2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
1YJ93 1VQO3 1S723 3CCQ3 1K8A4 3CCM3 1VQK3 2OTJ3 3CC73 3OW22 3CCL3 3CMA3 3CPW2 3CCV3 1VQ83 1VQ43 3CXC2 3I563 1Q824 1KQS2 1VQ53 1Q7Y4 1Q864 1W2B2 3G4S3 3G713 1NJI4 3CCJ3 1QVF2 1YJW3 1KD14 3CCR3 2QEX3 3CD63 3I553 3CME3 3G6E3 1YIT3 3CC23 1VQP3 3CCE3 1M904 1Q814 2OTL3 1VQM3 3CC43 1VQN3 1QVG2 1JJ22 1M1K4 1VQ63 1YI23 1VQL3 2QA43 1VQ73 1N8R4 3CCU3 1YHQ3 1K734 1YJN3 1KC84 1VQ93 3CCS3 1YIJ3 1K9M4
chains in the Genus database with same CATH superfamily
1DVCA 1RCKA 1UUVB 2HMMB 1TRPA 4FCZA 2ZA4A 1IV9A 2RCDA 1A67A 1S5AA 1KC84 2D1WA 2KF3A 4MJDA 4N6MA 3T0UA 2OTJ3 4O2HA 3CCL3 4I5QA 1MNLA 1QAKA 1X1UA 1DETA 1LOVA 3NQZA 1V57A 3VF1A 1WTHA 4J8TA 1V58A 2ML6A 4WFOA 2XSOB 2XFSA 3F8HA 1RGKA 2K3DA 3K0ZA 2OTL3 4RZMA 3NV0A 2CW9A 5CLKA 1HKXA 4IIAA 4Q53A 1DYUA 1EKMA 3OWSA 4EC6A 2O3OA 4XBXA 1FGMA 1BRKA 3GSPA 3SOAA 3UL6A 1BRNL 5AIHA 1HYFA 1LOXA 2IA7A 3HZPA 1T2HA 2Z77A 1UGHI 4PEJA 5IW9A 2B1XB 3CXC2 1UW1A 3JUQA 4HM8B 1STDA 2IMJA 2O9UX 1GSPA 2A15A 3S28A 1QALA 1RCLA 1NNVA 1IT8A 3RGAA 2BT3A 2JDIH 1BRJA 3BB9A 3CU3A 2GU3A 3EHCA 1UI8A 1UI7A 1W5ZA 3SOYA 4ZM8A 3BNCA 4OK0A 1NDOB 1TRQA 4GSPA 3T8NA 1D6YA 3AHWA 3ALAA 2RBIA 1RDSA 4R1KA 1B3SA 1I3IA 3G0KA 5IEOA 2F5WA 1CEWI 2OQEA 1GOYA 3G8ZA 3CCM3 1RLSA 3Q90A 5IERA 1NWWA 5M19A 2WOHA 2K0MA 3N9HA 1TU5A 2HMKB 1FUWA 2RFRA 1GMRA 4J5KA 1N9EA 1Q40B 4AEQA 2QEX3 3WHOA 1I2EA 2F5MA 1W6YA 2CFGA 4HVNA 4XDVA 3AMOB 2OWPA 3EE1A 2CC3A 1VQN3 2KCDA 5CK6A 5BIRA 3OWYA 5IF6A 2P09A 1LRAA 1W6GA 4HBRA 4KZ1A 4HZBB 1FYSA 4K61A 4LEHA 4N6V0 3WODG 3ZFZA 2WO0A 2BIRA 7STDA 3V98A 5M18A 3CCS3 1YIJ3 1YJ93 3NUVA 2AAEA 1K8A4 1I8VA 3F8XA 3LTDA 3OV4A 3ROBA 2RGQA 3JUMA 3MYTA 4CPKA 4EV2A 1EEJA 3RNTA 1IVWA 1ULIB 4J5GA 4NPBA 4FCJA 1A2PA 1STFI 5IG0A 3KFQC 3D79A 1YJW3 2CX1A 2XR8B 1JZOA 3NV0B 1M9GA 4XB5A 3PS8A 3BNDA 1U8CB 1ULJB 1WMNA 2H0HA 2W9PA 1W6CA 2GU1A 3HK4A 1IQYA 3LT9A 1PFPA 1QVG2 1O7PB 2XH9A 4HM7B 3FZWA 1BNJA 4KT3B 3WOFB 6RNTA 1ZO2A 2W0QA 1K734 1O7HB 2FXTA 4NHFA 3X3XA 3HOHA 2R4IA 1RHLA 1LVNA 3B8LA 1BRHA 5AI1A 1F8NA 3LYGA 1JB5A 1N8QA 1MWRA 1G0TA 5IEPA 4WWUC 1JNQA 3DGNA 1RN4A 6GSPA 2HMJB 4RNYA 2HOHA 3OXAA 2KRTA 1PY3A 2WOFA 2FGTA 2BU4A 3FF2A 2CH9A 4OUQA 5EEOA 2W56A 1Q864 4HM0B 1QVF2 5AYSC 1DMNA 2XGLA 2XFTA 2UGIA 1FW7A 2OCTA 5CXOA 3KN4A 5HOHA 4H61A 3EJVA 7GSPA 2MF7A 1Z1SA 1BU4A 2AADA 1IQXA 1MGRA 3WOEB 1BGSA 2W2CA 1JJ22 1FGOA 3MKIA 1B2MA 1VQ93 4BTWA 1BANA 2P0XA 3EBTA 3L0RA 1GMQA 2CWTA 3GZXB 3NXJA 2PNCA 1N9JA 2OQEC 1W02A 4NREA 4R80A 1RN7A 3A5EA 4ILFA 3SYUA 2KF6A 1OACA 1L5GB 3KSED 1YVBI 2YFIB 1FGQA 1Q9EA 3CMA3 1IVXA 1LOYA 5JPUA 1US1A 1MWUA 1E3VA 2RSXA 3MWZA 2HMNB 2OOVA 6STDA 2RNTA 2ZHXB 4WYKA 1I70A 3JUNA 3CCJ3 5EQLA 2GSPA 4HM1B 3JVCA 3CNXA 3MHEA 1N5PA 3BLZA 3LMLA 3CCE3 1RGCA 3D3LA 1KSIA 4LMIA 4EXRA 1PU4A 4CJNA 1K28A 2Z76A 4HM3B 1UGIA 3FG3A 3V99A 3GAXA 2QA43 1FA3A 2UUGC 1FZUA 2INXA 5M1AA 1RGAA 3F7XA 1JBSA 4N3VA 1CH0A 3KSPA 3LTAA 1UCLA 3NBJA 1DE3A 1EQKA 3EC9A 1OUNA 1Q7Y4 3LTCA 3G4S3 1HZ1A 1RMSA 1C7HA 1MGWA 3CD63 1MWTA 3OWUA 2C11A 1WNHA 1UCIA 3ER7A 4DKIA 2R41A 3KZTA 4K1VA 5EVHA 1RRHA 1BVIA 2GEXA 1BNIA 3D5GA 4GB5A 3K7CA 1LNHA 2H0IA 4HM5B 5CF1A 3F9SA 5KP1A 3UNLA 4EW5A 5LC6A 4CCVA 4O02B 2BMQB 1AVKA 1VZZA 4EYCA 1ASKA 1VQK3 4H3UA 1RTUA 4HZ9B 3MG2A 5DRVA 3VSYA 2W56B 4HJLB 1EUIC 3F7SA 3I563 2I9WA 1OHOA 2WGQA 1ISKA 4HKVB 2Y74A 1W2B2 1BNSA 1CYUA 4J9AA 3B7CA 3DH2A 2CFDA 1I3FA 1GD4A 1C54A 1OPYA 2D42A 1Q814 5FGOA 1ROAA 2CKFB 3DXOA 1SJWA 1TP6A 1BSDA 4IT7A 1CQSA 5KP4A 1LXEA 2L1SA 3K63A 4JRFA 5BU4A 4BL2A 3H3HA 3LZAA 3DGYA 4BU4A 1TIJA 2BO9B 3KIIA 3CPOA 4X2OA 3IPTA 1W4NA 2XF3A 4WHAA 1T3BA 2YX9A 5GSPA 3U97A 1GMPA 3CCV3 4WYKB 5LC7A 1BUJA 2JQ5A 1I0XA 2OOVC 3Q1CA 4LGQA 3X3ZA 1QMAA 3WA3A 5BXQA 2MC8A 3G713 1DMMA 3CCR3 4HYZA 1YGWA 2P05A 4KFEA 1RSNA 3G16A 4LSOA 1UDII 3IMAB 3UB1A 4BIRA 5A0OB 5AEUB 1N5HA 5DREA 1JBTA 1O7MB 1IQ8A 2GEYA 1O7WB 1MOLA 3QK9A 3X42A 5CF2A 1GY6A 1JN5B 4MMZB 3CCU3 3KCHA 2KF4A 2IUKA 2BNGA 2BHMA 3NX0A 1YNVX 3D4AA 3MG1A 1BSCA 2F99A 3T8UA 3FG4A 2F98A 1B27A 1SIIA 2LQVA 5I97A 1D6UA 4O8SA 2GXFA 7RNTA 1QJGA 1Q7HA 1UCJA 1W7CA 1WMPA 1ZGXA 4G1MB 1A90A 4N6NB 5AEWB 3S29A 2LYXA 3SX1A 2Y73A 3PYJA 2Q07A 3EN1B 2GBXB 3IJEB 1VQM3 9RNTA 2F4YA 2WGOA 1IYYA 1DVDA 4EV5A 1AVLA 3AGNA 1NU3A 1QAFA 1NO3A 3BNEA 1D6ZA 4ORLA 3EF8A 3X41A 2IYJA 3WA2X 1YJN3 1YHQ3 1OF5A 3HIIA 2QGUA 3TDGA 1K9M4 3BNBA 1LOWA 4WP5A 1VQO3 2E2VA 4FCMA 3CCQ3 2XSHB 4HOHA 3AHSA 1W01A 2XGNA 4GHOA 4AKYA 2C4BA 1AV4A 3B4OA 2B24B 1KWIA 1LQMB 5HGRA 4OVMA 1SIHA 1Q824 1TTOA 4BL3A 1T2IA 4HM6B 3DGOA 4KFDA 1NJI4 3FG1A 1KD14 1VQQA 1BRGA 2W6JH 3MSOA 2E2UA 3UL5A 3FSDA 3FCSB 2H0GA 8CHOA 3DMCA 4L7KA 1B2UA 3M8CA 3N54B 3NM2A 1GOVA 4STDA 5AIFA 2FNQA 5KP3A 1M1K4 1RGGA 3D9RA 3NQYA 2GBWB 3HI7A 1YVSA 4L8PA 2XRXB 3A76A 1I0VA 3EX9A 4FR9A 5D82A 1GS3A 4AKZA 3GZRA 2Z6BA 3PZWA 1B2SA 1BRIA 1JN5A 1I2GA 1JB2A 1GYBA 2PZVA 3DZLA 4IPBA 2Z7AA 3LOYA 3S5CA 5RNTA 4QWTA 4N6OB 4K90B 1IU7A 1OCVA 1PYLA 1RN1A 2CHCA 3GZBA 3BIRA 3EB8A 1J2BA 2F86B 1IT7A 2UX0A 3MPHA 4XDWA 1BIRA 2CG0A 2L4VA 3PCRA 1RNBA 3DUKA 3KE7A 1UUWB 4MMXB 1AR0A 1GD3A 2P38A 4LZIA 2C10A 3Q3FA 4R4KA 1A2KA 1BRSA 1IVVA 3STDA 2CX0A 1YIT3 1M904 1GOUA 2HMOB 3ECFA 1Q42A 1BSAA 1EG9B 1TFOA 2SBLA 3V92A 3FKAA 5G1LA 1ZS7A 5D81A 3F14A 4JF8A 5JPPA 1ZX2A 4O3VA 1FGTA 3KKGA 4XBYA 5ELUA 1RGLA 1BOXA 4KFFA 1YGEA 1JRQA 3ZG5A 3J7Yd 3U1WA 1SARA 1W00A 2QIYA 1X1WA 1UUGB 2KF5A 2ML5A 1BNFA 2CFKA 1BNEA 3S67A 3DY5A 3OX9A 3AGOA 2SARA 4EBGA 4L8OA 1KQS2 1VQ53 3NBRA 1BUQA 4FMDA 1UCKA 3SVAA 1RNTA 3URPA 4LYLB 3WR2A 3F40A 3DM8A 1BSEA 1X1XA 5AIGA 3RGRA 3I553 3K9MC 2BMOB 3SLUA 1CYVA 3EQQB 1BAOA 1OF5B 1X1YA 3N8BA 1T5YA 3DGMA 1MWSA 2V1LA 2IUJA 1U5OA 3H51A 5IG3A 1N8R4 1TUHA 1M1XB 1RRLA 4XM4A 1G02A 1A2VA 2CFWA 3B4PA 3ZG0A 1NB5I 4XBTA 1S723 4N6TA 3X3YA 3SXXA 1IK3A 5ELJA 5BVBA 4BTXA 3FH1A 2HMLB 4FMAA 3CC73 3OW22 4MEIA 2M7OA 1JBRA 1AQZA 1TFKA 1OHPA 2P0MA 2W04A 1JKGB 3WDGB 2STDA 1B20A 3CNMA 4HM2B 3QRDA 1GY5A 3NBBA 2CFLA 4I4KA 5G2GA 2W03A 3G6E3 1VQP3 2YFJB 2W9QA 1IVUA 3I0YA 1FUSA 1AY7A 1RGHA 2YFLB 3LTBA 4R9LA 4N6UA 1B2XA 3DGLA 3X40A 5AYRB 1VQL3 1VQ73 3PXMA 4N6LA 1B21A 1BNGA 1IV7A 1NB3I 5TGNA 2ZDJA 2ZL8A 5G1KA 1ROVA 3WMDA 4FMCA 4RBNA 2BMRB 3FGYA 1OGXA 3VGNA 1I2FA 4HAAA 2J8XB 2KXGA 1BSBA 1EA2A 1W2ZA 1Y4KA 3FLJA 1E97A 1OH0A 1VQ43 5AIIA 1LQGC 1OHSA 3LH4A 5D83A 5IG4A 4RNTA 3FF0A 2CWVA 4MMYB 5JBSA 4GL6A 1RJOA 2CWUA 1IDPA 2KAAA 1RGEA 3MG3A 3CME3 4R9KA 3GWRA 3NHXA 3EN8A 3GZYB 5STDA 3UJMA 1HU9A 1R4YA 1BNRA 3S27A 1V74A 1VQ63 3BU4A 1K41A 1FGRA 2E2TA 3D5IA 3LT8A 4FMBA 1JZDA 3NM7A 1O7GB 4KVHA 1SPUA 1SQWA 1JV2B 1WMOA 8RNTA 1E3RA 4X2HA 3JUPA 1G96A 2F56A 1RGFA 1DMQA 2CG1A 4CDLA 1TJDA 3CPW2 1VQ83 2IY2A 3E99A 3SEDA 1B2ZA 2CIUA 1RKYA 1GY7A 4BTYA 5IENA 3JUOA 3PCSA 4K1UA 3K5TA 1LNIA 1WQLB 3HX8A 1OGZA 3CC23 1JKGA 3Q2PA 1Q40A 3RDEA 3CC43 3GRDA 5FW5A 1R4CA 2K54A 1YI23 3AMOA 4RNZA 1FUTA 3PGBA 3HIGA 1JB4A 1O7NB 3EBYA 3O8YA 4TX4A 5IG5A 2CK3H 4HM4B 4U13A 3LXUX 2XEPA
chains in the Genus database with same CATH topology
1DVCA 1UUVB 2HMMB 4FCZA 1IV9A 2RCDA 1A67A 1S5AA 2D1WA 4MJDA 4N6MA 3T0UA 2OTJ3 4O2HA 3CCL3 1MNLA 1QAKA 3NQZA 3VF1A 1WTHA 4J8TA 2ML6A 4WFOA 2XSOB 2XFSA 3F8HA 3K0ZA 2OTL3 4RZMA 3NV0A 2CW9A 5CLKA 1HKXA 4IIAA 4Q53A 1DYUA 1EKMA 3OWSA 4EC6A 2O3OA 4XBXA 1FGMA 3SOAA 3UL6A 5AIHA 1LOXA 2IA7A 3HZPA 2Z77A 4PEJA 5IW9A 2B1XB 3CXC2 1UW1A 3JUQA 4HM8B 1STDA 2IMJA 2O9UX 2A15A 3S28A 1QALA 1IT8A 3RGAA 2BT3A 2JDIH 3BB9A 3CU3A 2GU3A 3EHCA 1UI8A 1UI7A 1W5ZA 3SOYA 4ZM8A 3BNCA 4OK0A 1NDOB 3T8NA 1D6YA 3ALAA 4R1KA 3G0KA 5IEOA 1CEWI 2OQEA 3G8ZA 3CCM3 5IERA 3Q90A 1NWWA 2WOHA 2K0MA 3N9HA 1TU5A 2HMKB 1FUWA 2RFRA 1N9EA 1Q40B 4AEQA 2QEX3 1W6YA 2CFGA 4HVNA 4XDVA 3AMOB 2OWPA 3EE1A 2CC3A 1VQN3 2KCDA 5CK6A 3OWYA 5IF6A 2P09A 1W6GA 4HBRA 4KZ1A 4HZBB 4LEHA 4K61A 4N6V0 3WODG 7STDA 3CCS3 2WO0A 1YIJ3 3V98A 1YJ93 3NUVA 1K8A4 3F8XA 3LTDA 3OV4A 3ROBA 2RGQA 3JUMA 3MYTA 4EV2A 1IVWA 1ULIB 4FCJA 5IG0A 1STFI 3KFQC 1YJW3 2XR8B 3NV0B 1M9GA 4XB5A 3PS8A 3BNDA 1U8CB 1ULJB 1WMNA 2W9PA 1W6CA 2GU1A 3HK4A 1IQYA 3LT9A 1PFPA 1QVG2 1O7PB 2XH9A 4HM7B 3FZWA 3WOFB 1ZO2A 2W0QA 1K734 1O7HB 2FXTA 4NHFA 3X3XA 2R4IA 1LVNA 3B8LA 5AI1A 1F8NA 3LYGA 1JB5A 1N8QA 5IEPA 4WWUC 1JNQA 3DGNA 2HMJB 4RNYA 3OXAA 2KRTA 3FF2A 2WOFA 2FGTA 2CH9A 4OUQA 5EEOA 2W56A 1Q864 4HM0B 1QVF2 5AYSC 1DMNA 2XGLA 2XFTA 2OCTA 5CXOA 3KN4A 4H61A 3EJVA 2MF7A 1Z1SA 1IQXA 3WOEB 1JJ22 2W2CA 1FGOA 3MKIA 1VQ93 4BTWA 2P0XA 3EBTA 3L0RA 2CWTA 3GZXB 3NXJA 2PNCA 1N9JA 2OQEC 1W02A 4NREA 4R80A 1RN7A 1OACA 1L5GB 3KSED 1YVBI 2YFIB 1FGQA 3CMA3 1IVXA 5JPUA 1US1A 1E3VA 2RSXA 3MWZA 2HMNB 2OOVA 6STDA 3CCJ3 4WYKA 3JUNA 5EQLA 4HM1B 3JVCA 3CNXA 3MHEA 1N5PA 3BLZA 3LMLA 3CCE3 3D3LA 1KSIA 4LMIA 4EXRA 1PU4A 1K28A 2Z76A 4HM3B 3FG3A 3V99A 3GAXA 2QA43 1FA3A 2INXA 3F7XA 4N3VA 3KSPA 3LTAA 3NBJA 1EQKA 3EC9A 1OUNA 1Q7Y4 3LTCA 3G4S3 1C7HA 3CD63 3OWUA 2C11A 1WNHA 3ER7A 3KZTA 4K1VA 5EVHA 1RRHA 2GEXA 4GB5A 3K7CA 1LNHA 4HM5B 5CF1A 3F9SA 5KP1A 3UNLA 5LC6A 4CCVA 4O02B 2BMQB 1AVKA 1VZZA 4EYCA 1ASKA 1VQK3 4H3UA 4HZ9B 3VSYA 3MG2A 5DRVA 2W56B 4HJLB 3F7SA 3I563 2I9WA 1OHOA 2WGQA 1ISKA 4HKVB 2Y74A 1W2B2 1CYUA 4J9AA 3B7CA 2CFDA 1GD4A 1OPYA 2D42A 1Q814 5FGOA 1ROAA 2CKFB 3DXOA 1SJWA 1TP6A 4IT7A 1CQSA 5KP4A 1LXEA 3K63A 4JRFA 3H3HA 3LZAA 1TIJA 2BO9B 3KIIA 3CPOA 4X2OA 3IPTA 1W4NA 2XF3A 4WHAA 2YX9A 3U97A 3CCV3 4WYKB 5LC7A 2JQ5A 4LGQA 2OOVC 3Q1CA 3X3ZA 1QMAA 3WA3A 5BXQA 2MC8A 3G713 1DMMA 3CCR3 4HYZA 4KFEA 2P05A 3G16A 4LSOA 3UB1A 5AEUB 3IMAB 5A0OB 1N5HA 5DREA 1O7MB 1IQ8A 2GEYA 1O7WB 1MOLA 3QK9A 3X42A 5CF2A 1GY6A 1JN5B 4MMZB 3CCU3 2IUKA 2BNGA 2BHMA 3NX0A 3MG1A 2F99A 3T8UA 3FG4A 2F98A 5I97A 1SIIA 2LQVA 1D6UA 4O8SA 2GXFA 1QJGA 1W7CA 1WMPA 4G1MB 1A90A 4N6NB 5AEWB 3S29A 2LYXA 3SX1A 2Y73A 3PYJA 2Q07A 3EN1B 2GBXB 3IJEB 1VQM3 1DVDA 2WGOA 4EV5A 1AVLA 1NU3A 1QAFA 1NO3A 3BNEA 1D6ZA 4ORLA 3EF8A 3X41A 3WA2X 1YJN3 1YHQ3 1KC84 1OF5A 3HIIA 2QGUA 3TDGA 1K9M4 3BNBA 4WP5A 1VQO3 2E2VA 4FCMA 3CCQ3 2XSHB 1W01A 2XGNA 4AKYA 3B4OA 1AV4A 2B24B 1KWIA 5HGRA 4OVMA 1SIHA 1Q824 4HM6B 3DGOA 4KFDA 1NJI4 3FG1A 1KD14 3MSOA 2W6JH 2E2UA 3UL5A 3FSDA 3FCSB 8CHOA 3DMCA 4L7KA 3N54B 3M8CA 4STDA 3NM2A 5KP3A 5AIFA 1M1K4 2FNQA 3NQYA 3D9RA 2GBWB 3HI7A 4L8PA 2XRXB 3A76A 5D82A 3EX9A 4FR9A 4AKZA 1GS3A 3GZRA 2Z6BA 3PZWA 1JN5A 1JB2A 1GYBA 2PZVA 3DZLA 4IPBA 2Z7AA 3LOYA 3S5CA 4QWTA 4N6OB 4K90B 1IU7A 1OCVA 2CHCA 3GZBA 3EB8A 1J2BA 2F86B 1IT7A 2UX0A 3MPHA 4XDWA 2CG0A 2L4VA 3PCRA 3DUKA 3KE7A 1UUWB 4MMXB 1AR0A 1GD3A 2P38A 4LZIA 2C10A 4R4KA 1A2KA 3STDA 1IVVA 1YIT3 1M904 2HMOB 3ECFA 1Q42A 1EG9B 1TFOA 2SBLA 3V92A 3FKAA 5D81A 3F14A 4JF8A 5JPPA 1ZX2A 4O3VA 1FGTA 3KKGA 4XBYA 5ELUA 4KFFA 1YGEA 1JRQA 3J7Yd 3U1WA 1W00A 2QIYA 2ML5A 2CFKA 3S67A 3DY5A 3OX9A 4EBGA 4L8OA 1KQS2 1VQ53 3NBRA 1BUQA 4FMDA 3SVAA 3F40A 3DM8A 3RGRA 3I553 5AIGA 3K9MC 2BMOB 3SLUA 1CYVA 3EQQB 1OF5B 3N8BA 1T5YA 3DGMA 2V1LA 2IUJA 1U5OA 3H51A 5IG3A 1N8R4 1TUHA 1M1XB 1RRLA 4XM4A 1A2VA 2CFWA 3B4PA 1NB5I 4XBTA 1S723 4N6TA 3X3YA 3SXXA 1IK3A 5ELJA 5BVBA 4BTXA 3FH1A 2HMLB 4FMAA 3CC73 3OW22 4MEIA 2M7OA 1TFKA 1OHPA 2P0MA 2W04A 1JKGB 3WDGB 2STDA 4HM2B 3CNMA 3QRDA 1GY5A 3NBBA 2CFLA 4I4KA 5G2GA 2W03A 3G6E3 1VQP3 2YFJB 2W9QA 1IVUA 3I0YA 2YFLB 3LTBA 4R9LA 4N6UA 3DGLA 3X40A 1VQL3 5AYRB 1VQ73 3PXMA 4N6LA 1IV7A 5TGNA 1NB3I 2ZDJA 2ZL8A 1ROVA 3WMDA 4FMCA 4RBNA 2BMRB 3FGYA 1OGXA 3VGNA 2KXGA 1EA2A 1W2ZA 1Y4KA 3FLJA 1E97A 1OH0A 1VQ43 5AIIA 3LH4A 1OHSA 5D83A 5IG4A 3FF0A 2CWVA 4MMYB 5JBSA 4GL6A 1RJOA 2CWUA 1IDPA 3MG3A 3CME3 4R9KA 3GWRA 3NHXA 3EN8A 3GZYB 5STDA 3UJMA 1HU9A 3S27A 1V74A 1VQ63 1K41A 1FGRA 2E2TA 3LT8A 4FMBA 4KVHA 3NM7A 1O7GB 1SPUA 1SQWA 1JV2B 1WMOA 1E3RA 4X2HA 3JUPA 1G96A 1DMQA 2CG1A 4CDLA 3CPW2 1VQ83 3E99A 3SEDA 2CIUA 1RKYA 1GY7A 4BTYA 5IENA 3JUOA 3PCSA 4K1UA 3K5TA 1WQLB 3HX8A 1OGZA 3CC23 1JKGA 3Q2PA 1Q40A 3RDEA 3CC43 3GRDA 5FW5A 1R4CA 2K54A 1YI23 3AMOA 4RNZA 3PGBA 3HIGA 1JB4A 1O7NB 3EBYA 3O8YA 4TX4A 5IG5A 2CK3H 4HM4B 4U13A 3LXUX 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 3;  1VQO 3;  1S72 3;  3CCQ 3;  1K8A 4;  3CCM 3;  1VQK 3;  2OTJ 3;  3CC7 3;  3OW2 2;  3CCL 3;  3CMA 3;  3CPW 2;  3CCV 3;  1VQ8 3;  1VQ4 3;  3CXC 2;  3I56 3;  1Q82 4;  1KQS 2;  1VQ5 3;  1Q7Y 4;  1Q86 4;  1W2B 2;  3G4S 3;  3G71 3;  1NJI 4;  3CCJ 3;  1QVF 2;  1YJW 3;  1KD1 4;  3CCR 3;  2QEX 3;  3CD6 3;  3I55 3;  3CME 3;  3G6E 3;  1YIT 3;  3CC2 3;  1VQP 3;  3CCE 3;  1M90 4;  1Q81 4;  2OTL 3;  1VQM 3;  3CC4 3;  1VQN 3;  1QVG 2;  1JJ2 2;  1M1K 4;  1VQ6 3;  1YI2 3;  1VQL 3;  2QA4 3;  1VQ7 3;  1N8R 4;  3CCU 3;  1YHQ 3;  1K73 4;  1YJN 3;  1KC8 4;  1VQ9 3;  3CCS 3;  1YIJ 3;  1K9M 4; 
#chains in the Genus database with same CATH topology
 1DVC A;  1RCK A;  1UUV B;  2HMM B;  1TRP A;  4FCZ A;  2ZA4 A;  1IV9 A;  2RCD A;  1A67 A;  1S5A A;  1KC8 4;  2D1W A;  2KF3 A;  4MJD A;  4N6M A;  3T0U A;  2OTJ 3;  4O2H A;  3CCL 3;  4I5Q A;  1MNL A;  1QAK A;  1X1U A;  1DET A;  1LOV A;  3NQZ A;  1V57 A;  3VF1 A;  1WTH A;  4J8T A;  1V58 A;  2ML6 A;  4WFO A;  2XSO B;  2XFS A;  3F8H A;  1RGK A;  2K3D A;  3K0Z A;  2OTL 3;  4RZM A;  3NV0 A;  2CW9 A;  5CLK A;  1HKX A;  4IIA A;  4Q53 A;  1DYU A;  1EKM A;  3OWS A;  4EC6 A;  2O3O A;  4XBX A;  1FGM A;  1BRK A;  3GSP A;  3SOA A;  3UL6 A;  1BRN L;  5AIH A;  1HYF A;  1LOX A;  2IA7 A;  3HZP A;  1T2H A;  2Z77 A;  1UGH I;  4PEJ A;  5IW9 A;  2B1X B;  3CXC 2;  1UW1 A;  3JUQ A;  4HM8 B;  1STD A;  2IMJ A;  2O9U X;  1GSP A;  2A15 A;  3S28 A;  1QAL A;  1RCL A;  1NNV A;  1IT8 A;  3RGA A;  2BT3 A;  2JDI H;  1BRJ A;  3BB9 A;  3CU3 A;  2GU3 A;  3EHC A;  1UI8 A;  1UI7 A;  1W5Z A;  3SOY A;  4ZM8 A;  3BNC A;  4OK0 A;  1NDO B;  1TRQ A;  4GSP A;  3T8N A;  1D6Y A;  3AHW A;  3ALA A;  2RBI A;  1RDS A;  4R1K A;  1B3S A;  1I3I A;  3G0K A;  5IEO A;  2F5W A;  1CEW I;  2OQE A;  1GOY A;  3G8Z A;  3CCM 3;  1RLS A;  3Q90 A;  5IER A;  1NWW A;  5M19 A;  2WOH A;  2K0M A;  3N9H A;  1TU5 A;  2HMK B;  1FUW A;  2RFR A;  1GMR A;  4J5K A;  1N9E A;  1Q40 B;  4AEQ A;  2QEX 3;  3WHO A;  1I2E A;  2F5M A;  1W6Y A;  2CFG A;  4HVN A;  4XDV A;  3AMO B;  2OWP A;  3EE1 A;  2CC3 A;  1VQN 3;  2KCD A;  5CK6 A;  5BIR A;  3OWY A;  5IF6 A;  2P09 A;  1LRA A;  1W6G A;  4HBR A;  4KZ1 A;  4HZB B;  1FYS A;  4K61 A;  4LEH A;  4N6V 0;  3WOD G;  3ZFZ A;  2WO0 A;  2BIR A;  7STD A;  3V98 A;  5M18 A;  3CCS 3;  1YIJ 3;  1YJ9 3;  3NUV A;  2AAE A;  1K8A 4;  1I8V A;  3F8X A;  3LTD A;  3OV4 A;  3ROB A;  2RGQ A;  3JUM A;  3MYT A;  4CPK A;  4EV2 A;  1EEJ A;  3RNT A;  1IVW A;  1ULI B;  4J5G A;  4NPB A;  4FCJ A;  1A2P A;  1STF I;  5IG0 A;  3KFQ C;  3D79 A;  1YJW 3;  2CX1 A;  2XR8 B;  1JZO A;  3NV0 B;  1M9G A;  4XB5 A;  3PS8 A;  3BND A;  1U8C B;  1ULJ B;  1WMN A;  2H0H A;  2W9P A;  1W6C A;  2GU1 A;  3HK4 A;  1IQY A;  3LT9 A;  1PFP A;  1QVG 2;  1O7P B;  2XH9 A;  4HM7 B;  3FZW A;  1BNJ A;  4KT3 B;  3WOF B;  6RNT A;  1ZO2 A;  2W0Q A;  1K73 4;  1O7H B;  2FXT A;  4NHF A;  3X3X A;  3HOH A;  2R4I A;  1RHL A;  1LVN A;  3B8L A;  1BRH A;  5AI1 A;  1F8N A;  3LYG A;  1JB5 A;  1N8Q A;  1MWR A;  1G0T A;  5IEP A;  4WWU C;  1JNQ A;  3DGN A;  1RN4 A;  6GSP A;  2HMJ B;  4RNY A;  2HOH A;  3OXA A;  2KRT A;  1PY3 A;  2WOF A;  2FGT A;  2BU4 A;  3FF2 A;  2CH9 A;  4OUQ A;  5EEO A;  2W56 A;  1Q86 4;  4HM0 B;  1QVF 2;  5AYS C;  1DMN A;  2XGL A;  2XFT A;  2UGI A;  1FW7 A;  2OCT A;  5CXO A;  3KN4 A;  5HOH A;  4H61 A;  3EJV A;  7GSP A;  2MF7 A;  1Z1S A;  1BU4 A;  2AAD A;  1IQX A;  1MGR A;  3WOE B;  1BGS A;  2W2C A;  1JJ2 2;  1FGO A;  3MKI A;  1B2M A;  1VQ9 3;  4BTW A;  1BAN A;  2P0X A;  3EBT A;  3L0R A;  1GMQ A;  2CWT A;  3GZX B;  3NXJ A;  2PNC A;  1N9J A;  2OQE C;  1W02 A;  4NRE A;  4R80 A;  1RN7 A;  3A5E A;  4ILF A;  3SYU A;  2KF6 A;  1OAC A;  1L5G B;  3KSE D;  1YVB I;  2YFI B;  1FGQ A;  1Q9E A;  3CMA 3;  1IVX A;  1LOY A;  5JPU A;  1US1 A;  1MWU A;  1E3V A;  2RSX A;  3MWZ A;  2HMN B;  2OOV A;  6STD A;  2RNT A;  2ZHX B;  4WYK A;  1I70 A;  3JUN A;  3CCJ 3;  5EQL A;  2GSP A;  4HM1 B;  3JVC A;  3CNX A;  3MHE A;  1N5P A;  3BLZ A;  3LML A;  3CCE 3;  1RGC A;  3D3L A;  1KSI A;  4LMI A;  4EXR A;  1PU4 A;  4CJN A;  1K28 A;  2Z76 A;  4HM3 B;  1UGI A;  3FG3 A;  3V99 A;  3GAX A;  2QA4 3;  1FA3 A;  2UUG C;  1FZU A;  2INX A;  5M1A A;  1RGA A;  3F7X A;  1JBS A;  4N3V A;  1CH0 A;  3KSP A;  3LTA A;  1UCL A;  3NBJ A;  1DE3 A;  1EQK A;  3EC9 A;  1OUN A;  1Q7Y 4;  3LTC A;  3G4S 3;  1HZ1 A;  1RMS A;  1C7H A;  1MGW A;  3CD6 3;  1MWT A;  3OWU A;  2C11 A;  1WNH A;  1UCI A;  3ER7 A;  4DKI A;  2R41 A;  3KZT A;  4K1V A;  5EVH A;  1RRH A;  1BVI A;  2GEX A;  1BNI A;  3D5G A;  4GB5 A;  3K7C A;  1LNH A;  2H0I A;  4HM5 B;  5CF1 A;  3F9S A;  5KP1 A;  3UNL A;  4EW5 A;  5LC6 A;  4CCV A;  4O02 B;  2BMQ B;  1AVK A;  1VZZ A;  4EYC A;  1ASK A;  1VQK 3;  4H3U A;  1RTU A;  4HZ9 B;  3MG2 A;  5DRV A;  3VSY A;  2W56 B;  4HJL B;  1EUI C;  3F7S A;  3I56 3;  2I9W A;  1OHO A;  2WGQ A;  1ISK A;  4HKV B;  2Y74 A;  1W2B 2;  1BNS A;  1CYU A;  4J9A A;  3B7C A;  3DH2 A;  2CFD A;  1I3F A;  1GD4 A;  1C54 A;  1OPY A;  2D42 A;  1Q81 4;  5FGO A;  1ROA A;  2CKF B;  3DXO A;  1SJW A;  1TP6 A;  1BSD A;  4IT7 A;  1CQS A;  5KP4 A;  1LXE A;  2L1S A;  3K63 A;  4JRF A;  5BU4 A;  4BL2 A;  3H3H A;  3LZA A;  3DGY A;  4BU4 A;  1TIJ A;  2BO9 B;  3KII A;  3CPO A;  4X2O A;  3IPT A;  1W4N A;  2XF3 A;  4WHA A;  1T3B A;  2YX9 A;  5GSP A;  3U97 A;  1GMP A;  3CCV 3;  4WYK B;  5LC7 A;  1BUJ A;  2JQ5 A;  1I0X A;  2OOV C;  3Q1C A;  4LGQ A;  3X3Z A;  1QMA A;  3WA3 A;  5BXQ A;  2MC8 A;  3G71 3;  1DMM A;  3CCR 3;  4HYZ A;  1YGW A;  2P05 A;  4KFE A;  1RSN A;  3G16 A;  4LSO A;  1UDI I;  3IMA B;  3UB1 A;  4BIR A;  5A0O B;  5AEU B;  1N5H A;  5DRE A;  1JBT A;  1O7M B;  1IQ8 A;  2GEY A;  1O7W B;  1MOL A;  3QK9 A;  3X42 A;  5CF2 A;  1GY6 A;  1JN5 B;  4MMZ B;  3CCU 3;  3KCH A;  2KF4 A;  2IUK A;  2BNG A;  2BHM A;  3NX0 A;  1YNV X;  3D4A A;  3MG1 A;  1BSC A;  2F99 A;  3T8U A;  3FG4 A;  2F98 A;  1B27 A;  1SII A;  2LQV A;  5I97 A;  1D6U A;  4O8S A;  2GXF A;  7RNT A;  1QJG A;  1Q7H A;  1UCJ A;  1W7C A;  1WMP A;  1ZGX A;  4G1M B;  1A90 A;  4N6N B;  5AEW B;  3S29 A;  2LYX A;  3SX1 A;  2Y73 A;  3PYJ A;  2Q07 A;  3EN1 B;  2GBX B;  3IJE B;  1VQM 3;  9RNT A;  2F4Y A;  2WGO A;  1IYY A;  1DVD A;  4EV5 A;  1AVL A;  3AGN A;  1NU3 A;  1QAF A;  1NO3 A;  3BNE A;  1D6Z A;  4ORL A;  3EF8 A;  3X41 A;  2IYJ A;  3WA2 X;  1YJN 3;  1YHQ 3;  1OF5 A;  3HII A;  2QGU A;  3TDG A;  1K9M 4;  3BNB A;  1LOW A;  4WP5 A;  1VQO 3;  2E2V A;  4FCM A;  3CCQ 3;  2XSH B;  4HOH A;  3AHS A;  1W01 A;  2XGN A;  4GHO A;  4AKY A;  2C4B A;  1AV4 A;  3B4O A;  2B24 B;  1KWI A;  1LQM B;  5HGR A;  4OVM A;  1SIH A;  1Q82 4;  1TTO A;  4BL3 A;  1T2I A;  4HM6 B;  3DGO A;  4KFD A;  1NJI 4;  3FG1 A;  1KD1 4;  1VQQ A;  1BRG A;  2W6J H;  3MSO A;  2E2U A;  3UL5 A;  3FSD A;  3FCS B;  2H0G A;  8CHO A;  3DMC A;  4L7K A;  1B2U A;  3M8C A;  3N54 B;  3NM2 A;  1GOV A;  4STD A;  5AIF A;  2FNQ A;  5KP3 A;  1M1K 4;  1RGG A;  3D9R A;  3NQY A;  2GBW B;  3HI7 A;  1YVS A;  4L8P A;  2XRX B;  3A76 A;  1I0V A;  3EX9 A;  4FR9 A;  5D82 A;  1GS3 A;  4AKZ A;  3GZR A;  2Z6B A;  3PZW A;  1B2S A;  1BRI A;  1JN5 A;  1I2G A;  1JB2 A;  1GYB A;  2PZV A;  3DZL A;  4IPB A;  2Z7A A;  3LOY A;  3S5C A;  5RNT A;  4QWT A;  4N6O B;  4K90 B;  1IU7 A;  1OCV A;  1PYL A;  1RN1 A;  2CHC A;  3GZB A;  3BIR A;  3EB8 A;  1J2B A;  2F86 B;  1IT7 A;  2UX0 A;  3MPH A;  4XDW A;  1BIR A;  2CG0 A;  2L4V A;  3PCR A;  1RNB A;  3DUK A;  3KE7 A;  1UUW B;  4MMX B;  1AR0 A;  1GD3 A;  2P38 A;  4LZI A;  2C10 A;  3Q3F A;  4R4K A;  1A2K A;  1BRS A;  1IVV A;  3STD A;  2CX0 A;  1YIT 3;  1M90 4;  1GOU A;  2HMO B;  3ECF A;  1Q42 A;  1BSA A;  1EG9 B;  1TFO A;  2SBL A;  3V92 A;  3FKA A;  5G1L A;  1ZS7 A;  5D81 A;  3F14 A;  4JF8 A;  5JPP A;  1ZX2 A;  4O3V A;  1FGT A;  3KKG A;  4XBY A;  5ELU A;  1RGL A;  1BOX A;  4KFF A;  1YGE A;  1JRQ A;  3ZG5 A;  3J7Y d;  3U1W A;  1SAR A;  1W00 A;  2QIY A;  1X1W A;  1UUG B;  2KF5 A;  2ML5 A;  1BNF A;  2CFK A;  1BNE A;  3S67 A;  3DY5 A;  3OX9 A;  3AGO A;  2SAR A;  4EBG A;  4L8O A;  1KQS 2;  1VQ5 3;  3NBR A;  1BUQ A;  4FMD A;  1UCK A;  3SVA A;  1RNT A;  3URP A;  4LYL B;  3WR2 A;  3F40 A;  3DM8 A;  1BSE A;  1X1X A;  5AIG A;  3RGR A;  3I55 3;  3K9M C;  2BMO B;  3SLU A;  1CYV A;  3EQQ B;  1BAO A;  1OF5 B;  1X1Y A;  3N8B A;  1T5Y A;  3DGM A;  1MWS A;  2V1L A;  2IUJ A;  1U5O A;  3H51 A;  5IG3 A;  1N8R 4;  1TUH A;  1M1X B;  1RRL A;  4XM4 A;  1G02 A;  1A2V A;  2CFW A;  3B4P A;  3ZG0 A;  1NB5 I;  4XBT A;  1S72 3;  4N6T A;  3X3Y A;  3SXX A;  1IK3 A;  5ELJ A;  5BVB A;  4BTX A;  3FH1 A;  2HML B;  4FMA A;  3CC7 3;  3OW2 2;  4MEI A;  2M7O A;  1JBR A;  1AQZ A;  1TFK A;  1OHP A;  2P0M A;  2W04 A;  1JKG B;  3WDG B;  2STD A;  1B20 A;  3CNM A;  4HM2 B;  3QRD A;  1GY5 A;  3NBB A;  2CFL A;  4I4K A;  5G2G A;  2W03 A;  3G6E 3;  1VQP 3;  2YFJ B;  2W9Q A;  1IVU A;  3I0Y A;  1FUS A;  1AY7 A;  1RGH A;  2YFL B;  3LTB A;  4R9L A;  4N6U A;  1B2X A;  3DGL A;  3X40 A;  5AYR B;  1VQL 3;  1VQ7 3;  3PXM A;  4N6L A;  1B21 A;  1BNG A;  1IV7 A;  1NB3 I;  5TGN A;  2ZDJ A;  2ZL8 A;  5G1K A;  1ROV A;  3WMD A;  4FMC A;  4RBN A;  2BMR B;  3FGY A;  1OGX A;  3VGN A;  1I2F A;  4HAA A;  2J8X B;  2KXG A;  1BSB A;  1EA2 A;  1W2Z A;  1Y4K A;  3FLJ A;  1E97 A;  1OH0 A;  1VQ4 3;  5AII A;  1LQG C;  1OHS A;  3LH4 A;  5D83 A;  5IG4 A;  4RNT A;  3FF0 A;  2CWV A;  4MMY B;  5JBS A;  4GL6 A;  1RJO A;  2CWU A;  1IDP A;  2KAA A;  1RGE A;  3MG3 A;  3CME 3;  4R9K A;  3GWR A;  3NHX A;  3EN8 A;  3GZY B;  5STD A;  3UJM A;  1HU9 A;  1R4Y A;  1BNR A;  3S27 A;  1V74 A;  1VQ6 3;  3BU4 A;  1K41 A;  1FGR A;  2E2T A;  3D5I A;  3LT8 A;  4FMB A;  1JZD A;  3NM7 A;  1O7G B;  4KVH A;  1SPU A;  1SQW A;  1JV2 B;  1WMO A;  8RNT A;  1E3R A;  4X2H A;  3JUP A;  1G96 A;  2F56 A;  1RGF A;  1DMQ A;  2CG1 A;  4CDL A;  1TJD A;  3CPW 2;  1VQ8 3;  2IY2 A;  3E99 A;  3SED A;  1B2Z A;  2CIU A;  1RKY A;  1GY7 A;  4BTY A;  5IEN A;  3JUO A;  3PCS A;  4K1U A;  3K5T A;  1LNI A;  1WQL B;  3HX8 A;  1OGZ A;  3CC2 3;  1JKG A;  3Q2P A;  1Q40 A;  3RDE A;  3CC4 3;  3GRD A;  5FW5 A;  1R4C A;  2K54 A;  1YI2 3;  3AMO A;  4RNZ A;  1FUT A;  3PGB A;  3HIG A;  1JB4 A;  1O7N B;  3EBY A;  3O8Y A;  4TX4 A;  5IG5 A;  2CK3 H;  4HM4 B;  4U13 A;  3LXU X;  2XEP A; 
#chains in the Genus database with same CATH homology
 1DVC A;  1UUV B;  2HMM B;  4FCZ A;  1IV9 A;  2RCD A;  1A67 A;  1S5A A;  2D1W A;  4MJD A;  4N6M A;  3T0U A;  2OTJ 3;  4O2H A;  3CCL 3;  1MNL A;  1QAK A;  3NQZ A;  3VF1 A;  1WTH A;  4J8T A;  2ML6 A;  4WFO A;  2XSO B;  2XFS A;  3F8H A;  3K0Z A;  2OTL 3;  4RZM A;  3NV0 A;  2CW9 A;  5CLK A;  1HKX A;  4IIA A;  4Q53 A;  1DYU A;  1EKM A;  3OWS A;  4EC6 A;  2O3O A;  4XBX A;  1FGM A;  3SOA A;  3UL6 A;  5AIH A;  1LOX A;  2IA7 A;  3HZP A;  2Z77 A;  4PEJ A;  5IW9 A;  2B1X B;  3CXC 2;  1UW1 A;  3JUQ A;  4HM8 B;  1STD A;  2IMJ A;  2O9U X;  2A15 A;  3S28 A;  1QAL A;  1IT8 A;  3RGA A;  2BT3 A;  2JDI H;  3BB9 A;  3CU3 A;  2GU3 A;  3EHC A;  1UI8 A;  1UI7 A;  1W5Z A;  3SOY A;  4ZM8 A;  3BNC A;  4OK0 A;  1NDO B;  3T8N A;  1D6Y A;  3ALA A;  4R1K A;  3G0K A;  5IEO A;  1CEW I;  2OQE A;  3G8Z A;  3CCM 3;  5IER A;  3Q90 A;  1NWW A;  2WOH A;  2K0M A;  3N9H A;  1TU5 A;  2HMK B;  1FUW A;  2RFR A;  1N9E A;  1Q40 B;  4AEQ A;  2QEX 3;  1W6Y A;  2CFG A;  4HVN A;  4XDV A;  3AMO B;  2OWP A;  3EE1 A;  2CC3 A;  1VQN 3;  2KCD A;  5CK6 A;  3OWY A;  5IF6 A;  2P09 A;  1W6G A;  4HBR A;  4KZ1 A;  4HZB B;  4LEH A;  4K61 A;  4N6V 0;  3WOD G;  7STD A;  3CCS 3;  2WO0 A;  1YIJ 3;  3V98 A;  1YJ9 3;  3NUV A;  1K8A 4;  3F8X A;  3LTD A;  3OV4 A;  3ROB A;  2RGQ A;  3JUM A;  3MYT A;  4EV2 A;  1IVW A;  1ULI B;  4FCJ A;  5IG0 A;  1STF I;  3KFQ C;  1YJW 3;  2XR8 B;  3NV0 B;  1M9G A;  4XB5 A;  3PS8 A;  3BND A;  1U8C B;  1ULJ B;  1WMN A;  2W9P A;  1W6C A;  2GU1 A;  3HK4 A;  1IQY A;  3LT9 A;  1PFP A;  1QVG 2;  1O7P B;  2XH9 A;  4HM7 B;  3FZW A;  3WOF B;  1ZO2 A;  2W0Q A;  1K73 4;  1O7H B;  2FXT A;  4NHF A;  3X3X A;  2R4I A;  1LVN A;  3B8L A;  5AI1 A;  1F8N A;  3LYG A;  1JB5 A;  1N8Q A;  5IEP A;  4WWU C;  1JNQ A;  3DGN A;  2HMJ B;  4RNY A;  3OXA A;  2KRT A;  3FF2 A;  2WOF A;  2FGT A;  2CH9 A;  4OUQ A;  5EEO A;  2W56 A;  1Q86 4;  4HM0 B;  1QVF 2;  5AYS C;  1DMN A;  2XGL A;  2XFT A;  2OCT A;  5CXO A;  3KN4 A;  4H61 A;  3EJV A;  2MF7 A;  1Z1S A;  1IQX A;  3WOE B;  1JJ2 2;  2W2C A;  1FGO A;  3MKI A;  1VQ9 3;  4BTW A;  2P0X A;  3EBT A;  3L0R A;  2CWT A;  3GZX B;  3NXJ A;  2PNC A;  1N9J A;  2OQE C;  1W02 A;  4NRE A;  4R80 A;  1RN7 A;  1OAC A;  1L5G B;  3KSE D;  1YVB I;  2YFI B;  1FGQ A;  3CMA 3;  1IVX A;  5JPU A;  1US1 A;  1E3V A;  2RSX A;  3MWZ A;  2HMN B;  2OOV A;  6STD A;  3CCJ 3;  4WYK A;  3JUN A;  5EQL A;  4HM1 B;  3JVC A;  3CNX A;  3MHE A;  1N5P A;  3BLZ A;  3LML A;  3CCE 3;  3D3L A;  1KSI A;  4LMI A;  4EXR A;  1PU4 A;  1K28 A;  2Z76 A;  4HM3 B;  3FG3 A;  3V99 A;  3GAX A;  2QA4 3;  1FA3 A;  2INX A;  3F7X A;  4N3V A;  3KSP A;  3LTA A;  3NBJ A;  1EQK A;  3EC9 A;  1OUN A;  1Q7Y 4;  3LTC A;  3G4S 3;  1C7H A;  3CD6 3;  3OWU A;  2C11 A;  1WNH A;  3ER7 A;  3KZT A;  4K1V A;  5EVH A;  1RRH A;  2GEX A;  4GB5 A;  3K7C A;  1LNH A;  4HM5 B;  5CF1 A;  3F9S A;  5KP1 A;  3UNL A;  5LC6 A;  4CCV A;  4O02 B;  2BMQ B;  1AVK A;  1VZZ A;  4EYC A;  1ASK A;  1VQK 3;  4H3U A;  4HZ9 B;  3VSY A;  3MG2 A;  5DRV A;  2W56 B;  4HJL B;  3F7S A;  3I56 3;  2I9W A;  1OHO A;  2WGQ A;  1ISK A;  4HKV B;  2Y74 A;  1W2B 2;  1CYU A;  4J9A A;  3B7C A;  2CFD A;  1GD4 A;  1OPY A;  2D42 A;  1Q81 4;  5FGO A;  1ROA A;  2CKF B;  3DXO A;  1SJW A;  1TP6 A;  4IT7 A;  1CQS A;  5KP4 A;  1LXE A;  3K63 A;  4JRF A;  3H3H A;  3LZA A;  1TIJ A;  2BO9 B;  3KII A;  3CPO A;  4X2O A;  3IPT A;  1W4N A;  2XF3 A;  4WHA A;  2YX9 A;  3U97 A;  3CCV 3;  4WYK B;  5LC7 A;  2JQ5 A;  4LGQ A;  2OOV C;  3Q1C A;  3X3Z A;  1QMA A;  3WA3 A;  5BXQ A;  2MC8 A;  3G71 3;  1DMM A;  3CCR 3;  4HYZ A;  4KFE A;  2P05 A;  3G16 A;  4LSO A;  3UB1 A;  5AEU B;  3IMA B;  5A0O B;  1N5H A;  5DRE A;  1O7M B;  1IQ8 A;  2GEY A;  1O7W B;  1MOL A;  3QK9 A;  3X42 A;  5CF2 A;  1GY6 A;  1JN5 B;  4MMZ B;  3CCU 3;  2IUK A;  2BNG A;  2BHM A;  3NX0 A;  3MG1 A;  2F99 A;  3T8U A;  3FG4 A;  2F98 A;  5I97 A;  1SII A;  2LQV A;  1D6U A;  4O8S A;  2GXF A;  1QJG A;  1W7C A;  1WMP A;  4G1M B;  1A90 A;  4N6N B;  5AEW B;  3S29 A;  2LYX A;  3SX1 A;  2Y73 A;  3PYJ A;  2Q07 A;  3EN1 B;  2GBX B;  3IJE B;  1VQM 3;  1DVD A;  2WGO A;  4EV5 A;  1AVL A;  1NU3 A;  1QAF A;  1NO3 A;  3BNE A;  1D6Z A;  4ORL A;  3EF8 A;  3X41 A;  3WA2 X;  1YJN 3;  1YHQ 3;  1KC8 4;  1OF5 A;  3HII A;  2QGU A;  3TDG A;  1K9M 4;  3BNB A;  4WP5 A;  1VQO 3;  2E2V A;  4FCM A;  3CCQ 3;  2XSH B;  1W01 A;  2XGN A;  4AKY A;  3B4O A;  1AV4 A;  2B24 B;  1KWI A;  5HGR A;  4OVM A;  1SIH A;  1Q82 4;  4HM6 B;  3DGO A;  4KFD A;  1NJI 4;  3FG1 A;  1KD1 4;  3MSO A;  2W6J H;  2E2U A;  3UL5 A;  3FSD A;  3FCS B;  8CHO A;  3DMC A;  4L7K A;  3N54 B;  3M8C A;  4STD A;  3NM2 A;  5KP3 A;  5AIF A;  1M1K 4;  2FNQ A;  3NQY A;  3D9R A;  2GBW B;  3HI7 A;  4L8P A;  2XRX B;  3A76 A;  5D82 A;  3EX9 A;  4FR9 A;  4AKZ A;  1GS3 A;  3GZR A;  2Z6B A;  3PZW A;  1JN5 A;  1JB2 A;  1GYB A;  2PZV A;  3DZL A;  4IPB A;  2Z7A A;  3LOY A;  3S5C A;  4QWT A;  4N6O B;  4K90 B;  1IU7 A;  1OCV A;  2CHC A;  3GZB A;  3EB8 A;  1J2B A;  2F86 B;  1IT7 A;  2UX0 A;  3MPH A;  4XDW A;  2CG0 A;  2L4V A;  3PCR A;  3DUK A;  3KE7 A;  1UUW B;  4MMX B;  1AR0 A;  1GD3 A;  2P38 A;  4LZI A;  2C10 A;  4R4K A;  1A2K A;  3STD A;  1IVV A;  1YIT 3;  1M90 4;  2HMO B;  3ECF A;  1Q42 A;  1EG9 B;  1TFO A;  2SBL A;  3V92 A;  3FKA A;  5D81 A;  3F14 A;  4JF8 A;  5JPP A;  1ZX2 A;  4O3V A;  1FGT A;  3KKG A;  4XBY A;  5ELU A;  4KFF A;  1YGE A;  1JRQ A;  3J7Y d;  3U1W A;  1W00 A;  2QIY A;  2ML5 A;  2CFK A;  3S67 A;  3DY5 A;  3OX9 A;  4EBG A;  4L8O A;  1KQS 2;  1VQ5 3;  3NBR A;  1BUQ A;  4FMD A;  3SVA A;  3F40 A;  3DM8 A;  3RGR A;  3I55 3;  5AIG A;  3K9M C;  2BMO B;  3SLU A;  1CYV A;  3EQQ B;  1OF5 B;  3N8B A;  1T5Y A;  3DGM A;  2V1L A;  2IUJ A;  1U5O A;  3H51 A;  5IG3 A;  1N8R 4;  1TUH A;  1M1X B;  1RRL A;  4XM4 A;  1A2V A;  2CFW A;  3B4P A;  1NB5 I;  4XBT A;  1S72 3;  4N6T A;  3X3Y A;  3SXX A;  1IK3 A;  5ELJ A;  5BVB A;  4BTX A;  3FH1 A;  2HML B;  4FMA A;  3CC7 3;  3OW2 2;  4MEI A;  2M7O A;  1TFK A;  1OHP A;  2P0M A;  2W04 A;  1JKG B;  3WDG B;  2STD A;  4HM2 B;  3CNM A;  3QRD A;  1GY5 A;  3NBB A;  2CFL A;  4I4K A;  5G2G A;  2W03 A;  3G6E 3;  1VQP 3;  2YFJ B;  2W9Q A;  1IVU A;  3I0Y A;  2YFL B;  3LTB A;  4R9L A;  4N6U A;  3DGL A;  3X40 A;  1VQL 3;  5AYR B;  1VQ7 3;  3PXM A;  4N6L A;  1IV7 A;  5TGN A;  1NB3 I;  2ZDJ A;  2ZL8 A;  1ROV A;  3WMD A;  4FMC A;  4RBN A;  2BMR B;  3FGY A;  1OGX A;  3VGN A;  2KXG A;  1EA2 A;  1W2Z A;  1Y4K A;  3FLJ A;  1E97 A;  1OH0 A;  1VQ4 3;  5AII A;  3LH4 A;  1OHS A;  5D83 A;  5IG4 A;  3FF0 A;  2CWV A;  4MMY B;  5JBS A;  4GL6 A;  1RJO A;  2CWU A;  1IDP A;  3MG3 A;  3CME 3;  4R9K A;  3GWR A;  3NHX A;  3EN8 A;  3GZY B;  5STD A;  3UJM A;  1HU9 A;  3S27 A;  1V74 A;  1VQ6 3;  1K41 A;  1FGR A;  2E2T A;  3LT8 A;  4FMB A;  4KVH A;  3NM7 A;  1O7G B;  1SPU A;  1SQW A;  1JV2 B;  1WMO A;  1E3R A;  4X2H A;  3JUP A;  1G96 A;  1DMQ A;  2CG1 A;  4CDL A;  3CPW 2;  1VQ8 3;  3E99 A;  3SED A;  2CIU A;  1RKY A;  1GY7 A;  4BTY A;  5IEN A;  3JUO A;  3PCS A;  4K1U A;  3K5T A;  1WQL B;  3HX8 A;  1OGZ A;  3CC2 3;  1JKG A;  3Q2P A;  1Q40 A;  3RDE A;  3CC4 3;  3GRD A;  5FW5 A;  1R4C A;  2K54 A;  1YI2 3;  3AMO A;  4RNZ A;  3PGB A;  3HIG A;  1JB4 A;  1O7N B;  3EBY A;  3O8Y A;  4TX4 A;  5IG5 A;  2CK3 H;  4HM4 B;  4U13 A;  3LXU X;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...