2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
1KC84 3CMA3 3CCS3 3CME3 3G4S3 3CXC2 2OTL3 1VQ83 1VQK3 3I563 3OW22 1M1K4 1VQ63 1M904 1Q814 1K9M4 1QVG2 1Q864 1YI23 3I553 3CC23 1Q7Y4 3CCE3 1VQM3 1YHQ3 1YJN3 1YJW3 1Q824 1N8R4 1W2B2 3CD63 1K734 1JJ22 3CC43 3CCV3 1S723 1KQS2 2QA43 1VQ93 3CCJ3 1YJ93 3CCL3 1NJI4 1VQL3 1VQ73 1VQP3 3CCU3 1VQ53 3CCQ3 1KD14 3CCM3 1YIT3 1VQ43 1K8A4 3CCR3 2OTJ3 3CPW2 1VQO3 2QEX3 3G6E3 1VQN3 3CC73 3G713 1QVF2 1YIJ3
chains in the Genus database with same CATH superfamily
1YVBI 2WO0A 3NQZA 2XSOB 4GB5A 1BGSA 1WTHA 2XSHB 1B2MA 3F14A 1RGCA 4HM3B 3KZTA 1JZOA 1CEWI 2UGIA 1I3FA 1UDII 3FG3A 4H61A 1I0XA 1SQWA 3G0KA 4N6NB 4O8SA 3RGRA 3X3YA 1PU4A 3CC23 1Q9EA 3Q90A 1FYSA 3IMAB 1BIRA 4IPBA 1A67A 5ELUA 5TGNA 1YJW3 2W03A 4EV2A 4GSPA 1ASKA 1KQS2 3V98A 3EC9A 5I97A 1BOXA 1RGGA 2H0GA 5A0OB 3T0UA 1OHSA 1SPUA 1UCLA 3DH2A 2KCDA 3EE1A 4HM1B 9RNTA 5M18A 2K54A 3G6E3 1IVXA 5KP4A 3KSED 4BTXA 5D82A 3DUKA 1UI7A 2Q07A 3PXMA 2Z7AA 1B21A 3HI7A 3WHOA 1D6YA 1IU7A 2CK3H 1BSAA 2K0MA 2ZDJA 1GSPA 1UCKA 2CFDA 1MWRA 3NV0A 3PCSA 1JKGA 2SARA 1ZGXA 1WQLB 4N6UA 4OVMA 3VGNA 1R4CA 2W2CA 2YFIB 2QIYA 2F56A 4LMIA 3CD63 1NDOB 1TJDA 1BRIA 3CCV3 1HU9A 1GY7A 3JUMA 3V99A 2GEXA 3CNMA 4XDVA 1BRJA 3HZPA 2W6JH 3E99A 3CCL3 3EN1B 2CWUA 2O9UX 4R9KA 1YIT3 1STDA 4GHOA 2W04A 1OCVA 1RN7A 1I0VA 3G713 3CCS3 5KP3A 3H51A 4HZBB 5IEPA 1IVVA 2GBWB 1LOVA 4AEQA 2GEYA 3STDA 1JN5B 1M1K4 3HX8A 1IV7A 1BNRA 1OPYA 2RGQA 4IT7A 4RNZA 1YI23 6GSPA 1Q864 1GOVA 3F40A 1EG9B 2M7OA 1W00A 3DY5A 1GOUA 1RRHA 1X1UA 3CNXA 5LC7A 1UCJA 1BVIA 3EJVA 3FKAA 1N8R4 1RN4A 2GXFA 3N54B 4X2OA 3LZAA 2A15A 1JB4A 3MKIA 3DGNA 2C11A 3AMOB 3K0ZA 3RGAA 1FW7A 1YJ93 1X1YA 4ILFA 1BSEA 2E2UA 1FGTA 3BB9A 3NM7A 1VQL3 4H3UA 3WMDA 1TIJA 2XFTA 4L8OA 1L5GB 4K61A 2LYXA 3UB1A 3BNEA 1B2SA 1NO3A 1BNSA 5IG0A 1EUIC 2HMJB 1B27A 2CFWA 4HZ9B 1E3VA 2W9PA 1MWUA 3EBTA 1W7CA 3L0RA 4I5QA 1RGLA 1TUHA 4DKIA 1VQ83 4XDWA 3PYJA 1A2PA 2W9QA 4HM6B 1SIIA 1CYVA 5STDA 1ISKA 1LVNA 2P05A 1MWTA 1UI8A 2Y73A 2KAAA 4BTYA 1Q42A 3Q3FA 3ZFZA 3LTDA 3WDGB 3S29A 4K1VA 1QJGA 1YVSA 4XBTA 3GSPA 3B4OA 3A76A 1JBSA 4FCZA 4MMXB 3X40A 4EC6A 1BRKA 1FZUA 1BSBA 2JQ5A 1LOWA 1DMMA 4LSOA 3EX9A 3KN4A 3GRDA 1PFPA 3NHXA 4N6MA 3AGNA 3LXUX 3SX1A 3ZG0A 1RSNA 4BU4A 1KC84 1OGXA 2XR8B 3EF8A 2CG1A 4FMAA 4XM4A 1ROAA 2F98A 4N6OB 1VQK3 3IPTA 1NU3A 2XEPA 4Q53A 5HOHA 1N8QA 3FLJA 3BIRA 4WWUC 1X1XA 1RRLA 1M9GA 3X41A 1PYLA 1RMSA 3DM8A 3MWZA 1YGEA 1VQ93 3OWYA 2BMRB 2IYJA 4LEHA 3NUVA 3KCHA 1W01A 3BNBA 5IENA 3UL6A 3J7Yd 1K8A4 4GL6A 1ROVA 1Q40B 2HMKB 1A2VA 3EN8A 4FMBA 1T2IA 3O8YA 2K3DA 4HM2B 5EEOA 4CCVA 1E97A 3CME3 2F5WA 2RFRA 1RKYA 4CJNA 2RNTA 4OUQA 4R80A 1B3SA 2BMOB 3D4AA 2B24B 4XB5A 4KT3B 3KFQC 1IV9A 1K41A 4O2HA 5EVHA 1BRGA 2QGUA 1RTUA 4CDLA 1Y4KA 2IMJA 1J2BA 5CXOA 1DVCA 2XF3A 2CH9A 1NJI4 4G1MB 3T8NA 3VF1A 1BU4A 1G02A 3UL5A 5BIRA 1FGOA 1K28A 1OHOA 5BU4A 5DREA 1MGWA 1OF5B 6RNTA 1FUTA 4HJLB 3CMA3 5LC6A 1CH0A 2IUJA 2HMLB 3G4S3 4RBNA 1N5HA 3GZXB 2XRXB 2HMNB 3JUPA 2CWTA 1C54A 1W4NA 1FUSA 1SJWA 4AKZA 1GMQA 1IT8A 2IY2A 5BVBA 1GY6A 4MEIA 5D83A 1RJOA 1RNTA 4BIRA 1YJN3 1FUWA 1FGQA 3JUQA 1HZ1A 3NQYA 2P0MA 1JRQA 1GYBA 2L1SA 3FCSB 2IUKA 2CFGA 3KKGA 2OTJ3 4HAAA 4HM0B 2OOVA 4FCMA 1GOYA 4WYKB 1MOLA 2ML6A 1Q7HA 5FW5A 2OWPA 1TRQA 2KF5A 3NBRA 2J8XB 4HKVB 5AIIA 1US1A 2XGLA 3SVAA 3FF2A 1QALA 1MGRA 1RCLA 1LOXA 1O7PB 3MG2A 4LGQA 4U13A 5JBSA 2BIRA 1BRSA 2XGNA 3EHCA 1B20A 1QVG2 2GBXB 1LQMB 3IJEB 2Z77A 2W56B 4N6V0 3BNDA 3FZWA 1I2GA 3LYGA 2UX0A 1D6UA 4JRFA 3ECFA 1AVKA 1R4YA 4ORLA 3SXXA 1JB5A 1W2B2 1K734 1RGEA 2IA7A 1I3IA 3D5GA 4KZ1A 2BU4A 1TRPA 1BNGA 3F8XA 1GMRA 3GAXA 3I0YA 4WHAA 1BRNL 1DVDA 1S5AA 1RLSA 2C4BA 4QWTA 2CIUA 5EQLA 1BANA 3KIIA 4HM8B 1BUJA 3DGOA 5GSPA 1W6CA 1I2FA 1SARA 4EW5A 1VZZA 3CC73 1RDSA 2KF3A 3FSDA 1UGHI 1D6ZA 1SIHA 4WFOA 1UW1A 3WOFB 1VQQA 5CF1A 2YFLB 1JN5A 3EBYA 3JUOA 5AIFA 4RNYA 1BRHA 4R9LA 3X42A 1YHQ3 3OWSA 2F86B 2WGQA 3F7SA 3GZYB 3CC43 1N9JA 5G2GA 1DETA 2ZA4A 3F8HA 7GSPA 1MWSA 3JUNA 2RSXA 1TP6A 3VSYA 2WGOA 1T3BA 1F8NA 1PY3A 1AQZA 2KF6A 4EXRA 1VQ43 1VQO3 3K9MC 3AMOA 3Q1CA 3K5TA 1I2EA 1JBRA 2RCDA 1AVLA 3NXJA 5AIGA 1JBTA 4J5GA 1AV4A 1OHPA 2AAEA 3F7XA 3CXC2 2Z76A 1C7HA 1ZS7A 1W6GA 3SOAA 1W2ZA 1STFI 1WMPA 1HKXA 2I9WA 1DE3A 1G0TA 3UJMA 3PZWA 1RNBA 2CG0A 4J5KA 1JNQA 3D3LA 3B4PA 2OOVC 3MSOA 3NM2A 4LYLB 5G1KA 3LMLA 4JF8A 3RDEA 1IVUA 4MJDA 1V74A 1S723 1I70A 3K63A 4TX4A 3KE7A 1A2KA 2BT3A 5IERA 3CU3A 1B2ZA 7RNTA 3LH4A 1TTOA 1KD14 4J9AA 3QK9A 2P09A 3T8UA 5AEWB 3OX9A 3OXAA 2INXA 4BL2A 4XBXA 3DXOA 2WOFA 3FG1A 4KFDA 1BNIA 2CWVA 3CPOA 1B2UA 4BTWA 1UCIA 2Z6BA 3OV4A 1UGIA 3S27A 1JB2A 1VQ63 1GD4A 1GY5A 1M904 1K9M4 2BNGA 4R1KA 1KSIA 4HYZA 4KFEA 2GSPA 2FNQA 3N8BA 1QAFA 2F5MA 2H0IA 5D81A 1IVWA 1LRAA 3M8CA 4I4KA 3SYUA 1RGFA 5M19A 2CX1A 1U8CB 2W0QA 3GZBA 2WOHA 3WODG 5IW9A 4FR9A 3DZLA 2B1XB 1CYUA 1O7MB 2P0XA 1EKMA 2CKFB 5AYSC 2L4VA 3D5IA 3GZRA 4BL3A 2RBIA 4KFFA 3G16A 5BXQA 3DGYA 1BNFA 1QAKA 1BNJA 2OCTA 3D79A 1EEJA 1BSCA 3LTBA 3NV0B 4NREA 1JKGB 3LT8A 8RNTA 1Q40A 2HMMB 2HMOB 3S5CA 1MNLA 3PS8A 4K90B 6STDA 2Y74A 3SOYA 5M1AA 2CFKA 1IQ8A 1IDPA 1ULIB 1YGWA 3WA3A 3I553 1B2XA 1Q824 3AHSA 1FA3A 1WMNA 2XFSA 1LNHA 1TFKA 1LQGC 1ZO2A 3EB8A 3NX0A 3PCRA 5IG5A 2FGTA 5AYRB 1X1WA 2E2VA 1QMAA 3CCU3 1VQ53 1KWIA 5CK6A 1OGZA 4NPBA 1W6YA 1JV2B 4EBGA 5DRVA 1FGRA 2GU1A 3HOHA 3AGOA 8CHOA 1QVF2 1RGAA 1W5ZA 3HIGA 1FGMA 2C10A 2PNCA 2OTL3 1UUWB 1RGHA 5HGRA 3GWRA 3BLZA 1OF5A 2D1WA 2CFLA 4PEJA 3LOYA 1O7HB 3F9SA 3HK4A 3SEDA 2UUGC 1IQYA 2BHMA 2BMQB 2MF7A 5AIHA 1JZDA 2GU3A 3URPA 1Q7Y4 5JPPA 3Q2PA 2R4IA 3HIIA 1T2HA 1EA2A 2OQEC 4EV5A 2ZHXB 1UUGB 2P38A 2AADA 4HM4B 3CCJ3 1RGKA 2V1LA 1DYUA 3JVCA 4L8PA 5CLKA 3U1WA 1V58A 1A90A 3AHWA 3N9HA 1GMPA 2CW9A 1N9EA 1RN1A 4O3VA 1ULJB 1YIJ3 2F99A 3TDGA 2KRTA 4HM7B 4HBRA 4WYKA 1LNIA 2D42A 2FXTA 3EQQB 2ML5A 1N5PA 1V57A 3G8ZA 4HVNA 3ALAA 3BU4A 3KSPA 3LTCA 4FMCA 1RCKA 5RNTA 5IEOA 2YX9A 3FF0A 4MMYB 4WP5A 4O02B 2XH9A 1E3RA 4K1UA 2ZL8A 3DGLA 2W56A 1GS3A 1YNVX 4XBYA 1LOYA 2BO9B 4N6LA 1DMQA 3CCQ3 4STDA 1O7NB 3CCR3 3K7CA 1O7WB 1TU5A 2QEX3 4KVHA 3U97A 3DMCA 1NWWA 2STDA 4LZIA 1O7GB 2H0HA 3MG1A 3D9RA 1IQXA 1WNHA 4N3VA 4CPKA 1NB5I 3ROBA 4MMZB 1OUNA 1BSDA 3FH1A 3H3HA 3WA2X 3QRDA 4RZMA 4HM5B 1DMNA 2SBLA 5AEUB 5IG4A 4R4KA 2MC8A 2F4YA 3DGMA 3MHEA 4RNTA 3S67A 3S28A 2CHCA 1LXEA 7STDA 3MPHA 2HOHA 1UUVB 2PZVA 3V92A 5KP1A 3A5EA 4AKYA 3ER7A 1JJ22 5G1LA 1OACA 4HOHA 1VQ73 2KF4A 1Z1SA 4FMDA 3MG3A 1BUQA 5AI1A 3CCM3 1W02A 1T5YA 3BNCA 3RNTA 1HYFA 1TFOA 3FG4A 4OK0A 1RHLA 5IG3A 1IYYA 3UNLA 2OQEA 1U5OA 1ZX2A 5ELJA 3WR2A 1AR0A 2E2TA 2CX0A 3I563 3SLUA 4X2HA 3OW22 4L7KA 3FGYA 4NHFA 5IF6A 1Q814 2KXGA 3X3XA 2CC3A 3LTAA 4ZM8A 3NBBA 3CCE3 1VQM3 3B8LA 3PGBA 4IIAA 1IK3A 1BNEA 1GD3A 5FGOA 1EQKA 1I8VA 2QA43 1G96A 1IT7A 5JPUA 2YFJB 1NNVA 1AY7A 2O3OA 3MYTA 5CF2A 3X3ZA 4EYCA 3NBJA 1NB3I 1VQP3 1OH0A 2JDIH 3LT9A 3OWUA 4FCJA 4J8TA 4N6TA 3CPW2 1WMOA 3WOEB 2R41A 2LQVA 1M1XB 3B7CA 3ZG5A 1BAOA 1VQN3 1CQSA
chains in the Genus database with same CATH topology
1YVBI 2WO0A 3NQZA 2XSOB 4GB5A 1WTHA 2XSHB 3F14A 4HM3B 3KZTA 1CEWI 3FG3A 4N6NB 4H61A 4O8SA 3RGRA 1SQWA 3X3YA 3G0KA 5CF1A 1PU4A 3CC23 3Q90A 3IMAB 4IPBA 1A67A 5ELUA 5TGNA 1YJW3 2W03A 4EV2A 1ASKA 1KQS2 3V98A 3EC9A 5I97A 5A0OB 3T0UA 1OHSA 1SPUA 4HM1B 2KCDA 3EE1A 2K54A 3G6E3 1IVXA 5KP4A 3KSED 4BTXA 5D82A 3DUKA 1UI7A 2Q07A 3PXMA 2Z7AA 3HI7A 1D6YA 1IU7A 2CK3H 2ZDJA 3PCSA 2CFDA 3NV0A 4N6UA 1JKGA 1WQLB 4OVMA 3VGNA 1R4CA 2W2CA 2YFIB 2QIYA 4LMIA 3CD63 1NDOB 3CCV3 1HU9A 1GY7A 3JUMA 3V99A 2GEXA 3CNMA 4XDVA 3CCL3 3HZPA 2W6JH 3E99A 3EN1B 2CWUA 2O9UX 4R9KA 1YIT3 1STDA 2W04A 1OCVA 1RN7A 3G713 3CCS3 5KP3A 3H51A 4HZBB 5IEPA 1IVVA 2GBWB 4AEQA 2GEYA 3STDA 1JN5B 1M1K4 3HX8A 1IV7A 1OPYA 2RGQA 4IT7A 4RNZA 1YI23 1Q864 3F40A 1EG9B 2M7OA 1W00A 3DY5A 3CNXA 1RRHA 5LC7A 1N8R4 3EJVA 3FKAA 2GXFA 3N54B 4X2OA 3LZAA 2A15A 1JB4A 3MKIA 3DGNA 2C11A 3AMOB 3K0ZA 3RGAA 1YJ93 2E2UA 1FGTA 3BB9A 3NM7A 1VQL3 4H3UA 3WMDA 1TIJA 2XFTA 4L8OA 1L5GB 4K61A 2LYXA 3UB1A 3BNEA 1NO3A 5IG0A 2HMJB 2CFWA 4HZ9B 1E3VA 2W9PA 3EBTA 3L0RA 1W7CA 1TUHA 1VQ83 4XDWA 3PYJA 2W9QA 4HM6B 1SIIA 1CYVA 5STDA 1ISKA 1LVNA 2P05A 1UI8A 2Y73A 4BTYA 1Q42A 3LTDA 3WDGB 3S29A 4K1VA 1QJGA 4XBTA 3B4OA 3A76A 4FCZA 4MMXB 3X40A 4EC6A 2JQ5A 1DMMA 4LSOA 3EX9A 3KN4A 3GRDA 1PFPA 3NHXA 4N6MA 3LXUX 3SX1A 1KC84 1OGXA 2XR8B 3EF8A 2CG1A 4FMAA 4XM4A 1ROAA 2F98A 4N6OB 1VQK3 3IPTA 1NU3A 2XEPA 4Q53A 1N8QA 3FLJA 4WWUC 1RRLA 1M9GA 3X41A 3MWZA 3DM8A 1YGEA 1VQ93 3OWYA 2BMRB 4LEHA 3NUVA 1W01A 3BNBA 5IENA 3UL6A 3J7Yd 1K8A4 4GL6A 1ROVA 1Q40B 2HMKB 1A2VA 3EN8A 4FMBA 4HM2B 3O8YA 5EEOA 4CCVA 1E97A 3CME3 2RFRA 1RKYA 4R80A 4OUQA 2BMOB 2B24B 4XB5A 3KFQC 1IV9A 1K41A 4O2HA 5EVHA 2QGUA 4CDLA 1Y4KA 2IMJA 1J2BA 5CXOA 1DVCA 2XF3A 2CH9A 1NJI4 4G1MB 3T8NA 3VF1A 3UL5A 1FGOA 1K28A 1OHOA 5DREA 1OF5B 4HJLB 3CMA3 5LC6A 2IUJA 2HMLB 3G4S3 4RBNA 1N5HA 3GZXB 2XRXB 2HMNB 3JUPA 2CWTA 1W4NA 1SJWA 4AKZA 1IT8A 5BVBA 1GY6A 4MEIA 5D83A 1RJOA 1YJN3 1FUWA 1FGQA 3JUQA 3NQYA 2P0MA 1JRQA 1GYBA 3FCSB 2IUKA 2CFGA 3KKGA 2OTJ3 4HM0B 2OOVA 4FCMA 4WYKB 1MOLA 2ML6A 5FW5A 2OWPA 3NBRA 4HKVB 5AIIA 3SVAA 1US1A 2XGLA 3FF2A 1QALA 1LOXA 1O7PB 3MG2A 4LGQA 4U13A 5JBSA 2XGNA 3EHCA 1QVG2 2GBXB 3IJEB 2Z77A 2W56B 4N6V0 3BNDA 3FZWA 3LYGA 2UX0A 1D6UA 4JRFA 3ECFA 1AVKA 4ORLA 3SXXA 1JB5A 1W2B2 1K734 2IA7A 4KZ1A 3F8XA 3GAXA 3I0YA 1DVDA 4WHAA 1S5AA 4QWTA 2CIUA 5EQLA 3KIIA 4HM8B 3DGOA 1W6CA 3CC73 1VZZA 3FSDA 1D6ZA 1SIHA 4WFOA 1UW1A 3WOFB 2YFLB 1JN5A 3EBYA 3JUOA 5AIFA 4RNYA 4R9LA 3X42A 1YHQ3 3OWSA 2F86B 2WGQA 3F7SA 3GZYB 3CC43 1N9JA 5G2GA 3F8HA 3JUNA 2RSXA 1TP6A 3VSYA 2WGOA 1F8NA 4EXRA 1VQ43 1VQO3 3K9MC 3AMOA 3Q1CA 3K5TA 2RCDA 1AVLA 3NXJA 5AIGA 1AV4A 1OHPA 3F7XA 3CXC2 2Z76A 1C7HA 3SOAA 1W6GA 1W2ZA 1STFI 1WMPA 1HKXA 2I9WA 3UJMA 3PZWA 2CG0A 1JNQA 3D3LA 3B4PA 2OOVC 3MSOA 3NM2A 3RDEA 3LMLA 4JF8A 1IVUA 4MJDA 1V74A 1S723 4TX4A 3K63A 3KE7A 1A2KA 2BT3A 5IERA 3CU3A 3LH4A 1KD14 4J9AA 3QK9A 2P09A 3T8UA 5AEWB 3OX9A 3OXAA 2INXA 4XBXA 3DXOA 2WOFA 3FG1A 4KFDA 3CPOA 2CWVA 4BTWA 2Z6BA 3OV4A 3S27A 1JB2A 1VQ63 1GD4A 1GY5A 1M904 1K9M4 2BNGA 4R1KA 1KSIA 4HYZA 4KFEA 2FNQA 3N8BA 1QAFA 5D81A 1IVWA 3M8CA 4I4KA 2W0QA 1U8CB 3GZBA 2WOHA 3WODG 5IW9A 4FR9A 3DZLA 2B1XB 1CYUA 1O7MB 2P0XA 1EKMA 2CKFB 5AYSC 2L4VA 3GZRA 4KFFA 3G16A 5BXQA 1QAKA 2OCTA 3LTBA 3NV0B 4NREA 1JKGB 3LT8A 1Q40A 2HMMB 2HMOB 3S5CA 1MNLA 3PS8A 4K90B 6STDA 2Y74A 3SOYA 2CFKA 1IQ8A 1IDPA 1ULIB 3WA3A 3I553 1Q824 1FA3A 1WMNA 2XFSA 1LNHA 1TFKA 1ZO2A 3EB8A 3NX0A 3PCRA 5IG5A 2FGTA 5AYRB 2E2VA 1QMAA 3CCU3 1VQ53 1KWIA 5CK6A 1OGZA 1W6YA 1JV2B 4EBGA 5DRVA 2GU1A 1FGRA 8CHOA 1QVF2 1W5ZA 3HIGA 1FGMA 2C10A 2PNCA 2OTL3 1UUWB 5HGRA 3GWRA 3BLZA 1OF5A 2D1WA 2CFLA 4PEJA 3LOYA 1O7HB 3F9SA 3HK4A 3SEDA 1IQYA 2BHMA 2BMQB 2MF7A 5AIHA 2GU3A 1Q7Y4 5JPPA 3Q2PA 2R4IA 3HIIA 1EA2A 2OQEC 4EV5A 2P38A 4HM4B 3CCJ3 2V1LA 3JVCA 1DYUA 4L8PA 5CLKA 3U1WA 1A90A 3N9HA 2CW9A 1N9EA 4O3VA 1ULJB 1YIJ3 2F99A 3TDGA 2KRTA 4HM7B 4HBRA 4WYKA 2D42A 2FXTA 3EQQB 2ML5A 1N5PA 3G8ZA 4HVNA 3ALAA 3KSPA 3LTCA 4FMCA 5IEOA 2YX9A 3FF0A 4MMYB 4WP5A 4O02B 2XH9A 1E3RA 4K1UA 2ZL8A 3DGLA 2W56A 1GS3A 4XBYA 2BO9B 4N6LA 1DMQA 3CCQ3 4STDA 1O7NB 3CCR3 3K7CA 1O7WB 1TU5A 2QEX3 4KVHA 3U97A 3DMCA 1NWWA 2STDA 4LZIA 1O7GB 3MG1A 3D9RA 1IQXA 1WNHA 4N3VA 1NB5I 3ROBA 4MMZB 1OUNA 3H3HA 3FH1A 3WA2X 3QRDA 4RZMA 4HM5B 1DMNA 2SBLA 5AEUB 5IG4A 4R4KA 2MC8A 3DGMA 3MHEA 3S67A 3S28A 2CHCA 1LXEA 7STDA 3MPHA 3V92A 1UUVB 2PZVA 5KP1A 1JJ22 4AKYA 3ER7A 1OACA 1VQ73 1Z1SA 4FMDA 3MG3A 1BUQA 5AI1A 3CCM3 1W02A 1T5YA 3BNCA 1TFOA 3FG4A 4OK0A 5IG3A 3UNLA 2OQEA 1U5OA 1ZX2A 5ELJA 1AR0A 2E2TA 3I563 3SLUA 4X2HA 3OW22 4L7KA 3FGYA 4NHFA 5IF6A 1Q814 2KXGA 3X3XA 2CC3A 3LTAA 4ZM8A 3NBBA 3CCE3 1VQM3 3B8LA 3PGBA 4IIAA 1IK3A 1GD3A 5FGOA 1EQKA 2QA43 1G96A 1IT7A 5JPUA 2YFJB 3MYTA 2O3OA 5CF2A 3X3ZA 4EYCA 3NBJA 1NB3I 1VQP3 1OH0A 2JDIH 3LT9A 3OWUA 4FCJA 4J8TA 4N6TA 3CPW2 1WMOA 3WOEB 3B7CA 2LQVA 1M1XB 1VQN3 2K0MA 1CQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 4;  3CMA 3;  3CCS 3;  3CME 3;  3G4S 3;  3CXC 2;  2OTL 3;  1VQ8 3;  1VQK 3;  3I56 3;  3OW2 2;  1M1K 4;  1VQ6 3;  1M90 4;  1Q81 4;  1K9M 4;  1QVG 2;  1Q86 4;  1YI2 3;  3I55 3;  3CC2 3;  1Q7Y 4;  3CCE 3;  1VQM 3;  1YHQ 3;  1YJN 3;  1YJW 3;  1Q82 4;  1N8R 4;  1W2B 2;  3CD6 3;  1K73 4;  1JJ2 2;  3CC4 3;  3CCV 3;  1S72 3;  1KQS 2;  2QA4 3;  1VQ9 3;  3CCJ 3;  1YJ9 3;  3CCL 3;  1NJI 4;  1VQL 3;  1VQ7 3;  1VQP 3;  3CCU 3;  1VQ5 3;  3CCQ 3;  1KD1 4;  3CCM 3;  1YIT 3;  1VQ4 3;  1K8A 4;  3CCR 3;  2OTJ 3;  3CPW 2;  1VQO 3;  2QEX 3;  3G6E 3;  1VQN 3;  3CC7 3;  3G71 3;  1QVF 2;  1YIJ 3; 
#chains in the Genus database with same CATH topology
 1YVB I;  2WO0 A;  3NQZ A;  2XSO B;  4GB5 A;  1BGS A;  1WTH A;  2XSH B;  1B2M A;  3F14 A;  1RGC A;  4HM3 B;  3KZT A;  1JZO A;  1CEW I;  2UGI A;  1I3F A;  1UDI I;  3FG3 A;  4H61 A;  1I0X A;  1SQW A;  3G0K A;  4N6N B;  4O8S A;  3RGR A;  3X3Y A;  1PU4 A;  3CC2 3;  1Q9E A;  3Q90 A;  1FYS A;  3IMA B;  1BIR A;  4IPB A;  1A67 A;  5ELU A;  5TGN A;  1YJW 3;  2W03 A;  4EV2 A;  4GSP A;  1ASK A;  1KQS 2;  3V98 A;  3EC9 A;  5I97 A;  1BOX A;  1RGG A;  2H0G A;  5A0O B;  3T0U A;  1OHS A;  1SPU A;  1UCL A;  3DH2 A;  2KCD A;  3EE1 A;  4HM1 B;  9RNT A;  5M18 A;  2K54 A;  3G6E 3;  1IVX A;  5KP4 A;  3KSE D;  4BTX A;  5D82 A;  3DUK A;  1UI7 A;  2Q07 A;  3PXM A;  2Z7A A;  1B21 A;  3HI7 A;  3WHO A;  1D6Y A;  1IU7 A;  2CK3 H;  1BSA A;  2K0M A;  2ZDJ A;  1GSP A;  1UCK A;  2CFD A;  1MWR A;  3NV0 A;  3PCS A;  1JKG A;  2SAR A;  1ZGX A;  1WQL B;  4N6U A;  4OVM A;  3VGN A;  1R4C A;  2W2C A;  2YFI B;  2QIY A;  2F56 A;  4LMI A;  3CD6 3;  1NDO B;  1TJD A;  1BRI A;  3CCV 3;  1HU9 A;  1GY7 A;  3JUM A;  3V99 A;  2GEX A;  3CNM A;  4XDV A;  1BRJ A;  3HZP A;  2W6J H;  3E99 A;  3CCL 3;  3EN1 B;  2CWU A;  2O9U X;  4R9K A;  1YIT 3;  1STD A;  4GHO A;  2W04 A;  1OCV A;  1RN7 A;  1I0V A;  3G71 3;  3CCS 3;  5KP3 A;  3H51 A;  4HZB B;  5IEP A;  1IVV A;  2GBW B;  1LOV A;  4AEQ A;  2GEY A;  3STD A;  1JN5 B;  1M1K 4;  3HX8 A;  1IV7 A;  1BNR A;  1OPY A;  2RGQ A;  4IT7 A;  4RNZ A;  1YI2 3;  6GSP A;  1Q86 4;  1GOV A;  3F40 A;  1EG9 B;  2M7O A;  1W00 A;  3DY5 A;  1GOU A;  1RRH A;  1X1U A;  3CNX A;  5LC7 A;  1UCJ A;  1BVI A;  3EJV A;  3FKA A;  1N8R 4;  1RN4 A;  2GXF A;  3N54 B;  4X2O A;  3LZA A;  2A15 A;  1JB4 A;  3MKI A;  3DGN A;  2C11 A;  3AMO B;  3K0Z A;  3RGA A;  1FW7 A;  1YJ9 3;  1X1Y A;  4ILF A;  1BSE A;  2E2U A;  1FGT A;  3BB9 A;  3NM7 A;  1VQL 3;  4H3U A;  3WMD A;  1TIJ A;  2XFT A;  4L8O A;  1L5G B;  4K61 A;  2LYX A;  3UB1 A;  3BNE A;  1B2S A;  1NO3 A;  1BNS A;  5IG0 A;  1EUI C;  2HMJ B;  1B27 A;  2CFW A;  4HZ9 B;  1E3V A;  2W9P A;  1MWU A;  3EBT A;  1W7C A;  3L0R A;  4I5Q A;  1RGL A;  1TUH A;  4DKI A;  1VQ8 3;  4XDW A;  3PYJ A;  1A2P A;  2W9Q A;  4HM6 B;  1SII A;  1CYV A;  5STD A;  1ISK A;  1LVN A;  2P05 A;  1MWT A;  1UI8 A;  2Y73 A;  2KAA A;  4BTY A;  1Q42 A;  3Q3F A;  3ZFZ A;  3LTD A;  3WDG B;  3S29 A;  4K1V A;  1QJG A;  1YVS A;  4XBT A;  3GSP A;  3B4O A;  3A76 A;  1JBS A;  4FCZ A;  4MMX B;  3X40 A;  4EC6 A;  1BRK A;  1FZU A;  1BSB A;  2JQ5 A;  1LOW A;  1DMM A;  4LSO A;  3EX9 A;  3KN4 A;  3GRD A;  1PFP A;  3NHX A;  4N6M A;  3AGN A;  3LXU X;  3SX1 A;  3ZG0 A;  1RSN A;  4BU4 A;  1KC8 4;  1OGX A;  2XR8 B;  3EF8 A;  2CG1 A;  4FMA A;  4XM4 A;  1ROA A;  2F98 A;  4N6O B;  1VQK 3;  3IPT A;  1NU3 A;  2XEP A;  4Q53 A;  5HOH A;  1N8Q A;  3FLJ A;  3BIR A;  4WWU C;  1X1X A;  1RRL A;  1M9G A;  3X41 A;  1PYL A;  1RMS A;  3DM8 A;  3MWZ A;  1YGE A;  1VQ9 3;  3OWY A;  2BMR B;  2IYJ A;  4LEH A;  3NUV A;  3KCH A;  1W01 A;  3BNB A;  5IEN A;  3UL6 A;  3J7Y d;  1K8A 4;  4GL6 A;  1ROV A;  1Q40 B;  2HMK B;  1A2V A;  3EN8 A;  4FMB A;  1T2I A;  3O8Y A;  2K3D A;  4HM2 B;  5EEO A;  4CCV A;  1E97 A;  3CME 3;  2F5W A;  2RFR A;  1RKY A;  4CJN A;  2RNT A;  4OUQ A;  4R80 A;  1B3S A;  2BMO B;  3D4A A;  2B24 B;  4XB5 A;  4KT3 B;  3KFQ C;  1IV9 A;  1K41 A;  4O2H A;  5EVH A;  1BRG A;  2QGU A;  1RTU A;  4CDL A;  1Y4K A;  2IMJ A;  1J2B A;  5CXO A;  1DVC A;  2XF3 A;  2CH9 A;  1NJI 4;  4G1M B;  3T8N A;  3VF1 A;  1BU4 A;  1G02 A;  3UL5 A;  5BIR A;  1FGO A;  1K28 A;  1OHO A;  5BU4 A;  5DRE A;  1MGW A;  1OF5 B;  6RNT A;  1FUT A;  4HJL B;  3CMA 3;  5LC6 A;  1CH0 A;  2IUJ A;  2HML B;  3G4S 3;  4RBN A;  1N5H A;  3GZX B;  2XRX B;  2HMN B;  3JUP A;  2CWT A;  1C54 A;  1W4N A;  1FUS A;  1SJW A;  4AKZ A;  1GMQ A;  1IT8 A;  2IY2 A;  5BVB A;  1GY6 A;  4MEI A;  5D83 A;  1RJO A;  1RNT A;  4BIR A;  1YJN 3;  1FUW A;  1FGQ A;  3JUQ A;  1HZ1 A;  3NQY A;  2P0M A;  1JRQ A;  1GYB A;  2L1S A;  3FCS B;  2IUK A;  2CFG A;  3KKG A;  2OTJ 3;  4HAA A;  4HM0 B;  2OOV A;  4FCM A;  1GOY A;  4WYK B;  1MOL A;  2ML6 A;  1Q7H A;  5FW5 A;  2OWP A;  1TRQ A;  2KF5 A;  3NBR A;  2J8X B;  4HKV B;  5AII A;  1US1 A;  2XGL A;  3SVA A;  3FF2 A;  1QAL A;  1MGR A;  1RCL A;  1LOX A;  1O7P B;  3MG2 A;  4LGQ A;  4U13 A;  5JBS A;  2BIR A;  1BRS A;  2XGN A;  3EHC A;  1B20 A;  1QVG 2;  2GBX B;  1LQM B;  3IJE B;  2Z77 A;  2W56 B;  4N6V 0;  3BND A;  3FZW A;  1I2G A;  3LYG A;  2UX0 A;  1D6U A;  4JRF A;  3ECF A;  1AVK A;  1R4Y A;  4ORL A;  3SXX A;  1JB5 A;  1W2B 2;  1K73 4;  1RGE A;  2IA7 A;  1I3I A;  3D5G A;  4KZ1 A;  2BU4 A;  1TRP A;  1BNG A;  3F8X A;  1GMR A;  3GAX A;  3I0Y A;  4WHA A;  1BRN L;  1DVD A;  1S5A A;  1RLS A;  2C4B A;  4QWT A;  2CIU A;  5EQL A;  1BAN A;  3KII A;  4HM8 B;  1BUJ A;  3DGO A;  5GSP A;  1W6C A;  1I2F A;  1SAR A;  4EW5 A;  1VZZ A;  3CC7 3;  1RDS A;  2KF3 A;  3FSD A;  1UGH I;  1D6Z A;  1SIH A;  4WFO A;  1UW1 A;  3WOF B;  1VQQ A;  5CF1 A;  2YFL B;  1JN5 A;  3EBY A;  3JUO A;  5AIF A;  4RNY A;  1BRH A;  4R9L A;  3X42 A;  1YHQ 3;  3OWS A;  2F86 B;  2WGQ A;  3F7S A;  3GZY B;  3CC4 3;  1N9J A;  5G2G A;  1DET A;  2ZA4 A;  3F8H A;  7GSP A;  1MWS A;  3JUN A;  2RSX A;  1TP6 A;  3VSY A;  2WGO A;  1T3B A;  1F8N A;  1PY3 A;  1AQZ A;  2KF6 A;  4EXR A;  1VQ4 3;  1VQO 3;  3K9M C;  3AMO A;  3Q1C A;  3K5T A;  1I2E A;  1JBR A;  2RCD A;  1AVL A;  3NXJ A;  5AIG A;  1JBT A;  4J5G A;  1AV4 A;  1OHP A;  2AAE A;  3F7X A;  3CXC 2;  2Z76 A;  1C7H A;  1ZS7 A;  1W6G A;  3SOA A;  1W2Z A;  1STF I;  1WMP A;  1HKX A;  2I9W A;  1DE3 A;  1G0T A;  3UJM A;  3PZW A;  1RNB A;  2CG0 A;  4J5K A;  1JNQ A;  3D3L A;  3B4P A;  2OOV C;  3MSO A;  3NM2 A;  4LYL B;  5G1K A;  3LML A;  4JF8 A;  3RDE A;  1IVU A;  4MJD A;  1V74 A;  1S72 3;  1I70 A;  3K63 A;  4TX4 A;  3KE7 A;  1A2K A;  2BT3 A;  5IER A;  3CU3 A;  1B2Z A;  7RNT A;  3LH4 A;  1TTO A;  1KD1 4;  4J9A A;  3QK9 A;  2P09 A;  3T8U A;  5AEW B;  3OX9 A;  3OXA A;  2INX A;  4BL2 A;  4XBX A;  3DXO A;  2WOF A;  3FG1 A;  4KFD A;  1BNI A;  2CWV A;  3CPO A;  1B2U A;  4BTW A;  1UCI A;  2Z6B A;  3OV4 A;  1UGI A;  3S27 A;  1JB2 A;  1VQ6 3;  1GD4 A;  1GY5 A;  1M90 4;  1K9M 4;  2BNG A;  4R1K A;  1KSI A;  4HYZ A;  4KFE A;  2GSP A;  2FNQ A;  3N8B A;  1QAF A;  2F5M A;  2H0I A;  5D81 A;  1IVW A;  1LRA A;  3M8C A;  4I4K A;  3SYU A;  1RGF A;  5M19 A;  2CX1 A;  1U8C B;  2W0Q A;  3GZB A;  2WOH A;  3WOD G;  5IW9 A;  4FR9 A;  3DZL A;  2B1X B;  1CYU A;  1O7M B;  2P0X A;  1EKM A;  2CKF B;  5AYS C;  2L4V A;  3D5I A;  3GZR A;  4BL3 A;  2RBI A;  4KFF A;  3G16 A;  5BXQ A;  3DGY A;  1BNF A;  1QAK A;  1BNJ A;  2OCT A;  3D79 A;  1EEJ A;  1BSC A;  3LTB A;  3NV0 B;  4NRE A;  1JKG B;  3LT8 A;  8RNT A;  1Q40 A;  2HMM B;  2HMO B;  3S5C A;  1MNL A;  3PS8 A;  4K90 B;  6STD A;  2Y74 A;  3SOY A;  5M1A A;  2CFK A;  1IQ8 A;  1IDP A;  1ULI B;  1YGW A;  3WA3 A;  3I55 3;  1B2X A;  1Q82 4;  3AHS A;  1FA3 A;  1WMN A;  2XFS A;  1LNH A;  1TFK A;  1LQG C;  1ZO2 A;  3EB8 A;  3NX0 A;  3PCR A;  5IG5 A;  2FGT A;  5AYR B;  1X1W A;  2E2V A;  1QMA A;  3CCU 3;  1VQ5 3;  1KWI A;  5CK6 A;  1OGZ A;  4NPB A;  1W6Y A;  1JV2 B;  4EBG A;  5DRV A;  1FGR A;  2GU1 A;  3HOH A;  3AGO A;  8CHO A;  1QVF 2;  1RGA A;  1W5Z A;  3HIG A;  1FGM A;  2C10 A;  2PNC A;  2OTL 3;  1UUW B;  1RGH A;  5HGR A;  3GWR A;  3BLZ A;  1OF5 A;  2D1W A;  2CFL A;  4PEJ A;  3LOY A;  1O7H B;  3F9S A;  3HK4 A;  3SED A;  2UUG C;  1IQY A;  2BHM A;  2BMQ B;  2MF7 A;  5AIH A;  1JZD A;  2GU3 A;  3URP A;  1Q7Y 4;  5JPP A;  3Q2P A;  2R4I A;  3HII A;  1T2H A;  1EA2 A;  2OQE C;  4EV5 A;  2ZHX B;  1UUG B;  2P38 A;  2AAD A;  4HM4 B;  3CCJ 3;  1RGK A;  2V1L A;  1DYU A;  3JVC A;  4L8P A;  5CLK A;  3U1W A;  1V58 A;  1A90 A;  3AHW A;  3N9H A;  1GMP A;  2CW9 A;  1N9E A;  1RN1 A;  4O3V A;  1ULJ B;  1YIJ 3;  2F99 A;  3TDG A;  2KRT A;  4HM7 B;  4HBR A;  4WYK A;  1LNI A;  2D42 A;  2FXT A;  3EQQ B;  2ML5 A;  1N5P A;  1V57 A;  3G8Z A;  4HVN A;  3ALA A;  3BU4 A;  3KSP A;  3LTC A;  4FMC A;  1RCK A;  5RNT A;  5IEO A;  2YX9 A;  3FF0 A;  4MMY B;  4WP5 A;  4O02 B;  2XH9 A;  1E3R A;  4K1U A;  2ZL8 A;  3DGL A;  2W56 A;  1GS3 A;  1YNV X;  4XBY A;  1LOY A;  2BO9 B;  4N6L A;  1DMQ A;  3CCQ 3;  4STD A;  1O7N B;  3CCR 3;  3K7C A;  1O7W B;  1TU5 A;  2QEX 3;  4KVH A;  3U97 A;  3DMC A;  1NWW A;  2STD A;  4LZI A;  1O7G B;  2H0H A;  3MG1 A;  3D9R A;  1IQX A;  1WNH A;  4N3V A;  4CPK A;  1NB5 I;  3ROB A;  4MMZ B;  1OUN A;  1BSD A;  3FH1 A;  3H3H A;  3WA2 X;  3QRD A;  4RZM A;  4HM5 B;  1DMN A;  2SBL A;  5AEU B;  5IG4 A;  4R4K A;  2MC8 A;  2F4Y A;  3DGM A;  3MHE A;  4RNT A;  3S67 A;  3S28 A;  2CHC A;  1LXE A;  7STD A;  3MPH A;  2HOH A;  1UUV B;  2PZV A;  3V92 A;  5KP1 A;  3A5E A;  4AKY A;  3ER7 A;  1JJ2 2;  5G1L A;  1OAC A;  4HOH A;  1VQ7 3;  2KF4 A;  1Z1S A;  4FMD A;  3MG3 A;  1BUQ A;  5AI1 A;  3CCM 3;  1W02 A;  1T5Y A;  3BNC A;  3RNT A;  1HYF A;  1TFO A;  3FG4 A;  4OK0 A;  1RHL A;  5IG3 A;  1IYY A;  3UNL A;  2OQE A;  1U5O A;  1ZX2 A;  5ELJ A;  3WR2 A;  1AR0 A;  2E2T A;  2CX0 A;  3I56 3;  3SLU A;  4X2H A;  3OW2 2;  4L7K A;  3FGY A;  4NHF A;  5IF6 A;  1Q81 4;  2KXG A;  3X3X A;  2CC3 A;  3LTA A;  4ZM8 A;  3NBB A;  3CCE 3;  1VQM 3;  3B8L A;  3PGB A;  4IIA A;  1IK3 A;  1BNE A;  1GD3 A;  5FGO A;  1EQK A;  1I8V A;  2QA4 3;  1G96 A;  1IT7 A;  5JPU A;  2YFJ B;  1NNV A;  1AY7 A;  2O3O A;  3MYT A;  5CF2 A;  3X3Z A;  4EYC A;  3NBJ A;  1NB3 I;  1VQP 3;  1OH0 A;  2JDI H;  3LT9 A;  3OWU A;  4FCJ A;  4J8T A;  4N6T A;  3CPW 2;  1WMO A;  3WOE B;  2R41 A;  2LQV A;  1M1X B;  3B7C A;  3ZG5 A;  1BAO A;  1VQN 3;  1CQS A; 
#chains in the Genus database with same CATH homology
 1YVB I;  2WO0 A;  3NQZ A;  2XSO B;  4GB5 A;  1WTH A;  2XSH B;  3F14 A;  4HM3 B;  3KZT A;  1CEW I;  3FG3 A;  4N6N B;  4H61 A;  4O8S A;  3RGR A;  1SQW A;  3X3Y A;  3G0K A;  5CF1 A;  1PU4 A;  3CC2 3;  3Q90 A;  3IMA B;  4IPB A;  1A67 A;  5ELU A;  5TGN A;  1YJW 3;  2W03 A;  4EV2 A;  1ASK A;  1KQS 2;  3V98 A;  3EC9 A;  5I97 A;  5A0O B;  3T0U A;  1OHS A;  1SPU A;  4HM1 B;  2KCD A;  3EE1 A;  2K54 A;  3G6E 3;  1IVX A;  5KP4 A;  3KSE D;  4BTX A;  5D82 A;  3DUK A;  1UI7 A;  2Q07 A;  3PXM A;  2Z7A A;  3HI7 A;  1D6Y A;  1IU7 A;  2CK3 H;  2ZDJ A;  3PCS A;  2CFD A;  3NV0 A;  4N6U A;  1JKG A;  1WQL B;  4OVM A;  3VGN A;  1R4C A;  2W2C A;  2YFI B;  2QIY A;  4LMI A;  3CD6 3;  1NDO B;  3CCV 3;  1HU9 A;  1GY7 A;  3JUM A;  3V99 A;  2GEX A;  3CNM A;  4XDV A;  3CCL 3;  3HZP A;  2W6J H;  3E99 A;  3EN1 B;  2CWU A;  2O9U X;  4R9K A;  1YIT 3;  1STD A;  2W04 A;  1OCV A;  1RN7 A;  3G71 3;  3CCS 3;  5KP3 A;  3H51 A;  4HZB B;  5IEP A;  1IVV A;  2GBW B;  4AEQ A;  2GEY A;  3STD A;  1JN5 B;  1M1K 4;  3HX8 A;  1IV7 A;  1OPY A;  2RGQ A;  4IT7 A;  4RNZ A;  1YI2 3;  1Q86 4;  3F40 A;  1EG9 B;  2M7O A;  1W00 A;  3DY5 A;  3CNX A;  1RRH A;  5LC7 A;  1N8R 4;  3EJV A;  3FKA A;  2GXF A;  3N54 B;  4X2O A;  3LZA A;  2A15 A;  1JB4 A;  3MKI A;  3DGN A;  2C11 A;  3AMO B;  3K0Z A;  3RGA A;  1YJ9 3;  2E2U A;  1FGT A;  3BB9 A;  3NM7 A;  1VQL 3;  4H3U A;  3WMD A;  1TIJ A;  2XFT A;  4L8O A;  1L5G B;  4K61 A;  2LYX A;  3UB1 A;  3BNE A;  1NO3 A;  5IG0 A;  2HMJ B;  2CFW A;  4HZ9 B;  1E3V A;  2W9P A;  3EBT A;  3L0R A;  1W7C A;  1TUH A;  1VQ8 3;  4XDW A;  3PYJ A;  2W9Q A;  4HM6 B;  1SII A;  1CYV A;  5STD A;  1ISK A;  1LVN A;  2P05 A;  1UI8 A;  2Y73 A;  4BTY A;  1Q42 A;  3LTD A;  3WDG B;  3S29 A;  4K1V A;  1QJG A;  4XBT A;  3B4O A;  3A76 A;  4FCZ A;  4MMX B;  3X40 A;  4EC6 A;  2JQ5 A;  1DMM A;  4LSO A;  3EX9 A;  3KN4 A;  3GRD A;  1PFP A;  3NHX A;  4N6M A;  3LXU X;  3SX1 A;  1KC8 4;  1OGX A;  2XR8 B;  3EF8 A;  2CG1 A;  4FMA A;  4XM4 A;  1ROA A;  2F98 A;  4N6O B;  1VQK 3;  3IPT A;  1NU3 A;  2XEP A;  4Q53 A;  1N8Q A;  3FLJ A;  4WWU C;  1RRL A;  1M9G A;  3X41 A;  3MWZ A;  3DM8 A;  1YGE A;  1VQ9 3;  3OWY A;  2BMR B;  4LEH A;  3NUV A;  1W01 A;  3BNB A;  5IEN A;  3UL6 A;  3J7Y d;  1K8A 4;  4GL6 A;  1ROV A;  1Q40 B;  2HMK B;  1A2V A;  3EN8 A;  4FMB A;  4HM2 B;  3O8Y A;  5EEO A;  4CCV A;  1E97 A;  3CME 3;  2RFR A;  1RKY A;  4R80 A;  4OUQ A;  2BMO B;  2B24 B;  4XB5 A;  3KFQ C;  1IV9 A;  1K41 A;  4O2H A;  5EVH A;  2QGU A;  4CDL A;  1Y4K A;  2IMJ A;  1J2B A;  5CXO A;  1DVC A;  2XF3 A;  2CH9 A;  1NJI 4;  4G1M B;  3T8N A;  3VF1 A;  3UL5 A;  1FGO A;  1K28 A;  1OHO A;  5DRE A;  1OF5 B;  4HJL B;  3CMA 3;  5LC6 A;  2IUJ A;  2HML B;  3G4S 3;  4RBN A;  1N5H A;  3GZX B;  2XRX B;  2HMN B;  3JUP A;  2CWT A;  1W4N A;  1SJW A;  4AKZ A;  1IT8 A;  5BVB A;  1GY6 A;  4MEI A;  5D83 A;  1RJO A;  1YJN 3;  1FUW A;  1FGQ A;  3JUQ A;  3NQY A;  2P0M A;  1JRQ A;  1GYB A;  3FCS B;  2IUK A;  2CFG A;  3KKG A;  2OTJ 3;  4HM0 B;  2OOV A;  4FCM A;  4WYK B;  1MOL A;  2ML6 A;  5FW5 A;  2OWP A;  3NBR A;  4HKV B;  5AII A;  3SVA A;  1US1 A;  2XGL A;  3FF2 A;  1QAL A;  1LOX A;  1O7P B;  3MG2 A;  4LGQ A;  4U13 A;  5JBS A;  2XGN A;  3EHC A;  1QVG 2;  2GBX B;  3IJE B;  2Z77 A;  2W56 B;  4N6V 0;  3BND A;  3FZW A;  3LYG A;  2UX0 A;  1D6U A;  4JRF A;  3ECF A;  1AVK A;  4ORL A;  3SXX A;  1JB5 A;  1W2B 2;  1K73 4;  2IA7 A;  4KZ1 A;  3F8X A;  3GAX A;  3I0Y A;  1DVD A;  4WHA A;  1S5A A;  4QWT A;  2CIU A;  5EQL A;  3KII A;  4HM8 B;  3DGO A;  1W6C A;  3CC7 3;  1VZZ A;  3FSD A;  1D6Z A;  1SIH A;  4WFO A;  1UW1 A;  3WOF B;  2YFL B;  1JN5 A;  3EBY A;  3JUO A;  5AIF A;  4RNY A;  4R9L A;  3X42 A;  1YHQ 3;  3OWS A;  2F86 B;  2WGQ A;  3F7S A;  3GZY B;  3CC4 3;  1N9J A;  5G2G A;  3F8H A;  3JUN A;  2RSX A;  1TP6 A;  3VSY A;  2WGO A;  1F8N A;  4EXR A;  1VQ4 3;  1VQO 3;  3K9M C;  3AMO A;  3Q1C A;  3K5T A;  2RCD A;  1AVL A;  3NXJ A;  5AIG A;  1AV4 A;  1OHP A;  3F7X A;  3CXC 2;  2Z76 A;  1C7H A;  3SOA A;  1W6G A;  1W2Z A;  1STF I;  1WMP A;  1HKX A;  2I9W A;  3UJM A;  3PZW A;  2CG0 A;  1JNQ A;  3D3L A;  3B4P A;  2OOV C;  3MSO A;  3NM2 A;  3RDE A;  3LML A;  4JF8 A;  1IVU A;  4MJD A;  1V74 A;  1S72 3;  4TX4 A;  3K63 A;  3KE7 A;  1A2K A;  2BT3 A;  5IER A;  3CU3 A;  3LH4 A;  1KD1 4;  4J9A A;  3QK9 A;  2P09 A;  3T8U A;  5AEW B;  3OX9 A;  3OXA A;  2INX A;  4XBX A;  3DXO A;  2WOF A;  3FG1 A;  4KFD A;  3CPO A;  2CWV A;  4BTW A;  2Z6B A;  3OV4 A;  3S27 A;  1JB2 A;  1VQ6 3;  1GD4 A;  1GY5 A;  1M90 4;  1K9M 4;  2BNG A;  4R1K A;  1KSI A;  4HYZ A;  4KFE A;  2FNQ A;  3N8B A;  1QAF A;  5D81 A;  1IVW A;  3M8C A;  4I4K A;  2W0Q A;  1U8C B;  3GZB A;  2WOH A;  3WOD G;  5IW9 A;  4FR9 A;  3DZL A;  2B1X B;  1CYU A;  1O7M B;  2P0X A;  1EKM A;  2CKF B;  5AYS C;  2L4V A;  3GZR A;  4KFF A;  3G16 A;  5BXQ A;  1QAK A;  2OCT A;  3LTB A;  3NV0 B;  4NRE A;  1JKG B;  3LT8 A;  1Q40 A;  2HMM B;  2HMO B;  3S5C A;  1MNL A;  3PS8 A;  4K90 B;  6STD A;  2Y74 A;  3SOY A;  2CFK A;  1IQ8 A;  1IDP A;  1ULI B;  3WA3 A;  3I55 3;  1Q82 4;  1FA3 A;  1WMN A;  2XFS A;  1LNH A;  1TFK A;  1ZO2 A;  3EB8 A;  3NX0 A;  3PCR A;  5IG5 A;  2FGT A;  5AYR B;  2E2V A;  1QMA A;  3CCU 3;  1VQ5 3;  1KWI A;  5CK6 A;  1OGZ A;  1W6Y A;  1JV2 B;  4EBG A;  5DRV A;  2GU1 A;  1FGR A;  8CHO A;  1QVF 2;  1W5Z A;  3HIG A;  1FGM A;  2C10 A;  2PNC A;  2OTL 3;  1UUW B;  5HGR A;  3GWR A;  3BLZ A;  1OF5 A;  2D1W A;  2CFL A;  4PEJ A;  3LOY A;  1O7H B;  3F9S A;  3HK4 A;  3SED A;  1IQY A;  2BHM A;  2BMQ B;  2MF7 A;  5AIH A;  2GU3 A;  1Q7Y 4;  5JPP A;  3Q2P A;  2R4I A;  3HII A;  1EA2 A;  2OQE C;  4EV5 A;  2P38 A;  4HM4 B;  3CCJ 3;  2V1L A;  3JVC A;  1DYU A;  4L8P A;  5CLK A;  3U1W A;  1A90 A;  3N9H A;  2CW9 A;  1N9E A;  4O3V A;  1ULJ B;  1YIJ 3;  2F99 A;  3TDG A;  2KRT A;  4HM7 B;  4HBR A;  4WYK A;  2D42 A;  2FXT A;  3EQQ B;  2ML5 A;  1N5P A;  3G8Z A;  4HVN A;  3ALA A;  3KSP A;  3LTC A;  4FMC A;  5IEO A;  2YX9 A;  3FF0 A;  4MMY B;  4WP5 A;  4O02 B;  2XH9 A;  1E3R A;  4K1U A;  2ZL8 A;  3DGL A;  2W56 A;  1GS3 A;  4XBY A;  2BO9 B;  4N6L A;  1DMQ A;  3CCQ 3;  4STD A;  1O7N B;  3CCR 3;  3K7C A;  1O7W B;  1TU5 A;  2QEX 3;  4KVH A;  3U97 A;  3DMC A;  1NWW A;  2STD A;  4LZI A;  1O7G B;  3MG1 A;  3D9R A;  1IQX A;  1WNH A;  4N3V A;  1NB5 I;  3ROB A;  4MMZ B;  1OUN A;  3H3H A;  3FH1 A;  3WA2 X;  3QRD A;  4RZM A;  4HM5 B;  1DMN A;  2SBL A;  5AEU B;  5IG4 A;  4R4K A;  2MC8 A;  3DGM A;  3MHE A;  3S67 A;  3S28 A;  2CHC A;  1LXE A;  7STD A;  3MPH A;  3V92 A;  1UUV B;  2PZV A;  5KP1 A;  1JJ2 2;  4AKY A;  3ER7 A;  1OAC A;  1VQ7 3;  1Z1S A;  4FMD A;  3MG3 A;  1BUQ A;  5AI1 A;  3CCM 3;  1W02 A;  1T5Y A;  3BNC A;  1TFO A;  3FG4 A;  4OK0 A;  5IG3 A;  3UNL A;  2OQE A;  1U5O A;  1ZX2 A;  5ELJ A;  1AR0 A;  2E2T A;  3I56 3;  3SLU A;  4X2H A;  3OW2 2;  4L7K A;  3FGY A;  4NHF A;  5IF6 A;  1Q81 4;  2KXG A;  3X3X A;  2CC3 A;  3LTA A;  4ZM8 A;  3NBB A;  3CCE 3;  1VQM 3;  3B8L A;  3PGB A;  4IIA A;  1IK3 A;  1GD3 A;  5FGO A;  1EQK A;  2QA4 3;  1G96 A;  1IT7 A;  5JPU A;  2YFJ B;  3MYT A;  2O3O A;  5CF2 A;  3X3Z A;  4EYC A;  3NBJ A;  1NB3 I;  1VQP 3;  1OH0 A;  2JDI H;  3LT9 A;  3OWU A;  4FCJ A;  4J8T A;  4N6T A;  3CPW 2;  1WMO A;  3WOE B;  3B7C A;  2LQV A;  1M1X B;  1VQN 3;  2K0M A;  1CQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...