4IPBA

Crystal structure of a duf2874 family protein (bacova_02504) from bacteroides ovatus atcc 8483 at 1.62 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
141
structure length
141
Chain Sequence
GDTPPGNVQSTFKKMYPKANGVAWSQDDGYYCANFAMNGFTKNVWFNVRGQWVMTLTDLVSLDRLTPTVYNAFVSGPYANWVVDNVTMVEFPKWQAIIVIKVGQDNVDIKYQLFYTPQGILLKTRNVSDMYDILGPSTFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_02504) from Bacteroides ovatus ATCC 8483 at 1.62 A resolution
rcsb
source organism Bacteroides ovatus
total genus 29
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11396 PepSY_like Putative beta-lactamase-inhibitor-like, PepSY-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ipbA00
3U1WA 4K61A 4FR9A 4HBRA 4IPBA
chains in the Genus database with same CATH superfamily
4XDVA 3T8NA 3DXOA 5IG0A 1GY5A 1DVCA 4FCZA 3LT9A 3NBRA 4AEQA 4N3VA 1OF5B 3ALAA 5A0OB 2QEX3 1T3BA 3CCQ3 1NDOB 1OUNA 1B2XA 2XFTA 1OGZA 5LC6A 1W6GA 3EQQB 3WODG 5JPUA 2QA43 2IYJA 2UGIA 2YFJB 3HK4A 4EV2A 4BTXA 3G4S3 4HM7B 1N8R4 2L1SA 3UJMA 4LYLB 4BL3A 2E2VA 1RGGA 3G8ZA 4U13A 1S5AA 1A2VA 3M8CA 2Y74A 3NV0A 4HAAA 1UUGB 2R41A 1D6YA 5CXOA 1CYUA 3DGLA 2IMJA 3CCL3 3I563 4N6MA 3A5EA 4TX4A 5HOHA 5KP4A 2HOHA 1X1UA 1T2HA 1W7CA 2IY2A 3CME3 1FGRA 1JB4A 4IPBA 2B24B 1NNVA 1I0XA 3PGBA 4N6UA 2GSPA 1CQSA 2Z6BA 4R80A 4GB5A 2HMKB 1U8CB 3G16A 3QK9A 1IU7A 2XRXB 1SJWA 2Z77A 3DMCA 1BRGA 3OWSA 3ECFA 1RN4A 3F8HA 5M19A 5FW5A 3Q1CA 1FUSA 1O7WB 1BIRA 4KFEA 4N6OB 1NO3A 4HOHA 1LNIA 5AYSC 1FGTA 4HZ9B 3VF1A 1NU3A 5EEOA 5BU4A 1JZOA 1B27A 2LYXA 2E2TA 1LRAA 3CD63 1GD3A 2ZHXB 2UX0A 3BLZA 3WHOA 1O7NB 1TTOA 1VQM3 1F8NA 1JRQA 1M1XB 2BHMA 2OWPA 2QIYA 3B8LA 2CG0A 2OOVA 2WOFA 1A67A 4IIAA 3B4PA 2CHCA 1WMOA 1W4NA 3F7XA 3LTDA 4EYCA 1QAKA 1STDA 4K90B 1LOVA 2YFLB 3EC9A 4N6LA 3FG1A 1VQP3 1OHPA 1OGXA 4ORLA 3KE7A 1L5GB 7STDA 3AHWA 4RNTA 1RGLA 3J7Yd 3CCV3 2CFGA 1FGOA 1B2UA 3EBYA 2RBIA 3F8XA 1KD14 4L7KA 2CWVA 1BRJA 3FG4A 1HYFA 1YJN3 8RNTA 1RGEA 1WNHA 1RN1A 3EN1B 2BU4A 3F14A 3NQYA 3PCRA 2C4BA 2HMMB 3EE1A 3FSDA 3IPTA 3FZWA 2K0MA 1IV7A 5BIRA 3GSPA 5JPPA 1I3FA 4BTWA 2CIUA 1YI23 1R4YA 1X1WA 3GRDA 3NXJA 3AGNA 4CJNA 2H0IA 3CC23 3KSED 2FGTA 4XBXA 5AI1A 4HZBB 3HOHA 4PEJA 2I9WA 1MWRA 2J8XB 1TJDA 3D9RA 2YX9A 2CWUA 4X2OA 5IG3A 1AVLA 4O02B 2Z7AA 4EW5A 3V99A 1I8VA 2W0QA 3SLUA 3DUKA 3G0KA 3K9MC 1K9M4 1JBTA 5IERA 2PZVA 1AQZA 1BNGA 2LQVA 1EKMA 1RGKA 1DMMA 3OX9A 4KZ1A 2RFRA 1N5PA 2CFKA 1GOUA 1W2B2 4BL2A 4RNZA 4LGQA 4HM5B 1FUWA 5M18A 1TP6A 4J8TA 1IVWA 2XGNA 2XSOB 3FLJA 3ZG5A 2W9QA 4J9AA 2OQEA 1KC84 2AAEA 3AHSA 5IEOA 1UCJA 1BNRA 4BTYA 2W2CA 2CWTA 1O7PB 9RNTA 2W6JH 3WA3A 1JBRA 3KFQC 1BSDA 4JF8A 5IG5A 2OTL3 1VQ83 4Q53A 1QJGA 3GWRA 3S5CA 2W04A 3BNDA 4J5KA 1JJ22 1SQWA 4H61A 1IDPA 1RTUA 4R1KA 1ISKA 2STDA 4K1UA 2AADA 1LNHA 1JB2A 3LMLA 1GMRA 1RJOA 2OCTA 1TRPA 4MJDA 1IQ8A 3B7CA 2P05A 3MHEA 1Y4KA 3D4AA 2XSHB 4LZIA 4XDWA 3SXXA 2KF5A 3MYTA 4ILFA 1B20A 1SPUA 1BRKA 3MSOA 4GSPA 3UB1A 4HYZA 4HM3B 2F86B 1BNIA 2B1XB 4OUQA 4CCVA 1IK3A 3CCE3 1IT8A 1JZDA 3JUMA 2W56A 4KFFA 5EVHA 3HIGA 4JRFA 2JDIH 1DE3A 1HKXA 1UCLA 3MKIA 2F98A 1UI8A 5IG4A 1GSPA 2OQEC 2A15A 3JUNA 4CDLA 1IVXA 1T2IA 2SBLA 1RN7A 1IVUA 4RNYA 1GOVA 5G1KA 1OCVA 3V98A 1B21A 4X2HA 2C11A 3JVCA 5AIIA 4LMIA 2XGLA 5FGOA 1Q42A 4FMBA 5CF1A 3PCSA 4BIRA 2CFLA 1OHOA 1A90A 1BSBA 3WOFB 1RNBA 3X40A 3KZTA 1S723 1C54A 1OF5A 3LH4A 2GBXB 2GXFA 6RNTA 1PU4A 1VQO3 1A2KA 3CCJ3 3V92A 3X41A 2P09A 1PYLA 4HM1B 4STDA 5IW9A 1FA3A 7GSPA 3FF0A 5KP3A 1VQ73 3CNXA 1KQS2 5JBSA 2BMOB 4KT3B 1JB5A 1OPYA 1DMNA 3MG1A 3VSYA 1JNQA 3CCR3 2L4VA 2RCDA 4N6V0 3DGMA 3NM7A 3K7CA 1KWIA 1GYBA 3KSPA 1BUQA 3DH2A 5G1LA 1V74A 3GZBA 1NWWA 2Y73A 1WMNA 3S28A 4XBYA 5DRVA 2KF4A 1UDII 2F99A 1VQQA 3EJVA 4MMZB 1BRHA 1BGSA 5M1AA 1PY3A 3N9HA 3Q90A 1VQ43 2CG1A 1VZZA 1FZUA 2ZA4A 3LXUX 2HMJB 1W6YA 1W5ZA 3ZFZA 3X42A 5AEWB 3T8UA 5IEPA 2WOHA 3PZWA 1G0TA 1GMQA 4NREA 4HM6B 2FXTA 1V57A 3N54B 1BVIA 1QAFA 3JUPA 3HZPA 4FMCA 1ZX2A 3FCSB 5AYRB 3HI7A 3CMA3 7RNTA 1VQN3 3DZLA 4I5QA 3FF2A 1V58A 2KF6A 2KRTA 3LT8A 1ZS7A 1I3IA 1RGHA 1Q814 1A2PA 1J2BA 1E3RA 1BSEA 1W6CA 3KN4A 1BNJA 1DVDA 3URPA 2ML6A 1KSIA 4DKIA 1LXEA 4O2HA 3DY5A 1E3VA 1MOLA 4N6TA 3UNLA 1YHQ3 5LC7A 2F4YA 4LEHA 1LQGC 4WHAA 3BNCA 3K63A 2OOVC 3D5IA 1GD4A 1OACA 4BU4A 3EX9A 1BRNL 4HM4B 1YJ93 1DETA 2BO9B 1W00A 1G96A 3X3YA 5AIGA 1MGWA 1Q824 3SOYA 4O8SA 1VQ93 1I70A 1QMAA 1X1YA 4L8PA 4FCJA 1BANA 2BNGA 3K5TA 1JKGB 2CX1A 1AV4A 1W02A 3ZG0A 1BNSA 2ZDJA 3CCS3 3GZYB 1IT7A 3ROBA 2SARA 5BVBA 5CK6A 4AKZA 3SOAA 3O8YA 2GEYA 3IJEB 1UI7A 3E99A 3WOEB 1ZGXA 2CK3H 1UGIA 3AMOB 4WYKB 2ML5A 1STFI 1UCKA 2V1LA 1FGQA 3LTAA 4HM0B 1K8A4 2K3DA 4XM4A 3EHCA 3SVAA 1Z1SA 1NB3I 2UUGC 1EUIC 1WMPA 5D83A 2F5MA 1FYSA 1LOXA 3D5GA 3U1WA 2W9PA 1JKGA 1MWTA 1MWUA 2CKFB 4GL6A 4K61A 1MWSA 5AIFA 1ULIB 4HBRA 3I553 1CEWI 1X1XA 1GMPA 4K1VA 2CFWA 6STDA 5CLKA 3BB9A 3U97A 1JBSA 3CXC2 3OV4A 1EEJA 3RGAA 1RMSA 3ER7A 3X3XA 1O7MB 6GSPA 1ZO2A 2Z76A 1EQKA 3N8BA 5RNTA 1K41A 1GY6A 1W01A 1ASKA 3PXMA 2GU3A 4WYKA 4MMYB 2YFIB 1LOWA 1RRLA 3EN8A 1ROAA 3NV0B 3LOYA 1RKYA 1VQL3 4KFDA 3WA2X 3F7SA 5AEUB 1FW7A 1TRQA 2C10A 2WO0A 1DMQA 4G1MB 3GZXB 1RCLA 1CH0A 3NUVA 3NQZA 4OK0A 1I2GA 1QVG2 3H51A 1MGRA 5IENA 1SIHA 2JQ5A 4KVHA 2W03A 4WP5A 3QRDA 1GY7A 1BNFA 1BRSA 4L8OA 3WDGB 1M1K4 1VQ53 2WGOA 1D6ZA 3NBBA 1AVKA 3AGOA 3DM8A 1RGAA 1QALA 3A76A 3G6E3 2CH9A 3S67A 1YGEA 3HIIA 5D81A 3TDGA 1O7HB 1UGHI 4AKYA 1B2MA 2GBWB 2IA7A 1N5HA 2P0XA 5D82A 1ROVA 1I0VA 1TU5A 4FR9A 1HU9A 2D1WA 4MEIA 3RNTA 3BNBA 1YGWA 1C7HA 5ELUA 4R9KA 5G2GA 3OW22 3RGRA 4NPBA 3OXAA 1MNLA 1U5OA 4H3UA 1TFOA 1LQMB 1PFPA 4EC6A 1RCKA 4FCMA 4I4KA 1G02A 1LOYA 3KKGA 3F40A 3JUQA 2INXA 3Q2PA 5KP1A 1GOYA 3SX1A 2GEXA 2CW9A 1UUVB 2XR8B 5BXQA 4WFOA 1BNEA 1OH0A 2KCDA 3LYGA 1WTHA 3CNMA 4HVNA 2M7OA 4FMDA 3MG2A 1HZ1A 3CPW2 3NHXA 2BIRA 3LZAA 8CHOA 4EBGA 2H0HA 3CC73 3MWZA 2RSXA 3EF8A 2KXGA 1RHLA 3LTBA 3VGNA 2FNQA 2XEPA 3UL6A 2HMOB 3HX8A 3UL5A 1YVSA 3CU3A 2XH9A 5STDA 1RDSA 3D3LA 4HM8B 2D42A 3OWUA 3BNEA 1DYUA 3JUOA 1YIT3 2O3OA 5ELJA 2QGUA 1RLSA 1FUTA 1M9GA 4R9LA 3S29A 1BSAA 1IVVA 2BT3A 4HKVB 1TUHA 1BAOA 4HM2B 2R4IA 4MMXB 1UCIA 1BU4A 1JN5B 3FGYA 3LTCA 3F9SA 4RBNA 3SEDA 3G713 1IYYA 1ULJB 1W2ZA 3L0RA 1CYVA 1WQLB 1JV2B 3I0YA 1M904 2RGQA 2H0GA 3NX0A 1T5YA 2E2UA 5I97A 1QVF2 1N8QA 1B2ZA 1AR0A 2IUKA 2WGQA 4XB5A 2PNCA 1I2FA 1RGFA 2P38A 4QWTA 1US1A 5HGRA 2XF3A 1UUWB 2RNTA 2BMQB 1RRHA 2ZL8A 1I2EA 3KIIA 1BRIA 1GS3A 1EG9B 1Q7HA 3MG3A 1D6UA 3D79A 1RGCA 2Q07A 4N6NB 3WMDA 3CCM3 2OTJ3 1BUJA 1Q40B 3PS8A 1Q864 1N9JA 4WWUC 2KAAA 1SARA 2GU1A 3KCHA 3STDA 5IF6A 5GSPA 1TFKA 1IV9A 2MF7A 2HMNB 1B2SA 1OHSA 1N9EA 3EB8A 1JN5A 3IMAB 3GAXA 2CC3A 4R4KA 3PYJA 1EA2A 3NBJA 3GZRA 4EV5A 3CCU3 3CC43 5DREA 4EXRA 1E97A 1B3SA 4O3VA 1VQ63 3K0ZA 1RSNA 3FH1A 1O7GB 1Q7Y4 4ZM8A 1FGMA 1K28A 1BOXA 3NM2A 1BSCA 3WR2A 1NJI4 3OWYA 2MC8A 4NHFA 3BIRA 3X3ZA 1Q9EA 1AY7A 2CFDA 1LVNA 1IQXA 3FKAA 3DGNA 4CPKA 2O9UX 2W56B 4FMAA 1Q40A 1TIJA 2BMRB 1YIJ3 1YJW3 4GHOA 4LSOA 1SIIA 4J5GA 3SYUA 1VQK3 3DGOA 4IT7A 4RZMA 5TGNA 2F5WA 2XFSA 3RDEA 3FG3A 1UW1A 3MPHA 3T0UA 2K54A 3S27A 2P0MA 1IQYA 4HJLB 2CX0A 1NB5I 3AMOA 2F56A 1R4CA 2KF3A 2HMLB 3EBTA 3B4OA 3DGYA 3H3HA 4XBTA 3Q3FA 5AIHA 1K734 5EQLA 1RNTA 3BU4A 1YNVX 3CPOA 4OVMA 5CF2A 1YVBI 2IUJA
chains in the Genus database with same CATH topology
4XDVA 3T8NA 3DXOA 5IG0A 1GY5A 1DVCA 4FCZA 3LT9A 3NBRA 4AEQA 4N3VA 1OF5B 3ALAA 5A0OB 2QEX3 3CCQ3 1NDOB 1OUNA 2XFTA 1OGZA 5LC6A 1W6GA 3EQQB 3WODG 5JPUA 2QA43 2YFJB 3HK4A 4EV2A 4BTXA 3G4S3 4HM7B 1N8R4 3UJMA 2E2VA 3G8ZA 4U13A 1S5AA 1A2VA 3M8CA 2Y74A 3NV0A 1D6YA 5CXOA 1CYUA 3DGLA 2IMJA 3CCL3 3I563 4N6MA 4TX4A 5KP4A 1W7CA 3CME3 1FGRA 1JB4A 4IPBA 2B24B 3PGBA 4N6UA 1CQSA 2Z6BA 4R80A 4GB5A 2HMKB 1U8CB 3G16A 3QK9A 1IU7A 2XRXB 1SJWA 2Z77A 3DMCA 3OWSA 3ECFA 3F8HA 5FW5A 3Q1CA 1O7WB 4KFEA 4N6OB 1NO3A 5AYSC 1FGTA 4HZ9B 3VF1A 1NU3A 5EEOA 2LYXA 2E2TA 3CD63 1GD3A 2UX0A 3BLZA 1O7NB 1VQM3 1F8NA 1JRQA 1M1XB 2BHMA 2OWPA 2QIYA 3B8LA 2CG0A 2OOVA 2WOFA 1A67A 4IIAA 3B4PA 2CHCA 1WMOA 1W4NA 3F7XA 3LTDA 4EYCA 1QAKA 1STDA 4K90B 2YFLB 3EC9A 4N6LA 3FG1A 1VQP3 1OHPA 1OGXA 4ORLA 3KE7A 1L5GB 7STDA 3J7Yd 3CCV3 2CFGA 1FGOA 3EBYA 3F8XA 1KD14 4L7KA 2CWVA 3FG4A 1YJN3 1WNHA 3EN1B 3F14A 3NQYA 3PCRA 3EE1A 2HMMB 3FSDA 3IPTA 3FZWA 2K0MA 1IV7A 5JPPA 4BTWA 2CIUA 1YI23 3GRDA 3NXJA 3CC23 3KSED 2FGTA 4XBXA 5AI1A 4HZBB 4PEJA 2I9WA 3D9RA 2YX9A 2CWUA 4X2OA 5IG3A 1AVLA 4O02B 2Z7AA 3V99A 3SLUA 2W0QA 3DUKA 3G0KA 3K9MC 1K9M4 5IERA 2PZVA 2LQVA 1EKMA 1DMMA 3OX9A 4KZ1A 2RFRA 2CFKA 1N5PA 1W2B2 4RNZA 4LGQA 4HM5B 1FUWA 1TP6A 4J8TA 1IVWA 2XGNA 2XSOB 3FLJA 2W9QA 4J9AA 2OQEA 1KC84 5IEOA 4BTYA 2W2CA 2CWTA 1O7PB 2W6JH 3WA3A 3KFQC 4JF8A 5IG5A 2OTL3 1VQ83 4Q53A 1QJGA 3GWRA 3S5CA 2W04A 3BNDA 1JJ22 1SQWA 4H61A 1IDPA 4R1KA 1ISKA 2STDA 4K1UA 1LNHA 1JB2A 3LMLA 1RJOA 2OCTA 4MJDA 1IQ8A 3B7CA 2P05A 3MHEA 1Y4KA 4LZIA 2XSHB 3SXXA 4XDWA 3MYTA 1SPUA 3MSOA 3UB1A 4HYZA 4HM3B 2F86B 2B1XB 4OUQA 4CCVA 1IK3A 3CCE3 1IT8A 3JUMA 2W56A 4KFFA 5EVHA 3HIGA 4JRFA 2JDIH 1HKXA 3MKIA 2F98A 1UI8A 5IG4A 2OQEC 2A15A 3JUNA 4CDLA 1IVXA 2SBLA 1RN7A 1IVUA 4RNYA 1OCVA 3V98A 4X2HA 2C11A 3JVCA 5AIIA 4LMIA 2XGLA 5FGOA 1Q42A 4FMBA 5CF1A 3PCSA 2CFLA 1OHOA 1A90A 3WOFB 3X40A 3KZTA 1S723 1OF5A 3LH4A 2GBXB 2GXFA 1PU4A 1VQO3 1A2KA 3CCJ3 3V92A 3X41A 2P09A 4HM1B 4STDA 5IW9A 1FA3A 1VQ73 3FF0A 5KP3A 3CNXA 1KQS2 5JBSA 2BMOB 1JB5A 1OPYA 1DMNA 3MG1A 3VSYA 1JNQA 3CCR3 2L4VA 2RCDA 4N6V0 3DGMA 3NM7A 3K7CA 1KWIA 1GYBA 3KSPA 1BUQA 1V74A 3GZBA 1NWWA 2Y73A 1WMNA 3S28A 4XBYA 5DRVA 3EJVA 3CXC2 2F99A 4MMZB 3N9HA 3Q90A 1VQ43 2CG1A 1VZZA 3LXUX 2HMJB 1W6YA 1W5ZA 3X42A 5AEWB 3T8UA 5IEPA 2WOHA 3PZWA 4NREA 4HM6B 2FXTA 3N54B 1QAFA 3JUPA 3HZPA 4FMCA 1ZX2A 3FCSB 5AYRB 3HI7A 3CMA3 1VQN3 3DZLA 3FF2A 2KRTA 3LT8A 1Q814 1J2BA 1E3RA 1W6CA 3KN4A 1DVDA 2ML6A 1KSIA 1LXEA 4O2HA 3DY5A 1E3VA 1MOLA 4N6TA 3UNLA 1YHQ3 5LC7A 4LEHA 4WHAA 3BNCA 3K63A 2OOVC 1GD4A 1OACA 3EX9A 4HM4B 1YJ93 2BO9B 1W00A 1G96A 3X3YA 5AIGA 1Q824 3SOYA 4O8SA 1VQ93 1QMAA 4L8PA 4FCJA 2BNGA 3K5TA 1JKGB 1AV4A 1W02A 2ZDJA 3CCS3 3GZYB 1IT7A 3ROBA 5BVBA 5CK6A 4AKZA 3SOAA 3O8YA 2GEYA 3IJEB 1UI7A 3E99A 3WOEB 2CK3H 3AMOB 4WYKB 2ML5A 1STFI 2V1LA 1FGQA 3LTAA 4HM0B 1K8A4 4XM4A 3EHCA 3SVAA 1Z1SA 1NB3I 1WMPA 5D83A 1LOXA 3U1WA 2W9PA 1JKGA 4GL6A 2CKFB 4K61A 5AIFA 3I553 1ULIB 4HBRA 1CEWI 4K1VA 2CFWA 6STDA 5CLKA 3BB9A 3U97A 3OV4A 3RGAA 3ER7A 3X3XA 1O7MB 1ZO2A 2Z76A 1EQKA 3N8BA 1K41A 1GY6A 1W01A 1ASKA 3PXMA 2GU3A 4WYKA 4MMYB 2YFIB 1RRLA 3EN8A 1ROAA 3NV0B 3LOYA 1RKYA 1VQL3 4KFDA 3WA2X 3F7SA 5AEUB 2C10A 2WO0A 1DMQA 4G1MB 3GZXB 3NUVA 3NQZA 4OK0A 1QVG2 3H51A 5IENA 1SIHA 2JQ5A 4KVHA 2W03A 4WP5A 3QRDA 1GY7A 4L8OA 3WDGB 1M1K4 1VQ53 2WGOA 1D6ZA 3NBBA 1AVKA 3DM8A 3A76A 1QALA 3G6E3 2CH9A 3S67A 1YGEA 3HIIA 5D81A 3TDGA 1O7HB 4AKYA 2GBWB 2IA7A 1N5HA 2P0XA 5D82A 1ROVA 1TU5A 4FR9A 1HU9A 2D1WA 4MEIA 3BNBA 1C7HA 5ELUA 4R9KA 5G2GA 3OW22 3RGRA 3OXAA 1MNLA 1U5OA 4H3UA 1TFOA 1PFPA 4EC6A 4FCMA 4I4KA 3KKGA 3F40A 3JUQA 2INXA 5KP1A 3SX1A 2GEXA 2CW9A 1UUVB 2XR8B 5BXQA 4WFOA 1OH0A 2KCDA 3LYGA 1WTHA 3CNMA 4HVNA 2M7OA 4FMDA 3MG2A 3CPW2 3NHXA 3LZAA 8CHOA 4EBGA 3CC73 3MWZA 2RSXA 3EF8A 2KXGA 3LTBA 3VGNA 2FNQA 2XEPA 3UL6A 2HMOB 3HX8A 3UL5A 3CU3A 2XH9A 5STDA 3D3LA 4HM8B 2D42A 3OWUA 3BNEA 1DYUA 3JUOA 1YIT3 2O3OA 5ELJA 2QGUA 1M9GA 4R9LA 3S29A 1IVVA 2BT3A 4HKVB 1TUHA 4HM2B 2R4IA 4MMXB 3SEDA 1JN5B 3FGYA 3G713 3LTCA 3F9SA 4RBNA 1ULJB 1W2ZA 3L0RA 1CYVA 1WQLB 1JV2B 3I0YA 1M904 2RGQA 3NX0A 5I97A 1T5YA 2E2UA 1QVF2 1N8QA 1AR0A 2IUKA 2WGQA 4XB5A 2PNCA 2P38A 4QWTA 1US1A 5HGRA 2XF3A 1UUWB 2BMQB 1RRHA 2ZL8A 3KIIA 3Q2PA 1GS3A 4N6NB 1EG9B 3MG3A 3WMDA 1D6UA 3CCM3 2Q07A 2OTJ3 1Q40B 3PS8A 1Q864 1N9JA 4WWUC 2GU1A 3STDA 5IF6A 1TFKA 1IV9A 2MF7A 2HMNB 1OHSA 1N9EA 3EB8A 1JN5A 3IMAB 3GAXA 2CC3A 4R4KA 3PYJA 1EA2A 3NBJA 3GZRA 4EV5A 3CCU3 3CC43 5DREA 4EXRA 1E97A 4O3VA 1VQ63 3K0ZA 3FH1A 1O7GB 1Q7Y4 4ZM8A 1FGMA 1K28A 3NM2A 1NJI4 3OWYA 2MC8A 4NHFA 3X3ZA 2CFDA 1LVNA 1IQXA 3FKAA 3DGNA 2O9UX 2W56B 4FMAA 1Q40A 1TIJA 2BMRB 1YIJ3 1YJW3 4LSOA 1SIIA 1VQK3 3DGOA 4IT7A 4RZMA 5TGNA 2XFSA 3RDEA 3FG3A 1UW1A 3MPHA 3T0UA 2K54A 3S27A 2P0MA 1IQYA 4HJLB 1NB5I 3AMOA 1R4CA 2HMLB 3EBTA 3B4OA 3H3HA 4XBTA 5AIHA 1K734 5EQLA 3CPOA 4OVMA 5CF2A 1YVBI 2IUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1W A;  4K61 A;  4FR9 A;  4HBR A;  4IPB A; 
#chains in the Genus database with same CATH topology
 4XDV A;  3T8N A;  3DXO A;  5IG0 A;  1GY5 A;  1DVC A;  4FCZ A;  3LT9 A;  3NBR A;  4AEQ A;  4N3V A;  1OF5 B;  3ALA A;  5A0O B;  2QEX 3;  1T3B A;  3CCQ 3;  1NDO B;  1OUN A;  1B2X A;  2XFT A;  1OGZ A;  5LC6 A;  1W6G A;  3EQQ B;  3WOD G;  5JPU A;  2QA4 3;  2IYJ A;  2UGI A;  2YFJ B;  3HK4 A;  4EV2 A;  4BTX A;  3G4S 3;  4HM7 B;  1N8R 4;  2L1S A;  3UJM A;  4LYL B;  4BL3 A;  2E2V A;  1RGG A;  3G8Z A;  4U13 A;  1S5A A;  1A2V A;  3M8C A;  2Y74 A;  3NV0 A;  4HAA A;  1UUG B;  2R41 A;  1D6Y A;  5CXO A;  1CYU A;  3DGL A;  2IMJ A;  3CCL 3;  3I56 3;  4N6M A;  3A5E A;  4TX4 A;  5HOH A;  5KP4 A;  2HOH A;  1X1U A;  1T2H A;  1W7C A;  2IY2 A;  3CME 3;  1FGR A;  1JB4 A;  4IPB A;  2B24 B;  1NNV A;  1I0X A;  3PGB A;  4N6U A;  2GSP A;  1CQS A;  2Z6B A;  4R80 A;  4GB5 A;  2HMK B;  1U8C B;  3G16 A;  3QK9 A;  1IU7 A;  2XRX B;  1SJW A;  2Z77 A;  3DMC A;  1BRG A;  3OWS A;  3ECF A;  1RN4 A;  3F8H A;  5M19 A;  5FW5 A;  3Q1C A;  1FUS A;  1O7W B;  1BIR A;  4KFE A;  4N6O B;  1NO3 A;  4HOH A;  1LNI A;  5AYS C;  1FGT A;  4HZ9 B;  3VF1 A;  1NU3 A;  5EEO A;  5BU4 A;  1JZO A;  1B27 A;  2LYX A;  2E2T A;  1LRA A;  3CD6 3;  1GD3 A;  2ZHX B;  2UX0 A;  3BLZ A;  3WHO A;  1O7N B;  1TTO A;  1VQM 3;  1F8N A;  1JRQ A;  1M1X B;  2BHM A;  2OWP A;  2QIY A;  3B8L A;  2CG0 A;  2OOV A;  2WOF A;  1A67 A;  4IIA A;  3B4P A;  2CHC A;  1WMO A;  1W4N A;  3F7X A;  3LTD A;  4EYC A;  1QAK A;  1STD A;  4K90 B;  1LOV A;  2YFL B;  3EC9 A;  4N6L A;  3FG1 A;  1VQP 3;  1OHP A;  1OGX A;  4ORL A;  3KE7 A;  1L5G B;  7STD A;  3AHW A;  4RNT A;  1RGL A;  3J7Y d;  3CCV 3;  2CFG A;  1FGO A;  1B2U A;  3EBY A;  2RBI A;  3F8X A;  1KD1 4;  4L7K A;  2CWV A;  1BRJ A;  3FG4 A;  1HYF A;  1YJN 3;  8RNT A;  1RGE A;  1WNH A;  1RN1 A;  3EN1 B;  2BU4 A;  3F14 A;  3NQY A;  3PCR A;  2C4B A;  2HMM B;  3EE1 A;  3FSD A;  3IPT A;  3FZW A;  2K0M A;  1IV7 A;  5BIR A;  3GSP A;  5JPP A;  1I3F A;  4BTW A;  2CIU A;  1YI2 3;  1R4Y A;  1X1W A;  3GRD A;  3NXJ A;  3AGN A;  4CJN A;  2H0I A;  3CC2 3;  3KSE D;  2FGT A;  4XBX A;  5AI1 A;  4HZB B;  3HOH A;  4PEJ A;  2I9W A;  1MWR A;  2J8X B;  1TJD A;  3D9R A;  2YX9 A;  2CWU A;  4X2O A;  5IG3 A;  1AVL A;  4O02 B;  2Z7A A;  4EW5 A;  3V99 A;  1I8V A;  2W0Q A;  3SLU A;  3DUK A;  3G0K A;  3K9M C;  1K9M 4;  1JBT A;  5IER A;  2PZV A;  1AQZ A;  1BNG A;  2LQV A;  1EKM A;  1RGK A;  1DMM A;  3OX9 A;  4KZ1 A;  2RFR A;  1N5P A;  2CFK A;  1GOU A;  1W2B 2;  4BL2 A;  4RNZ A;  4LGQ A;  4HM5 B;  1FUW A;  5M18 A;  1TP6 A;  4J8T A;  1IVW A;  2XGN A;  2XSO B;  3FLJ A;  3ZG5 A;  2W9Q A;  4J9A A;  2OQE A;  1KC8 4;  2AAE A;  3AHS A;  5IEO A;  1UCJ A;  1BNR A;  4BTY A;  2W2C A;  2CWT A;  1O7P B;  9RNT A;  2W6J H;  3WA3 A;  1JBR A;  3KFQ C;  1BSD A;  4JF8 A;  5IG5 A;  2OTL 3;  1VQ8 3;  4Q53 A;  1QJG A;  3GWR A;  3S5C A;  2W04 A;  3BND A;  4J5K A;  1JJ2 2;  1SQW A;  4H61 A;  1IDP A;  1RTU A;  4R1K A;  1ISK A;  2STD A;  4K1U A;  2AAD A;  1LNH A;  1JB2 A;  3LML A;  1GMR A;  1RJO A;  2OCT A;  1TRP A;  4MJD A;  1IQ8 A;  3B7C A;  2P05 A;  3MHE A;  1Y4K A;  3D4A A;  2XSH B;  4LZI A;  4XDW A;  3SXX A;  2KF5 A;  3MYT A;  4ILF A;  1B20 A;  1SPU A;  1BRK A;  3MSO A;  4GSP A;  3UB1 A;  4HYZ A;  4HM3 B;  2F86 B;  1BNI A;  2B1X B;  4OUQ A;  4CCV A;  1IK3 A;  3CCE 3;  1IT8 A;  1JZD A;  3JUM A;  2W56 A;  4KFF A;  5EVH A;  3HIG A;  4JRF A;  2JDI H;  1DE3 A;  1HKX A;  1UCL A;  3MKI A;  2F98 A;  1UI8 A;  5IG4 A;  1GSP A;  2OQE C;  2A15 A;  3JUN A;  4CDL A;  1IVX A;  1T2I A;  2SBL A;  1RN7 A;  1IVU A;  4RNY A;  1GOV A;  5G1K A;  1OCV A;  3V98 A;  1B21 A;  4X2H A;  2C11 A;  3JVC A;  5AII A;  4LMI A;  2XGL A;  5FGO A;  1Q42 A;  4FMB A;  5CF1 A;  3PCS A;  4BIR A;  2CFL A;  1OHO A;  1A90 A;  1BSB A;  3WOF B;  1RNB A;  3X40 A;  3KZT A;  1S72 3;  1C54 A;  1OF5 A;  3LH4 A;  2GBX B;  2GXF A;  6RNT A;  1PU4 A;  1VQO 3;  1A2K A;  3CCJ 3;  3V92 A;  3X41 A;  2P09 A;  1PYL A;  4HM1 B;  4STD A;  5IW9 A;  1FA3 A;  7GSP A;  3FF0 A;  5KP3 A;  1VQ7 3;  3CNX A;  1KQS 2;  5JBS A;  2BMO B;  4KT3 B;  1JB5 A;  1OPY A;  1DMN A;  3MG1 A;  3VSY A;  1JNQ A;  3CCR 3;  2L4V A;  2RCD A;  4N6V 0;  3DGM A;  3NM7 A;  3K7C A;  1KWI A;  1GYB A;  3KSP A;  1BUQ A;  3DH2 A;  5G1L A;  1V74 A;  3GZB A;  1NWW A;  2Y73 A;  1WMN A;  3S28 A;  4XBY A;  5DRV A;  2KF4 A;  1UDI I;  2F99 A;  1VQQ A;  3EJV A;  4MMZ B;  1BRH A;  1BGS A;  5M1A A;  1PY3 A;  3N9H A;  3Q90 A;  1VQ4 3;  2CG1 A;  1VZZ A;  1FZU A;  2ZA4 A;  3LXU X;  2HMJ B;  1W6Y A;  1W5Z A;  3ZFZ A;  3X42 A;  5AEW B;  3T8U A;  5IEP A;  2WOH A;  3PZW A;  1G0T A;  1GMQ A;  4NRE A;  4HM6 B;  2FXT A;  1V57 A;  3N54 B;  1BVI A;  1QAF A;  3JUP A;  3HZP A;  4FMC A;  1ZX2 A;  3FCS B;  5AYR B;  3HI7 A;  3CMA 3;  7RNT A;  1VQN 3;  3DZL A;  4I5Q A;  3FF2 A;  1V58 A;  2KF6 A;  2KRT A;  3LT8 A;  1ZS7 A;  1I3I A;  1RGH A;  1Q81 4;  1A2P A;  1J2B A;  1E3R A;  1BSE A;  1W6C A;  3KN4 A;  1BNJ A;  1DVD A;  3URP A;  2ML6 A;  1KSI A;  4DKI A;  1LXE A;  4O2H A;  3DY5 A;  1E3V A;  1MOL A;  4N6T A;  3UNL A;  1YHQ 3;  5LC7 A;  2F4Y A;  4LEH A;  1LQG C;  4WHA A;  3BNC A;  3K63 A;  2OOV C;  3D5I A;  1GD4 A;  1OAC A;  4BU4 A;  3EX9 A;  1BRN L;  4HM4 B;  1YJ9 3;  1DET A;  2BO9 B;  1W00 A;  1G96 A;  3X3Y A;  5AIG A;  1MGW A;  1Q82 4;  3SOY A;  4O8S A;  1VQ9 3;  1I70 A;  1QMA A;  1X1Y A;  4L8P A;  4FCJ A;  1BAN A;  2BNG A;  3K5T A;  1JKG B;  2CX1 A;  1AV4 A;  1W02 A;  3ZG0 A;  1BNS A;  2ZDJ A;  3CCS 3;  3GZY B;  1IT7 A;  3ROB A;  2SAR A;  5BVB A;  5CK6 A;  4AKZ A;  3SOA A;  3O8Y A;  2GEY A;  3IJE B;  1UI7 A;  3E99 A;  3WOE B;  1ZGX A;  2CK3 H;  1UGI A;  3AMO B;  4WYK B;  2ML5 A;  1STF I;  1UCK A;  2V1L A;  1FGQ A;  3LTA A;  4HM0 B;  1K8A 4;  2K3D A;  4XM4 A;  3EHC A;  3SVA A;  1Z1S A;  1NB3 I;  2UUG C;  1EUI C;  1WMP A;  5D83 A;  2F5M A;  1FYS A;  1LOX A;  3D5G A;  3U1W A;  2W9P A;  1JKG A;  1MWT A;  1MWU A;  2CKF B;  4GL6 A;  4K61 A;  1MWS A;  5AIF A;  1ULI B;  4HBR A;  3I55 3;  1CEW I;  1X1X A;  1GMP A;  4K1V A;  2CFW A;  6STD A;  5CLK A;  3BB9 A;  3U97 A;  1JBS A;  3CXC 2;  3OV4 A;  1EEJ A;  3RGA A;  1RMS A;  3ER7 A;  3X3X A;  1O7M B;  6GSP A;  1ZO2 A;  2Z76 A;  1EQK A;  3N8B A;  5RNT A;  1K41 A;  1GY6 A;  1W01 A;  1ASK A;  3PXM A;  2GU3 A;  4WYK A;  4MMY B;  2YFI B;  1LOW A;  1RRL A;  3EN8 A;  1ROA A;  3NV0 B;  3LOY A;  1RKY A;  1VQL 3;  4KFD A;  3WA2 X;  3F7S A;  5AEU B;  1FW7 A;  1TRQ A;  2C10 A;  2WO0 A;  1DMQ A;  4G1M B;  3GZX B;  1RCL A;  1CH0 A;  3NUV A;  3NQZ A;  4OK0 A;  1I2G A;  1QVG 2;  3H51 A;  1MGR A;  5IEN A;  1SIH A;  2JQ5 A;  4KVH A;  2W03 A;  4WP5 A;  3QRD A;  1GY7 A;  1BNF A;  1BRS A;  4L8O A;  3WDG B;  1M1K 4;  1VQ5 3;  2WGO A;  1D6Z A;  3NBB A;  1AVK A;  3AGO A;  3DM8 A;  1RGA A;  1QAL A;  3A76 A;  3G6E 3;  2CH9 A;  3S67 A;  1YGE A;  3HII A;  5D81 A;  3TDG A;  1O7H B;  1UGH I;  4AKY A;  1B2M A;  2GBW B;  2IA7 A;  1N5H A;  2P0X A;  5D82 A;  1ROV A;  1I0V A;  1TU5 A;  4FR9 A;  1HU9 A;  2D1W A;  4MEI A;  3RNT A;  3BNB A;  1YGW A;  1C7H A;  5ELU A;  4R9K A;  5G2G A;  3OW2 2;  3RGR A;  4NPB A;  3OXA A;  1MNL A;  1U5O A;  4H3U A;  1TFO A;  1LQM B;  1PFP A;  4EC6 A;  1RCK A;  4FCM A;  4I4K A;  1G02 A;  1LOY A;  3KKG A;  3F40 A;  3JUQ A;  2INX A;  3Q2P A;  5KP1 A;  1GOY A;  3SX1 A;  2GEX A;  2CW9 A;  1UUV B;  2XR8 B;  5BXQ A;  4WFO A;  1BNE A;  1OH0 A;  2KCD A;  3LYG A;  1WTH A;  3CNM A;  4HVN A;  2M7O A;  4FMD A;  3MG2 A;  1HZ1 A;  3CPW 2;  3NHX A;  2BIR A;  3LZA A;  8CHO A;  4EBG A;  2H0H A;  3CC7 3;  3MWZ A;  2RSX A;  3EF8 A;  2KXG A;  1RHL A;  3LTB A;  3VGN A;  2FNQ A;  2XEP A;  3UL6 A;  2HMO B;  3HX8 A;  3UL5 A;  1YVS A;  3CU3 A;  2XH9 A;  5STD A;  1RDS A;  3D3L A;  4HM8 B;  2D42 A;  3OWU A;  3BNE A;  1DYU A;  3JUO A;  1YIT 3;  2O3O A;  5ELJ A;  2QGU A;  1RLS A;  1FUT A;  1M9G A;  4R9L A;  3S29 A;  1BSA A;  1IVV A;  2BT3 A;  4HKV B;  1TUH A;  1BAO A;  4HM2 B;  2R4I A;  4MMX B;  1UCI A;  1BU4 A;  1JN5 B;  3FGY A;  3LTC A;  3F9S A;  4RBN A;  3SED A;  3G71 3;  1IYY A;  1ULJ B;  1W2Z A;  3L0R A;  1CYV A;  1WQL B;  1JV2 B;  3I0Y A;  1M90 4;  2RGQ A;  2H0G A;  3NX0 A;  1T5Y A;  2E2U A;  5I97 A;  1QVF 2;  1N8Q A;  1B2Z A;  1AR0 A;  2IUK A;  2WGQ A;  4XB5 A;  2PNC A;  1I2F A;  1RGF A;  2P38 A;  4QWT A;  1US1 A;  5HGR A;  2XF3 A;  1UUW B;  2RNT A;  2BMQ B;  1RRH A;  2ZL8 A;  1I2E A;  3KII A;  1BRI A;  1GS3 A;  1EG9 B;  1Q7H A;  3MG3 A;  1D6U A;  3D79 A;  1RGC A;  2Q07 A;  4N6N B;  3WMD A;  3CCM 3;  2OTJ 3;  1BUJ A;  1Q40 B;  3PS8 A;  1Q86 4;  1N9J A;  4WWU C;  2KAA A;  1SAR A;  2GU1 A;  3KCH A;  3STD A;  5IF6 A;  5GSP A;  1TFK A;  1IV9 A;  2MF7 A;  2HMN B;  1B2S A;  1OHS A;  1N9E A;  3EB8 A;  1JN5 A;  3IMA B;  3GAX A;  2CC3 A;  4R4K A;  3PYJ A;  1EA2 A;  3NBJ A;  3GZR A;  4EV5 A;  3CCU 3;  3CC4 3;  5DRE A;  4EXR A;  1E97 A;  1B3S A;  4O3V A;  1VQ6 3;  3K0Z A;  1RSN A;  3FH1 A;  1O7G B;  1Q7Y 4;  4ZM8 A;  1FGM A;  1K28 A;  1BOX A;  3NM2 A;  1BSC A;  3WR2 A;  1NJI 4;  3OWY A;  2MC8 A;  4NHF A;  3BIR A;  3X3Z A;  1Q9E A;  1AY7 A;  2CFD A;  1LVN A;  1IQX A;  3FKA A;  3DGN A;  4CPK A;  2O9U X;  2W56 B;  4FMA A;  1Q40 A;  1TIJ A;  2BMR B;  1YIJ 3;  1YJW 3;  4GHO A;  4LSO A;  1SII A;  4J5G A;  3SYU A;  1VQK 3;  3DGO A;  4IT7 A;  4RZM A;  5TGN A;  2F5W A;  2XFS A;  3RDE A;  3FG3 A;  1UW1 A;  3MPH A;  3T0U A;  2K54 A;  3S27 A;  2P0M A;  1IQY A;  4HJL B;  2CX0 A;  1NB5 I;  3AMO A;  2F56 A;  1R4C A;  2KF3 A;  2HML B;  3EBT A;  3B4O A;  3DGY A;  3H3H A;  4XBT A;  3Q3F A;  5AIH A;  1K73 4;  5EQL A;  1RNT A;  3BU4 A;  1YNV X;  3CPO A;  4OVM A;  5CF2 A;  1YVB I;  2IUJ A; 
#chains in the Genus database with same CATH homology
 4XDV A;  3T8N A;  3DXO A;  5IG0 A;  1GY5 A;  1DVC A;  4FCZ A;  3LT9 A;  3NBR A;  4AEQ A;  4N3V A;  1OF5 B;  3ALA A;  5A0O B;  2QEX 3;  3CCQ 3;  1NDO B;  1OUN A;  2XFT A;  1OGZ A;  5LC6 A;  1W6G A;  3EQQ B;  3WOD G;  5JPU A;  2QA4 3;  2YFJ B;  3HK4 A;  4EV2 A;  4BTX A;  3G4S 3;  4HM7 B;  1N8R 4;  3UJM A;  2E2V A;  3G8Z A;  4U13 A;  1S5A A;  1A2V A;  3M8C A;  2Y74 A;  3NV0 A;  1D6Y A;  5CXO A;  1CYU A;  3DGL A;  2IMJ A;  3CCL 3;  3I56 3;  4N6M A;  4TX4 A;  5KP4 A;  1W7C A;  3CME 3;  1FGR A;  1JB4 A;  4IPB A;  2B24 B;  3PGB A;  4N6U A;  1CQS A;  2Z6B A;  4R80 A;  4GB5 A;  2HMK B;  1U8C B;  3G16 A;  3QK9 A;  1IU7 A;  2XRX B;  1SJW A;  2Z77 A;  3DMC A;  3OWS A;  3ECF A;  3F8H A;  5FW5 A;  3Q1C A;  1O7W B;  4KFE A;  4N6O B;  1NO3 A;  5AYS C;  1FGT A;  4HZ9 B;  3VF1 A;  1NU3 A;  5EEO A;  2LYX A;  2E2T A;  3CD6 3;  1GD3 A;  2UX0 A;  3BLZ A;  1O7N B;  1VQM 3;  1F8N A;  1JRQ A;  1M1X B;  2BHM A;  2OWP A;  2QIY A;  3B8L A;  2CG0 A;  2OOV A;  2WOF A;  1A67 A;  4IIA A;  3B4P A;  2CHC A;  1WMO A;  1W4N A;  3F7X A;  3LTD A;  4EYC A;  1QAK A;  1STD A;  4K90 B;  2YFL B;  3EC9 A;  4N6L A;  3FG1 A;  1VQP 3;  1OHP A;  1OGX A;  4ORL A;  3KE7 A;  1L5G B;  7STD A;  3J7Y d;  3CCV 3;  2CFG A;  1FGO A;  3EBY A;  3F8X A;  1KD1 4;  4L7K A;  2CWV A;  3FG4 A;  1YJN 3;  1WNH A;  3EN1 B;  3F14 A;  3NQY A;  3PCR A;  3EE1 A;  2HMM B;  3FSD A;  3IPT A;  3FZW A;  2K0M A;  1IV7 A;  5JPP A;  4BTW A;  2CIU A;  1YI2 3;  3GRD A;  3NXJ A;  3CC2 3;  3KSE D;  2FGT A;  4XBX A;  5AI1 A;  4HZB B;  4PEJ A;  2I9W A;  3D9R A;  2YX9 A;  2CWU A;  4X2O A;  5IG3 A;  1AVL A;  4O02 B;  2Z7A A;  3V99 A;  3SLU A;  2W0Q A;  3DUK A;  3G0K A;  3K9M C;  1K9M 4;  5IER A;  2PZV A;  2LQV A;  1EKM A;  1DMM A;  3OX9 A;  4KZ1 A;  2RFR A;  2CFK A;  1N5P A;  1W2B 2;  4RNZ A;  4LGQ A;  4HM5 B;  1FUW A;  1TP6 A;  4J8T A;  1IVW A;  2XGN A;  2XSO B;  3FLJ A;  2W9Q A;  4J9A A;  2OQE A;  1KC8 4;  5IEO A;  4BTY A;  2W2C A;  2CWT A;  1O7P B;  2W6J H;  3WA3 A;  3KFQ C;  4JF8 A;  5IG5 A;  2OTL 3;  1VQ8 3;  4Q53 A;  1QJG A;  3GWR A;  3S5C A;  2W04 A;  3BND A;  1JJ2 2;  1SQW A;  4H61 A;  1IDP A;  4R1K A;  1ISK A;  2STD A;  4K1U A;  1LNH A;  1JB2 A;  3LML A;  1RJO A;  2OCT A;  4MJD A;  1IQ8 A;  3B7C A;  2P05 A;  3MHE A;  1Y4K A;  4LZI A;  2XSH B;  3SXX A;  4XDW A;  3MYT A;  1SPU A;  3MSO A;  3UB1 A;  4HYZ A;  4HM3 B;  2F86 B;  2B1X B;  4OUQ A;  4CCV A;  1IK3 A;  3CCE 3;  1IT8 A;  3JUM A;  2W56 A;  4KFF A;  5EVH A;  3HIG A;  4JRF A;  2JDI H;  1HKX A;  3MKI A;  2F98 A;  1UI8 A;  5IG4 A;  2OQE C;  2A15 A;  3JUN A;  4CDL A;  1IVX A;  2SBL A;  1RN7 A;  1IVU A;  4RNY A;  1OCV A;  3V98 A;  4X2H A;  2C11 A;  3JVC A;  5AII A;  4LMI A;  2XGL A;  5FGO A;  1Q42 A;  4FMB A;  5CF1 A;  3PCS A;  2CFL A;  1OHO A;  1A90 A;  3WOF B;  3X40 A;  3KZT A;  1S72 3;  1OF5 A;  3LH4 A;  2GBX B;  2GXF A;  1PU4 A;  1VQO 3;  1A2K A;  3CCJ 3;  3V92 A;  3X41 A;  2P09 A;  4HM1 B;  4STD A;  5IW9 A;  1FA3 A;  1VQ7 3;  3FF0 A;  5KP3 A;  3CNX A;  1KQS 2;  5JBS A;  2BMO B;  1JB5 A;  1OPY A;  1DMN A;  3MG1 A;  3VSY A;  1JNQ A;  3CCR 3;  2L4V A;  2RCD A;  4N6V 0;  3DGM A;  3NM7 A;  3K7C A;  1KWI A;  1GYB A;  3KSP A;  1BUQ A;  1V74 A;  3GZB A;  1NWW A;  2Y73 A;  1WMN A;  3S28 A;  4XBY A;  5DRV A;  3EJV A;  3CXC 2;  2F99 A;  4MMZ B;  3N9H A;  3Q90 A;  1VQ4 3;  2CG1 A;  1VZZ A;  3LXU X;  2HMJ B;  1W6Y A;  1W5Z A;  3X42 A;  5AEW B;  3T8U A;  5IEP A;  2WOH A;  3PZW A;  4NRE A;  4HM6 B;  2FXT A;  3N54 B;  1QAF A;  3JUP A;  3HZP A;  4FMC A;  1ZX2 A;  3FCS B;  5AYR B;  3HI7 A;  3CMA 3;  1VQN 3;  3DZL A;  3FF2 A;  2KRT A;  3LT8 A;  1Q81 4;  1J2B A;  1E3R A;  1W6C A;  3KN4 A;  1DVD A;  2ML6 A;  1KSI A;  1LXE A;  4O2H A;  3DY5 A;  1E3V A;  1MOL A;  4N6T A;  3UNL A;  1YHQ 3;  5LC7 A;  4LEH A;  4WHA A;  3BNC A;  3K63 A;  2OOV C;  1GD4 A;  1OAC A;  3EX9 A;  4HM4 B;  1YJ9 3;  2BO9 B;  1W00 A;  1G96 A;  3X3Y A;  5AIG A;  1Q82 4;  3SOY A;  4O8S A;  1VQ9 3;  1QMA A;  4L8P A;  4FCJ A;  2BNG A;  3K5T A;  1JKG B;  1AV4 A;  1W02 A;  2ZDJ A;  3CCS 3;  3GZY B;  1IT7 A;  3ROB A;  5BVB A;  5CK6 A;  4AKZ A;  3SOA A;  3O8Y A;  2GEY A;  3IJE B;  1UI7 A;  3E99 A;  3WOE B;  2CK3 H;  3AMO B;  4WYK B;  2ML5 A;  1STF I;  2V1L A;  1FGQ A;  3LTA A;  4HM0 B;  1K8A 4;  4XM4 A;  3EHC A;  3SVA A;  1Z1S A;  1NB3 I;  1WMP A;  5D83 A;  1LOX A;  3U1W A;  2W9P A;  1JKG A;  4GL6 A;  2CKF B;  4K61 A;  5AIF A;  3I55 3;  1ULI B;  4HBR A;  1CEW I;  4K1V A;  2CFW A;  6STD A;  5CLK A;  3BB9 A;  3U97 A;  3OV4 A;  3RGA A;  3ER7 A;  3X3X A;  1O7M B;  1ZO2 A;  2Z76 A;  1EQK A;  3N8B A;  1K41 A;  1GY6 A;  1W01 A;  1ASK A;  3PXM A;  2GU3 A;  4WYK A;  4MMY B;  2YFI B;  1RRL A;  3EN8 A;  1ROA A;  3NV0 B;  3LOY A;  1RKY A;  1VQL 3;  4KFD A;  3WA2 X;  3F7S A;  5AEU B;  2C10 A;  2WO0 A;  1DMQ A;  4G1M B;  3GZX B;  3NUV A;  3NQZ A;  4OK0 A;  1QVG 2;  3H51 A;  5IEN A;  1SIH A;  2JQ5 A;  4KVH A;  2W03 A;  4WP5 A;  3QRD A;  1GY7 A;  4L8O A;  3WDG B;  1M1K 4;  1VQ5 3;  2WGO A;  1D6Z A;  3NBB A;  1AVK A;  3DM8 A;  3A76 A;  1QAL A;  3G6E 3;  2CH9 A;  3S67 A;  1YGE A;  3HII A;  5D81 A;  3TDG A;  1O7H B;  4AKY A;  2GBW B;  2IA7 A;  1N5H A;  2P0X A;  5D82 A;  1ROV A;  1TU5 A;  4FR9 A;  1HU9 A;  2D1W A;  4MEI A;  3BNB A;  1C7H A;  5ELU A;  4R9K A;  5G2G A;  3OW2 2;  3RGR A;  3OXA A;  1MNL A;  1U5O A;  4H3U A;  1TFO A;  1PFP A;  4EC6 A;  4FCM A;  4I4K A;  3KKG A;  3F40 A;  3JUQ A;  2INX A;  5KP1 A;  3SX1 A;  2GEX A;  2CW9 A;  1UUV B;  2XR8 B;  5BXQ A;  4WFO A;  1OH0 A;  2KCD A;  3LYG A;  1WTH A;  3CNM A;  4HVN A;  2M7O A;  4FMD A;  3MG2 A;  3CPW 2;  3NHX A;  3LZA A;  8CHO A;  4EBG A;  3CC7 3;  3MWZ A;  2RSX A;  3EF8 A;  2KXG A;  3LTB A;  3VGN A;  2FNQ A;  2XEP A;  3UL6 A;  2HMO B;  3HX8 A;  3UL5 A;  3CU3 A;  2XH9 A;  5STD A;  3D3L A;  4HM8 B;  2D42 A;  3OWU A;  3BNE A;  1DYU A;  3JUO A;  1YIT 3;  2O3O A;  5ELJ A;  2QGU A;  1M9G A;  4R9L A;  3S29 A;  1IVV A;  2BT3 A;  4HKV B;  1TUH A;  4HM2 B;  2R4I A;  4MMX B;  3SED A;  1JN5 B;  3FGY A;  3G71 3;  3LTC A;  3F9S A;  4RBN A;  1ULJ B;  1W2Z A;  3L0R A;  1CYV A;  1WQL B;  1JV2 B;  3I0Y A;  1M90 4;  2RGQ A;  3NX0 A;  5I97 A;  1T5Y A;  2E2U A;  1QVF 2;  1N8Q A;  1AR0 A;  2IUK A;  2WGQ A;  4XB5 A;  2PNC A;  2P38 A;  4QWT A;  1US1 A;  5HGR A;  2XF3 A;  1UUW B;  2BMQ B;  1RRH A;  2ZL8 A;  3KII A;  3Q2P A;  1GS3 A;  4N6N B;  1EG9 B;  3MG3 A;  3WMD A;  1D6U A;  3CCM 3;  2Q07 A;  2OTJ 3;  1Q40 B;  3PS8 A;  1Q86 4;  1N9J A;  4WWU C;  2GU1 A;  3STD A;  5IF6 A;  1TFK A;  1IV9 A;  2MF7 A;  2HMN B;  1OHS A;  1N9E A;  3EB8 A;  1JN5 A;  3IMA B;  3GAX A;  2CC3 A;  4R4K A;  3PYJ A;  1EA2 A;  3NBJ A;  3GZR A;  4EV5 A;  3CCU 3;  3CC4 3;  5DRE A;  4EXR A;  1E97 A;  4O3V A;  1VQ6 3;  3K0Z A;  3FH1 A;  1O7G B;  1Q7Y 4;  4ZM8 A;  1FGM A;  1K28 A;  3NM2 A;  1NJI 4;  3OWY A;  2MC8 A;  4NHF A;  3X3Z A;  2CFD A;  1LVN A;  1IQX A;  3FKA A;  3DGN A;  2O9U X;  2W56 B;  4FMA A;  1Q40 A;  1TIJ A;  2BMR B;  1YIJ 3;  1YJW 3;  4LSO A;  1SII A;  1VQK 3;  3DGO A;  4IT7 A;  4RZM A;  5TGN A;  2XFS A;  3RDE A;  3FG3 A;  1UW1 A;  3MPH A;  3T0U A;  2K54 A;  3S27 A;  2P0M A;  1IQY A;  4HJL B;  1NB5 I;  3AMO A;  1R4C A;  2HML B;  3EBT A;  3B4O A;  3H3H A;  4XBT A;  5AIH A;  1K73 4;  5EQL A;  3CPO A;  4OVM A;  5CF2 A;  1YVB I;  2IUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...