2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
1JJ22 1VQK3 1KC84 1Q814 3OW22 1VQ43 3CCJ3 1K8A4 1Q824 3I563 3CCR3 1QVG2 1K734 1VQL3 3CC43 1VQN3 2OTJ3 1VQP3 3CCV3 1YIT3 1YI23 1K9M4 1M904 1VQ83 3CD63 3CCM3 3CC23 1VQ93 3CPW2 3CCU3 3G4S3 1YJN3 2OTL3 1YJ93 1KD14 3CCS3 2QA43 1YHQ3 1VQO3 3G6E3 3G713 1W2B2 1NJI4 1VQ63 1KQS2 1QVF2 1N8R4 3CCL3 3CXC2 1YJW3 1VQM3 1VQ53 1S723 1Q864 1Q7Y4 1M1K4 3CMA3 1YIJ3 2QEX3 3I553 1VQ73 3CCE3 3CC73 3CME3 3CCQ3
chains in the Genus database with same CATH superfamily
3EE1A 1HZ1A 2CIUA 2MF7A 2JDIH 5G1LA 1WMOA 1Q824 1QVG2 3B7CA 2W2CA 1T5YA 3S28A 3CPOA 3UJMA 2OTJ3 4WHAA 1W6GA 5STDA 4NREA 2FNQA 1YVBI 3EQQB 2XR8B 3MSOA 4R9LA 2RNTA 3VF1A 6STDA 3G8ZA 1JB5A 5AEUB 1N5HA 1RCKA 3F9SA 3SYUA 3G713 1W2B2 5IW9A 4OUQA 2HMKB 1K28A 2LYXA 3JUMA 1NWWA 1O7GB 2W04A 3NM2A 4J9AA 5IG4A 3FKAA 4KT3B 2Z77A 3HIGA 1BNIA 2XSOB 3BLZA 2B1XB 3PCRA 1W6YA 1IV9A 1W6CA 4JRFA 3N8BA 3D79A 3K5TA 3F8HA 2CFKA 5IG0A 7GSPA 5IENA 1RN4A 4HOHA 1N8QA 3CC43 1SQWA 1VQN3 4EYCA 4N6OB 3LZAA 4KZ1A 1DE3A 3BB9A 3DM8A 1VQ93 3PZWA 4MJDA 3HOHA 3T0UA 1DETA 3U97A 2ML6A 2HMNB 5D83A 5BVBA 1DVCA 1V57A 2E2UA 4HM5B 3K9MC 1NJI4 3LOYA 1GSPA 4RNZA 1EEJA 1VQM3 3MKIA 2OQEC 1Q7Y4 1GOYA 3DGLA 2F99A 4R9KA 5FGOA 2CFLA 2K54A 1N9JA 1RGCA 3UL6A 4IIAA 1AV4A 4LGQA 1U5OA 1B2SA 1BSEA 2CFWA 2CFGA 4HM1B 3X42A 1IV7A 1OGZA 3IJEB 3D5IA 1IVVA 2UUGC 1LOYA 4HM3B 1YGWA 4U13A 9RNTA 2WO0A 2IYJA 4HM8B 5BXQA 1EQKA 1LXEA 2P38A 5JBSA 3JUPA 3WA3A 1YI23 3DY5A 2BU4A 3NBJA 1WMNA 5HOHA 3NBBA 3STDA 3EBYA 1IVWA 3S27A 1DVDA 2KCDA 1PFPA 1VQO3 2BO9B 3DZLA 1BRKA 1EG9B 5HGRA 4BTXA 3WR2A 1LRAA 1BUJA 1YGEA 1AVKA 4XDWA 2C11A 2XFSA 3CNXA 3LT8A 2GBXB 3PYJA 1TJDA 1GD3A 3F14A 3CCQ3 1SARA 3V92A 7STDA 1LVNA 1IQXA 4WP5A 3HIIA 1JBTA 2FGTA 2XFTA 1FGQA 2AAEA 1BRIA 3FG4A 1VQP3 2CWVA 3FLJA 3OWSA 3CD63 3LTDA 4XDVA 7RNTA 2W9PA 1YJN3 1JB4A 1E97A 3LTCA 1I8VA 1MWTA 4AEQA 3K7CA 2CX1A 2R4IA 3CNMA 3NHXA 1VQ63 3WMDA 1LOWA 3EC9A 3PCSA 4KFEA 5RNTA 2P0XA 3NM7A 2GU1A 4FCMA 3B4OA 3GAXA 1FW7A 3CMA3 3Q2PA 1Q40B 4N6V0 1PY3A 1UGIA 2KF4A 3JUOA 3CCE3 1VQ73 4OK0A 1QALA 1JRQA 4EV2A 3CC73 1BANA 2D42A 2KXGA 1KWIA 4WFOA 2IUJA 2XRXB 2F5MA 3CCJ3 5AIHA 3NXJA 1ROVA 1STFI 1IQYA 4N6TA 3M8CA 1JN5B 3DGYA 1I0XA 3G0KA 1SIIA 1TP6A 1W7CA 3HI7A 3SEDA 2RSXA 4R80A 3EN8A 1I3IA 4J5KA 3O8YA 3F7XA 1O7WB 2GEXA 3LTAA 3NX0A 4IPBA 1NDOB 2D1WA 3EJVA 4HM2B 3V99A 1NU3A 4EV5A 2W0QA 1EA2A 5KP3A 4KFFA 3URPA 1ISKA 1JNQA 3B8LA 5DRVA 4RBNA 4HM6B 5IF6A 1UUVB 1BNFA 3JUNA 2QEX3 3GZRA 1RN7A 4MMYB 4O3VA 1JJ22 1JKGB 1ULJB 1U8CB 1OUNA 3F7SA 2GU3A 1QAFA 1K8A4 2H0GA 1Z1SA 1GMQA 2W03A 3WODG 1LQMB 4HM0B 4K1VA 3D4AA 1JN5A 1RGLA 1TRPA 2WOFA 1VQQA 3SOYA 4AKZA 2C4BA 1D6YA 1X1YA 3GRDA 4GB5A 1LQGC 4XB5A 3WHOA 3TDGA 2W6JH 1QVF2 3BNDA 1A90A 1Q42A 2CH9A 4HZ9B 2UGIA 2CHCA 3EX9A 4CPKA 4Q53A 5CXOA 1RLSA 8CHOA 3FGYA 1EUIC 1IT8A 4MMZB 3EHCA 3NQYA 2KF6A 5EVHA 1A2KA 3SOAA 1T3BA 1JKGA 4LSOA 1T2HA 3S67A 1SIHA 3CCR3 1GY7A 4LZIA 5D82A 1BAOA 2UX0A 4HZBB 3PXMA 1SPUA 1BRHA 4I4KA 3RDEA 4WYKA 1FUWA 3N9HA 2YFIB 1FUTA 4EC6A 4XBXA 1BRSA 1I0VA 1WQLB 1YIT3 1A67A 3G4S3 4GSPA 1QAKA 3PGBA 4GHOA 2STDA 4L8OA 3ZG0A 1HYFA 1D6UA 3SLUA 1PU4A 4XBTA 2CW9A 3T8NA 1CQSA 1S5AA 2BMRB 1ZS7A 1BOXA 3UNLA 1RJOA 1CYUA 1IU7A 1I2GA 2XF3A 2ZA4A 4LMIA 3RNTA 4BL3A 1M1K4 3I553 1AQZA 2R41A 3ALAA 3NV0A 1B2UA 3QRDA 2YX9A 3MG3A 1VQ43 3EBTA 5CK6A 3LXUX 1YVSA 4X2OA 1BNEA 2Z76A 1B3SA 1VQL3 3UL5A 4N6MA 3FSDA 4GL6A 5AIIA 1TTOA 1UCKA 3I0YA 4NHFA 1ZGXA 3CCV3 2Q07A 1RDSA 3X3XA 3NBRA 3KKGA 4N3VA 5IEPA 1HU9A 1UCLA 1IK3A 2QA43 1IQ8A 3BNCA 4R4KA 1OHSA 1NNVA 5EQLA 3CCL3 3OWYA 3X3YA 1BRGA 3AHWA 3BNBA 2HMMB 3ZFZA 2BMOB 2BIRA 2A15A 2V1LA 1I70A 4K90B 1O7PB 2WOHA 1RNBA 3K0ZA 2OQEA 5BIRA 2IA7A 5AI1A 4WWUC 2I9WA 4HYZA 4R1KA 2BMQB 4BTWA 5IG5A 1BVIA 3KCHA 1Q7HA 3D9RA 3VSYA 1LNIA 1N9EA 2YFLB 1O7NB 1RN1A 3AGNA 1AY7A 3HZPA 1FGOA 2O3OA 3DGMA 3EB8A 5IEOA 5AEWB 1B21A 2P0MA 4HM4B 2Z7AA 3CCU3 2PNCA 3NUVA 3MYTA 2SBLA 5CF2A 2KAAA 3H51A 2CKFB 2ZDJA 1GY6A 2IY2A 4RZMA 1RTUA 1KQS2 1UI7A 1GMPA 4FMAA 3JVCA 3ECFA 2GSPA 3X41A 5BU4A 1MOLA 1FGTA 3N54B 1W02A 1OACA 1T2IA 3A76A 3FF2A 4H61A 1BSDA 1B27A 2XEPA 2Z6BA 1FZUA 4OVMA 1CEWI 1KC84 2E2TA 5D81A 1MGRA 1GYBA 3KE7A 2HMLB 2L1SA 3L0RA 4N6UA 1K734 3G16A 5AYSC 1BSCA 1X1WA 2RCDA 4PEJA 4HM7B 1RGFA 4QWTA 2W9QA 1JZOA 1QMAA 1K9M4 2F98A 1US1A 1UUWB 2WGQA 3BNEA 1W00A 1CYVA 1DMNA 3LH4A 4O2HA 3WA2X 1GS3A 1E3RA 1JV2B 3PS8A 1W01A 2RBIA 1IT7A 1GY5A 2O9UX 3CXC2 1B2MA 2HMJB 1DMMA 3VGNA 5KP4A 1HKXA 2RGQA 3RGRA 4O02B 5IERA 5IG3A 4BU4A 3F8XA 3AGOA 4LEHA 1FGMA 1FUSA 1LNHA 2BNGA 4FR9A 4TX4A 3ROBA 3BIRA 3E99A 4MEIA 2RFRA 1M1XB 1NB3I 2Y74A 5AIGA 3I563 2BT3A 1AR0A 5LC6A 1V58A 4FMDA 1TUHA 1IVUA 4ORLA 2CK3H 5A0OB 2CWTA 4STDA 4X2HA 1I2EA 5M1AA 2P05A 3WOFB 1M904 1EKMA 3UB1A 1BIRA 3DUKA 3OX9A 2B24B 3KSPA 3WDGB 1UW1A 3G6E3 3Q1CA 4LYLB 3KSED 4BIRA 4O8SA 3H3HA 1STDA 1UCJA 4RNYA 1CH0A 3EF8A 1VZZA 2IMJA 1BNRA 5JPPA 1RCLA 4EW5A 2XGLA 1YNVX 3Q3FA 1GD4A 1Y4KA 1R4CA 3NV0B 4RNTA 2INXA 3FG3A 3IPTA 1IVXA 1E3VA 3OV4A 1VQK3 1C54A 3FF0A 3DXOA 1N5PA 3S5CA 1NO3A 2F56A 4DKIA 1RHLA 1NB5I 1RMSA 5ELUA 1BNJA 1X1UA 3KFQC 2CWUA 3BU4A 2XSHB 4HJLB 4NPBA 8RNTA 4KFDA 5AIFA 1BGSA 1DYUA 3DMCA 4BL2A 1O7HB 1BNGA 3AHSA 3D3LA 1RGKA 1FGRA 3LYGA 1B20A 3DH2A 1OHOA 1MWRA 3ER7A 3X40A 4BTYA 2GXFA 1RGHA 1UDII 3B4PA 2FXTA 1G02A 3OWUA 1KSIA 1RRHA 5ELJA 4FMBA 1RGGA 1A2VA 3SVAA 3SXXA 1OGXA 2Y73A 1B2ZA 4K61A 2OOVA 2GBWB 1D6ZA 1ULIB 5M19A 2QIYA 5LC7A 1FA3A 1K41A 1Q9EA 3EN1B 5AYRB 3QK9A 1OPYA 1JBRA 4JF8A 1BSAA 2ZHXB 3HK4A 3AMOA 2K0MA 1UI8A 3MG2A 3CPW2 1OH0A 2OTL3 1OF5A 3MHEA 1ZX2A 1GOUA 2L4VA 4KVHA 1G0TA 2ZL8A 6RNTA 1L5GB 2SARA 1LOVA 1MNLA 1R4YA 3Q90A 1MWSA 2W56B 5CF1A 2OCTA 3A5EA 4K1UA 4J8TA 1Q814 1G96A 1OF5B 1W4NA 1RSNA 1ROAA 1GOVA 2IUKA 3KIIA 5G2GA 2H0HA 4HAAA 3SX1A 1DMQA 2CFDA 3IMAB 5TGNA 1M9GA 4EBGA 3MWZA 1WMPA 3MPHA 4H3UA 3KN4A 3NQZA 1AVLA 3HX8A 2KF5A 4ZM8A 1Q40A 2J8XB 1JBSA 1TU5A 2OWPA 1RRLA 2XGNA 3F40A 1RGAA 4ILFA 3KZTA 5FW5A 1YJ93 1O7MB 1MWUA 3JUQA 1YHQ3 1BNSA 2MC8A 2KRTA 1BSBA 1F8NA 1YJW3 4XBYA 1VQ53 1Q864 3LMLA 1UGHI 1TIJA 4XM4A 2YFJB 1LOXA 3ZG5A 1C7HA 2C10A 4FMCA 2HMOB 3GZBA 1GMRA 4CJNA 3OW22 2CC3A 2H0IA 2GEYA 1JZDA 1V74A 2F5WA 1B2XA 3T8UA 3U1WA 5CLKA 3FZWA 1W5ZA 5EEOA 3OXAA 1SJWA 3GZYB 3FG1A 4G1MB 1A2PA 1ZO2A 3WOEB 1VQ83 1BRNL 2KF3A 1WNHA 2M7OA 1I3FA 3FCSB 4CDLA 3LTBA 1RKYA 4HBRA 3DGNA 4EXRA 1N8R4 2P09A 4L8PA 4L7KA 1OCVA 2CG0A 1WTHA 2PZVA 3GWRA 4MMXB 2HOHA 5M18A 3LT9A 1YIJ3 1TFOA 1RGEA 2W56A 3D5GA 4WYKB 3CU3A 2BHMA 5G1KA 5KP1A 3CME3 3FH1A 1BU4A 4FCJA 1FYSA 1TRQA 3K63A 2JQ5A 2QGUA 1J2BA 1I2FA 6GSPA 1MGWA 1UUGB 1BRJA 1OHPA 3DGOA 4CCVA 3MG1A 2K3DA 1X1XA 1PYLA 4HVNA 4FCZA 1S723 3GSPA 3AMOB 2E2VA 2XH9A 4N6NB 4AKYA 5I97A 5DREA 1IDPA 2ML5A 1RNTA 3CC23 3CCM3 1BUQA 1JB2A 1IYYA 3X3ZA 1KD14 3CCS3 3S29A 1UCIA 2F86B 4N6LA 5GSPA 3RGAA 2AADA 4J5GA 2CX0A 4I5QA 1ASKA 2LQVA 1QJGA 3GZXB 4HKVB 4IT7A 1TFKA 3V98A 2CG1A 2WGOA 3J7Yd 2OOVC 2F4YA 5JPUA 1W2ZA
chains in the Genus database with same CATH topology
3EE1A 2CIUA 2MF7A 2JDIH 1WMOA 1Q824 1QVG2 3B7CA 2W2CA 1T5YA 3S28A 3CPOA 3UJMA 2OTJ3 4WHAA 1W6GA 5STDA 4NREA 2FNQA 1YVBI 3EQQB 2XR8B 3MSOA 4R9LA 3VF1A 6STDA 3G8ZA 1JB5A 5AEUB 1N5HA 3G713 3F9SA 1W2B2 5IW9A 4OUQA 2HMKB 1K28A 2LYXA 3JUMA 1NWWA 1O7GB 2W04A 3NM2A 4J9AA 5IG4A 3FKAA 2Z77A 3HIGA 2XSOB 3BLZA 2B1XB 3PCRA 1W6YA 1IV9A 1W6CA 4JRFA 3N8BA 3K5TA 3F8HA 2CFKA 5IG0A 5IENA 1N8QA 3CC43 1SQWA 1VQN3 4EYCA 4N6OB 3LZAA 4KZ1A 3BB9A 3DM8A 1VQ93 3PZWA 4MJDA 3T0UA 3U97A 2ML6A 2HMNB 5D83A 5BVBA 1DVCA 2E2UA 4HM5B 1NJI4 3K9MC 3LOYA 4RNZA 1VQM3 3MKIA 2OQEC 1Q7Y4 3DGLA 2F99A 4R9KA 5FGOA 2CFLA 2K54A 1N9JA 3UL6A 4IIAA 1AV4A 4LGQA 1U5OA 2CFWA 2CFGA 4HM1B 3X42A 1IV7A 1OGZA 3IJEB 1IVVA 4U13A 4HM3B 2WO0A 4HM8B 5BXQA 1EQKA 1LXEA 2P38A 5JBSA 3JUPA 3WA3A 1YI23 3DY5A 3NBJA 1WMNA 3NBBA 3STDA 3EBYA 1IVWA 3S27A 1DVDA 2KCDA 1PFPA 1VQO3 2BO9B 3DZLA 1EG9B 5HGRA 4BTXA 1YGEA 1AVKA 4XDWA 2C11A 2XFSA 3CNXA 3LT8A 2GBXB 3PYJA 1GD3A 3F14A 3CCQ3 3V92A 7STDA 1LVNA 1IQXA 4WP5A 3HIIA 2FGTA 2XFTA 1FGQA 1VQP3 3FG4A 2CWVA 3FLJA 3OWSA 3CD63 3LTDA 4XDVA 2W9PA 1YJN3 1JB4A 1E97A 3LTCA 4AEQA 3K7CA 2R4IA 3NHXA 3CNMA 1VQ63 3WMDA 3EC9A 3PCSA 4KFEA 2P0XA 3NM7A 2GU1A 4FCMA 3B4OA 3GAXA 3CMA3 3Q2PA 1Q40B 4N6V0 1VQ73 3JUOA 3CCE3 4OK0A 1QALA 1JRQA 4EV2A 3CC73 2D42A 2KXGA 1KWIA 4WFOA 2IUJA 2XRXB 3CCJ3 5AIHA 3NXJA 1ROVA 1STFI 1IQYA 4N6TA 3M8CA 1JN5B 3G0KA 1SIIA 1TP6A 1W7CA 3HI7A 3SEDA 2RSXA 4R80A 3EN8A 3O8YA 3F7XA 1O7WB 2GEXA 3LTAA 3NX0A 4IPBA 1NDOB 2D1WA 3EJVA 4HM2B 3V99A 1NU3A 4EV5A 2W0QA 1EA2A 5KP3A 4KFFA 1ISKA 1JNQA 3B8LA 5DRVA 4RBNA 4HM6B 5IF6A 1UUVB 3JUNA 2QEX3 3GZRA 1RN7A 4MMYB 4O3VA 1JJ22 1JKGB 1ULJB 1U8CB 1OUNA 3F7SA 2GU3A 1QAFA 1K8A4 1Z1SA 3WODG 2W03A 4HM0B 4K1VA 1JN5A 2WOFA 3SOYA 4AKZA 1D6YA 3GRDA 4GB5A 4XB5A 3TDGA 2W6JH 1QVF2 3BNDA 1A90A 1Q42A 2CH9A 4HZ9B 3EX9A 2CHCA 4Q53A 5CXOA 8CHOA 3FGYA 1IT8A 4MMZB 3EHCA 3NQYA 5EVHA 1A2KA 3SOAA 1JKGA 4LSOA 3S67A 1SIHA 3CCR3 1GY7A 4LZIA 5D82A 2UX0A 4HZBB 3PXMA 1SPUA 4I4KA 3RDEA 4WYKA 1FUWA 3N9HA 2YFIB 1YIT3 4EC6A 4XBXA 1WQLB 1A67A 3G4S3 1QAKA 3PGBA 2STDA 4L8OA 1D6UA 3SLUA 1PU4A 4XBTA 2CW9A 3T8NA 1CQSA 1S5AA 2BMRB 3UNLA 1CYUA 1RJOA 1IU7A 2XF3A 1M1K4 4LMIA 3I553 3ALAA 3NV0A 3QRDA 2YX9A 3MG3A 1VQ43 3EBTA 5CK6A 3LXUX 4X2OA 2Z76A 1VQL3 3UL5A 4N6MA 3FSDA 4GL6A 5AIIA 3I0YA 4NHFA 3CCV3 2Q07A 3X3XA 3NBRA 3KKGA 4N3VA 5IEPA 1HU9A 1IK3A 2QA43 1IQ8A 3BNCA 4R4KA 1OHSA 5EQLA 3CCL3 3OWYA 3X3YA 3BNBA 2HMMB 2BMOB 2A15A 2V1LA 4K90B 2WOHA 1O7PB 3K0ZA 2OQEA 2IA7A 5AI1A 4WWUC 2I9WA 4HYZA 4R1KA 2BMQB 4BTWA 5IG5A 3D9RA 3VSYA 2YFLB 1N9EA 1O7NB 3HZPA 1FGOA 2O3OA 3DGMA 3EB8A 5IEOA 5AEWB 2P0MA 4HM4B 2Z7AA 3CCU3 2PNCA 3NUVA 3MYTA 2SBLA 5CF2A 3H51A 2CKFB 2ZDJA 1GY6A 4RZMA 1KQS2 1UI7A 4FMAA 3JVCA 3ECFA 3X41A 1MOLA 1FGTA 3N54B 1W02A 1OACA 3A76A 3FF2A 4H61A 2XEPA 2Z6BA 4OVMA 1CEWI 1KC84 2E2TA 5D81A 1GYBA 3KE7A 2HMLB 3L0RA 4N6UA 1K734 3G16A 5AYSC 2RCDA 4PEJA 4HM7B 4QWTA 2W9QA 1QMAA 1K9M4 2F98A 1US1A 1UUWB 2WGQA 3BNEA 1W00A 1CYVA 1DMNA 3LH4A 4O2HA 3WA2X 1GS3A 1E3RA 1JV2B 3PS8A 1W01A 3CXC2 1IT7A 1GY5A 2O9UX 2HMJB 1DMMA 3VGNA 5KP4A 1HKXA 2RGQA 3RGRA 4O02B 5IERA 5IG3A 3F8XA 4LEHA 1FGMA 1LNHA 2BNGA 4FR9A 4TX4A 3ROBA 3E99A 4MEIA 2RFRA 1M1XB 1NB3I 2Y74A 5AIGA 3I563 2BT3A 1AR0A 5LC6A 4FMDA 1TUHA 1IVUA 4ORLA 2CK3H 5A0OB 2CWTA 4STDA 4X2HA 3WOFB 1M904 2P05A 1EKMA 3UB1A 3DUKA 3OX9A 2B24B 3KSPA 3WDGB 1UW1A 3G6E3 3Q1CA 3KSED 4O8SA 3H3HA 1STDA 4RNYA 3EF8A 1VZZA 2IMJA 5JPPA 2XGLA 1GD4A 1Y4KA 1R4CA 3NV0B 1VQK3 2INXA 3FG3A 3IPTA 1IVXA 1E3VA 3OV4A 3FF0A 3DXOA 1N5PA 3S5CA 1NO3A 1NB5I 5ELUA 3KFQC 2CWUA 2XSHB 4HJLB 4KFDA 5AIFA 1DYUA 3DMCA 1O7HB 3D3LA 1FGRA 3LYGA 1OHOA 3ER7A 3X40A 4BTYA 2GXFA 3B4PA 2FXTA 3OWUA 1KSIA 1RRHA 5ELJA 4FMBA 1A2VA 3SVAA 3SXXA 1OGXA 2Y73A 4K61A 2OOVA 2GBWB 1D6ZA 1ULIB 2QIYA 5LC7A 1FA3A 1K41A 3EN1B 5AYRB 3QK9A 1OPYA 4JF8A 3HK4A 3AMOA 2K0MA 1UI8A 3MG2A 3CPW2 1OH0A 2OTL3 1OF5A 3MHEA 1ZX2A 4KVHA 2L4VA 2ZL8A 1L5GB 1MNLA 3Q90A 2W56B 5CF1A 2OCTA 4K1UA 4J8TA 1Q814 1G96A 1OF5B 1W4NA 3KIIA 1ROAA 2IUKA 5G2GA 3SX1A 1DMQA 2CFDA 3IMAB 5TGNA 1M9GA 4EBGA 3MWZA 1WMPA 3MPHA 4H3UA 3KN4A 3NQZA 1AVLA 3HX8A 4ZM8A 1Q40A 1TU5A 2OWPA 1RRLA 2XGNA 3F40A 5FW5A 3KZTA 1YJ93 1O7MB 3JUQA 1YHQ3 2MC8A 2KRTA 1F8NA 1YJW3 4XBYA 1VQ53 1Q864 3LMLA 1TIJA 4XM4A 2YFJB 1LOXA 1C7HA 2C10A 4FMCA 2HMOB 3GZBA 3OW22 2CC3A 2GEYA 1V74A 3T8UA 3U1WA 5CLKA 3FZWA 1W5ZA 5EEOA 3OXAA 1SJWA 3GZYB 3FG1A 4G1MB 1ZO2A 3WOEB 1VQ83 1WNHA 2M7OA 3FCSB 4CDLA 1RKYA 3LTBA 4HBRA 3DGNA 4EXRA 1N8R4 2P09A 4L8PA 4L7KA 1OCVA 1WTHA 2CG0A 2PZVA 3GWRA 4MMXB 1S723 3LT9A 1YIJ3 1TFOA 2W56A 4WYKB 3CU3A 2BHMA 5KP1A 3CME3 3FH1A 4FCJA 3K63A 2JQ5A 2QGUA 1J2BA 1OHPA 3DGOA 4CCVA 3MG1A 4HVNA 4FCZA 3AMOB 2E2VA 2XH9A 4N6NB 4AKYA 5I97A 5DREA 1IDPA 2ML5A 3CC23 3CCM3 1BUQA 1JB2A 3X3ZA 1KD14 3CCS3 3S29A 2F86B 4N6LA 3RGAA 4IT7A 1ASKA 2LQVA 1QJGA 3GZXB 4HKVB 1TFKA 3V98A 2CG1A 2WGOA 3J7Yd 2OOVC 5JPUA 1W2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 2;  1VQK 3;  1KC8 4;  1Q81 4;  3OW2 2;  1VQ4 3;  3CCJ 3;  1K8A 4;  1Q82 4;  3I56 3;  3CCR 3;  1QVG 2;  1K73 4;  1VQL 3;  3CC4 3;  1VQN 3;  2OTJ 3;  1VQP 3;  3CCV 3;  1YIT 3;  1YI2 3;  1K9M 4;  1M90 4;  1VQ8 3;  3CD6 3;  3CCM 3;  3CC2 3;  1VQ9 3;  3CPW 2;  3CCU 3;  3G4S 3;  1YJN 3;  2OTL 3;  1YJ9 3;  1KD1 4;  3CCS 3;  2QA4 3;  1YHQ 3;  1VQO 3;  3G6E 3;  3G71 3;  1W2B 2;  1NJI 4;  1VQ6 3;  1KQS 2;  1QVF 2;  1N8R 4;  3CCL 3;  3CXC 2;  1YJW 3;  1VQM 3;  1VQ5 3;  1S72 3;  1Q86 4;  1Q7Y 4;  1M1K 4;  3CMA 3;  1YIJ 3;  2QEX 3;  3I55 3;  1VQ7 3;  3CCE 3;  3CC7 3;  3CME 3;  3CCQ 3; 
#chains in the Genus database with same CATH topology
 3EE1 A;  1HZ1 A;  2CIU A;  2MF7 A;  2JDI H;  5G1L A;  1WMO A;  1Q82 4;  1QVG 2;  3B7C A;  2W2C A;  1T5Y A;  3S28 A;  3CPO A;  3UJM A;  2OTJ 3;  4WHA A;  1W6G A;  5STD A;  4NRE A;  2FNQ A;  1YVB I;  3EQQ B;  2XR8 B;  3MSO A;  4R9L A;  2RNT A;  3VF1 A;  6STD A;  3G8Z A;  1JB5 A;  5AEU B;  1N5H A;  1RCK A;  3F9S A;  3SYU A;  3G71 3;  1W2B 2;  5IW9 A;  4OUQ A;  2HMK B;  1K28 A;  2LYX A;  3JUM A;  1NWW A;  1O7G B;  2W04 A;  3NM2 A;  4J9A A;  5IG4 A;  3FKA A;  4KT3 B;  2Z77 A;  3HIG A;  1BNI A;  2XSO B;  3BLZ A;  2B1X B;  3PCR A;  1W6Y A;  1IV9 A;  1W6C A;  4JRF A;  3N8B A;  3D79 A;  3K5T A;  3F8H A;  2CFK A;  5IG0 A;  7GSP A;  5IEN A;  1RN4 A;  4HOH A;  1N8Q A;  3CC4 3;  1SQW A;  1VQN 3;  4EYC A;  4N6O B;  3LZA A;  4KZ1 A;  1DE3 A;  3BB9 A;  3DM8 A;  1VQ9 3;  3PZW A;  4MJD A;  3HOH A;  3T0U A;  1DET A;  3U97 A;  2ML6 A;  2HMN B;  5D83 A;  5BVB A;  1DVC A;  1V57 A;  2E2U A;  4HM5 B;  3K9M C;  1NJI 4;  3LOY A;  1GSP A;  4RNZ A;  1EEJ A;  1VQM 3;  3MKI A;  2OQE C;  1Q7Y 4;  1GOY A;  3DGL A;  2F99 A;  4R9K A;  5FGO A;  2CFL A;  2K54 A;  1N9J A;  1RGC A;  3UL6 A;  4IIA A;  1AV4 A;  4LGQ A;  1U5O A;  1B2S A;  1BSE A;  2CFW A;  2CFG A;  4HM1 B;  3X42 A;  1IV7 A;  1OGZ A;  3IJE B;  3D5I A;  1IVV A;  2UUG C;  1LOY A;  4HM3 B;  1YGW A;  4U13 A;  9RNT A;  2WO0 A;  2IYJ A;  4HM8 B;  5BXQ A;  1EQK A;  1LXE A;  2P38 A;  5JBS A;  3JUP A;  3WA3 A;  1YI2 3;  3DY5 A;  2BU4 A;  3NBJ A;  1WMN A;  5HOH A;  3NBB A;  3STD A;  3EBY A;  1IVW A;  3S27 A;  1DVD A;  2KCD A;  1PFP A;  1VQO 3;  2BO9 B;  3DZL A;  1BRK A;  1EG9 B;  5HGR A;  4BTX A;  3WR2 A;  1LRA A;  1BUJ A;  1YGE A;  1AVK A;  4XDW A;  2C11 A;  2XFS A;  3CNX A;  3LT8 A;  2GBX B;  3PYJ A;  1TJD A;  1GD3 A;  3F14 A;  3CCQ 3;  1SAR A;  3V92 A;  7STD A;  1LVN A;  1IQX A;  4WP5 A;  3HII A;  1JBT A;  2FGT A;  2XFT A;  1FGQ A;  2AAE A;  1BRI A;  3FG4 A;  1VQP 3;  2CWV A;  3FLJ A;  3OWS A;  3CD6 3;  3LTD A;  4XDV A;  7RNT A;  2W9P A;  1YJN 3;  1JB4 A;  1E97 A;  3LTC A;  1I8V A;  1MWT A;  4AEQ A;  3K7C A;  2CX1 A;  2R4I A;  3CNM A;  3NHX A;  1VQ6 3;  3WMD A;  1LOW A;  3EC9 A;  3PCS A;  4KFE A;  5RNT A;  2P0X A;  3NM7 A;  2GU1 A;  4FCM A;  3B4O A;  3GAX A;  1FW7 A;  3CMA 3;  3Q2P A;  1Q40 B;  4N6V 0;  1PY3 A;  1UGI A;  2KF4 A;  3JUO A;  3CCE 3;  1VQ7 3;  4OK0 A;  1QAL A;  1JRQ A;  4EV2 A;  3CC7 3;  1BAN A;  2D42 A;  2KXG A;  1KWI A;  4WFO A;  2IUJ A;  2XRX B;  2F5M A;  3CCJ 3;  5AIH A;  3NXJ A;  1ROV A;  1STF I;  1IQY A;  4N6T A;  3M8C A;  1JN5 B;  3DGY A;  1I0X A;  3G0K A;  1SII A;  1TP6 A;  1W7C A;  3HI7 A;  3SED A;  2RSX A;  4R80 A;  3EN8 A;  1I3I A;  4J5K A;  3O8Y A;  3F7X A;  1O7W B;  2GEX A;  3LTA A;  3NX0 A;  4IPB A;  1NDO B;  2D1W A;  3EJV A;  4HM2 B;  3V99 A;  1NU3 A;  4EV5 A;  2W0Q A;  1EA2 A;  5KP3 A;  4KFF A;  3URP A;  1ISK A;  1JNQ A;  3B8L A;  5DRV A;  4RBN A;  4HM6 B;  5IF6 A;  1UUV B;  1BNF A;  3JUN A;  2QEX 3;  3GZR A;  1RN7 A;  4MMY B;  4O3V A;  1JJ2 2;  1JKG B;  1ULJ B;  1U8C B;  1OUN A;  3F7S A;  2GU3 A;  1QAF A;  1K8A 4;  2H0G A;  1Z1S A;  1GMQ A;  2W03 A;  3WOD G;  1LQM B;  4HM0 B;  4K1V A;  3D4A A;  1JN5 A;  1RGL A;  1TRP A;  2WOF A;  1VQQ A;  3SOY A;  4AKZ A;  2C4B A;  1D6Y A;  1X1Y A;  3GRD A;  4GB5 A;  1LQG C;  4XB5 A;  3WHO A;  3TDG A;  2W6J H;  1QVF 2;  3BND A;  1A90 A;  1Q42 A;  2CH9 A;  4HZ9 B;  2UGI A;  2CHC A;  3EX9 A;  4CPK A;  4Q53 A;  5CXO A;  1RLS A;  8CHO A;  3FGY A;  1EUI C;  1IT8 A;  4MMZ B;  3EHC A;  3NQY A;  2KF6 A;  5EVH A;  1A2K A;  3SOA A;  1T3B A;  1JKG A;  4LSO A;  1T2H A;  3S67 A;  1SIH A;  3CCR 3;  1GY7 A;  4LZI A;  5D82 A;  1BAO A;  2UX0 A;  4HZB B;  3PXM A;  1SPU A;  1BRH A;  4I4K A;  3RDE A;  4WYK A;  1FUW A;  3N9H A;  2YFI B;  1FUT A;  4EC6 A;  4XBX A;  1BRS A;  1I0V A;  1WQL B;  1YIT 3;  1A67 A;  3G4S 3;  4GSP A;  1QAK A;  3PGB A;  4GHO A;  2STD A;  4L8O A;  3ZG0 A;  1HYF A;  1D6U A;  3SLU A;  1PU4 A;  4XBT A;  2CW9 A;  3T8N A;  1CQS A;  1S5A A;  2BMR B;  1ZS7 A;  1BOX A;  3UNL A;  1RJO A;  1CYU A;  1IU7 A;  1I2G A;  2XF3 A;  2ZA4 A;  4LMI A;  3RNT A;  4BL3 A;  1M1K 4;  3I55 3;  1AQZ A;  2R41 A;  3ALA A;  3NV0 A;  1B2U A;  3QRD A;  2YX9 A;  3MG3 A;  1VQ4 3;  3EBT A;  5CK6 A;  3LXU X;  1YVS A;  4X2O A;  1BNE A;  2Z76 A;  1B3S A;  1VQL 3;  3UL5 A;  4N6M A;  3FSD A;  4GL6 A;  5AII A;  1TTO A;  1UCK A;  3I0Y A;  4NHF A;  1ZGX A;  3CCV 3;  2Q07 A;  1RDS A;  3X3X A;  3NBR A;  3KKG A;  4N3V A;  5IEP A;  1HU9 A;  1UCL A;  1IK3 A;  2QA4 3;  1IQ8 A;  3BNC A;  4R4K A;  1OHS A;  1NNV A;  5EQL A;  3CCL 3;  3OWY A;  3X3Y A;  1BRG A;  3AHW A;  3BNB A;  2HMM B;  3ZFZ A;  2BMO B;  2BIR A;  2A15 A;  2V1L A;  1I70 A;  4K90 B;  1O7P B;  2WOH A;  1RNB A;  3K0Z A;  2OQE A;  5BIR A;  2IA7 A;  5AI1 A;  4WWU C;  2I9W A;  4HYZ A;  4R1K A;  2BMQ B;  4BTW A;  5IG5 A;  1BVI A;  3KCH A;  1Q7H A;  3D9R A;  3VSY A;  1LNI A;  1N9E A;  2YFL B;  1O7N B;  1RN1 A;  3AGN A;  1AY7 A;  3HZP A;  1FGO A;  2O3O A;  3DGM A;  3EB8 A;  5IEO A;  5AEW B;  1B21 A;  2P0M A;  4HM4 B;  2Z7A A;  3CCU 3;  2PNC A;  3NUV A;  3MYT A;  2SBL A;  5CF2 A;  2KAA A;  3H51 A;  2CKF B;  2ZDJ A;  1GY6 A;  2IY2 A;  4RZM A;  1RTU A;  1KQS 2;  1UI7 A;  1GMP A;  4FMA A;  3JVC A;  3ECF A;  2GSP A;  3X41 A;  5BU4 A;  1MOL A;  1FGT A;  3N54 B;  1W02 A;  1OAC A;  1T2I A;  3A76 A;  3FF2 A;  4H61 A;  1BSD A;  1B27 A;  2XEP A;  2Z6B A;  1FZU A;  4OVM A;  1CEW I;  1KC8 4;  2E2T A;  5D81 A;  1MGR A;  1GYB A;  3KE7 A;  2HML B;  2L1S A;  3L0R A;  4N6U A;  1K73 4;  3G16 A;  5AYS C;  1BSC A;  1X1W A;  2RCD A;  4PEJ A;  4HM7 B;  1RGF A;  4QWT A;  2W9Q A;  1JZO A;  1QMA A;  1K9M 4;  2F98 A;  1US1 A;  1UUW B;  2WGQ A;  3BNE A;  1W00 A;  1CYV A;  1DMN A;  3LH4 A;  4O2H A;  3WA2 X;  1GS3 A;  1E3R A;  1JV2 B;  3PS8 A;  1W01 A;  2RBI A;  1IT7 A;  1GY5 A;  2O9U X;  3CXC 2;  1B2M A;  2HMJ B;  1DMM A;  3VGN A;  5KP4 A;  1HKX A;  2RGQ A;  3RGR A;  4O02 B;  5IER A;  5IG3 A;  4BU4 A;  3F8X A;  3AGO A;  4LEH A;  1FGM A;  1FUS A;  1LNH A;  2BNG A;  4FR9 A;  4TX4 A;  3ROB A;  3BIR A;  3E99 A;  4MEI A;  2RFR A;  1M1X B;  1NB3 I;  2Y74 A;  5AIG A;  3I56 3;  2BT3 A;  1AR0 A;  5LC6 A;  1V58 A;  4FMD A;  1TUH A;  1IVU A;  4ORL A;  2CK3 H;  5A0O B;  2CWT A;  4STD A;  4X2H A;  1I2E A;  5M1A A;  2P05 A;  3WOF B;  1M90 4;  1EKM A;  3UB1 A;  1BIR A;  3DUK A;  3OX9 A;  2B24 B;  3KSP A;  3WDG B;  1UW1 A;  3G6E 3;  3Q1C A;  4LYL B;  3KSE D;  4BIR A;  4O8S A;  3H3H A;  1STD A;  1UCJ A;  4RNY A;  1CH0 A;  3EF8 A;  1VZZ A;  2IMJ A;  1BNR A;  5JPP A;  1RCL A;  4EW5 A;  2XGL A;  1YNV X;  3Q3F A;  1GD4 A;  1Y4K A;  1R4C A;  3NV0 B;  4RNT A;  2INX A;  3FG3 A;  3IPT A;  1IVX A;  1E3V A;  3OV4 A;  1VQK 3;  1C54 A;  3FF0 A;  3DXO A;  1N5P A;  3S5C A;  1NO3 A;  2F56 A;  4DKI A;  1RHL A;  1NB5 I;  1RMS A;  5ELU A;  1BNJ A;  1X1U A;  3KFQ C;  2CWU A;  3BU4 A;  2XSH B;  4HJL B;  4NPB A;  8RNT A;  4KFD A;  5AIF A;  1BGS A;  1DYU A;  3DMC A;  4BL2 A;  1O7H B;  1BNG A;  3AHS A;  3D3L A;  1RGK A;  1FGR A;  3LYG A;  1B20 A;  3DH2 A;  1OHO A;  1MWR A;  3ER7 A;  3X40 A;  4BTY A;  2GXF A;  1RGH A;  1UDI I;  3B4P A;  2FXT A;  1G02 A;  3OWU A;  1KSI A;  1RRH A;  5ELJ A;  4FMB A;  1RGG A;  1A2V A;  3SVA A;  3SXX A;  1OGX A;  2Y73 A;  1B2Z A;  4K61 A;  2OOV A;  2GBW B;  1D6Z A;  1ULI B;  5M19 A;  2QIY A;  5LC7 A;  1FA3 A;  1K41 A;  1Q9E A;  3EN1 B;  5AYR B;  3QK9 A;  1OPY A;  1JBR A;  4JF8 A;  1BSA A;  2ZHX B;  3HK4 A;  3AMO A;  2K0M A;  1UI8 A;  3MG2 A;  3CPW 2;  1OH0 A;  2OTL 3;  1OF5 A;  3MHE A;  1ZX2 A;  1GOU A;  2L4V A;  4KVH A;  1G0T A;  2ZL8 A;  6RNT A;  1L5G B;  2SAR A;  1LOV A;  1MNL A;  1R4Y A;  3Q90 A;  1MWS A;  2W56 B;  5CF1 A;  2OCT A;  3A5E A;  4K1U A;  4J8T A;  1Q81 4;  1G96 A;  1OF5 B;  1W4N A;  1RSN A;  1ROA A;  1GOV A;  2IUK A;  3KII A;  5G2G A;  2H0H A;  4HAA A;  3SX1 A;  1DMQ A;  2CFD A;  3IMA B;  5TGN A;  1M9G A;  4EBG A;  3MWZ A;  1WMP A;  3MPH A;  4H3U A;  3KN4 A;  3NQZ A;  1AVL A;  3HX8 A;  2KF5 A;  4ZM8 A;  1Q40 A;  2J8X B;  1JBS A;  1TU5 A;  2OWP A;  1RRL A;  2XGN A;  3F40 A;  1RGA A;  4ILF A;  3KZT A;  5FW5 A;  1YJ9 3;  1O7M B;  1MWU A;  3JUQ A;  1YHQ 3;  1BNS A;  2MC8 A;  2KRT A;  1BSB A;  1F8N A;  1YJW 3;  4XBY A;  1VQ5 3;  1Q86 4;  3LML A;  1UGH I;  1TIJ A;  4XM4 A;  2YFJ B;  1LOX A;  3ZG5 A;  1C7H A;  2C10 A;  4FMC A;  2HMO B;  3GZB A;  1GMR A;  4CJN A;  3OW2 2;  2CC3 A;  2H0I A;  2GEY A;  1JZD A;  1V74 A;  2F5W A;  1B2X A;  3T8U A;  3U1W A;  5CLK A;  3FZW A;  1W5Z A;  5EEO A;  3OXA A;  1SJW A;  3GZY B;  3FG1 A;  4G1M B;  1A2P A;  1ZO2 A;  3WOE B;  1VQ8 3;  1BRN L;  2KF3 A;  1WNH A;  2M7O A;  1I3F A;  3FCS B;  4CDL A;  3LTB A;  1RKY A;  4HBR A;  3DGN A;  4EXR A;  1N8R 4;  2P09 A;  4L8P A;  4L7K A;  1OCV A;  2CG0 A;  1WTH A;  2PZV A;  3GWR A;  4MMX B;  2HOH A;  5M18 A;  3LT9 A;  1YIJ 3;  1TFO A;  1RGE A;  2W56 A;  3D5G A;  4WYK B;  3CU3 A;  2BHM A;  5G1K A;  5KP1 A;  3CME 3;  3FH1 A;  1BU4 A;  4FCJ A;  1FYS A;  1TRQ A;  3K63 A;  2JQ5 A;  2QGU A;  1J2B A;  1I2F A;  6GSP A;  1MGW A;  1UUG B;  1BRJ A;  1OHP A;  3DGO A;  4CCV A;  3MG1 A;  2K3D A;  1X1X A;  1PYL A;  4HVN A;  4FCZ A;  1S72 3;  3GSP A;  3AMO B;  2E2V A;  2XH9 A;  4N6N B;  4AKY A;  5I97 A;  5DRE A;  1IDP A;  2ML5 A;  1RNT A;  3CC2 3;  3CCM 3;  1BUQ A;  1JB2 A;  1IYY A;  3X3Z A;  1KD1 4;  3CCS 3;  3S29 A;  1UCI A;  2F86 B;  4N6L A;  5GSP A;  3RGA A;  2AAD A;  4J5G A;  2CX0 A;  4I5Q A;  1ASK A;  2LQV A;  1QJG A;  3GZX B;  4HKV B;  4IT7 A;  1TFK A;  3V98 A;  2CG1 A;  2WGO A;  3J7Y d;  2OOV C;  2F4Y A;  5JPU A;  1W2Z A; 
#chains in the Genus database with same CATH homology
 3EE1 A;  2CIU A;  2MF7 A;  2JDI H;  1WMO A;  1Q82 4;  1QVG 2;  3B7C A;  2W2C A;  1T5Y A;  3S28 A;  3CPO A;  3UJM A;  2OTJ 3;  4WHA A;  1W6G A;  5STD A;  4NRE A;  2FNQ A;  1YVB I;  3EQQ B;  2XR8 B;  3MSO A;  4R9L A;  3VF1 A;  6STD A;  3G8Z A;  1JB5 A;  5AEU B;  1N5H A;  3G71 3;  3F9S A;  1W2B 2;  5IW9 A;  4OUQ A;  2HMK B;  1K28 A;  2LYX A;  3JUM A;  1NWW A;  1O7G B;  2W04 A;  3NM2 A;  4J9A A;  5IG4 A;  3FKA A;  2Z77 A;  3HIG A;  2XSO B;  3BLZ A;  2B1X B;  3PCR A;  1W6Y A;  1IV9 A;  1W6C A;  4JRF A;  3N8B A;  3K5T A;  3F8H A;  2CFK A;  5IG0 A;  5IEN A;  1N8Q A;  3CC4 3;  1SQW A;  1VQN 3;  4EYC A;  4N6O B;  3LZA A;  4KZ1 A;  3BB9 A;  3DM8 A;  1VQ9 3;  3PZW A;  4MJD A;  3T0U A;  3U97 A;  2ML6 A;  2HMN B;  5D83 A;  5BVB A;  1DVC A;  2E2U A;  4HM5 B;  1NJI 4;  3K9M C;  3LOY A;  4RNZ A;  1VQM 3;  3MKI A;  2OQE C;  1Q7Y 4;  3DGL A;  2F99 A;  4R9K A;  5FGO A;  2CFL A;  2K54 A;  1N9J A;  3UL6 A;  4IIA A;  1AV4 A;  4LGQ A;  1U5O A;  2CFW A;  2CFG A;  4HM1 B;  3X42 A;  1IV7 A;  1OGZ A;  3IJE B;  1IVV A;  4U13 A;  4HM3 B;  2WO0 A;  4HM8 B;  5BXQ A;  1EQK A;  1LXE A;  2P38 A;  5JBS A;  3JUP A;  3WA3 A;  1YI2 3;  3DY5 A;  3NBJ A;  1WMN A;  3NBB A;  3STD A;  3EBY A;  1IVW A;  3S27 A;  1DVD A;  2KCD A;  1PFP A;  1VQO 3;  2BO9 B;  3DZL A;  1EG9 B;  5HGR A;  4BTX A;  1YGE A;  1AVK A;  4XDW A;  2C11 A;  2XFS A;  3CNX A;  3LT8 A;  2GBX B;  3PYJ A;  1GD3 A;  3F14 A;  3CCQ 3;  3V92 A;  7STD A;  1LVN A;  1IQX A;  4WP5 A;  3HII A;  2FGT A;  2XFT A;  1FGQ A;  1VQP 3;  3FG4 A;  2CWV A;  3FLJ A;  3OWS A;  3CD6 3;  3LTD A;  4XDV A;  2W9P A;  1YJN 3;  1JB4 A;  1E97 A;  3LTC A;  4AEQ A;  3K7C A;  2R4I A;  3NHX A;  3CNM A;  1VQ6 3;  3WMD A;  3EC9 A;  3PCS A;  4KFE A;  2P0X A;  3NM7 A;  2GU1 A;  4FCM A;  3B4O A;  3GAX A;  3CMA 3;  3Q2P A;  1Q40 B;  4N6V 0;  1VQ7 3;  3JUO A;  3CCE 3;  4OK0 A;  1QAL A;  1JRQ A;  4EV2 A;  3CC7 3;  2D42 A;  2KXG A;  1KWI A;  4WFO A;  2IUJ A;  2XRX B;  3CCJ 3;  5AIH A;  3NXJ A;  1ROV A;  1STF I;  1IQY A;  4N6T A;  3M8C A;  1JN5 B;  3G0K A;  1SII A;  1TP6 A;  1W7C A;  3HI7 A;  3SED A;  2RSX A;  4R80 A;  3EN8 A;  3O8Y A;  3F7X A;  1O7W B;  2GEX A;  3LTA A;  3NX0 A;  4IPB A;  1NDO B;  2D1W A;  3EJV A;  4HM2 B;  3V99 A;  1NU3 A;  4EV5 A;  2W0Q A;  1EA2 A;  5KP3 A;  4KFF A;  1ISK A;  1JNQ A;  3B8L A;  5DRV A;  4RBN A;  4HM6 B;  5IF6 A;  1UUV B;  3JUN A;  2QEX 3;  3GZR A;  1RN7 A;  4MMY B;  4O3V A;  1JJ2 2;  1JKG B;  1ULJ B;  1U8C B;  1OUN A;  3F7S A;  2GU3 A;  1QAF A;  1K8A 4;  1Z1S A;  3WOD G;  2W03 A;  4HM0 B;  4K1V A;  1JN5 A;  2WOF A;  3SOY A;  4AKZ A;  1D6Y A;  3GRD A;  4GB5 A;  4XB5 A;  3TDG A;  2W6J H;  1QVF 2;  3BND A;  1A90 A;  1Q42 A;  2CH9 A;  4HZ9 B;  3EX9 A;  2CHC A;  4Q53 A;  5CXO A;  8CHO A;  3FGY A;  1IT8 A;  4MMZ B;  3EHC A;  3NQY A;  5EVH A;  1A2K A;  3SOA A;  1JKG A;  4LSO A;  3S67 A;  1SIH A;  3CCR 3;  1GY7 A;  4LZI A;  5D82 A;  2UX0 A;  4HZB B;  3PXM A;  1SPU A;  4I4K A;  3RDE A;  4WYK A;  1FUW A;  3N9H A;  2YFI B;  1YIT 3;  4EC6 A;  4XBX A;  1WQL B;  1A67 A;  3G4S 3;  1QAK A;  3PGB A;  2STD A;  4L8O A;  1D6U A;  3SLU A;  1PU4 A;  4XBT A;  2CW9 A;  3T8N A;  1CQS A;  1S5A A;  2BMR B;  3UNL A;  1CYU A;  1RJO A;  1IU7 A;  2XF3 A;  1M1K 4;  4LMI A;  3I55 3;  3ALA A;  3NV0 A;  3QRD A;  2YX9 A;  3MG3 A;  1VQ4 3;  3EBT A;  5CK6 A;  3LXU X;  4X2O A;  2Z76 A;  1VQL 3;  3UL5 A;  4N6M A;  3FSD A;  4GL6 A;  5AII A;  3I0Y A;  4NHF A;  3CCV 3;  2Q07 A;  3X3X A;  3NBR A;  3KKG A;  4N3V A;  5IEP A;  1HU9 A;  1IK3 A;  2QA4 3;  1IQ8 A;  3BNC A;  4R4K A;  1OHS A;  5EQL A;  3CCL 3;  3OWY A;  3X3Y A;  3BNB A;  2HMM B;  2BMO B;  2A15 A;  2V1L A;  4K90 B;  2WOH A;  1O7P B;  3K0Z A;  2OQE A;  2IA7 A;  5AI1 A;  4WWU C;  2I9W A;  4HYZ A;  4R1K A;  2BMQ B;  4BTW A;  5IG5 A;  3D9R A;  3VSY A;  2YFL B;  1N9E A;  1O7N B;  3HZP A;  1FGO A;  2O3O A;  3DGM A;  3EB8 A;  5IEO A;  5AEW B;  2P0M A;  4HM4 B;  2Z7A A;  3CCU 3;  2PNC A;  3NUV A;  3MYT A;  2SBL A;  5CF2 A;  3H51 A;  2CKF B;  2ZDJ A;  1GY6 A;  4RZM A;  1KQS 2;  1UI7 A;  4FMA A;  3JVC A;  3ECF A;  3X41 A;  1MOL A;  1FGT A;  3N54 B;  1W02 A;  1OAC A;  3A76 A;  3FF2 A;  4H61 A;  2XEP A;  2Z6B A;  4OVM A;  1CEW I;  1KC8 4;  2E2T A;  5D81 A;  1GYB A;  3KE7 A;  2HML B;  3L0R A;  4N6U A;  1K73 4;  3G16 A;  5AYS C;  2RCD A;  4PEJ A;  4HM7 B;  4QWT A;  2W9Q A;  1QMA A;  1K9M 4;  2F98 A;  1US1 A;  1UUW B;  2WGQ A;  3BNE A;  1W00 A;  1CYV A;  1DMN A;  3LH4 A;  4O2H A;  3WA2 X;  1GS3 A;  1E3R A;  1JV2 B;  3PS8 A;  1W01 A;  3CXC 2;  1IT7 A;  1GY5 A;  2O9U X;  2HMJ B;  1DMM A;  3VGN A;  5KP4 A;  1HKX A;  2RGQ A;  3RGR A;  4O02 B;  5IER A;  5IG3 A;  3F8X A;  4LEH A;  1FGM A;  1LNH A;  2BNG A;  4FR9 A;  4TX4 A;  3ROB A;  3E99 A;  4MEI A;  2RFR A;  1M1X B;  1NB3 I;  2Y74 A;  5AIG A;  3I56 3;  2BT3 A;  1AR0 A;  5LC6 A;  4FMD A;  1TUH A;  1IVU A;  4ORL A;  2CK3 H;  5A0O B;  2CWT A;  4STD A;  4X2H A;  3WOF B;  1M90 4;  2P05 A;  1EKM A;  3UB1 A;  3DUK A;  3OX9 A;  2B24 B;  3KSP A;  3WDG B;  1UW1 A;  3G6E 3;  3Q1C A;  3KSE D;  4O8S A;  3H3H A;  1STD A;  4RNY A;  3EF8 A;  1VZZ A;  2IMJ A;  5JPP A;  2XGL A;  1GD4 A;  1Y4K A;  1R4C A;  3NV0 B;  1VQK 3;  2INX A;  3FG3 A;  3IPT A;  1IVX A;  1E3V A;  3OV4 A;  3FF0 A;  3DXO A;  1N5P A;  3S5C A;  1NO3 A;  1NB5 I;  5ELU A;  3KFQ C;  2CWU A;  2XSH B;  4HJL B;  4KFD A;  5AIF A;  1DYU A;  3DMC A;  1O7H B;  3D3L A;  1FGR A;  3LYG A;  1OHO A;  3ER7 A;  3X40 A;  4BTY A;  2GXF A;  3B4P A;  2FXT A;  3OWU A;  1KSI A;  1RRH A;  5ELJ A;  4FMB A;  1A2V A;  3SVA A;  3SXX A;  1OGX A;  2Y73 A;  4K61 A;  2OOV A;  2GBW B;  1D6Z A;  1ULI B;  2QIY A;  5LC7 A;  1FA3 A;  1K41 A;  3EN1 B;  5AYR B;  3QK9 A;  1OPY A;  4JF8 A;  3HK4 A;  3AMO A;  2K0M A;  1UI8 A;  3MG2 A;  3CPW 2;  1OH0 A;  2OTL 3;  1OF5 A;  3MHE A;  1ZX2 A;  4KVH A;  2L4V A;  2ZL8 A;  1L5G B;  1MNL A;  3Q90 A;  2W56 B;  5CF1 A;  2OCT A;  4K1U A;  4J8T A;  1Q81 4;  1G96 A;  1OF5 B;  1W4N A;  3KII A;  1ROA A;  2IUK A;  5G2G A;  3SX1 A;  1DMQ A;  2CFD A;  3IMA B;  5TGN A;  1M9G A;  4EBG A;  3MWZ A;  1WMP A;  3MPH A;  4H3U A;  3KN4 A;  3NQZ A;  1AVL A;  3HX8 A;  4ZM8 A;  1Q40 A;  1TU5 A;  2OWP A;  1RRL A;  2XGN A;  3F40 A;  5FW5 A;  3KZT A;  1YJ9 3;  1O7M B;  3JUQ A;  1YHQ 3;  2MC8 A;  2KRT A;  1F8N A;  1YJW 3;  4XBY A;  1VQ5 3;  1Q86 4;  3LML A;  1TIJ A;  4XM4 A;  2YFJ B;  1LOX A;  1C7H A;  2C10 A;  4FMC A;  2HMO B;  3GZB A;  3OW2 2;  2CC3 A;  2GEY A;  1V74 A;  3T8U A;  3U1W A;  5CLK A;  3FZW A;  1W5Z A;  5EEO A;  3OXA A;  1SJW A;  3GZY B;  3FG1 A;  4G1M B;  1ZO2 A;  3WOE B;  1VQ8 3;  1WNH A;  2M7O A;  3FCS B;  4CDL A;  1RKY A;  3LTB A;  4HBR A;  3DGN A;  4EXR A;  1N8R 4;  2P09 A;  4L8P A;  4L7K A;  1OCV A;  1WTH A;  2CG0 A;  2PZV A;  3GWR A;  4MMX B;  1S72 3;  3LT9 A;  1YIJ 3;  1TFO A;  2W56 A;  4WYK B;  3CU3 A;  2BHM A;  5KP1 A;  3CME 3;  3FH1 A;  4FCJ A;  3K63 A;  2JQ5 A;  2QGU A;  1J2B A;  1OHP A;  3DGO A;  4CCV A;  3MG1 A;  4HVN A;  4FCZ A;  3AMO B;  2E2V A;  2XH9 A;  4N6N B;  4AKY A;  5I97 A;  5DRE A;  1IDP A;  2ML5 A;  3CC2 3;  3CCM 3;  1BUQ A;  1JB2 A;  3X3Z A;  1KD1 4;  3CCS 3;  3S29 A;  2F86 B;  4N6L A;  3RGA A;  4IT7 A;  1ASK A;  2LQV A;  1QJG A;  3GZX B;  4HKV B;  1TFK A;  3V98 A;  2CG1 A;  2WGO A;  3J7Y d;  2OOV C;  5JPU A;  1W2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...