atcc 8483 at 1.62 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
141
structure length
141
Chain Sequence
b'GDTPPGNVQSTFKKMYPKANGVAWSQDDGYYCANFAMNGFTKNVWFNVRGQWVMTLTDLVSLDRLTPTVYNAFVSGPYANWVVDNVTMVEFPKWQAIIVIKVGQDNVDIKYQLFYTPQGILLKTRNVSDMYDILGPSTFLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_02504) from Bacteroides ovatus ATCC 8483 at 1.62 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 29
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11396 PepSY_like Putative beta-lactamase-inhibitor-like, PepSY-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ipbA00
3U1WA 4IPBA 4FR9A 4HBRA 4K61A
chains in the Genus database with same CATH superfamily
3B4PA 3X3ZA 4LEHA 1KQS2 4TX4A 1RN1A 4H61A 1N9EA 1DVCA 1O7NB 2P05A 3BLZA 1RMSA 2Y74A 4HM2B 4RZMA 2PNCA 2QEX3 2W9QA 1FGOA 1M9GA 1GY5A 4FMAA 5AYRB 3FCSB 1CEWI 4BTYA 4XB5A 1W00A 2BU4A 4OUQA 3K63A 2IUJA 2W6JH 2I9WA 1R4YA 4WFOA 1JJ22 1SJWA 1BNRA 3CCJ3 4G1MB 2XR8B 1EUIC 1AVKA 1NB3I 1BRJA 3EC9A 4O02B 2Y73A 1VQ63 2RFRA 2CG1A 1CH0A 1IT8A 2C4BA 4RBNA 3FH1A 1VQK3 1BOXA 3LOYA 1BNFA 1NO3A 1YNVX 1B3SA 4HAAA 3DGMA 5TGNA 3G6E3 1JBRA 5AEWB 3BNBA 4XM4A 1JZOA 4JF8A 1TIJA 5EVHA 2PZVA 3H51A 2IA7A 4HOHA 3ZFZA 1GY6A 1X1XA 3X3YA 3GWRA 1B20A 2RSXA 2CWUA 1IVXA 1QAFA 1K28A 1FW7A 1TJDA 3AMOA 1UI8A 4RNTA 3N54B 2IY2A 4IT7A 2CIUA 1IQYA 1UCKA 3EQQB 1N9JA 4HM0B 3AGNA 1MWRA 3WMDA 1N8QA 1K734 1OGXA 1IV7A 2W56B 1MWUA 3SX1A 3EBTA 4HBRA 4HM3B 1UCJA 1W2B2 1BVIA 3MG1A 5BIRA 1V58A 3A5EA 1HU9A 1PU4A 2GU1A 4I5QA 2M7OA 3S67A 3SOYA 1FA3A 1T2HA 1VQ53 6STDA 1SARA 1WMNA 3UL6A 1G0TA 1W4NA 3CCL3 1TU5A 2CX0A 3UNLA 1IDPA 3CD63 5KP3A 1A2VA 1LOWA 2GBWB 1STDA 1TTOA 2Z76A 1BAOA 3KIIA 7GSPA 3PGBA 2CC3A 2F5WA 7STDA 4STDA 3CME3 4FMCA 1NJI4 3CC43 1RGKA 3CCM3 1EQKA 3HIIA 1IVVA 1D6YA 4L8PA 5AIHA 2YX9A 3CCS3 3EHCA 3V92A 1X1UA 3ZG5A 3OWUA 5IERA 3KN4A 3HZPA 1MGWA 1YHQ3 1QJGA 1BUQA 1UCLA 5G2GA 1OH0A 1EA2A 1W6GA 1UDII 3BIRA 4NREA 1UI7A 2W03A 2O3OA 5CLKA 1LQMB 1RHLA 5DREA 5AYSC 1HKXA 3CNXA 4N6TA 2HMOB 3X3XA 1CYVA 1OHSA 3UB1A 2D1WA 2UX0A 3CCQ3 1OF5A 2P38A 1OHOA 1TFKA 2OCTA 4GL6A 1RTUA 3EJVA 4I4KA 2E2UA 3RDEA 4HM4B 2GEXA 3KSED 3NV0B 1ZGXA 1JKGB 4N6OB 1I2GA 3FZWA 1VQ83 1C54A 1BSAA 3K0ZA 4KFDA 4XDVA 3U1WA 5D81A 2XH9A 3F9SA 3FF2A 2CW9A 1PFPA 2HMNB 2INXA 1VQN3 2FXTA 1FGTA 1BNIA 1O7WB 2KF4A 3D79A 3KFQC 2K3DA 5EEOA 4ZM8A 1Q824 4EYCA 4FCMA 1TFOA 1KC84 1JZDA 2LQVA 3WODG 1ZO2A 1U5OA 3DH2A 3QK9A 1KD14 3Q90A 1BRHA 2F86B 2GSPA 1TUHA 3DUKA 3IJEB 1JB2A 3T8UA 4MMZB 1A67A 1JBSA 4FMDA 4MJDA 3WA2X 1M1XB 2CKFB 1UGHI 1ZX2A 3I553 2C11A 3F8XA 2GEYA 2STDA 1RNBA 3DM8A 3U97A 3PXMA 1FUTA 1N5HA 3OV4A 3DGOA 4WYKB 3F8HA 4HM6B 3G713 4EC6A 1GSPA 5BXQA 3OX9A 1Q40A 1W01A 1DMQA 1AY7A 1BRSA 1E97A 4X2HA 3B7CA 3EX9A 5LC7A 3K7CA 1DMNA 1UUVB 3V98A 4DKIA 1RGEA 1RGAA 3PYJA 4J5GA 2BMOB 3V99A 5ELUA 3LTBA 1CQSA 2O9UX 3VF1A 1JBTA 3FKAA 2BNGA 3FLJA 5HGRA 1IU7A 3IPTA 3JUMA 3STDA 1BSCA 4AEQA 2XRXB 4R80A 2HMMB 3GZYB 1OHPA 2UUGC 1NWWA 4O2HA 5CF2A 3T0UA 1O7GB 3X40A 3MKIA 4L7KA 4N6LA 5FGOA 1OCVA 3LTDA 4K90B 1YJN3 3LTAA 1QALA 2WGOA 3JUPA 3KZTA 3Q3FA 1MWTA 4MMYB 2CFGA 1X1WA 3EB8A 3RNTA 2FGTA 4N6V0 2MF7A 2L4VA 3MG3A 4BTWA 3VSYA 3OWSA 1W6CA 3JUQA 2OTJ3 2RNTA 1JN5B 1YIJ3 2E2VA 2KF5A 1I3FA 1IK3A 4HVNA 1YI23 2R41A 3JUNA 4XBTA 3KE7A 1RGFA 2H0GA 2CX1A 2D42A 3PS8A 3CCU3 2P09A 3VGNA 3OWYA 1VQL3 1D6ZA 2KRTA 3EF8A 2J8XB 3GZRA 5IW9A 4FR9A 1YVBI 2HMJB 5JPPA 5KP4A 1B2UA 2KCDA 1RSNA 1MOLA 2V1LA 4HJLB 1Q7Y4 1BNGA 1ROVA 1TRPA 3K9MC 4HKVB 4GHOA 4EV2A 1RGCA 3BU4A 1T3BA 1I8VA 1BGSA 2KF6A 3HI7A 3UL5A 4AKYA 3SXXA 1RKYA 4KVHA 2LYXA 3MG2A 2ZA4A 3G0KA 3URPA 3WDGB 5IEPA 3I563 1VQ93 1QVF2 1N8R4 3ER7A 2L1SA 3D5GA 5ELJA 3AHWA 5IENA 1BRIA 1LRAA 4FMBA 3DXOA 1R4CA 3L0RA 1N5PA 3D5IA 1RN4A 4PEJA 1JV2B 4X2OA 2W0QA 1DETA 1O7HB 4WP5A 3UJMA 1VQO3 3MSOA 1AV4A 5M1AA 2F4YA 1FGRA 3Q2PA 3HOHA 3AMOB 1RCLA 4K1VA 2RCDA 1DE3A 3IMAB 5IF6A 1MWSA 3T8NA 3D3LA 3J7Yd 3PZWA 4EV5A 1EKMA 5AIIA 3X42A 5IG3A 2ML5A 1V74A 4OK0A 1B2ZA 4JRFA 2K54A 3SYUA 3CC73 4H3UA 3CCR3 1F8NA 2ZL8A 4KFFA 4O3VA 1GOUA 3D4AA 2OQEA 1STFI 2RBIA 3CNMA 1M904 3N8BA 3S29A 1OUNA 2K0MA 3M8CA 3CXC2 2AAEA 1VQP3 2HMKB 1O7MB 1V57A 5CXOA 3DGLA 4N6NB 3F7SA 3GSPA 1IV9A 1B2XA 4IIAA 1BIRA 4R9KA 2BO9B 2Q07A 1RN7A 4XBXA 5IG0A 2CK3H 1BNSA 1A2KA 1HZ1A 1FYSA 3CC23 1BUJA 2B24B 3JUOA 1BNJA 1IYYA 2F98A 2WOFA 3CMA3 2Z77A 1I0XA 1G02A 4LZIA 3LMLA 3ZG0A 2GBXB 2XGLA 3PCSA 1Y4KA 5IEOA 2QGUA 2BHMA 3NBRA 1BSDA 3G8ZA 3S5CA 2WOHA 1GMPA 1JB4A 2FNQA 4N3VA 1UUWB 1OF5B 2MC8A 4BL2A 3CCV3 2H0IA 3CCE3 1AQZA 2CFDA 4L8OA 2Z7AA 3SOAA 4ILFA 1GY7A 3NQZA 1W7CA 4MMXB 1RLSA 1E3VA 3NQYA 1UGIA 1RRLA 1B2SA 3FF0A 1W02A 3D9RA 2OWPA 1VQ43 3MYTA 4U13A 1J2BA 4R1KA 4R4KA 1ULIB 3G16A 2OQEC 3NM7A 1YVSA 2Z6BA 3NM2A 1GOYA 3F14A 1TP6A 1WMOA 2XSOB 3AGOA 3MHEA 4HM5B 1NB5I 1QVG2 4MEIA 1SQWA 2R4IA 1UW1A 3FSDA 5AIFA 4AKZA 2HOHA 1GD4A 2W04A 4K61A 4XDWA 2XEPA 1D6UA 1BRKA 2CG0A 1JNQA 2BMQB 4BIRA 1KSIA 2JDIH 1EEJA 1ULJB 2ZHXB 3DZLA 3E99A 3NXJA 1KWIA 1SIHA 5EQLA 3KSPA 3HX8A 1US1A 3B4OA 3LXUX 2AADA 2CHCA 3F40A 3ROBA 5LC6A 2GXFA 2YFIB 5BU4A 1NU3A 3DY5A 3DMCA 4J5KA 2B1XB 4KT3B 4R9LA 1Q40B 1B2MA 5AEUB 1WTHA 1IVWA 2C10A 3RGAA 2XF3A 1Q9EA 2P0XA 3FG1A 3CPW2 1A90A 1BANA 2XFTA 3F7XA 4WHAA 2BIRA 2CFLA 2OTL3 1CYUA 5IG5A 4ORLA 3GZXB 1RGHA 2W56A 2IUKA 2XSHB 4NHFA 5M18A 1ASKA 2SBLA 2CFWA 2HMLB 5HOHA 1BRGA 4WWUC 4HYZA 1VQ73 4LSOA 3PCRA 2OOVC 3DGNA 1IQ8A 3NX0A 1VQM3 2JQ5A 1EG9B 1DYUA 1K41A 4BU4A 1FUWA 5GSPA 5KP1A 1SIIA 4CJNA 3Q1CA 1B27A 3WOEB 1Q7HA 2E2TA 1IQXA 1GMRA 1JB5A 2CH9A 4HZBB 1W2ZA 4EBGA 1K8A4 2KXGA 1MGRA 2UGIA 1YIT3 2XGNA 1UUGB 3LH4A 4CCVA 1I70A 3S27A 1BU4A 1FGQA 3WA3A 3O8YA 2CWVA 1LOVA 5AIGA 1YJ93 3SLUA 1Q814 2YFJB 2A15A 4RNZA 1S723 3BNDA 3EBYA 1ISKA 1I3IA 3BB9A 4FCZA 5D83A 1IT7A 4QWTA 1WQLB 5JBSA 1LNHA 4LYLB 1OGZA 1Q864 1FZUA 1X1YA 4KFEA 7RNTA 1BSEA 3OW22 1FUSA 2W9PA 5RNTA 1Q42A 4RNYA 3EN8A 3CU3A 3LYGA 5IG4A 3NUVA 4CDLA 2IYJA 2YFLB 3DGYA 1C7HA 3EE1A 3NV0A 5DRVA 1JKGA 1OACA 1RCKA 3CPOA 4EXRA 5G1KA 3S28A 2H0HA 9RNTA 2QA43 1BSBA 1YGEA 3B8LA 1RRHA 3BNCA 3NHXA 3FG4A 4LMIA 4HM7B 4O8SA 1I2FA 4XBYA 3FGYA 5FW5A 3TDGA 4KZ1A 5D82A 2WO0A 4GB5A 1GS3A 1L5GB 1LOYA 3FG3A 1I0VA 3A76A 6GSPA 2BT3A 5I97A 5CF1A 1HYFA 1LNIA 4LGQA 3HK4A 3AHSA 2WGQA 2KAAA 8RNTA 1JRQA 3GZBA 1LXEA 1B21A 1IVUA 1LVNA 3K5TA 1GYBA 3QRDA 1QMAA 1G96A 1ZS7A 3EN1B 2XFSA 1BNEA 1A2PA 3MWZA 5STDA 1ROAA 5G1LA 1GOVA 3N9HA 1RJOA 1Z1SA 2SARA 1DMMA 4NPBA 3G4S3 4J8TA 2CFKA 1OPYA 1VQQA 3HIGA 3JVCA 2CWTA 3I0YA 4WYKA 1UCIA 1M1K4 1PYLA 3LZAA 4Q53A 1YJW3 2ZDJA 3NBBA 5AI1A 1YGWA 3BNEA 3X41A 3LTCA 1GD3A 2P0MA 2W2CA 3OXAA 1RDSA 3WHOA 3ALAA 3ECFA 1S5AA 3RGRA 1PY3A 1VZZA 2F99A 1W5ZA 2QIYA 4OVMA 3MPHA 1GMQA 1RGGA 2OOVA 3SEDA 1K9M4 1T2IA 1RGLA 1U8CB 1SPUA 6RNTA 1QAKA 3WR2A 2F5MA 4J9AA 3WOFB 2RGQA 8CHOA 1NDOB 1FGMA 1NNVA 2ML6A 1MNLA 1AR0A 3GAXA 1I2EA 5M19A 1DVDA 4HM8B 1TRQA 4GSPA 1RNTA 1W6YA 3KCHA 4FCJA 4K1UA 1WNHA 4HZ9B 3NBJA 1AVLA 3GRDA 4N6UA 4IPBA 1O7PB 2F56A 4BTXA 1T5YA 4N6MA 5JPUA 1LQGC 5A0OB 5BVBA 1BRNL 3LT9A 3SVAA 1WMPA 4CPKA 3KKGA 4BL3A 2GU3A 2KF3A 2IMJA 4EW5A 3LT8A 1E3RA 1JN5A 4HM1B 1LOXA 2BMRB 5CK6A 3H3HA
chains in the Genus database with same CATH topology
3B4PA 3X3ZA 4LEHA 1KQS2 4TX4A 4H61A 1N9EA 1DVCA 1O7NB 2P05A 3BLZA 2Y74A 4HM2B 4RZMA 2PNCA 2QEX3 2W9QA 1FGOA 1M9GA 1GY5A 4FMAA 5AYRB 3FCSB 1CEWI 4BTYA 4XB5A 1W00A 4OUQA 3K63A 2IUJA 2W6JH 2I9WA 4WFOA 1JJ22 1SJWA 3CCJ3 4G1MB 2XR8B 1AVKA 1NB3I 3EC9A 4O02B 2Y73A 1VQ63 2RFRA 2CG1A 1IT8A 4RBNA 3FH1A 1VQK3 3LOYA 1NO3A 3DGMA 5TGNA 3G6E3 3BNBA 4XM4A 4JF8A 1TIJA 5EVHA 2PZVA 3H51A 2IA7A 1GY6A 3X3YA 3GWRA 2RSXA 2CWUA 1IVXA 1QAFA 1K28A 3AMOA 1UI8A 3N54B 4IT7A 2CIUA 1IQYA 3EQQB 1N9JA 4HM0B 3WMDA 1N8QA 1K734 1OGXA 1IV7A 2W56B 3SX1A 3EBTA 4HBRA 4HM3B 1W2B2 3MG1A 1HU9A 1PU4A 2GU1A 3S67A 2M7OA 3SOYA 1FA3A 1VQ53 6STDA 1WMNA 3UL6A 1W4NA 3CCL3 1TU5A 3UNLA 1IDPA 3CD63 5KP3A 1A2VA 2GBWB 3KIIA 1STDA 2Z76A 3PGBA 2CC3A 7STDA 4STDA 3CME3 4FMCA 1NJI4 3CC43 3CCM3 1EQKA 3HIIA 1IVVA 1D6YA 4L8PA 5AIHA 2YX9A 3CCS3 3EHCA 3V92A 5IERA 3OWUA 3KN4A 3HZPA 1YHQ3 1QJGA 1BUQA 5G2GA 1OH0A 1EA2A 1W6GA 4NREA 1UI7A 2W03A 2O3OA 5CLKA 5DREA 5AYSC 1HKXA 3CNXA 4N6TA 2HMOB 3X3XA 1CYVA 1OHSA 3UB1A 2D1WA 2UX0A 3CCQ3 1OF5A 2P38A 1OHOA 1TFKA 2OCTA 4GL6A 4I4KA 3EJVA 2E2UA 3RDEA 4HM4B 2GEXA 3KSED 3NV0B 1JKGB 4N6OB 3FZWA 1VQ83 3K0ZA 4KFDA 4XDVA 3U1WA 5D81A 2XH9A 3F9SA 3FF2A 2CW9A 1PFPA 2HMNB 2INXA 1VQN3 2FXTA 1FGTA 3KFQC 1O7WB 5EEOA 4ZM8A 1Q824 4EYCA 4FCMA 1TFOA 1KC84 2LQVA 3WODG 1ZO2A 1U5OA 1KD14 3QK9A 3Q90A 2F86B 1TUHA 3DUKA 3IJEB 1JB2A 3T8UA 4MMZB 1A67A 4FMDA 4MJDA 3WA2X 1M1XB 2CKFB 1ZX2A 3I553 2C11A 3F8XA 2GEYA 2STDA 3DM8A 3U97A 3PXMA 1N5HA 3OV4A 3DGOA 4WYKB 3F8HA 4HM6B 3G713 4EC6A 5BXQA 3OX9A 1Q40A 1W01A 1DMQA 1E97A 4X2HA 3B7CA 3EX9A 5LC7A 3K7CA 1DMNA 1UUVB 3V98A 3PYJA 2BMOB 3V99A 5ELUA 3LTBA 1CQSA 2O9UX 3VF1A 3FKAA 2BNGA 3FLJA 5HGRA 1IU7A 3IPTA 3JUMA 3STDA 4AEQA 2XRXB 4R80A 2HMMB 3GZYB 1OHPA 1NWWA 4O2HA 5CF2A 3T0UA 1O7GB 3X40A 3MKIA 4L7KA 4N6LA 5FGOA 1OCVA 3LTDA 4K90B 1YJN3 3LTAA 1QALA 2WGOA 3JUPA 3KZTA 4MMYB 2CFGA 3EB8A 2FGTA 4N6V0 2MF7A 2L4VA 3MG3A 4BTWA 3VSYA 3OWSA 1W6CA 3JUQA 2OTJ3 1JN5B 1YIJ3 2E2VA 1IK3A 4HVNA 1YI23 3JUNA 4XBTA 3KE7A 2D42A 3PS8A 3CCU3 2P09A 3VGNA 3OWYA 1VQL3 1D6ZA 2KRTA 3EF8A 3GZRA 5IW9A 4FR9A 1YVBI 2HMJB 5JPPA 5KP4A 2KCDA 1MOLA 2V1LA 4HJLB 1Q7Y4 1ROVA 4HKVB 3K9MC 4EV2A 3UL5A 3HI7A 4AKYA 3SXXA 1RKYA 4KVHA 2LYXA 3MG2A 3G0KA 3WDGB 5IEPA 3I563 1VQ93 1QVF2 1N8R4 3ER7A 5ELJA 5IENA 4FMBA 3DXOA 1R4CA 3L0RA 1N5PA 4PEJA 1JV2B 4X2OA 2W0QA 1O7HB 4WP5A 3UJMA 1VQO3 3MSOA 1AV4A 1FGRA 3Q2PA 3AMOB 4K1VA 2RCDA 3IMAB 5IF6A 3T8NA 3D3LA 3J7Yd 3PZWA 4EV5A 1EKMA 5AIIA 3X42A 5IG3A 2ML5A 1V74A 4OK0A 4JRFA 2K54A 3CC73 4H3UA 3CCR3 1F8NA 2ZL8A 4KFFA 4O3VA 2OQEA 1STFI 3CNMA 1M904 3N8BA 3S29A 1OUNA 2K0MA 3M8CA 3CXC2 1VQP3 2HMKB 1O7MB 5CXOA 3DGLA 4N6NB 3F7SA 1IV9A 4IIAA 4R9KA 2BO9B 2Q07A 1RN7A 4XBXA 5IG0A 2CK3H 1A2KA 3CC23 2B24B 3JUOA 2F98A 2WOFA 3CMA3 2Z77A 4LZIA 3LMLA 2GBXB 2XGLA 3PCSA 1Y4KA 5IEOA 2QGUA 2BHMA 3NBRA 3G8ZA 3S5CA 2WOHA 1JB4A 2FNQA 4N3VA 1UUWB 1OF5B 2MC8A 3CCV3 3CCE3 2CFDA 4L8OA 2Z7AA 3SOAA 1GY7A 3NQZA 1W7CA 4MMXB 1E3VA 3NQYA 1RRLA 3FF0A 1W02A 3D9RA 2OWPA 1VQ43 3MYTA 4U13A 1J2BA 4R1KA 4R4KA 1ULIB 3G16A 2OQEC 3NM7A 2Z6BA 3NM2A 3F14A 1TP6A 1WMOA 2XSOB 3MHEA 4HM5B 1NB5I 1QVG2 4MEIA 1SQWA 2R4IA 1UW1A 3FSDA 5AIFA 4AKZA 2W04A 1GD4A 4K61A 4XDWA 2XEPA 1D6UA 2CG0A 1JNQA 2BMQB 1KSIA 2JDIH 1ULJB 3NXJA 3E99A 3DZLA 5EQLA 1KWIA 1SIHA 3KSPA 3HX8A 1US1A 3B4OA 3LXUX 2CHCA 3ROBA 3F40A 5LC6A 2GXFA 2YFIB 1NU3A 3DY5A 3DMCA 2B1XB 4R9LA 1Q40B 5AEUB 1WTHA 1IVWA 2C10A 3RGAA 2XF3A 2P0XA 3FG1A 3CPW2 1A90A 3F7XA 2XFTA 4WHAA 2CFLA 2OTL3 1CYUA 5IG5A 4ORLA 3GZXB 2W56A 2IUKA 2XSHB 4NHFA 1ASKA 2SBLA 2CFWA 2HMLB 4WWUC 4HYZA 1VQ73 4LSOA 3PCRA 2OOVC 3DGNA 1IQ8A 3NX0A 1VQM3 2JQ5A 1EG9B 1DYUA 1K41A 1FUWA 5KP1A 1SIIA 3Q1CA 3WOEB 2E2TA 1IQXA 1JB5A 2CH9A 4HZBB 1W2ZA 4EBGA 1K8A4 2KXGA 1YIT3 2XGNA 3LH4A 4CCVA 3S27A 1FGQA 3WA3A 3O8YA 2CWVA 5AIGA 1YJ93 3SLUA 1Q814 2YFJB 2A15A 4RNZA 1S723 3BNDA 3EBYA 1ISKA 3BB9A 4FCZA 5D83A 1IT7A 4QWTA 1WQLB 5JBSA 1LNHA 1OGZA 1Q864 4KFEA 3OW22 2W9PA 1Q42A 4RNYA 3EN8A 3CU3A 3LYGA 5IG4A 3NUVA 4CDLA 2YFLB 3NV0A 1C7HA 3EE1A 5DRVA 1JKGA 1OACA 3CPOA 4EXRA 3S28A 2QA43 1YGEA 3B8LA 1RRHA 3BNCA 3NHXA 3FG4A 4LMIA 4HM7B 4O8SA 4XBYA 3FGYA 5FW5A 3TDGA 4KZ1A 5D82A 2WO0A 4GB5A 1GS3A 1L5GB 3FG3A 3A76A 2BT3A 5I97A 5CF1A 4LGQA 3HK4A 2WGQA 1JRQA 3GZBA 1LXEA 1IVUA 1LVNA 3K5TA 1GYBA 3QRDA 1QMAA 1G96A 3EN1B 2XFSA 3MWZA 5STDA 1ROAA 3N9HA 1RJOA 1Z1SA 1DMMA 3G4S3 4J8TA 2CFKA 1OPYA 3HIGA 3JVCA 4WYKA 2CWTA 3I0YA 5AEWB 1M1K4 3LZAA 4Q53A 1YJW3 2ZDJA 3NBBA 5AI1A 3BNEA 3X41A 3LTCA 1GD3A 2P0MA 2W2CA 3OXAA 3ALAA 3ECFA 1S5AA 3RGRA 1VZZA 2F99A 1W5ZA 2QIYA 4OVMA 3MPHA 2OOVA 3SEDA 1K9M4 1U8CB 1SPUA 1QAKA 4J9AA 3WOFB 2RGQA 8CHOA 1NDOB 1FGMA 2ML6A 3GAXA 1MNLA 1AR0A 1DVDA 4HM8B 4FCJA 1W6YA 4K1UA 1WNHA 4HZ9B 3NBJA 1AVLA 3GRDA 4N6UA 4IPBA 1O7PB 4BTXA 1T5YA 4N6MA 5JPUA 5A0OB 5BVBA 3LT9A 3SVAA 1WMPA 3KKGA 2GU3A 2IMJA 3LT8A 1E3RA 1JN5A 4HM1B 1LOXA 2BMRB 5CK6A 3H3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1W A;  4IPB A;  4FR9 A;  4HBR A;  4K61 A; 
#chains in the Genus database with same CATH topology
 3B4P A;  3X3Z A;  4LEH A;  1KQS 2;  4TX4 A;  1RN1 A;  4H61 A;  1N9E A;  1DVC A;  1O7N B;  2P05 A;  3BLZ A;  1RMS A;  2Y74 A;  4HM2 B;  4RZM A;  2PNC A;  2QEX 3;  2W9Q A;  1FGO A;  1M9G A;  1GY5 A;  4FMA A;  5AYR B;  3FCS B;  1CEW I;  4BTY A;  4XB5 A;  1W00 A;  2BU4 A;  4OUQ A;  3K63 A;  2IUJ A;  2W6J H;  2I9W A;  1R4Y A;  4WFO A;  1JJ2 2;  1SJW A;  1BNR A;  3CCJ 3;  4G1M B;  2XR8 B;  1EUI C;  1AVK A;  1NB3 I;  1BRJ A;  3EC9 A;  4O02 B;  2Y73 A;  1VQ6 3;  2RFR A;  2CG1 A;  1CH0 A;  1IT8 A;  2C4B A;  4RBN A;  3FH1 A;  1VQK 3;  1BOX A;  3LOY A;  1BNF A;  1NO3 A;  1YNV X;  1B3S A;  4HAA A;  3DGM A;  5TGN A;  3G6E 3;  1JBR A;  5AEW B;  3BNB A;  4XM4 A;  1JZO A;  4JF8 A;  1TIJ A;  5EVH A;  2PZV A;  3H51 A;  2IA7 A;  4HOH A;  3ZFZ A;  1GY6 A;  1X1X A;  3X3Y A;  3GWR A;  1B20 A;  2RSX A;  2CWU A;  1IVX A;  1QAF A;  1K28 A;  1FW7 A;  1TJD A;  3AMO A;  1UI8 A;  4RNT A;  3N54 B;  2IY2 A;  4IT7 A;  2CIU A;  1IQY A;  1UCK A;  3EQQ B;  1N9J A;  4HM0 B;  3AGN A;  1MWR A;  3WMD A;  1N8Q A;  1K73 4;  1OGX A;  1IV7 A;  2W56 B;  1MWU A;  3SX1 A;  3EBT A;  4HBR A;  4HM3 B;  1UCJ A;  1W2B 2;  1BVI A;  3MG1 A;  5BIR A;  1V58 A;  3A5E A;  1HU9 A;  1PU4 A;  2GU1 A;  4I5Q A;  2M7O A;  3S67 A;  3SOY A;  1FA3 A;  1T2H A;  1VQ5 3;  6STD A;  1SAR A;  1WMN A;  3UL6 A;  1G0T A;  1W4N A;  3CCL 3;  1TU5 A;  2CX0 A;  3UNL A;  1IDP A;  3CD6 3;  5KP3 A;  1A2V A;  1LOW A;  2GBW B;  1STD A;  1TTO A;  2Z76 A;  1BAO A;  3KII A;  7GSP A;  3PGB A;  2CC3 A;  2F5W A;  7STD A;  4STD A;  3CME 3;  4FMC A;  1NJI 4;  3CC4 3;  1RGK A;  3CCM 3;  1EQK A;  3HII A;  1IVV A;  1D6Y A;  4L8P A;  5AIH A;  2YX9 A;  3CCS 3;  3EHC A;  3V92 A;  1X1U A;  3ZG5 A;  3OWU A;  5IER A;  3KN4 A;  3HZP A;  1MGW A;  1YHQ 3;  1QJG A;  1BUQ A;  1UCL A;  5G2G A;  1OH0 A;  1EA2 A;  1W6G A;  1UDI I;  3BIR A;  4NRE A;  1UI7 A;  2W03 A;  2O3O A;  5CLK A;  1LQM B;  1RHL A;  5DRE A;  5AYS C;  1HKX A;  3CNX A;  4N6T A;  2HMO B;  3X3X A;  1CYV A;  1OHS A;  3UB1 A;  2D1W A;  2UX0 A;  3CCQ 3;  1OF5 A;  2P38 A;  1OHO A;  1TFK A;  2OCT A;  4GL6 A;  1RTU A;  3EJV A;  4I4K A;  2E2U A;  3RDE A;  4HM4 B;  2GEX A;  3KSE D;  3NV0 B;  1ZGX A;  1JKG B;  4N6O B;  1I2G A;  3FZW A;  1VQ8 3;  1C54 A;  1BSA A;  3K0Z A;  4KFD A;  4XDV A;  3U1W A;  5D81 A;  2XH9 A;  3F9S A;  3FF2 A;  2CW9 A;  1PFP A;  2HMN B;  2INX A;  1VQN 3;  2FXT A;  1FGT A;  1BNI A;  1O7W B;  2KF4 A;  3D79 A;  3KFQ C;  2K3D A;  5EEO A;  4ZM8 A;  1Q82 4;  4EYC A;  4FCM A;  1TFO A;  1KC8 4;  1JZD A;  2LQV A;  3WOD G;  1ZO2 A;  1U5O A;  3DH2 A;  3QK9 A;  1KD1 4;  3Q90 A;  1BRH A;  2F86 B;  2GSP A;  1TUH A;  3DUK A;  3IJE B;  1JB2 A;  3T8U A;  4MMZ B;  1A67 A;  1JBS A;  4FMD A;  4MJD A;  3WA2 X;  1M1X B;  2CKF B;  1UGH I;  1ZX2 A;  3I55 3;  2C11 A;  3F8X A;  2GEY A;  2STD A;  1RNB A;  3DM8 A;  3U97 A;  3PXM A;  1FUT A;  1N5H A;  3OV4 A;  3DGO A;  4WYK B;  3F8H A;  4HM6 B;  3G71 3;  4EC6 A;  1GSP A;  5BXQ A;  3OX9 A;  1Q40 A;  1W01 A;  1DMQ A;  1AY7 A;  1BRS A;  1E97 A;  4X2H A;  3B7C A;  3EX9 A;  5LC7 A;  3K7C A;  1DMN A;  1UUV B;  3V98 A;  4DKI A;  1RGE A;  1RGA A;  3PYJ A;  4J5G A;  2BMO B;  3V99 A;  5ELU A;  3LTB A;  1CQS A;  2O9U X;  3VF1 A;  1JBT A;  3FKA A;  2BNG A;  3FLJ A;  5HGR A;  1IU7 A;  3IPT A;  3JUM A;  3STD A;  1BSC A;  4AEQ A;  2XRX B;  4R80 A;  2HMM B;  3GZY B;  1OHP A;  2UUG C;  1NWW A;  4O2H A;  5CF2 A;  3T0U A;  1O7G B;  3X40 A;  3MKI A;  4L7K A;  4N6L A;  5FGO A;  1OCV A;  3LTD A;  4K90 B;  1YJN 3;  3LTA A;  1QAL A;  2WGO A;  3JUP A;  3KZT A;  3Q3F A;  1MWT A;  4MMY B;  2CFG A;  1X1W A;  3EB8 A;  3RNT A;  2FGT A;  4N6V 0;  2MF7 A;  2L4V A;  3MG3 A;  4BTW A;  3VSY A;  3OWS A;  1W6C A;  3JUQ A;  2OTJ 3;  2RNT A;  1JN5 B;  1YIJ 3;  2E2V A;  2KF5 A;  1I3F A;  1IK3 A;  4HVN A;  1YI2 3;  2R41 A;  3JUN A;  4XBT A;  3KE7 A;  1RGF A;  2H0G A;  2CX1 A;  2D42 A;  3PS8 A;  3CCU 3;  2P09 A;  3VGN A;  3OWY A;  1VQL 3;  1D6Z A;  2KRT A;  3EF8 A;  2J8X B;  3GZR A;  5IW9 A;  4FR9 A;  1YVB I;  2HMJ B;  5JPP A;  5KP4 A;  1B2U A;  2KCD A;  1RSN A;  1MOL A;  2V1L A;  4HJL B;  1Q7Y 4;  1BNG A;  1ROV A;  1TRP A;  3K9M C;  4HKV B;  4GHO A;  4EV2 A;  1RGC A;  3BU4 A;  1T3B A;  1I8V A;  1BGS A;  2KF6 A;  3HI7 A;  3UL5 A;  4AKY A;  3SXX A;  1RKY A;  4KVH A;  2LYX A;  3MG2 A;  2ZA4 A;  3G0K A;  3URP A;  3WDG B;  5IEP A;  3I56 3;  1VQ9 3;  1QVF 2;  1N8R 4;  3ER7 A;  2L1S A;  3D5G A;  5ELJ A;  3AHW A;  5IEN A;  1BRI A;  1LRA A;  4FMB A;  3DXO A;  1R4C A;  3L0R A;  1N5P A;  3D5I A;  1RN4 A;  4PEJ A;  1JV2 B;  4X2O A;  2W0Q A;  1DET A;  1O7H B;  4WP5 A;  3UJM A;  1VQO 3;  3MSO A;  1AV4 A;  5M1A A;  2F4Y A;  1FGR A;  3Q2P A;  3HOH A;  3AMO B;  1RCL A;  4K1V A;  2RCD A;  1DE3 A;  3IMA B;  5IF6 A;  1MWS A;  3T8N A;  3D3L A;  3J7Y d;  3PZW A;  4EV5 A;  1EKM A;  5AII A;  3X42 A;  5IG3 A;  2ML5 A;  1V74 A;  4OK0 A;  1B2Z A;  4JRF A;  2K54 A;  3SYU A;  3CC7 3;  4H3U A;  3CCR 3;  1F8N A;  2ZL8 A;  4KFF A;  4O3V A;  1GOU A;  3D4A A;  2OQE A;  1STF I;  2RBI A;  3CNM A;  1M90 4;  3N8B A;  3S29 A;  1OUN A;  2K0M A;  3M8C A;  3CXC 2;  2AAE A;  1VQP 3;  2HMK B;  1O7M B;  1V57 A;  5CXO A;  3DGL A;  4N6N B;  3F7S A;  3GSP A;  1IV9 A;  1B2X A;  4IIA A;  1BIR A;  4R9K A;  2BO9 B;  2Q07 A;  1RN7 A;  4XBX A;  5IG0 A;  2CK3 H;  1BNS A;  1A2K A;  1HZ1 A;  1FYS A;  3CC2 3;  1BUJ A;  2B24 B;  3JUO A;  1BNJ A;  1IYY A;  2F98 A;  2WOF A;  3CMA 3;  2Z77 A;  1I0X A;  1G02 A;  4LZI A;  3LML A;  3ZG0 A;  2GBX B;  2XGL A;  3PCS A;  1Y4K A;  5IEO A;  2QGU A;  2BHM A;  3NBR A;  1BSD A;  3G8Z A;  3S5C A;  2WOH A;  1GMP A;  1JB4 A;  2FNQ A;  4N3V A;  1UUW B;  1OF5 B;  2MC8 A;  4BL2 A;  3CCV 3;  2H0I A;  3CCE 3;  1AQZ A;  2CFD A;  4L8O A;  2Z7A A;  3SOA A;  4ILF A;  1GY7 A;  3NQZ A;  1W7C A;  4MMX B;  1RLS A;  1E3V A;  3NQY A;  1UGI A;  1RRL A;  1B2S A;  3FF0 A;  1W02 A;  3D9R A;  2OWP A;  1VQ4 3;  3MYT A;  4U13 A;  1J2B A;  4R1K A;  4R4K A;  1ULI B;  3G16 A;  2OQE C;  3NM7 A;  1YVS A;  2Z6B A;  3NM2 A;  1GOY A;  3F14 A;  1TP6 A;  1WMO A;  2XSO B;  3AGO A;  3MHE A;  4HM5 B;  1NB5 I;  1QVG 2;  4MEI A;  1SQW A;  2R4I A;  1UW1 A;  3FSD A;  5AIF A;  4AKZ A;  2HOH A;  1GD4 A;  2W04 A;  4K61 A;  4XDW A;  2XEP A;  1D6U A;  1BRK A;  2CG0 A;  1JNQ A;  2BMQ B;  4BIR A;  1KSI A;  2JDI H;  1EEJ A;  1ULJ B;  2ZHX B;  3DZL A;  3E99 A;  3NXJ A;  1KWI A;  1SIH A;  5EQL A;  3KSP A;  3HX8 A;  1US1 A;  3B4O A;  3LXU X;  2AAD A;  2CHC A;  3F40 A;  3ROB A;  5LC6 A;  2GXF A;  2YFI B;  5BU4 A;  1NU3 A;  3DY5 A;  3DMC A;  4J5K A;  2B1X B;  4KT3 B;  4R9L A;  1Q40 B;  1B2M A;  5AEU B;  1WTH A;  1IVW A;  2C10 A;  3RGA A;  2XF3 A;  1Q9E A;  2P0X A;  3FG1 A;  3CPW 2;  1A90 A;  1BAN A;  2XFT A;  3F7X A;  4WHA A;  2BIR A;  2CFL A;  2OTL 3;  1CYU A;  5IG5 A;  4ORL A;  3GZX B;  1RGH A;  2W56 A;  2IUK A;  2XSH B;  4NHF A;  5M18 A;  1ASK A;  2SBL A;  2CFW A;  2HML B;  5HOH A;  1BRG A;  4WWU C;  4HYZ A;  1VQ7 3;  4LSO A;  3PCR A;  2OOV C;  3DGN A;  1IQ8 A;  3NX0 A;  1VQM 3;  2JQ5 A;  1EG9 B;  1DYU A;  1K41 A;  4BU4 A;  1FUW A;  5GSP A;  5KP1 A;  1SII A;  4CJN A;  3Q1C A;  1B27 A;  3WOE B;  1Q7H A;  2E2T A;  1IQX A;  1GMR A;  1JB5 A;  2CH9 A;  4HZB B;  1W2Z A;  4EBG A;  1K8A 4;  2KXG A;  1MGR A;  2UGI A;  1YIT 3;  2XGN A;  1UUG B;  3LH4 A;  4CCV A;  1I70 A;  3S27 A;  1BU4 A;  1FGQ A;  3WA3 A;  3O8Y A;  2CWV A;  1LOV A;  5AIG A;  1YJ9 3;  3SLU A;  1Q81 4;  2YFJ B;  2A15 A;  4RNZ A;  1S72 3;  3BND A;  3EBY A;  1ISK A;  1I3I A;  3BB9 A;  4FCZ A;  5D83 A;  1IT7 A;  4QWT A;  1WQL B;  5JBS A;  1LNH A;  4LYL B;  1OGZ A;  1Q86 4;  1FZU A;  1X1Y A;  4KFE A;  7RNT A;  1BSE A;  3OW2 2;  1FUS A;  2W9P A;  5RNT A;  1Q42 A;  4RNY A;  3EN8 A;  3CU3 A;  3LYG A;  5IG4 A;  3NUV A;  4CDL A;  2IYJ A;  2YFL B;  3DGY A;  1C7H A;  3EE1 A;  3NV0 A;  5DRV A;  1JKG A;  1OAC A;  1RCK A;  3CPO A;  4EXR A;  5G1K A;  3S28 A;  2H0H A;  9RNT A;  2QA4 3;  1BSB A;  1YGE A;  3B8L A;  1RRH A;  3BNC A;  3NHX A;  3FG4 A;  4LMI A;  4HM7 B;  4O8S A;  1I2F A;  4XBY A;  3FGY A;  5FW5 A;  3TDG A;  4KZ1 A;  5D82 A;  2WO0 A;  4GB5 A;  1GS3 A;  1L5G B;  1LOY A;  3FG3 A;  1I0V A;  3A76 A;  6GSP A;  2BT3 A;  5I97 A;  5CF1 A;  1HYF A;  1LNI A;  4LGQ A;  3HK4 A;  3AHS A;  2WGQ A;  2KAA A;  8RNT A;  1JRQ A;  3GZB A;  1LXE A;  1B21 A;  1IVU A;  1LVN A;  3K5T A;  1GYB A;  3QRD A;  1QMA A;  1G96 A;  1ZS7 A;  3EN1 B;  2XFS A;  1BNE A;  1A2P A;  3MWZ A;  5STD A;  1ROA A;  5G1L A;  1GOV A;  3N9H A;  1RJO A;  1Z1S A;  2SAR A;  1DMM A;  4NPB A;  3G4S 3;  4J8T A;  2CFK A;  1OPY A;  1VQQ A;  3HIG A;  3JVC A;  2CWT A;  3I0Y A;  4WYK A;  1UCI A;  1M1K 4;  1PYL A;  3LZA A;  4Q53 A;  1YJW 3;  2ZDJ A;  3NBB A;  5AI1 A;  1YGW A;  3BNE A;  3X41 A;  3LTC A;  1GD3 A;  2P0M A;  2W2C A;  3OXA A;  1RDS A;  3WHO A;  3ALA A;  3ECF A;  1S5A A;  3RGR A;  1PY3 A;  1VZZ A;  2F99 A;  1W5Z A;  2QIY A;  4OVM A;  3MPH A;  1GMQ A;  1RGG A;  2OOV A;  3SED A;  1K9M 4;  1T2I A;  1RGL A;  1U8C B;  1SPU A;  6RNT A;  1QAK A;  3WR2 A;  2F5M A;  4J9A A;  3WOF B;  2RGQ A;  8CHO A;  1NDO B;  1FGM A;  1NNV A;  2ML6 A;  1MNL A;  1AR0 A;  3GAX A;  1I2E A;  5M19 A;  1DVD A;  4HM8 B;  1TRQ A;  4GSP A;  1RNT A;  1W6Y A;  3KCH A;  4FCJ A;  4K1U A;  1WNH A;  4HZ9 B;  3NBJ A;  1AVL A;  3GRD A;  4N6U A;  4IPB A;  1O7P B;  2F56 A;  4BTX A;  1T5Y A;  4N6M A;  5JPU A;  1LQG C;  5A0O B;  5BVB A;  1BRN L;  3LT9 A;  3SVA A;  1WMP A;  4CPK A;  3KKG A;  4BL3 A;  2GU3 A;  2KF3 A;  2IMJ A;  4EW5 A;  3LT8 A;  1E3R A;  1JN5 A;  4HM1 B;  1LOX A;  2BMR B;  5CK6 A;  3H3H A; 
#chains in the Genus database with same CATH homology
 3B4P A;  3X3Z A;  4LEH A;  1KQS 2;  4TX4 A;  4H61 A;  1N9E A;  1DVC A;  1O7N B;  2P05 A;  3BLZ A;  2Y74 A;  4HM2 B;  4RZM A;  2PNC A;  2QEX 3;  2W9Q A;  1FGO A;  1M9G A;  1GY5 A;  4FMA A;  5AYR B;  3FCS B;  1CEW I;  4BTY A;  4XB5 A;  1W00 A;  4OUQ A;  3K63 A;  2IUJ A;  2W6J H;  2I9W A;  4WFO A;  1JJ2 2;  1SJW A;  3CCJ 3;  4G1M B;  2XR8 B;  1AVK A;  1NB3 I;  3EC9 A;  4O02 B;  2Y73 A;  1VQ6 3;  2RFR A;  2CG1 A;  1IT8 A;  4RBN A;  3FH1 A;  1VQK 3;  3LOY A;  1NO3 A;  3DGM A;  5TGN A;  3G6E 3;  3BNB A;  4XM4 A;  4JF8 A;  1TIJ A;  5EVH A;  2PZV A;  3H51 A;  2IA7 A;  1GY6 A;  3X3Y A;  3GWR A;  2RSX A;  2CWU A;  1IVX A;  1QAF A;  1K28 A;  3AMO A;  1UI8 A;  3N54 B;  4IT7 A;  2CIU A;  1IQY A;  3EQQ B;  1N9J A;  4HM0 B;  3WMD A;  1N8Q A;  1K73 4;  1OGX A;  1IV7 A;  2W56 B;  3SX1 A;  3EBT A;  4HBR A;  4HM3 B;  1W2B 2;  3MG1 A;  1HU9 A;  1PU4 A;  2GU1 A;  3S67 A;  2M7O A;  3SOY A;  1FA3 A;  1VQ5 3;  6STD A;  1WMN A;  3UL6 A;  1W4N A;  3CCL 3;  1TU5 A;  3UNL A;  1IDP A;  3CD6 3;  5KP3 A;  1A2V A;  2GBW B;  3KII A;  1STD A;  2Z76 A;  3PGB A;  2CC3 A;  7STD A;  4STD A;  3CME 3;  4FMC A;  1NJI 4;  3CC4 3;  3CCM 3;  1EQK A;  3HII A;  1IVV A;  1D6Y A;  4L8P A;  5AIH A;  2YX9 A;  3CCS 3;  3EHC A;  3V92 A;  5IER A;  3OWU A;  3KN4 A;  3HZP A;  1YHQ 3;  1QJG A;  1BUQ A;  5G2G A;  1OH0 A;  1EA2 A;  1W6G A;  4NRE A;  1UI7 A;  2W03 A;  2O3O A;  5CLK A;  5DRE A;  5AYS C;  1HKX A;  3CNX A;  4N6T A;  2HMO B;  3X3X A;  1CYV A;  1OHS A;  3UB1 A;  2D1W A;  2UX0 A;  3CCQ 3;  1OF5 A;  2P38 A;  1OHO A;  1TFK A;  2OCT A;  4GL6 A;  4I4K A;  3EJV A;  2E2U A;  3RDE A;  4HM4 B;  2GEX A;  3KSE D;  3NV0 B;  1JKG B;  4N6O B;  3FZW A;  1VQ8 3;  3K0Z A;  4KFD A;  4XDV A;  3U1W A;  5D81 A;  2XH9 A;  3F9S A;  3FF2 A;  2CW9 A;  1PFP A;  2HMN B;  2INX A;  1VQN 3;  2FXT A;  1FGT A;  3KFQ C;  1O7W B;  5EEO A;  4ZM8 A;  1Q82 4;  4EYC A;  4FCM A;  1TFO A;  1KC8 4;  2LQV A;  3WOD G;  1ZO2 A;  1U5O A;  1KD1 4;  3QK9 A;  3Q90 A;  2F86 B;  1TUH A;  3DUK A;  3IJE B;  1JB2 A;  3T8U A;  4MMZ B;  1A67 A;  4FMD A;  4MJD A;  3WA2 X;  1M1X B;  2CKF B;  1ZX2 A;  3I55 3;  2C11 A;  3F8X A;  2GEY A;  2STD A;  3DM8 A;  3U97 A;  3PXM A;  1N5H A;  3OV4 A;  3DGO A;  4WYK B;  3F8H A;  4HM6 B;  3G71 3;  4EC6 A;  5BXQ A;  3OX9 A;  1Q40 A;  1W01 A;  1DMQ A;  1E97 A;  4X2H A;  3B7C A;  3EX9 A;  5LC7 A;  3K7C A;  1DMN A;  1UUV B;  3V98 A;  3PYJ A;  2BMO B;  3V99 A;  5ELU A;  3LTB A;  1CQS A;  2O9U X;  3VF1 A;  3FKA A;  2BNG A;  3FLJ A;  5HGR A;  1IU7 A;  3IPT A;  3JUM A;  3STD A;  4AEQ A;  2XRX B;  4R80 A;  2HMM B;  3GZY B;  1OHP A;  1NWW A;  4O2H A;  5CF2 A;  3T0U A;  1O7G B;  3X40 A;  3MKI A;  4L7K A;  4N6L A;  5FGO A;  1OCV A;  3LTD A;  4K90 B;  1YJN 3;  3LTA A;  1QAL A;  2WGO A;  3JUP A;  3KZT A;  4MMY B;  2CFG A;  3EB8 A;  2FGT A;  4N6V 0;  2MF7 A;  2L4V A;  3MG3 A;  4BTW A;  3VSY A;  3OWS A;  1W6C A;  3JUQ A;  2OTJ 3;  1JN5 B;  1YIJ 3;  2E2V A;  1IK3 A;  4HVN A;  1YI2 3;  3JUN A;  4XBT A;  3KE7 A;  2D42 A;  3PS8 A;  3CCU 3;  2P09 A;  3VGN A;  3OWY A;  1VQL 3;  1D6Z A;  2KRT A;  3EF8 A;  3GZR A;  5IW9 A;  4FR9 A;  1YVB I;  2HMJ B;  5JPP A;  5KP4 A;  2KCD A;  1MOL A;  2V1L A;  4HJL B;  1Q7Y 4;  1ROV A;  4HKV B;  3K9M C;  4EV2 A;  3UL5 A;  3HI7 A;  4AKY A;  3SXX A;  1RKY A;  4KVH A;  2LYX A;  3MG2 A;  3G0K A;  3WDG B;  5IEP A;  3I56 3;  1VQ9 3;  1QVF 2;  1N8R 4;  3ER7 A;  5ELJ A;  5IEN A;  4FMB A;  3DXO A;  1R4C A;  3L0R A;  1N5P A;  4PEJ A;  1JV2 B;  4X2O A;  2W0Q A;  1O7H B;  4WP5 A;  3UJM A;  1VQO 3;  3MSO A;  1AV4 A;  1FGR A;  3Q2P A;  3AMO B;  4K1V A;  2RCD A;  3IMA B;  5IF6 A;  3T8N A;  3D3L A;  3J7Y d;  3PZW A;  4EV5 A;  1EKM A;  5AII A;  3X42 A;  5IG3 A;  2ML5 A;  1V74 A;  4OK0 A;  4JRF A;  2K54 A;  3CC7 3;  4H3U A;  3CCR 3;  1F8N A;  2ZL8 A;  4KFF A;  4O3V A;  2OQE A;  1STF I;  3CNM A;  1M90 4;  3N8B A;  3S29 A;  1OUN A;  2K0M A;  3M8C A;  3CXC 2;  1VQP 3;  2HMK B;  1O7M B;  5CXO A;  3DGL A;  4N6N B;  3F7S A;  1IV9 A;  4IIA A;  4R9K A;  2BO9 B;  2Q07 A;  1RN7 A;  4XBX A;  5IG0 A;  2CK3 H;  1A2K A;  3CC2 3;  2B24 B;  3JUO A;  2F98 A;  2WOF A;  3CMA 3;  2Z77 A;  4LZI A;  3LML A;  2GBX B;  2XGL A;  3PCS A;  1Y4K A;  5IEO A;  2QGU A;  2BHM A;  3NBR A;  3G8Z A;  3S5C A;  2WOH A;  1JB4 A;  2FNQ A;  4N3V A;  1UUW B;  1OF5 B;  2MC8 A;  3CCV 3;  3CCE 3;  2CFD A;  4L8O A;  2Z7A A;  3SOA A;  1GY7 A;  3NQZ A;  1W7C A;  4MMX B;  1E3V A;  3NQY A;  1RRL A;  3FF0 A;  1W02 A;  3D9R A;  2OWP A;  1VQ4 3;  3MYT A;  4U13 A;  1J2B A;  4R1K A;  4R4K A;  1ULI B;  3G16 A;  2OQE C;  3NM7 A;  2Z6B A;  3NM2 A;  3F14 A;  1TP6 A;  1WMO A;  2XSO B;  3MHE A;  4HM5 B;  1NB5 I;  1QVG 2;  4MEI A;  1SQW A;  2R4I A;  1UW1 A;  3FSD A;  5AIF A;  4AKZ A;  2W04 A;  1GD4 A;  4K61 A;  4XDW A;  2XEP A;  1D6U A;  2CG0 A;  1JNQ A;  2BMQ B;  1KSI A;  2JDI H;  1ULJ B;  3NXJ A;  3E99 A;  3DZL A;  5EQL A;  1KWI A;  1SIH A;  3KSP A;  3HX8 A;  1US1 A;  3B4O A;  3LXU X;  2CHC A;  3ROB A;  3F40 A;  5LC6 A;  2GXF A;  2YFI B;  1NU3 A;  3DY5 A;  3DMC A;  2B1X B;  4R9L A;  1Q40 B;  5AEU B;  1WTH A;  1IVW A;  2C10 A;  3RGA A;  2XF3 A;  2P0X A;  3FG1 A;  3CPW 2;  1A90 A;  3F7X A;  2XFT A;  4WHA A;  2CFL A;  2OTL 3;  1CYU A;  5IG5 A;  4ORL A;  3GZX B;  2W56 A;  2IUK A;  2XSH B;  4NHF A;  1ASK A;  2SBL A;  2CFW A;  2HML B;  4WWU C;  4HYZ A;  1VQ7 3;  4LSO A;  3PCR A;  2OOV C;  3DGN A;  1IQ8 A;  3NX0 A;  1VQM 3;  2JQ5 A;  1EG9 B;  1DYU A;  1K41 A;  1FUW A;  5KP1 A;  1SII A;  3Q1C A;  3WOE B;  2E2T A;  1IQX A;  1JB5 A;  2CH9 A;  4HZB B;  1W2Z A;  4EBG A;  1K8A 4;  2KXG A;  1YIT 3;  2XGN A;  3LH4 A;  4CCV A;  3S27 A;  1FGQ A;  3WA3 A;  3O8Y A;  2CWV A;  5AIG A;  1YJ9 3;  3SLU A;  1Q81 4;  2YFJ B;  2A15 A;  4RNZ A;  1S72 3;  3BND A;  3EBY A;  1ISK A;  3BB9 A;  4FCZ A;  5D83 A;  1IT7 A;  4QWT A;  1WQL B;  5JBS A;  1LNH A;  1OGZ A;  1Q86 4;  4KFE A;  3OW2 2;  2W9P A;  1Q42 A;  4RNY A;  3EN8 A;  3CU3 A;  3LYG A;  5IG4 A;  3NUV A;  4CDL A;  2YFL B;  3NV0 A;  1C7H A;  3EE1 A;  5DRV A;  1JKG A;  1OAC A;  3CPO A;  4EXR A;  3S28 A;  2QA4 3;  1YGE A;  3B8L A;  1RRH A;  3BNC A;  3NHX A;  3FG4 A;  4LMI A;  4HM7 B;  4O8S A;  4XBY A;  3FGY A;  5FW5 A;  3TDG A;  4KZ1 A;  5D82 A;  2WO0 A;  4GB5 A;  1GS3 A;  1L5G B;  3FG3 A;  3A76 A;  2BT3 A;  5I97 A;  5CF1 A;  4LGQ A;  3HK4 A;  2WGQ A;  1JRQ A;  3GZB A;  1LXE A;  1IVU A;  1LVN A;  3K5T A;  1GYB A;  3QRD A;  1QMA A;  1G96 A;  3EN1 B;  2XFS A;  3MWZ A;  5STD A;  1ROA A;  3N9H A;  1RJO A;  1Z1S A;  1DMM A;  3G4S 3;  4J8T A;  2CFK A;  1OPY A;  3HIG A;  3JVC A;  4WYK A;  2CWT A;  3I0Y A;  5AEW B;  1M1K 4;  3LZA A;  4Q53 A;  1YJW 3;  2ZDJ A;  3NBB A;  5AI1 A;  3BNE A;  3X41 A;  3LTC A;  1GD3 A;  2P0M A;  2W2C A;  3OXA A;  3ALA A;  3ECF A;  1S5A A;  3RGR A;  1VZZ A;  2F99 A;  1W5Z A;  2QIY A;  4OVM A;  3MPH A;  2OOV A;  3SED A;  1K9M 4;  1U8C B;  1SPU A;  1QAK A;  4J9A A;  3WOF B;  2RGQ A;  8CHO A;  1NDO B;  1FGM A;  2ML6 A;  3GAX A;  1MNL A;  1AR0 A;  1DVD A;  4HM8 B;  4FCJ A;  1W6Y A;  4K1U A;  1WNH A;  4HZ9 B;  3NBJ A;  1AVL A;  3GRD A;  4N6U A;  4IPB A;  1O7P B;  4BTX A;  1T5Y A;  4N6M A;  5JPU A;  5A0O B;  5BVB A;  3LT9 A;  3SVA A;  1WMP A;  3KKG A;  2GU3 A;  2IMJ A;  3LT8 A;  1E3R A;  1JN5 A;  4HM1 B;  1LOX A;  2BMR B;  5CK6 A;  3H3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...