2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
1KC84 1YJ93 1Q814 3CPW2 3CCU3 1YJN3 1VQM3 1VQK3 1VQ83 1S723 1K9M4 1VQ43 1YJW3 3G4S3 3CC73 1Q824 1VQ93 3CXC2 1M904 3CCM3 3CD63 3CCR3 1KD14 1YI23 2QEX3 1YIT3 3G713 3G6E3 1Q864 1VQO3 3CMA3 1VQP3 1VQL3 2OTL3 3CC43 3CCV3 3I553 1VQ73 1K8A4 1QVF2 1K734 3CC23 3CCJ3 2QA43 3CCE3 3CME3 1VQ63 1N8R4 1Q7Y4 1VQN3 3OW22 3CCS3 2OTJ3 3I563 1W2B2 1M1K4 1KQS2 1QVG2 3CCL3 1NJI4 3CCQ3 1YIJ3 1YHQ3 1JJ22 1VQ53
chains in the Genus database with same CATH superfamily
3MWZA 1M1XB 3HOHA 4AEQA 1TRQA 3D9RA 3WMDA 1IT8A 4KZ1A 2OOVA 4HM8B 2P09A 1HKXA 1TTOA 1BUJA 3CXC2 1RSNA 3S27A 5AYSC 1YIT3 1A67A 3OXAA 3G6E3 4WYKB 3DY5A 7RNTA 3NUVA 1OHSA 1O7MB 4R80A 1GSPA 5BIRA 5G2GA 2F4YA 3CCJ3 4IPBA 1RN4A 2IA7A 3OX9A 4GHOA 1PY3A 4IIAA 3SOYA 3WA2X 1X1UA 1VQ63 1GOYA 2CWTA 1OGXA 1DMNA 3B4OA 3GZBA 4GL6A 2J8XB 3UL6A 3D5GA 3HK4A 2Q07A 5D81A 5IW9A 2SARA 3BNEA 1IVVA 1C7HA 3B8LA 1VQM3 2KRTA 1K9M4 1YJW3 3EF8A 3NXJA 1C54A 1UGHI 3QRDA 4H61A 3HI7A 4K1VA 3F40A 1I8VA 2ZHXB 4L8OA 3DH2A 5DREA 2GEYA 2W9PA 3LOYA 3F9SA 1FZUA 1OHPA 2BNGA 1L5GB 1D6YA 1IVWA 2W2CA 1AQZA 3LXUX 5BU4A 1QVF2 3CC23 2UGIA 4RZMA 5HGRA 1UW1A 3LTBA 4OUQA 5IENA 3NQZA 4HAAA 1DVDA 1BGSA 3KSED 4HBRA 1V58A 4KFEA 1M1K4 1JNQA 2B24B 1RGEA 4HZBB 2XGNA 2H0IA 1ZX2A 4I5QA 2C4BA 1IV7A 1BANA 1TRPA 2O3OA 1JJ22 1VQ43 4MMXB 1JBRA 4I4KA 1VQK3 3GZXB 4O02B 1BVIA 1RGHA 3Q3FA 2W6JH 5IG0A 3DGOA 1A2VA 3WR2A 4FMCA 2LQVA 1UCKA 2Y74A 1E97A 1UCLA 2CFKA 2K3DA 4MEIA 4BIRA 1BNGA 3AHWA 1BAOA 3X3YA 1BNFA 4J9AA 1RCLA 6GSPA 4X2HA 2JQ5A 3LYGA 2BMOB 2GBWB 2YX9A 5LC7A 4AKZA 4R9LA 4ORLA 2AADA 1UUGB 1Q42A 3GAXA 1NO3A 3CNMA 2HMJB 3ER7A 3SVAA 3WA3A 1LVNA 4FCJA 1NWWA 4N6V0 1DMMA 4N6OB 5RNTA 1IU7A 3KN4A 1TJDA 5STDA 1QAKA 5M19A 2CH9A 2YFIB 1MWTA 1N9JA 1OUNA 2CFLA 4L7KA 3HIIA 3CCR3 1JKGA 1RKYA 1Q864 1G96A 1MWUA 1I3FA 1PYLA 2ZL8A 3LTDA 4LYLB 5EQLA 3V98A 2P0XA 1HU9A 4HVNA 2K0MA 1RN1A 1RNBA 3RDEA 2AAEA 1X1WA 3MG2A 4FR9A 1ZGXA 1MGWA 1STFI 1NNVA 3RGAA 1IQ8A 4N6UA 5IEOA 1W2B2 2CKFB 2WO0A 3ZG0A 1JN5B 1RRLA 3HIGA 4RBNA 4H3UA 1FW7A 1RCKA 4XBYA 1Q814 3CPW2 1Q7HA 3ALAA 3BLZA 4TX4A 1W4NA 5KP3A 3PZWA 5AIFA 3AMOB 4BTYA 1F8NA 1MWSA 5M1AA 1T5YA 2BO9B 1LOXA 1LNHA 3KE7A 2V1LA 5M18A 2BMRB 1I2FA 1MGRA 4HM2B 1IV9A 3GZRA 3GSPA 1K8A4 3WODG 1GOVA 1IQXA 2ML5A 1YGEA 2CWVA 1WTHA 3FG4A 2QA43 3U1WA 2F98A 4LEHA 3DGMA 1N8R4 3FF2A 2W56A 1CQSA 1I2GA 1KSIA 1YVSA 3SXXA 1PU4A 1MOLA 1CYUA 1W2ZA 1STDA 4KT3B 3CCL3 3L0RA 1GD4A 3VGNA 2Z76A 4HM0B 2XSOB 3NHXA 1N5PA 3UL5A 4LZIA 1O7NB 2HOHA 3WHOA 1DYUA 1ULIB 2KF6A 3FCSB 3MG1A 2UX0A 1O7GB 3KFQC 1S5AA 3F14A 3FG1A 3X40A 1AVKA 1LNIA 2F99A 2WGOA 4HM5B 2KXGA 2A15A 4MJDA 4MMZB 2BT3A 4R9KA 1OHOA 1YI23 1BSDA 1QJGA 1B2SA 3F8HA 1RGKA 4XB5A 2RGQA 3FG3A 4HM7B 1NB5I 1WMPA 2XFSA 1EQKA 1A90A 3ECFA 3Q2PA 5FGOA 3CME3 1RJOA 4EYCA 2SBLA 2RNTA 4FMAA 3FZWA 1ZS7A 2XF3A 1RGAA 4GB5A 4WWUC 1BU4A 1IYYA 1BNIA 6STDA 2LYXA 1TUHA 2XRXB 4L8PA 4K1UA 1GY7A 1UUVB 1AVLA 3PCRA 4PEJA 5KP4A 3N54B 2CFDA 3NQYA 2MF7A 3HX8A 2E2VA 1BNJA 3DXOA 3EBTA 3FSDA 3EN1B 1YNVX 4RNYA 3ZFZA 2BMQB 2CX1A 3KZTA 3G8ZA 3CD63 1D6ZA 5G1KA 3K0ZA 1RHLA 1UGIA 1OF5A 2M7OA 1ROVA 5BVBA 1B3SA 3EN8A 2RSXA 4RNZA 1BNEA 1OACA 3B7CA 5IG3A 2R41A 2F56A 5AEWB 3LMLA 1T3BA 1FUSA 3OWUA 2KF3A 3K7CA 4KFFA 3SX1A 4AKYA 1JRQA 1RMSA 1FGQA 2CC3A 4CCVA 1IVUA 3NV0A 1YJ93 3LT8A 2STDA 3EE1A 1TU5A 2GU3A 1YVBI 3MYTA 4BTWA 3SYUA 3X3ZA 1AV4A 1I0VA 4WP5A 8CHOA 5IF6A 3DGYA 1TFOA 4HKVB 2YFJB 4LSOA 3BIRA 1Q40A 3M8CA 3WDGB 5EVHA 5LC6A 4WHAA 5JPPA 1GY5A 6RNTA 1BUQA 3CNXA 1K734 2H0GA 1BNSA 2HMKB 3N8BA 1W01A 1G02A 1LQMB 1X1XA 2QIYA 3D79A 3PGBA 4K61A 3CCS3 3NM2A 3KKGA 1YJN3 4OVMA 3A5EA 3S28A 3G0KA 4HM4B 1BRKA 2F86B 3IJEB 4STDA 1EG9B 2JDIH 2XH9A 3JUOA 5AEUB 1ROAA 1Z1SA 3BB9A 3BNCA 2I9WA 4R4KA 1VQ83 2CFGA 2F5MA 3FF0A 2WGQA 3Q90A 3D3LA 3G16A 1EKMA 4EV5A 3DUKA 3BNDA 2C11A 3KCHA 1RN7A 1JZOA 3VF1A 4HM3B 3WOFB 2BHMA 4JF8A 2GXFA 1FGRA 1M9GA 3OV4A 3SLUA 3G713 1ASKA 1K28A 1QMAA 3AGOA 2GEXA 3OWSA 3TDGA 4WYKA 2R4IA 3PS8A 2P38A 4ZM8A 1TP6A 2IUKA 4HZ9B 1WMOA 4NREA 1RNTA 1U8CB 4HYZA 4JRFA 1W5ZA 2C10A 3K5TA 3GRDA 4G1MB 2MC8A 2B1XB 3LTAA 3I563 2ZA4A 1W7CA 1BSEA 5BXQA 2KF5A 1BRGA 4N3VA 2W04A 1A2KA 1JB5A 2W9QA 1RGGA 1X1YA 1NB3I 2CWUA 2IYJA 5TGNA 3EB8A 1GMQA 4GSPA 1E3VA 3E99A 1BRHA 5IERA 1DMQA 1SQWA 1QALA 3NM7A 5EEOA 2PZVA 3CU3A 3FGYA 1ULJB 3MSOA 1OH0A 3JUNA 3K9MC 4RNTA 5FW5A 2L1SA 4O8SA 1I70A 1ZO2A 5CK6A 3DGLA 1IDPA 1JB2A 5AIHA 3CCE3 1Q7Y4 2CFWA 4XDVA 1SIIA 3BNBA 2OTJ3 5AYRB 1BOXA 3F8XA 1GS3A 2D42A 4N6LA 1KQS2 1TFKA 4FMDA 5D83A 5KP1A 1QVG2 4EXRA 2CK3H 2BU4A 1SPUA 3UB1A 1FGTA 7STDA 5AIIA 1UUWB 1W6YA 3NX0A 4NHFA 3CCU3 3MKIA 5HOHA 1I2EA 4LGQA 4U13A 2E2TA 4N6NB 1I3IA 1B2ZA 1UCJA 2IMJA 1HYFA 1W00A 3IPTA 1OGZA 2FGTA 2O9UX 3FLJA 4BU4A 3UJMA 3UNLA 3URPA 2OTL3 4CPKA 2GU1A 1VQ73 1GOUA 2F5WA 1HZ1A 2L4VA 1A2PA 1RDSA 1B20A 5G1LA 1W6CA 4XBTA 3SEDA 1D6UA 1BSAA 1O7WB 2RFRA 3JUQA 1O7PB 3EX9A 2ML6A 7GSPA 1RLSA 3NBRA 1MWRA 1CYVA 1JKGB 1GYBA 3G4S3 1VQ93 1FA3A 1MNLA 2Z6BA 5IG5A 1NU3A 3EHCA 3I0YA 1EA2A 1VQO3 2BIRA 4NPBA 2H0HA 3ROBA 2KF4A 4WFOA 9RNTA 2PNCA 1RTUA 1FGMA 1N8QA 5ELJA 1WMNA 3X3XA 1N5HA 2D1WA 3EBYA 5CF1A 4N6TA 3WOEB 2CW9A 2CG0A 3I553 3STDA 2Z77A 2OQEC 1LOYA 2WOHA 3CCQ3 1YIJ3 3DMCA 2WOFA 1KC84 1JN5A 1RGCA 1AY7A 1GMRA 1SJWA 3ZG5A 4FMBA 1K41A 3LH4A 1BNRA 3A76A 1WQLB 2XFTA 3O8YA 4HJLB 3CC73 3HZPA 3CCV3 3DM8A 3T8NA 1RGLA 1UI7A 3AMOA 4XM4A 3V99A 2Z7AA 3MG3A 5JBSA 1YGWA 3H3HA 3X42A 4O3VA 5ELUA 1LOVA 1JBTA 2W56B 1B21A 2RBIA 4XBXA 1JB4A 5AI1A 4EW5A 8RNTA 2OCTA 3MPHA 2INXA 5IG4A 5CLKA 3V92A 2K54A 3FKAA 4HM1B 5AIGA 1BSBA 1NJI4 1IK3A 2W03A 1YHQ3 2IY2A 1KWIA 4EBGA 1VQ53 3S5CA 1PFPA 4R1KA 4X2OA 1N9EA 3S67A 1GMPA 4J8TA 1S723 3N9HA 1R4CA 3S29A 1FUTA 2HMNB 1LRAA 4CJNA 3LTCA 4IT7A 1UI8A 3GWRA 3J7Yd 3Q1CA 4DKIA 1VQQA 1G0TA 2GBXB 3D4AA 3U97A 3CC43 3LT9A 2CX0A 1BRNL 3F7SA 4BL3A 1VQN3 1E3RA 1B2UA 1SARA 1T2HA 1T2IA 2HMOB 4J5GA 4BTXA 3OW22 5IEPA 1U5OA 2KAAA 4KVHA 1LOWA 1W6GA 1GY6A 1I0XA 1Q9EA 2E2UA 2XR8B 3GZYB 4J5KA 1FUWA 2OOVC 3T8UA 1QAFA 1BSCA 1B2XA 2ZDJA 5D82A 4ILFA 2OQEA 1JBSA 3PYJA 4LMIA 2P05A 1JV2B 1FGOA 2CIUA 3LZAA 1M904 1OF5B 1B27A 3H51A 1DVCA 2YFLB 5DRVA 2CG1A 1CH0A 2FNQA 3CMA3 2QGUA 1R4YA 3MHEA 3IMAB 3B4PA 4OK0A 5CF2A 1V74A 4QWTA 2OWPA 1IQYA 1FYSA 2Y73A 3D5IA 1LXEA 2UUGC 3FH1A 3JVCA 4FCZA 4KFDA 3X41A 1IVXA 1UCIA 3DGNA 3DZLA 1WNHA 3OWYA 1AR0A 3PXMA 3KSPA 3VSYA 4BL2A 1IT7A 1BIRA 2P0MA 2W0QA 2XSHB 5I97A 1NDOB 4XDWA 1Y4KA 3NV0B 1BRJA 3PCSA 1JZDA 1US1A 3JUPA 1W02A 2RCDA 5CXOA 3AHSA 1O7HB 1UDII 3EJVA 3JUMA 1LQGC 1DETA 3F7XA 1BRIA 1GD3A 3NBJA 4HOHA 1CEWI 4K90B 4HM6B 1SIHA 2IUJA 3RGRA 3SOAA 3RNTA 4EC6A 1Q40B 1Q824 1V57A 2HMLB 3K63A 3EQQB 4Q53A 1ISKA 4O2HA 1KD14 2FXTA 2QEX3 2XGLA 3KIIA 1B2MA 3AGNA 3NBBA 1VQP3 1VQL3 4N6MA 2XEPA 1RRHA 2GSPA 3BU4A 3CPOA 1BRSA 1RGFA 4FCMA 1OPYA 4CDLA 1J2BA 1EUIC 2CHCA 1OCVA 3T0UA 3CCM3 1VZZA 2HMMB 5GSPA 4MMYB 1TIJA 1DE3A 1EEJA 3EC9A 5JPUA 4EV2A 5A0OB 3QK9A 2KCDA
chains in the Genus database with same CATH topology
3MWZA 1M1XB 4AEQA 3D9RA 3WMDA 1IT8A 4KZ1A 2OOVA 4HM8B 2P09A 1HKXA 3CXC2 3S27A 5AYSC 1YIT3 1A67A 3OXAA 3G6E3 4WYKB 3DY5A 3NUVA 1OHSA 1O7MB 4R80A 5G2GA 3CCJ3 4IPBA 1VQ63 2IA7A 3OX9A 4IIAA 3SOYA 3WA2X 2CWTA 1OGXA 1DMNA 3B4OA 3GZBA 4GL6A 3UL6A 3HK4A 2Q07A 5D81A 5IW9A 3BNEA 1IVVA 1C7HA 3B8LA 1VQM3 2KRTA 1K9M4 1YJW3 3EF8A 3NXJA 3QRDA 4H61A 3HI7A 4K1VA 3F40A 4L8OA 5DREA 2GEYA 2W9PA 3LOYA 3F9SA 1OHPA 2BNGA 1QVF2 1L5GB 1D6YA 1IVWA 2W2CA 3LXUX 3CC23 4RZMA 5HGRA 1UW1A 3LTBA 4OUQA 5IENA 3NQZA 1DVDA 3KSED 4HBRA 4KFEA 1M1K4 1JNQA 2B24B 4HZBB 2XGNA 1ZX2A 1JJ22 1IV7A 2O3OA 4MMXB 4I4KA 1VQK3 3GZXB 4O02B 2W6JH 5IG0A 3DGOA 1A2VA 4FMCA 2LQVA 2Y74A 1E97A 2CFKA 4MEIA 3X3YA 4J9AA 4X2HA 2JQ5A 3LYGA 2BMOB 2GBWB 2YX9A 5LC7A 4AKZA 4R9LA 4ORLA 1Q42A 3GAXA 1NO3A 3CNMA 2HMJB 3ER7A 3SVAA 3WA3A 1LVNA 4FCJA 1NWWA 4N6V0 1DMMA 4N6OB 1IU7A 3KN4A 5STDA 1QAKA 2CH9A 2YFIB 1N9JA 1OUNA 2CFLA 4L7KA 3HIIA 3CCR3 1JKGA 1RKYA 1Q864 1G96A 2ZL8A 3LTDA 5EQLA 3V98A 2P0XA 1HU9A 4HVNA 2K0MA 3RDEA 3MG2A 4FR9A 1STFI 3RGAA 1IQ8A 4N6UA 5IEOA 1W2B2 2CKFB 2WO0A 1JN5B 1RRLA 3HIGA 4RBNA 4H3UA 1Q814 3CPW2 3ALAA 3BLZA 4TX4A 1W4NA 5KP3A 3PZWA 5AIFA 3AMOB 4BTYA 1F8NA 1T5YA 2BO9B 1LOXA 1LNHA 3KE7A 2V1LA 2BMRB 4HM2B 1IV9A 3GZRA 1K8A4 3WODG 1IQXA 2ML5A 1YGEA 2CWVA 1WTHA 3FG4A 2QA43 3U1WA 2F98A 4LEHA 3DGMA 1N8R4 3FF2A 2W56A 1CQSA 1KSIA 3SXXA 1PU4A 1MOLA 1CYUA 1W2ZA 1STDA 3CCL3 3L0RA 1GD4A 3VGNA 2Z76A 4HM0B 2XSOB 3NHXA 1N5PA 3UL5A 4LZIA 1O7NB 1DYUA 1ULIB 3FCSB 3MG1A 2UX0A 1O7GB 3KFQC 1S5AA 3F14A 3FG1A 3X40A 1AVKA 2F99A 4HM5B 2WGOA 4MJDA 2KXGA 2A15A 4MMZB 4R9KA 2BT3A 3CCM3 1OHOA 1YI23 1QJGA 3F8HA 4XB5A 2RGQA 3FG3A 4HM7B 1NB5I 1WMPA 2XFSA 1EQKA 1A90A 3ECFA 3Q2PA 5FGOA 3CME3 1RJOA 4EYCA 2SBLA 4FMAA 3FZWA 2XF3A 4GB5A 4WWUC 6STDA 2LYXA 1TUHA 2XRXB 4L8PA 4K1UA 1GY7A 1UUVB 1AVLA 3PCRA 4PEJA 5KP4A 3N54B 2CFDA 3NQYA 2MF7A 3HX8A 2E2VA 3DXOA 3EBTA 3FSDA 4RNYA 3EN1B 3CD63 2BMQB 3KZTA 3G8ZA 1D6ZA 3K0ZA 1OF5A 2M7OA 1ROVA 5BVBA 3EN8A 2RSXA 4RNZA 1OACA 3B7CA 5AEWB 3LMLA 3OWUA 3K7CA 4KFFA 3SX1A 4AKYA 1JRQA 1FGQA 2CC3A 4CCVA 1IVUA 3NV0A 1YJ93 3LT8A 2STDA 3EE1A 1TU5A 2GU3A 1YVBI 3MYTA 4BTWA 3X3ZA 1AV4A 4WP5A 8CHOA 5IF6A 4HKVB 1TFOA 4LSOA 2YFJB 1Q40A 3M8CA 3WDGB 5EVHA 5LC6A 4WHAA 5JPPA 1GY5A 1BUQA 3CNXA 1K734 2HMKB 3N8BA 1W01A 2QIYA 3PGBA 4K61A 3CCS3 3NM2A 3KKGA 4OVMA 3S28A 3G0KA 4HM4B 2F86B 3IJEB 4STDA 1EG9B 2JDIH 2XH9A 3JUOA 5AEUB 1ROAA 1Z1SA 3BB9A 3BNCA 2I9WA 4R4KA 1VQ83 2CFGA 3FF0A 2WGQA 3Q90A 3D3LA 3G16A 1EKMA 4EV5A 3DUKA 3BNDA 2C11A 1RN7A 3VF1A 4HM3B 3WOFB 2BHMA 4JF8A 2GXFA 1FGRA 1M9GA 3OV4A 3SLUA 3G713 1ASKA 1K28A 1QMAA 2GEXA 3OWSA 3TDGA 4WYKA 2R4IA 3PS8A 2P38A 4ZM8A 1TP6A 2IUKA 4HZ9B 1WMOA 4NREA 1U8CB 4HYZA 4JRFA 1W5ZA 2C10A 3K5TA 3GRDA 4G1MB 2MC8A 2B1XB 3LTAA 3I563 1W7CA 5BXQA 4N3VA 2W04A 1A2KA 1JB5A 2W9QA 1NB3I 2CWUA 5TGNA 3EB8A 1E3VA 3E99A 5IERA 1DMQA 1SQWA 1QALA 3NM7A 5EEOA 2PZVA 3CU3A 3FGYA 1ULJB 3MSOA 1OH0A 3JUNA 3K9MC 5FW5A 3I553 3CCV3 4O8SA 1ZO2A 5CK6A 3DGLA 1IDPA 1JB2A 5AIHA 3CCE3 1Q7Y4 2CFWA 4XDVA 1SIIA 3BNBA 2OTJ3 5AYRB 3F8XA 1GS3A 2D42A 4N6LA 1KQS2 1TFKA 4FMDA 5D83A 5KP1A 1QVG2 4EXRA 2CK3H 1SPUA 3UB1A 1FGTA 7STDA 5AIIA 1UUWB 1W6YA 3NX0A 4NHFA 3CCU3 3MKIA 4LGQA 4U13A 2E2TA 4N6NB 2IMJA 1W00A 3IPTA 1OGZA 2FGTA 2O9UX 3FLJA 3UJMA 3UNLA 2OTL3 2GU1A 1VQ73 2L4VA 1W6CA 4XBTA 3SEDA 1D6UA 1O7WB 2RFRA 3JUQA 1O7PB 3EX9A 2ML6A 3NBRA 1CYVA 1JKGB 1GYBA 3G4S3 1VQ93 1FA3A 1MNLA 2Z6BA 5IG5A 1NU3A 3EHCA 3I0YA 1EA2A 1VQO3 3ROBA 4WFOA 2PNCA 1FGMA 1N8QA 5ELJA 1WMNA 3X3XA 1N5HA 2D1WA 3EBYA 5CF1A 4N6TA 3WOEB 2CW9A 2CG0A 3STDA 2Z77A 2OQEC 3CCQ3 2WOHA 1YIJ3 3DMCA 2WOFA 1KC84 1JN5A 1SJWA 4FMBA 1K41A 3LH4A 3A76A 1WQLB 2XFTA 3O8YA 4HJLB 3CC73 3HZPA 3DM8A 3T8NA 1UI7A 3AMOA 4XM4A 3V99A 2Z7AA 3MG3A 5JBSA 3H3HA 3X42A 4O3VA 5ELUA 2W56B 5IG4A 4XBXA 1JB4A 5AI1A 2OCTA 3MPHA 2INXA 5CLKA 3V92A 2K54A 3FKAA 4HM1B 5AIGA 1NJI4 1IK3A 2W03A 1YHQ3 1KWIA 4EBGA 1VQ53 3S5CA 1PFPA 4R1KA 4X2OA 1N9EA 3S67A 4J8TA 1S723 3N9HA 1R4CA 3S29A 2HMNB 3LTCA 4IT7A 1UI8A 3GWRA 3J7Yd 3Q1CA 2GBXB 3U97A 3CC43 3LT9A 3F7SA 1VQN3 1E3RA 4BTXA 3OW22 2HMOB 5IEPA 1U5OA 4KVHA 1W6GA 1GY6A 2E2UA 2XR8B 3GZYB 1FUWA 2OOVC 3T8UA 1QAFA 2ZDJA 5D82A 2OQEA 3PYJA 4LMIA 2P05A 1JV2B 1FGOA 2CIUA 3LZAA 1M904 1OF5B 3H51A 1DVCA 2YFLB 5DRVA 2CG1A 2FNQA 3CMA3 2QGUA 3MHEA 3IMAB 3B4PA 4OK0A 5CF2A 1V74A 4QWTA 2OWPA 1IQYA 2Y73A 3JVCA 4FCZA 1LXEA 3FH1A 4KFDA 4XDWA 3X41A 5IG3A 1IVXA 3DGNA 3DZLA 1WNHA 3OWYA 1AR0A 3PXMA 3KSPA 3VSYA 1IT7A 2P0MA 2W0QA 2XSHB 5I97A 1NDOB 1Y4KA 3NV0B 3PCSA 1US1A 3JUPA 1W02A 2RCDA 5CXOA 3EJVA 1O7HB 3JUMA 1YJN3 3F7XA 4XBYA 2IUJA 3RGRA 1GD3A 3NBJA 1VQ43 1CEWI 4K90B 4HM6B 1SIHA 3SOAA 4EC6A 1Q40B 1Q824 2HMLB 3K63A 3EQQB 4Q53A 1ISKA 4O2HA 1KD14 2FXTA 2QEX3 2XGLA 3KIIA 3NBBA 1VQP3 1VQL3 4N6MA 2XEPA 1RRHA 3CPOA 4FCMA 1OPYA 4CDLA 1J2BA 2CHCA 1OCVA 3T0UA 1VZZA 2HMMB 4MMYB 1TIJA 3EC9A 5JPUA 4EV2A 5A0OB 3QK9A 2KCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 4;  1YJ9 3;  1Q81 4;  3CPW 2;  3CCU 3;  1YJN 3;  1VQM 3;  1VQK 3;  1VQ8 3;  1S72 3;  1K9M 4;  1VQ4 3;  1YJW 3;  3G4S 3;  3CC7 3;  1Q82 4;  1VQ9 3;  3CXC 2;  1M90 4;  3CCM 3;  3CD6 3;  3CCR 3;  1KD1 4;  1YI2 3;  2QEX 3;  1YIT 3;  3G71 3;  3G6E 3;  1Q86 4;  1VQO 3;  3CMA 3;  1VQP 3;  1VQL 3;  2OTL 3;  3CC4 3;  3CCV 3;  3I55 3;  1VQ7 3;  1K8A 4;  1QVF 2;  1K73 4;  3CC2 3;  3CCJ 3;  2QA4 3;  3CCE 3;  3CME 3;  1VQ6 3;  1N8R 4;  1Q7Y 4;  1VQN 3;  3OW2 2;  3CCS 3;  2OTJ 3;  3I56 3;  1W2B 2;  1M1K 4;  1KQS 2;  1QVG 2;  3CCL 3;  1NJI 4;  3CCQ 3;  1YIJ 3;  1YHQ 3;  1JJ2 2;  1VQ5 3; 
#chains in the Genus database with same CATH topology
 3MWZ A;  1M1X B;  3HOH A;  4AEQ A;  1TRQ A;  3D9R A;  3WMD A;  1IT8 A;  4KZ1 A;  2OOV A;  4HM8 B;  2P09 A;  1HKX A;  1TTO A;  1BUJ A;  3CXC 2;  1RSN A;  3S27 A;  5AYS C;  1YIT 3;  1A67 A;  3OXA A;  3G6E 3;  4WYK B;  3DY5 A;  7RNT A;  3NUV A;  1OHS A;  1O7M B;  4R80 A;  1GSP A;  5BIR A;  5G2G A;  2F4Y A;  3CCJ 3;  4IPB A;  1RN4 A;  2IA7 A;  3OX9 A;  4GHO A;  1PY3 A;  4IIA A;  3SOY A;  3WA2 X;  1X1U A;  1VQ6 3;  1GOY A;  2CWT A;  1OGX A;  1DMN A;  3B4O A;  3GZB A;  4GL6 A;  2J8X B;  3UL6 A;  3D5G A;  3HK4 A;  2Q07 A;  5D81 A;  5IW9 A;  2SAR A;  3BNE A;  1IVV A;  1C7H A;  3B8L A;  1VQM 3;  2KRT A;  1K9M 4;  1YJW 3;  3EF8 A;  3NXJ A;  1C54 A;  1UGH I;  3QRD A;  4H61 A;  3HI7 A;  4K1V A;  3F40 A;  1I8V A;  2ZHX B;  4L8O A;  3DH2 A;  5DRE A;  2GEY A;  2W9P A;  3LOY A;  3F9S A;  1FZU A;  1OHP A;  2BNG A;  1L5G B;  1D6Y A;  1IVW A;  2W2C A;  1AQZ A;  3LXU X;  5BU4 A;  1QVF 2;  3CC2 3;  2UGI A;  4RZM A;  5HGR A;  1UW1 A;  3LTB A;  4OUQ A;  5IEN A;  3NQZ A;  4HAA A;  1DVD A;  1BGS A;  3KSE D;  4HBR A;  1V58 A;  4KFE A;  1M1K 4;  1JNQ A;  2B24 B;  1RGE A;  4HZB B;  2XGN A;  2H0I A;  1ZX2 A;  4I5Q A;  2C4B A;  1IV7 A;  1BAN A;  1TRP A;  2O3O A;  1JJ2 2;  1VQ4 3;  4MMX B;  1JBR A;  4I4K A;  1VQK 3;  3GZX B;  4O02 B;  1BVI A;  1RGH A;  3Q3F A;  2W6J H;  5IG0 A;  3DGO A;  1A2V A;  3WR2 A;  4FMC A;  2LQV A;  1UCK A;  2Y74 A;  1E97 A;  1UCL A;  2CFK A;  2K3D A;  4MEI A;  4BIR A;  1BNG A;  3AHW A;  1BAO A;  3X3Y A;  1BNF A;  4J9A A;  1RCL A;  6GSP A;  4X2H A;  2JQ5 A;  3LYG A;  2BMO B;  2GBW B;  2YX9 A;  5LC7 A;  4AKZ A;  4R9L A;  4ORL A;  2AAD A;  1UUG B;  1Q42 A;  3GAX A;  1NO3 A;  3CNM A;  2HMJ B;  3ER7 A;  3SVA A;  3WA3 A;  1LVN A;  4FCJ A;  1NWW A;  4N6V 0;  1DMM A;  4N6O B;  5RNT A;  1IU7 A;  3KN4 A;  1TJD A;  5STD A;  1QAK A;  5M19 A;  2CH9 A;  2YFI B;  1MWT A;  1N9J A;  1OUN A;  2CFL A;  4L7K A;  3HII A;  3CCR 3;  1JKG A;  1RKY A;  1Q86 4;  1G96 A;  1MWU A;  1I3F A;  1PYL A;  2ZL8 A;  3LTD A;  4LYL B;  5EQL A;  3V98 A;  2P0X A;  1HU9 A;  4HVN A;  2K0M A;  1RN1 A;  1RNB A;  3RDE A;  2AAE A;  1X1W A;  3MG2 A;  4FR9 A;  1ZGX A;  1MGW A;  1STF I;  1NNV A;  3RGA A;  1IQ8 A;  4N6U A;  5IEO A;  1W2B 2;  2CKF B;  2WO0 A;  3ZG0 A;  1JN5 B;  1RRL A;  3HIG A;  4RBN A;  4H3U A;  1FW7 A;  1RCK A;  4XBY A;  1Q81 4;  3CPW 2;  1Q7H A;  3ALA A;  3BLZ A;  4TX4 A;  1W4N A;  5KP3 A;  3PZW A;  5AIF A;  3AMO B;  4BTY A;  1F8N A;  1MWS A;  5M1A A;  1T5Y A;  2BO9 B;  1LOX A;  1LNH A;  3KE7 A;  2V1L A;  5M18 A;  2BMR B;  1I2F A;  1MGR A;  4HM2 B;  1IV9 A;  3GZR A;  3GSP A;  1K8A 4;  3WOD G;  1GOV A;  1IQX A;  2ML5 A;  1YGE A;  2CWV A;  1WTH A;  3FG4 A;  2QA4 3;  3U1W A;  2F98 A;  4LEH A;  3DGM A;  1N8R 4;  3FF2 A;  2W56 A;  1CQS A;  1I2G A;  1KSI A;  1YVS A;  3SXX A;  1PU4 A;  1MOL A;  1CYU A;  1W2Z A;  1STD A;  4KT3 B;  3CCL 3;  3L0R A;  1GD4 A;  3VGN A;  2Z76 A;  4HM0 B;  2XSO B;  3NHX A;  1N5P A;  3UL5 A;  4LZI A;  1O7N B;  2HOH A;  3WHO A;  1DYU A;  1ULI B;  2KF6 A;  3FCS B;  3MG1 A;  2UX0 A;  1O7G B;  3KFQ C;  1S5A A;  3F14 A;  3FG1 A;  3X40 A;  1AVK A;  1LNI A;  2F99 A;  2WGO A;  4HM5 B;  2KXG A;  2A15 A;  4MJD A;  4MMZ B;  2BT3 A;  4R9K A;  1OHO A;  1YI2 3;  1BSD A;  1QJG A;  1B2S A;  3F8H A;  1RGK A;  4XB5 A;  2RGQ A;  3FG3 A;  4HM7 B;  1NB5 I;  1WMP A;  2XFS A;  1EQK A;  1A90 A;  3ECF A;  3Q2P A;  5FGO A;  3CME 3;  1RJO A;  4EYC A;  2SBL A;  2RNT A;  4FMA A;  3FZW A;  1ZS7 A;  2XF3 A;  1RGA A;  4GB5 A;  4WWU C;  1BU4 A;  1IYY A;  1BNI A;  6STD A;  2LYX A;  1TUH A;  2XRX B;  4L8P A;  4K1U A;  1GY7 A;  1UUV B;  1AVL A;  3PCR A;  4PEJ A;  5KP4 A;  3N54 B;  2CFD A;  3NQY A;  2MF7 A;  3HX8 A;  2E2V A;  1BNJ A;  3DXO A;  3EBT A;  3FSD A;  3EN1 B;  1YNV X;  4RNY A;  3ZFZ A;  2BMQ B;  2CX1 A;  3KZT A;  3G8Z A;  3CD6 3;  1D6Z A;  5G1K A;  3K0Z A;  1RHL A;  1UGI A;  1OF5 A;  2M7O A;  1ROV A;  5BVB A;  1B3S A;  3EN8 A;  2RSX A;  4RNZ A;  1BNE A;  1OAC A;  3B7C A;  5IG3 A;  2R41 A;  2F56 A;  5AEW B;  3LML A;  1T3B A;  1FUS A;  3OWU A;  2KF3 A;  3K7C A;  4KFF A;  3SX1 A;  4AKY A;  1JRQ A;  1RMS A;  1FGQ A;  2CC3 A;  4CCV A;  1IVU A;  3NV0 A;  1YJ9 3;  3LT8 A;  2STD A;  3EE1 A;  1TU5 A;  2GU3 A;  1YVB I;  3MYT A;  4BTW A;  3SYU A;  3X3Z A;  1AV4 A;  1I0V A;  4WP5 A;  8CHO A;  5IF6 A;  3DGY A;  1TFO A;  4HKV B;  2YFJ B;  4LSO A;  3BIR A;  1Q40 A;  3M8C A;  3WDG B;  5EVH A;  5LC6 A;  4WHA A;  5JPP A;  1GY5 A;  6RNT A;  1BUQ A;  3CNX A;  1K73 4;  2H0G A;  1BNS A;  2HMK B;  3N8B A;  1W01 A;  1G02 A;  1LQM B;  1X1X A;  2QIY A;  3D79 A;  3PGB A;  4K61 A;  3CCS 3;  3NM2 A;  3KKG A;  1YJN 3;  4OVM A;  3A5E A;  3S28 A;  3G0K A;  4HM4 B;  1BRK A;  2F86 B;  3IJE B;  4STD A;  1EG9 B;  2JDI H;  2XH9 A;  3JUO A;  5AEU B;  1ROA A;  1Z1S A;  3BB9 A;  3BNC A;  2I9W A;  4R4K A;  1VQ8 3;  2CFG A;  2F5M A;  3FF0 A;  2WGQ A;  3Q90 A;  3D3L A;  3G16 A;  1EKM A;  4EV5 A;  3DUK A;  3BND A;  2C11 A;  3KCH A;  1RN7 A;  1JZO A;  3VF1 A;  4HM3 B;  3WOF B;  2BHM A;  4JF8 A;  2GXF A;  1FGR A;  1M9G A;  3OV4 A;  3SLU A;  3G71 3;  1ASK A;  1K28 A;  1QMA A;  3AGO A;  2GEX A;  3OWS A;  3TDG A;  4WYK A;  2R4I A;  3PS8 A;  2P38 A;  4ZM8 A;  1TP6 A;  2IUK A;  4HZ9 B;  1WMO A;  4NRE A;  1RNT A;  1U8C B;  4HYZ A;  4JRF A;  1W5Z A;  2C10 A;  3K5T A;  3GRD A;  4G1M B;  2MC8 A;  2B1X B;  3LTA A;  3I56 3;  2ZA4 A;  1W7C A;  1BSE A;  5BXQ A;  2KF5 A;  1BRG A;  4N3V A;  2W04 A;  1A2K A;  1JB5 A;  2W9Q A;  1RGG A;  1X1Y A;  1NB3 I;  2CWU A;  2IYJ A;  5TGN A;  3EB8 A;  1GMQ A;  4GSP A;  1E3V A;  3E99 A;  1BRH A;  5IER A;  1DMQ A;  1SQW A;  1QAL A;  3NM7 A;  5EEO A;  2PZV A;  3CU3 A;  3FGY A;  1ULJ B;  3MSO A;  1OH0 A;  3JUN A;  3K9M C;  4RNT A;  5FW5 A;  2L1S A;  4O8S A;  1I70 A;  1ZO2 A;  5CK6 A;  3DGL A;  1IDP A;  1JB2 A;  5AIH A;  3CCE 3;  1Q7Y 4;  2CFW A;  4XDV A;  1SII A;  3BNB A;  2OTJ 3;  5AYR B;  1BOX A;  3F8X A;  1GS3 A;  2D42 A;  4N6L A;  1KQS 2;  1TFK A;  4FMD A;  5D83 A;  5KP1 A;  1QVG 2;  4EXR A;  2CK3 H;  2BU4 A;  1SPU A;  3UB1 A;  1FGT A;  7STD A;  5AII A;  1UUW B;  1W6Y A;  3NX0 A;  4NHF A;  3CCU 3;  3MKI A;  5HOH A;  1I2E A;  4LGQ A;  4U13 A;  2E2T A;  4N6N B;  1I3I A;  1B2Z A;  1UCJ A;  2IMJ A;  1HYF A;  1W00 A;  3IPT A;  1OGZ A;  2FGT A;  2O9U X;  3FLJ A;  4BU4 A;  3UJM A;  3UNL A;  3URP A;  2OTL 3;  4CPK A;  2GU1 A;  1VQ7 3;  1GOU A;  2F5W A;  1HZ1 A;  2L4V A;  1A2P A;  1RDS A;  1B20 A;  5G1L A;  1W6C A;  4XBT A;  3SED A;  1D6U A;  1BSA A;  1O7W B;  2RFR A;  3JUQ A;  1O7P B;  3EX9 A;  2ML6 A;  7GSP A;  1RLS A;  3NBR A;  1MWR A;  1CYV A;  1JKG B;  1GYB A;  3G4S 3;  1VQ9 3;  1FA3 A;  1MNL A;  2Z6B A;  5IG5 A;  1NU3 A;  3EHC A;  3I0Y A;  1EA2 A;  1VQO 3;  2BIR A;  4NPB A;  2H0H A;  3ROB A;  2KF4 A;  4WFO A;  9RNT A;  2PNC A;  1RTU A;  1FGM A;  1N8Q A;  5ELJ A;  1WMN A;  3X3X A;  1N5H A;  2D1W A;  3EBY A;  5CF1 A;  4N6T A;  3WOE B;  2CW9 A;  2CG0 A;  3I55 3;  3STD A;  2Z77 A;  2OQE C;  1LOY A;  2WOH A;  3CCQ 3;  1YIJ 3;  3DMC A;  2WOF A;  1KC8 4;  1JN5 A;  1RGC A;  1AY7 A;  1GMR A;  1SJW A;  3ZG5 A;  4FMB A;  1K41 A;  3LH4 A;  1BNR A;  3A76 A;  1WQL B;  2XFT A;  3O8Y A;  4HJL B;  3CC7 3;  3HZP A;  3CCV 3;  3DM8 A;  3T8N A;  1RGL A;  1UI7 A;  3AMO A;  4XM4 A;  3V99 A;  2Z7A A;  3MG3 A;  5JBS A;  1YGW A;  3H3H A;  3X42 A;  4O3V A;  5ELU A;  1LOV A;  1JBT A;  2W56 B;  1B21 A;  2RBI A;  4XBX A;  1JB4 A;  5AI1 A;  4EW5 A;  8RNT A;  2OCT A;  3MPH A;  2INX A;  5IG4 A;  5CLK A;  3V92 A;  2K54 A;  3FKA A;  4HM1 B;  5AIG A;  1BSB A;  1NJI 4;  1IK3 A;  2W03 A;  1YHQ 3;  2IY2 A;  1KWI A;  4EBG A;  1VQ5 3;  3S5C A;  1PFP A;  4R1K A;  4X2O A;  1N9E A;  3S67 A;  1GMP A;  4J8T A;  1S72 3;  3N9H A;  1R4C A;  3S29 A;  1FUT A;  2HMN B;  1LRA A;  4CJN A;  3LTC A;  4IT7 A;  1UI8 A;  3GWR A;  3J7Y d;  3Q1C A;  4DKI A;  1VQQ A;  1G0T A;  2GBX B;  3D4A A;  3U97 A;  3CC4 3;  3LT9 A;  2CX0 A;  1BRN L;  3F7S A;  4BL3 A;  1VQN 3;  1E3R A;  1B2U A;  1SAR A;  1T2H A;  1T2I A;  2HMO B;  4J5G A;  4BTX A;  3OW2 2;  5IEP A;  1U5O A;  2KAA A;  4KVH A;  1LOW A;  1W6G A;  1GY6 A;  1I0X A;  1Q9E A;  2E2U A;  2XR8 B;  3GZY B;  4J5K A;  1FUW A;  2OOV C;  3T8U A;  1QAF A;  1BSC A;  1B2X A;  2ZDJ A;  5D82 A;  4ILF A;  2OQE A;  1JBS A;  3PYJ A;  4LMI A;  2P05 A;  1JV2 B;  1FGO A;  2CIU A;  3LZA A;  1M90 4;  1OF5 B;  1B27 A;  3H51 A;  1DVC A;  2YFL B;  5DRV A;  2CG1 A;  1CH0 A;  2FNQ A;  3CMA 3;  2QGU A;  1R4Y A;  3MHE A;  3IMA B;  3B4P A;  4OK0 A;  5CF2 A;  1V74 A;  4QWT A;  2OWP A;  1IQY A;  1FYS A;  2Y73 A;  3D5I A;  1LXE A;  2UUG C;  3FH1 A;  3JVC A;  4FCZ A;  4KFD A;  3X41 A;  1IVX A;  1UCI A;  3DGN A;  3DZL A;  1WNH A;  3OWY A;  1AR0 A;  3PXM A;  3KSP A;  3VSY A;  4BL2 A;  1IT7 A;  1BIR A;  2P0M A;  2W0Q A;  2XSH B;  5I97 A;  1NDO B;  4XDW A;  1Y4K A;  3NV0 B;  1BRJ A;  3PCS A;  1JZD A;  1US1 A;  3JUP A;  1W02 A;  2RCD A;  5CXO A;  3AHS A;  1O7H B;  1UDI I;  3EJV A;  3JUM A;  1LQG C;  1DET A;  3F7X A;  1BRI A;  1GD3 A;  3NBJ A;  4HOH A;  1CEW I;  4K90 B;  4HM6 B;  1SIH A;  2IUJ A;  3RGR A;  3SOA A;  3RNT A;  4EC6 A;  1Q40 B;  1Q82 4;  1V57 A;  2HML B;  3K63 A;  3EQQ B;  4Q53 A;  1ISK A;  4O2H A;  1KD1 4;  2FXT A;  2QEX 3;  2XGL A;  3KII A;  1B2M A;  3AGN A;  3NBB A;  1VQP 3;  1VQL 3;  4N6M A;  2XEP A;  1RRH A;  2GSP A;  3BU4 A;  3CPO A;  1BRS A;  1RGF A;  4FCM A;  1OPY A;  4CDL A;  1J2B A;  1EUI C;  2CHC A;  1OCV A;  3T0U A;  3CCM 3;  1VZZ A;  2HMM B;  5GSP A;  4MMY B;  1TIJ A;  1DE3 A;  1EEJ A;  3EC9 A;  5JPU A;  4EV2 A;  5A0O B;  3QK9 A;  2KCD A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  1M1X B;  4AEQ A;  3D9R A;  3WMD A;  1IT8 A;  4KZ1 A;  2OOV A;  4HM8 B;  2P09 A;  1HKX A;  3CXC 2;  3S27 A;  5AYS C;  1YIT 3;  1A67 A;  3OXA A;  3G6E 3;  4WYK B;  3DY5 A;  3NUV A;  1OHS A;  1O7M B;  4R80 A;  5G2G A;  3CCJ 3;  4IPB A;  1VQ6 3;  2IA7 A;  3OX9 A;  4IIA A;  3SOY A;  3WA2 X;  2CWT A;  1OGX A;  1DMN A;  3B4O A;  3GZB A;  4GL6 A;  3UL6 A;  3HK4 A;  2Q07 A;  5D81 A;  5IW9 A;  3BNE A;  1IVV A;  1C7H A;  3B8L A;  1VQM 3;  2KRT A;  1K9M 4;  1YJW 3;  3EF8 A;  3NXJ A;  3QRD A;  4H61 A;  3HI7 A;  4K1V A;  3F40 A;  4L8O A;  5DRE A;  2GEY A;  2W9P A;  3LOY A;  3F9S A;  1OHP A;  2BNG A;  1QVF 2;  1L5G B;  1D6Y A;  1IVW A;  2W2C A;  3LXU X;  3CC2 3;  4RZM A;  5HGR A;  1UW1 A;  3LTB A;  4OUQ A;  5IEN A;  3NQZ A;  1DVD A;  3KSE D;  4HBR A;  4KFE A;  1M1K 4;  1JNQ A;  2B24 B;  4HZB B;  2XGN A;  1ZX2 A;  1JJ2 2;  1IV7 A;  2O3O A;  4MMX B;  4I4K A;  1VQK 3;  3GZX B;  4O02 B;  2W6J H;  5IG0 A;  3DGO A;  1A2V A;  4FMC A;  2LQV A;  2Y74 A;  1E97 A;  2CFK A;  4MEI A;  3X3Y A;  4J9A A;  4X2H A;  2JQ5 A;  3LYG A;  2BMO B;  2GBW B;  2YX9 A;  5LC7 A;  4AKZ A;  4R9L A;  4ORL A;  1Q42 A;  3GAX A;  1NO3 A;  3CNM A;  2HMJ B;  3ER7 A;  3SVA A;  3WA3 A;  1LVN A;  4FCJ A;  1NWW A;  4N6V 0;  1DMM A;  4N6O B;  1IU7 A;  3KN4 A;  5STD A;  1QAK A;  2CH9 A;  2YFI B;  1N9J A;  1OUN A;  2CFL A;  4L7K A;  3HII A;  3CCR 3;  1JKG A;  1RKY A;  1Q86 4;  1G96 A;  2ZL8 A;  3LTD A;  5EQL A;  3V98 A;  2P0X A;  1HU9 A;  4HVN A;  2K0M A;  3RDE A;  3MG2 A;  4FR9 A;  1STF I;  3RGA A;  1IQ8 A;  4N6U A;  5IEO A;  1W2B 2;  2CKF B;  2WO0 A;  1JN5 B;  1RRL A;  3HIG A;  4RBN A;  4H3U A;  1Q81 4;  3CPW 2;  3ALA A;  3BLZ A;  4TX4 A;  1W4N A;  5KP3 A;  3PZW A;  5AIF A;  3AMO B;  4BTY A;  1F8N A;  1T5Y A;  2BO9 B;  1LOX A;  1LNH A;  3KE7 A;  2V1L A;  2BMR B;  4HM2 B;  1IV9 A;  3GZR A;  1K8A 4;  3WOD G;  1IQX A;  2ML5 A;  1YGE A;  2CWV A;  1WTH A;  3FG4 A;  2QA4 3;  3U1W A;  2F98 A;  4LEH A;  3DGM A;  1N8R 4;  3FF2 A;  2W56 A;  1CQS A;  1KSI A;  3SXX A;  1PU4 A;  1MOL A;  1CYU A;  1W2Z A;  1STD A;  3CCL 3;  3L0R A;  1GD4 A;  3VGN A;  2Z76 A;  4HM0 B;  2XSO B;  3NHX A;  1N5P A;  3UL5 A;  4LZI A;  1O7N B;  1DYU A;  1ULI B;  3FCS B;  3MG1 A;  2UX0 A;  1O7G B;  3KFQ C;  1S5A A;  3F14 A;  3FG1 A;  3X40 A;  1AVK A;  2F99 A;  4HM5 B;  2WGO A;  4MJD A;  2KXG A;  2A15 A;  4MMZ B;  4R9K A;  2BT3 A;  3CCM 3;  1OHO A;  1YI2 3;  1QJG A;  3F8H A;  4XB5 A;  2RGQ A;  3FG3 A;  4HM7 B;  1NB5 I;  1WMP A;  2XFS A;  1EQK A;  1A90 A;  3ECF A;  3Q2P A;  5FGO A;  3CME 3;  1RJO A;  4EYC A;  2SBL A;  4FMA A;  3FZW A;  2XF3 A;  4GB5 A;  4WWU C;  6STD A;  2LYX A;  1TUH A;  2XRX B;  4L8P A;  4K1U A;  1GY7 A;  1UUV B;  1AVL A;  3PCR A;  4PEJ A;  5KP4 A;  3N54 B;  2CFD A;  3NQY A;  2MF7 A;  3HX8 A;  2E2V A;  3DXO A;  3EBT A;  3FSD A;  4RNY A;  3EN1 B;  3CD6 3;  2BMQ B;  3KZT A;  3G8Z A;  1D6Z A;  3K0Z A;  1OF5 A;  2M7O A;  1ROV A;  5BVB A;  3EN8 A;  2RSX A;  4RNZ A;  1OAC A;  3B7C A;  5AEW B;  3LML A;  3OWU A;  3K7C A;  4KFF A;  3SX1 A;  4AKY A;  1JRQ A;  1FGQ A;  2CC3 A;  4CCV A;  1IVU A;  3NV0 A;  1YJ9 3;  3LT8 A;  2STD A;  3EE1 A;  1TU5 A;  2GU3 A;  1YVB I;  3MYT A;  4BTW A;  3X3Z A;  1AV4 A;  4WP5 A;  8CHO A;  5IF6 A;  4HKV B;  1TFO A;  4LSO A;  2YFJ B;  1Q40 A;  3M8C A;  3WDG B;  5EVH A;  5LC6 A;  4WHA A;  5JPP A;  1GY5 A;  1BUQ A;  3CNX A;  1K73 4;  2HMK B;  3N8B A;  1W01 A;  2QIY A;  3PGB A;  4K61 A;  3CCS 3;  3NM2 A;  3KKG A;  4OVM A;  3S28 A;  3G0K A;  4HM4 B;  2F86 B;  3IJE B;  4STD A;  1EG9 B;  2JDI H;  2XH9 A;  3JUO A;  5AEU B;  1ROA A;  1Z1S A;  3BB9 A;  3BNC A;  2I9W A;  4R4K A;  1VQ8 3;  2CFG A;  3FF0 A;  2WGQ A;  3Q90 A;  3D3L A;  3G16 A;  1EKM A;  4EV5 A;  3DUK A;  3BND A;  2C11 A;  1RN7 A;  3VF1 A;  4HM3 B;  3WOF B;  2BHM A;  4JF8 A;  2GXF A;  1FGR A;  1M9G A;  3OV4 A;  3SLU A;  3G71 3;  1ASK A;  1K28 A;  1QMA A;  2GEX A;  3OWS A;  3TDG A;  4WYK A;  2R4I A;  3PS8 A;  2P38 A;  4ZM8 A;  1TP6 A;  2IUK A;  4HZ9 B;  1WMO A;  4NRE A;  1U8C B;  4HYZ A;  4JRF A;  1W5Z A;  2C10 A;  3K5T A;  3GRD A;  4G1M B;  2MC8 A;  2B1X B;  3LTA A;  3I56 3;  1W7C A;  5BXQ A;  4N3V A;  2W04 A;  1A2K A;  1JB5 A;  2W9Q A;  1NB3 I;  2CWU A;  5TGN A;  3EB8 A;  1E3V A;  3E99 A;  5IER A;  1DMQ A;  1SQW A;  1QAL A;  3NM7 A;  5EEO A;  2PZV A;  3CU3 A;  3FGY A;  1ULJ B;  3MSO A;  1OH0 A;  3JUN A;  3K9M C;  5FW5 A;  3I55 3;  3CCV 3;  4O8S A;  1ZO2 A;  5CK6 A;  3DGL A;  1IDP A;  1JB2 A;  5AIH A;  3CCE 3;  1Q7Y 4;  2CFW A;  4XDV A;  1SII A;  3BNB A;  2OTJ 3;  5AYR B;  3F8X A;  1GS3 A;  2D42 A;  4N6L A;  1KQS 2;  1TFK A;  4FMD A;  5D83 A;  5KP1 A;  1QVG 2;  4EXR A;  2CK3 H;  1SPU A;  3UB1 A;  1FGT A;  7STD A;  5AII A;  1UUW B;  1W6Y A;  3NX0 A;  4NHF A;  3CCU 3;  3MKI A;  4LGQ A;  4U13 A;  2E2T A;  4N6N B;  2IMJ A;  1W00 A;  3IPT A;  1OGZ A;  2FGT A;  2O9U X;  3FLJ A;  3UJM A;  3UNL A;  2OTL 3;  2GU1 A;  1VQ7 3;  2L4V A;  1W6C A;  4XBT A;  3SED A;  1D6U A;  1O7W B;  2RFR A;  3JUQ A;  1O7P B;  3EX9 A;  2ML6 A;  3NBR A;  1CYV A;  1JKG B;  1GYB A;  3G4S 3;  1VQ9 3;  1FA3 A;  1MNL A;  2Z6B A;  5IG5 A;  1NU3 A;  3EHC A;  3I0Y A;  1EA2 A;  1VQO 3;  3ROB A;  4WFO A;  2PNC A;  1FGM A;  1N8Q A;  5ELJ A;  1WMN A;  3X3X A;  1N5H A;  2D1W A;  3EBY A;  5CF1 A;  4N6T A;  3WOE B;  2CW9 A;  2CG0 A;  3STD A;  2Z77 A;  2OQE C;  3CCQ 3;  2WOH A;  1YIJ 3;  3DMC A;  2WOF A;  1KC8 4;  1JN5 A;  1SJW A;  4FMB A;  1K41 A;  3LH4 A;  3A76 A;  1WQL B;  2XFT A;  3O8Y A;  4HJL B;  3CC7 3;  3HZP A;  3DM8 A;  3T8N A;  1UI7 A;  3AMO A;  4XM4 A;  3V99 A;  2Z7A A;  3MG3 A;  5JBS A;  3H3H A;  3X42 A;  4O3V A;  5ELU A;  2W56 B;  5IG4 A;  4XBX A;  1JB4 A;  5AI1 A;  2OCT A;  3MPH A;  2INX A;  5CLK A;  3V92 A;  2K54 A;  3FKA A;  4HM1 B;  5AIG A;  1NJI 4;  1IK3 A;  2W03 A;  1YHQ 3;  1KWI A;  4EBG A;  1VQ5 3;  3S5C A;  1PFP A;  4R1K A;  4X2O A;  1N9E A;  3S67 A;  4J8T A;  1S72 3;  3N9H A;  1R4C A;  3S29 A;  2HMN B;  3LTC A;  4IT7 A;  1UI8 A;  3GWR A;  3J7Y d;  3Q1C A;  2GBX B;  3U97 A;  3CC4 3;  3LT9 A;  3F7S A;  1VQN 3;  1E3R A;  4BTX A;  3OW2 2;  2HMO B;  5IEP A;  1U5O A;  4KVH A;  1W6G A;  1GY6 A;  2E2U A;  2XR8 B;  3GZY B;  1FUW A;  2OOV C;  3T8U A;  1QAF A;  2ZDJ A;  5D82 A;  2OQE A;  3PYJ A;  4LMI A;  2P05 A;  1JV2 B;  1FGO A;  2CIU A;  3LZA A;  1M90 4;  1OF5 B;  3H51 A;  1DVC A;  2YFL B;  5DRV A;  2CG1 A;  2FNQ A;  3CMA 3;  2QGU A;  3MHE A;  3IMA B;  3B4P A;  4OK0 A;  5CF2 A;  1V74 A;  4QWT A;  2OWP A;  1IQY A;  2Y73 A;  3JVC A;  4FCZ A;  1LXE A;  3FH1 A;  4KFD A;  4XDW A;  3X41 A;  5IG3 A;  1IVX A;  3DGN A;  3DZL A;  1WNH A;  3OWY A;  1AR0 A;  3PXM A;  3KSP A;  3VSY A;  1IT7 A;  2P0M A;  2W0Q A;  2XSH B;  5I97 A;  1NDO B;  1Y4K A;  3NV0 B;  3PCS A;  1US1 A;  3JUP A;  1W02 A;  2RCD A;  5CXO A;  3EJV A;  1O7H B;  3JUM A;  1YJN 3;  3F7X A;  4XBY A;  2IUJ A;  3RGR A;  1GD3 A;  3NBJ A;  1VQ4 3;  1CEW I;  4K90 B;  4HM6 B;  1SIH A;  3SOA A;  4EC6 A;  1Q40 B;  1Q82 4;  2HML B;  3K63 A;  3EQQ B;  4Q53 A;  1ISK A;  4O2H A;  1KD1 4;  2FXT A;  2QEX 3;  2XGL A;  3KII A;  3NBB A;  1VQP 3;  1VQL 3;  4N6M A;  2XEP A;  1RRH A;  3CPO A;  4FCM A;  1OPY A;  4CDL A;  1J2B A;  2CHC A;  1OCV A;  3T0U A;  1VZZ A;  2HMM B;  4MMY B;  1TIJ A;  3EC9 A;  5JPU A;  4EV2 A;  5A0O B;  3QK9 A;  2KCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...