2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
3G713 1YHQ3 2OTL3 1VQL3 1W2B2 1YJW3 1NJI4 1Q7Y4 3OW22 1Q814 1QVG2 3CCM3 3CXC2 3CC23 1KC84 1N8R4 1K8A4 1YIT3 1Q864 3CCV3 3CC43 1JJ22 3CD63 3CME3 3CCU3 1VQ83 1YI23 1YIJ3 3I563 2OTJ3 1VQO3 3CCE3 3CCQ3 1M1K4 1VQ63 1YJN3 3G4S3 1K9M4 1VQK3 3G6E3 2QEX3 2QA43 1M904 1KQS2 3CCS3 1VQ43 1VQ53 3CPW2 3I553 1K734 1KD14 3CCJ3 1YJ93 1VQ73 3CC73 1VQ93 3CCR3 1VQM3 1S723 1VQP3 3CCL3 1Q824 1QVF2 1VQN3 3CMA3
chains in the Genus database with same CATH superfamily
1CEWI 4N6MA 3LOYA 4HM5B 1UUVB 5M18A 1YJW3 3OWYA 3LTBA 2AADA 5AEUB 2KF6A 2XSOB 1CYUA 4NHFA 4FMCA 4WWUC 1N8R4 3S67A 1B21A 1OHOA 1UDII 2R41A 1N5HA 1OHPA 1PFPA 3NV0A 4FCJA 2GU1A 3X3XA 1EQKA 1LOYA 2IUKA 1A90A 1VZZA 1EG9B 3OWSA 4WHAA 2SBLA 1O7HB 3DUKA 4K1VA 4HBRA 4MMYB 5EVHA 1IQYA 1A67A 5IEPA 3GSPA 1EKMA 1LXEA 3WA2X 1IQXA 5CF2A 3I553 2CK3H 1YJ93 1OACA 1OHSA 1PYLA 2A15A 4BTXA 2HMKB 5ELJA 4J8TA 1NNVA 1SARA 3SLUA 1G02A 3KKGA 2GXFA 3K9MC 2P38A 1GMQA 3GZYB 4HM2B 4N6NB 3T0UA 2H0IA 2Q07A 3DGYA 1YHQ3 3V92A 1Q7HA 1V74A 2LQVA 4KFEA 1BU4A 2OCTA 3CXC2 4L8OA 3HX8A 3PYJA 1BRIA 2SARA 1O7NB 2BHMA 1BSAA 5JPPA 1C54A 1ZX2A 4FMAA 2XRXB 1OPYA 4FMDA 1FYSA 2KAAA 4BIRA 3IJEB 2RFRA 1YVSA 5AIHA 1UCJA 4KFDA 3CCE3 1JB5A 1W2ZA 2FXTA 1YNVX 2RGQA 3M8CA 4N6LA 5AI1A 1D6YA 1PU4A 1JNQA 1B2MA 4GL6A 4CPKA 4MEIA 1DMMA 1FUWA 5KP1A 3SVAA 1FGQA 3HIGA 3X41A 3X40A 1UUGB 4R9LA 2P09A 3JUQA 4N6V0 3CU3A 2HMNB 1UGIA 1RTUA 1W00A 3KSED 3DGLA 2KCDA 3NM2A 1I2FA 3FSDA 1BNIA 4LYLB 4EC6A 3LTCA 5IG3A 1CH0A 4HZ9B 5M1AA 2D1WA 1WMPA 1QVG2 4ILFA 2B1XB 1N9EA 2KXGA 1ROAA 2L1SA 5IF6A 3NBBA 2H0GA 1BNSA 2CKFB 2HOHA 2CG1A 3LMLA 5IW9A 1W02A 1GY7A 3K63A 2ZHXB 1AVKA 3NUVA 4XB5A 1IU7A 3DGOA 3N8BA 1FGTA 1IT8A 1BNJA 1GSPA 1MWRA 4IPBA 1MWTA 2XH9A 1RDSA 4XBTA 1SIIA 4AKYA 3ECFA 3UL5A 3EX9A 2BU4A 3D9RA 3SX1A 4N6UA 4RNZA 1FUTA 2PNCA 1RGEA 3GZXB 5AIFA 3WHOA 1U5OA 1R4CA 1BRNL 2FNQA 3AHWA 1V58A 3L0RA 3WOFB 2Z6BA 1W01A 1YIT3 3KZTA 3ZG5A 3Q2PA 1SPUA 1T3BA 1TRPA 4GSPA 4BL3A 4BTWA 1WMOA 5BXQA 3JVCA 1GYBA 3PZWA 3KN4A 3V98A 3MG3A 4DKIA 4EV2A 1CYVA 4LMIA 1LOVA 1C7HA 5CF1A 1TU5A 2W03A 3N54B 4R1KA 2XF3A 1I2GA 3X3YA 1DVDA 5FGOA 8RNTA 3FGYA 9RNTA 1RNBA 1WMNA 1IVUA 3LT8A 5KP3A 4HVNA 4BTYA 1E3VA 4AKZA 5D81A 5KP4A 2R4IA 3G713 1Q42A 1AY7A 5AYSC 1STDA 3B8LA 3H3HA 4HJLB 2CW9A 1TFOA 1A2VA 5A0OB 1W6CA 3F14A 4N6OB 1RSNA 4HKVB 4HOHA 7GSPA 1V57A 2HMJB 3LH4A 4L8PA 3FH1A 3I563 1VQO3 1BSBA 2GU3A 2CFWA 2O3OA 5JPUA 1Z1SA 4H3UA 4FCMA 1KQS2 2V1LA 3AHSA 2BT3A 1BAOA 2WGQA 3B7CA 1G96A 3LTDA 1IK3A 1E3RA 4L7KA 3DGNA 1RGFA 1RGKA 2ML5A 1T2HA 5FW5A 2HMOB 3BNCA 2UGIA 3H51A 1B2XA 2RSXA 3AMOB 3T8UA 3B4OA 2Y73A 3JUOA 1VQL3 3E99A 2PZVA 3F7SA 4NREA 1Q814 2UX0A 3BLZA 1GY6A 3QRDA 1OH0A 3BB9A 3X3ZA 3EHCA 3PCRA 4GHOA 1UUWB 1J2BA 1LOWA 1I3FA 2YFIB 1IV7A 1HYFA 5EEOA 3LZAA 4RNYA 1QMAA 1A2PA 5AEWB 1JKGB 1NU3A 3EJVA 2BMQB 5DRVA 2CX1A 6STDA 4XDVA 1T2IA 1BNEA 1N5PA 1RN1A 2CG0A 1SQWA 3CMA3 1FGRA 1IVXA 2YX9A 3DXOA 1TUHA 1X1UA 3BU4A 1JN5A 3RDEA 2F5WA 4ORLA 4IIAA 3NM7A 1Q7Y4 5DREA 4X2OA 3OW22 3PGBA 3DY5A 1LNIA 2K3DA 3VF1A 3CC23 3Q3FA 1I3IA 1W4NA 1JKGA 1D6ZA 1B27A 1R4YA 1OUNA 3BNBA 3MYTA 5IENA 3DMCA 4ZM8A 5IG5A 4BL2A 4K1UA 4R9KA 2OOVA 4CJNA 1OF5B 4GB5A 1RGAA 3GZBA 2BNGA 3NX0A 4OUQA 4MMZB 2WOHA 1X1YA 3MG1A 4HM6B 1UI7A 5BU4A 5JBSA 1B2SA 5BIRA 2JQ5A 3SXXA 4QWTA 1FUSA 2WOFA 3D5GA 3STDA 3Q90A 2P0XA 2D42A 2YFLB 3IPTA 5CLKA 2XGLA 5GSPA 1KSIA 2FGTA 1BANA 4XDWA 3EC9A 3WDGB 1TRQA 3GWRA 1OF5A 3CCM3 3SOYA 1ZS7A 1Q864 4KZ1A 1JJ22 1ASKA 3EE1A 1BGSA 2GEYA 1O7MB 2B24B 2Y74A 1M904 2BMOB 1BUJA 1GD3A 3CPW2 1MNLA 3NQZA 1IVWA 1JN5B 7STDA 1SJWA 3CCR3 4J5GA 1VQM3 3EBTA 3HZPA 4O02B 1VQP3 2GSPA 4FMBA 1L5GB 1RGHA 1NB5I 2CFLA 1GMRA 4HM7B 4OK0A 1BRSA 4RNTA 1DMQA 2W9QA 1I70A 3AMOA 1BNFA 1FW7A 1MWUA 2YFJB 3O8YA 4H61A 3HK4A 3V99A 2Z77A 3F40A 1LOXA 2P05A 2F86B 1QALA 3FF0A 4WFOA 3CCV3 4J5KA 3CNMA 1ZO2A 2CH9A 3CD63 1JRQA 1GMPA 2OWPA 1RJOA 4LGQA 4LSOA 4XM4A 1YI23 3URPA 2OTJ3 3OX9A 1MOLA 1RGCA 2K0MA 5M19A 5AIIA 4HM4B 3G4S3 1SIHA 4LZIA 4LEHA 3UL6A 1NDOB 1W5ZA 5IERA 1RGLA 3G6E3 1KD14 1WTHA 3LYGA 5STDA 1OCVA 5RNTA 1TFKA 1VQ93 3DGMA 1BRHA 4N6TA 1YGWA 2ZDJA 4I5QA 4KFFA 4Q53A 4PEJA 4EW5A 2F56A 8CHOA 2IYJA 3ER7A 2ZA4A 2E2VA 2IMJA 3I0YA 1US1A 4R4KA 2OTL3 1MWSA 1W2B2 3UNLA 4O8SA 1GOYA 2CIUA 2L4VA 3MG2A 1AVLA 2K54A 4K90B 2P0MA 2QIYA 3BIRA 3CNXA 3VGNA 3T8NA 3CC43 2IUJA 5AYRB 3CME3 1HKXA 2BMRB 3JUNA 4XBYA 3FLJA 1O7WB 1RKYA 3CCU3 1ROVA 2GEXA 3PS8A 2MC8A 1W6YA 3FKAA 1N9JA 3HI7A 1YJN3 1TP6A 3PCSA 2QEX3 1BUQA 4K61A 3F9SA 1VQ53 5HOHA 4HYZA 3RGRA 5IG4A 2W9PA 3Q1CA 3BNEA 1W6GA 1JBTA 1W7CA 2OQEC 2KF5A 1I0VA 5TGNA 3X42A 1IYYA 3AGOA 3S5CA 1NJI4 2XGNA 3FG3A 1QJGA 4JRFA 1AV4A 1B2UA 1EA2A 1K8A4 1ZGXA 2RBIA 3EN1B 3FF2A 1BRJA 1RHLA 1MGWA 1B3SA 2C11A 2KF3A 2BO9B 2F99A 1IVVA 1RRHA 6RNTA 1BIRA 1BSEA 2I9WA 2E2UA 2W56A 3CCQ3 3CPOA 3IMAB 5I97A 3A5EA 4EBGA 1UCIA 3RGAA 2LYXA 1FZUA 2ZL8A 3CCS3 2M7OA 2H0HA 1ULIB 4O2HA 3MWZA 3F8XA 2JDIH 1FGOA 1GS3A 1O7PB 1Q9EA 1UI8A 1EUIC 3PXMA 3UJMA 3ZG0A 4CCVA 4G1MB 1RMSA 3ROBA 2OQEA 1G0TA 1S5AA 2UUGC 1E97A 1LVNA 3OXAA 1KC84 1TJDA 3K7CA 5CK6A 3WODG 3EF8A 1RN7A 2XFTA 1JB4A 2XFSA 1NB3I 1MGRA 1LRAA 1K28A 3WOEB 4RBNA 3GAXA 1I8VA 2W2CA 1ULJB 4HAAA 1K734 1JV2B 2W6JH 1BRGA 3LTAA 2HMLB 3NBJA 3G0KA 3CC73 3QK9A 2WO0A 4WP5A 3ZFZA 1QVF2 2QGUA 4MMXB 3HOHA 5G1KA 2XSHB 1K41A 4RZMA 3KIIA 2GBWB 1M9GA 4OVMA 2CWVA 5IEOA 2Z76A 4I4KA 3RNTA 3U1WA 3VSYA 3DZLA 1Q40A 2WGOA 3G16A 1U8CB 1GOUA 1JBRA 1GY5A 3FZWA 4X2HA 2XR8B 5AIGA 1JZOA 1EEJA 2INXA 3TDGA 2AAEA 4J9AA 1JZDA 3OWUA 3D79A 1UW1A 3LXUX 1RGGA 1OGXA 1RCKA 4WYKB 4FR9A 1WQLB 4TX4A 1DETA 1B20A 1GOVA 3BNDA 2CFGA 2MF7A 3MPHA 3EBYA 1F8NA 4AEQA 2QA43 4KT3B 3OV4A 4HM3B 2CHCA 3WR2A 1LQGC 2XEPA 1IV9A 2F98A 1S723 4IT7A 1Q824 3NQYA 1YVBI 2IY2A 1NWWA 1QAKA 3JUPA 1GD4A 4HZBB 2E2TA 1DVCA 1PY3A 1BNGA 1HZ1A 5G2GA 3NHXA 2GBXB 3AGNA 1WNHA 3N9HA 1UCLA 4HM8B 4EYCA 1JBSA 3A76A 3ALAA 2C4BA 2O9UX 1DYUA 3FG1A 1ISKA 2STDA 1UCKA 3F8HA 3MSOA 4HM1B 1VQ83 4U13A 1YIJ3 1IDPA 5IG0A 3KE7A 1OGZA 2CWTA 1VQ63 1STFI 1Y4KA 3K5TA 1RN4A 1N8QA 2RCDA 3U97A 2F5MA 1AR0A 1LNHA 5HGRA 1I2EA 3G8ZA 4KVHA 3WMDA 1B2ZA 3S29A 4EV5A 1FGMA 1Q40B 1BOXA 3NBRA 2CWUA 5D82A 1BVIA 2KRTA 3MKIA 5D83A 1A2KA 1YGEA 2CX0A 5CXOA 1T5YA 6GSPA 2F4YA 2W04A 3DM8A 5ELUA 3WA3A 1RNTA 1AQZA 1IT7A 2KF4A 5BVBA 1TTOA 2CC3A 3SYUA 4STDA 4R80A 1BSCA 1HU9A 1X1XA 1CQSA 1RLSA 2Z7AA 3EN8A 1BSDA 2BIRA 4CDLA 1BRKA 3S28A 1RRLA 4EXRA 4NPBA 1K9M4 1VQK3 1KWIA 1TIJA 3KCHA 1VQ43 3B4PA 3CCJ3 2W56B 2CFKA 3F7XA 1FA3A 3D3LA 3MHEA 2ML6A 3KSPA 4MJDA 4BU4A 3FG4A 3J7Yd 3CCL3 3GRDA 2W0QA 3LT9A 5LC6A 1DMNA 3EQQB 3KFQC 3FCSB 1RCLA 1JB2A 3HIIA 1IQ8A 3UB1A 1DE3A 2RNTA 1X1WA 2CFDA 3JUMA 3SOAA 7RNTA 2HMMB 4JF8A 3DH2A 2J8XB 4WYKA 1I0XA 4XBXA 3GZRA 3EB8A 4HM0B 4FCZA 1NO3A 5G1LA 5LC7A 5EQLA 2OOVC 1VQQA 3K0ZA 3D5IA 1M1XB 3NXJA 1O7GB 3NV0B 1BNRA 3SEDA 1UGHI 1VQ73 1D6UA 1LQMB 1VQN3 3S27A 4O3VA 1M1K4 1QAFA 3D4AA 4N3VA 2IA7A 2C10A
chains in the Genus database with same CATH topology
1CEWI 4N6MA 3LOYA 4HM5B 1UUVB 1YJW3 3OWYA 3LTBA 5AEUB 2XSOB 1CYUA 4NHFA 4FMCA 4WWUC 1N8R4 3S67A 1OHOA 1N5HA 1OHPA 1PFPA 3NV0A 4FCJA 2GU1A 3X3XA 1EQKA 2IUKA 1A90A 1VZZA 1EG9B 3OWSA 4WHAA 2SBLA 1O7HB 3DUKA 4K1VA 4HBRA 4MMYB 5EVHA 1IQYA 1A67A 5IEPA 1EKMA 1LXEA 3WA2X 1IQXA 5CF2A 3I553 2CK3H 1YJ93 1OACA 1OHSA 2A15A 4BTXA 2HMKB 5ELJA 4J8TA 3SLUA 3KKGA 4HM2B 2GXFA 3K9MC 2P38A 3GZYB 4N6NB 3T0UA 1YHQ3 2Q07A 3V92A 1V74A 2LQVA 4KFEA 2OCTA 3CXC2 4L8OA 3HX8A 3PYJA 1O7NB 2BHMA 5JPPA 1ZX2A 4FMAA 2XRXB 1OPYA 4FMDA 3IJEB 2RFRA 5AIHA 4KFDA 3CCE3 1JB5A 1W2ZA 2FXTA 2RGQA 3M8CA 1M1K4 4N6LA 5AI1A 1D6YA 1PU4A 1JNQA 4GL6A 4MEIA 1DMMA 1FUWA 5KP1A 3SVAA 1FGQA 3HIGA 3X41A 3X40A 4R9LA 2P09A 3JUQA 4N6V0 3CU3A 2HMNB 1W00A 3KSED 3DGLA 2KCDA 3NM2A 3FSDA 4EC6A 3LTCA 5IG3A 1QVG2 4HZ9B 2D1WA 1WMPA 2B1XB 1N9EA 2KXGA 1ROAA 5IF6A 3NBBA 2CKFB 2CG1A 3LMLA 5IW9A 1W02A 1GY7A 3K63A 1AVKA 3NUVA 4XB5A 1IU7A 3DGOA 3N8BA 1FGTA 1IT8A 4IPBA 2XH9A 4XBTA 1SIIA 4AKYA 3ECFA 3UL5A 3EX9A 3D9RA 3SX1A 4N6UA 4RNZA 2PNCA 3GZXB 5AIFA 1U5OA 1R4CA 2FNQA 3L0RA 3WOFB 2Z6BA 1W01A 1YIT3 3KZTA 3Q2PA 1SPUA 4BTWA 1WMOA 5BXQA 3JVCA 1GYBA 3PZWA 3KN4A 3V98A 3MG3A 5CF1A 4EV2A 1CYVA 4LMIA 1C7HA 1TU5A 2W03A 3N54B 4R1KA 2XF3A 3X3YA 1DVDA 5FGOA 3FGYA 1WMNA 1IVUA 3LT8A 5KP3A 4HVNA 4BTYA 1E3VA 4AKZA 5D81A 5KP4A 2R4IA 3G713 1Q42A 5AYSC 1STDA 3B8LA 3H3HA 4HJLB 2CW9A 1TFOA 1A2VA 5A0OB 1W6CA 3F14A 4N6OB 4HKVB 2HMJB 3LH4A 4L8PA 3FH1A 3I563 1VQO3 2GU3A 2CFWA 2O3OA 5JPUA 1Z1SA 4H3UA 4FCMA 1KQS2 2V1LA 2BT3A 2WGQA 3B7CA 1IK3A 1G96A 3LTDA 1E3RA 4L7KA 3DGNA 5FW5A 2ML5A 2HMOB 3BNCA 3H51A 2RSXA 3AMOB 3T8UA 3B4OA 2Y73A 3JUOA 1VQL3 3E99A 2PZVA 3F7SA 4NREA 1Q814 2UX0A 3BLZA 1GY6A 3QRDA 1OH0A 3BB9A 3X3ZA 3EHCA 3PCRA 1UUWB 1J2BA 2YFIB 1IV7A 5EEOA 3LZAA 4RNYA 1QMAA 5AEWB 1JKGB 1NU3A 3EJVA 2BMQB 5DRVA 6STDA 4XDVA 1N5PA 2CG0A 3CMA3 1SQWA 1FGRA 3DXOA 1IVXA 2YX9A 1TUHA 3RDEA 1JN5A 4ORLA 4IIAA 3NM7A 1Q7Y4 5DREA 4X2OA 3OW22 3PGBA 3DY5A 3VF1A 3CC23 1W4NA 1JKGA 1D6ZA 1OUNA 3BNBA 3MYTA 5IENA 3DMCA 5IG5A 4K1UA 4R9KA 2OOVA 1OF5B 4GB5A 3GZBA 2BNGA 3NX0A 4OUQA 4MMZB 2WOHA 3MG1A 4HM6B 1UI7A 5JBSA 2JQ5A 3SXXA 4QWTA 2WOFA 3STDA 3Q90A 2P0XA 2D42A 2YFLB 3IPTA 5CLKA 2XGLA 1KSIA 2FGTA 4XDWA 3EC9A 3WDGB 3GWRA 1OF5A 3CCM3 3SOYA 1Q864 4KZ1A 1JJ22 1ASKA 3EE1A 2GEYA 1O7MB 2B24B 2Y74A 1M904 2BMOB 1GD3A 3CPW2 1MNLA 3NQZA 1IVWA 1JN5B 7STDA 1SJWA 3CCR3 1VQM3 1VQP3 3EBTA 3HZPA 4O02B 4FMBA 1L5GB 1NB5I 2CFLA 4HM7B 4OK0A 1DMQA 2W9QA 3AMOA 2YFJB 3O8YA 4H61A 3HK4A 3V99A 2Z77A 3F40A 1LOXA 2P05A 2F86B 1QALA 3FF0A 4WFOA 3CCV3 3CNMA 1ZO2A 2CH9A 3CD63 1JRQA 2OWPA 4LGQA 1RJOA 4LSOA 4XM4A 1YI23 2OTJ3 3OX9A 1MOLA 2K0MA 5AIIA 4HM4B 3G4S3 1SIHA 4LZIA 4LEHA 3UL6A 1NDOB 1W5ZA 5IERA 3G6E3 1KD14 1WTHA 3LYGA 5STDA 1OCVA 1VQ93 1TFKA 3DGMA 4N6TA 4Q53A 2ZDJA 4KFFA 4PEJA 8CHOA 3ER7A 2E2VA 2IMJA 3I0YA 1US1A 4R4KA 2OTL3 1W2B2 3UNLA 4O8SA 2CIUA 2L4VA 3MG2A 1AVLA 2K54A 4K90B 2P0MA 2QIYA 3CNXA 3VGNA 3T8NA 3CC43 2IUJA 5AYRB 3CME3 1HKXA 2BMRB 3JUNA 4XBYA 3FLJA 1O7WB 1RKYA 3CCU3 1ROVA 2GEXA 3PS8A 2MC8A 1W6YA 3FKAA 1N9JA 3HI7A 1YJN3 1TP6A 3PCSA 2QEX3 1BUQA 4K61A 3F9SA 1VQ53 4HYZA 3RGRA 5IG4A 2W9PA 3Q1CA 3BNEA 1W6GA 1W7CA 2OQEC 5TGNA 3X42A 3S5CA 1NJI4 2XGNA 3FG3A 1QJGA 4JRFA 1AV4A 1EA2A 1K8A4 3FF2A 3EN1B 2C11A 2BO9B 2F99A 1IVVA 1RRHA 2I9WA 2E2UA 2W56A 3CCQ3 3CPOA 3IMAB 5I97A 4EBGA 3RGAA 2LYXA 2ZL8A 3CCS3 2M7OA 1ULIB 4O2HA 3MWZA 3F8XA 2JDIH 1FGOA 1GS3A 1O7PB 1UI8A 3PXMA 3UJMA 4CCVA 4G1MB 3ROBA 2OQEA 1S5AA 1E97A 1LVNA 3OXAA 1KC84 3K7CA 5CK6A 3WODG 3EF8A 1RN7A 2XFTA 1JB4A 2XFSA 1NB3I 1K28A 3WOEB 4RBNA 3GAXA 2W2CA 1ULJB 1K734 1JV2B 2W6JH 3LTAA 3NBJA 2HMLB 3G0KA 3CC73 3QK9A 2WO0A 4WP5A 1QVF2 2QGUA 4MMXB 2XSHB 1K41A 4RZMA 3KIIA 2GBWB 1M9GA 4OVMA 2CWVA 5IEOA 2Z76A 4I4KA 3U1WA 3VSYA 4ZM8A 3DZLA 1Q40A 2WGOA 3G16A 1U8CB 1GY5A 3FZWA 4X2HA 2XR8B 5AIGA 2INXA 3TDGA 4J9AA 3OWUA 1UW1A 3LXUX 4WYKB 1OGXA 4FR9A 1WQLB 4TX4A 3BNDA 2CFGA 2MF7A 3MPHA 3EBYA 1F8NA 4AEQA 2QA43 3OV4A 4HM3B 2CHCA 2XEPA 1IV9A 2F98A 1S723 4IT7A 1Q824 3NQYA 1YVBI 1NWWA 1QAKA 3JUPA 1GD4A 4HZBB 1DVCA 2E2TA 5G2GA 3NHXA 2GBXB 1WNHA 3N9HA 4HM8B 4EYCA 3A76A 3ALAA 2O9UX 1DYUA 3FG1A 1ISKA 2STDA 3F8HA 3MSOA 4HM1B 1VQ83 4U13A 1YIJ3 1IDPA 5IG0A 3KE7A 1OGZA 2CWTA 1VQ63 1STFI 1Y4KA 3K5TA 1N8QA 2RCDA 3U97A 1AR0A 1LNHA 5HGRA 3G8ZA 4KVHA 3WMDA 3S29A 4EV5A 1FGMA 1Q40B 5D82A 3NBRA 2CWUA 2KRTA 3MKIA 5D83A 1A2KA 1YGEA 3WA3A 5CXOA 1T5YA 5ELUA 2W04A 3DM8A 1IT7A 5BVBA 2CC3A 4STDA 4R80A 1HU9A 1CQSA 2Z7AA 3EN8A 4CDLA 4EXRA 3S28A 1RRLA 1K9M4 1VQK3 1KWIA 1TIJA 1VQ43 3B4PA 3CCJ3 2W56B 2CFKA 3F7XA 1FA3A 3D3LA 3MHEA 2ML6A 3KSPA 4MJDA 3J7Yd 3FG4A 3CCL3 3GRDA 2W0QA 3LT9A 5LC6A 1DMNA 3EQQB 3KFQC 3FCSB 3UB1A 1JB2A 3HIIA 1IQ8A 2CFDA 3JUMA 3SOAA 2HMMB 4JF8A 4WYKA 4XBXA 3GZRA 3EB8A 4HM0B 4FCZA 1NO3A 5LC7A 5EQLA 2OOVC 3K0ZA 1M1XB 3NXJA 1O7GB 3NV0B 3SEDA 1VQ73 1D6UA 1VQN3 3S27A 4O3VA 1QAFA 4N3VA 2IA7A 2C10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 3;  1YHQ 3;  2OTL 3;  1VQL 3;  1W2B 2;  1YJW 3;  1NJI 4;  1Q7Y 4;  3OW2 2;  1Q81 4;  1QVG 2;  3CCM 3;  3CXC 2;  3CC2 3;  1KC8 4;  1N8R 4;  1K8A 4;  1YIT 3;  1Q86 4;  3CCV 3;  3CC4 3;  1JJ2 2;  3CD6 3;  3CME 3;  3CCU 3;  1VQ8 3;  1YI2 3;  1YIJ 3;  3I56 3;  2OTJ 3;  1VQO 3;  3CCE 3;  3CCQ 3;  1M1K 4;  1VQ6 3;  1YJN 3;  3G4S 3;  1K9M 4;  1VQK 3;  3G6E 3;  2QEX 3;  2QA4 3;  1M90 4;  1KQS 2;  3CCS 3;  1VQ4 3;  1VQ5 3;  3CPW 2;  3I55 3;  1K73 4;  1KD1 4;  3CCJ 3;  1YJ9 3;  1VQ7 3;  3CC7 3;  1VQ9 3;  3CCR 3;  1VQM 3;  1S72 3;  1VQP 3;  3CCL 3;  1Q82 4;  1QVF 2;  1VQN 3;  3CMA 3; 
#chains in the Genus database with same CATH topology
 1CEW I;  4N6M A;  3LOY A;  4HM5 B;  1UUV B;  5M18 A;  1YJW 3;  3OWY A;  3LTB A;  2AAD A;  5AEU B;  2KF6 A;  2XSO B;  1CYU A;  4NHF A;  4FMC A;  4WWU C;  1N8R 4;  3S67 A;  1B21 A;  1OHO A;  1UDI I;  2R41 A;  1N5H A;  1OHP A;  1PFP A;  3NV0 A;  4FCJ A;  2GU1 A;  3X3X A;  1EQK A;  1LOY A;  2IUK A;  1A90 A;  1VZZ A;  1EG9 B;  3OWS A;  4WHA A;  2SBL A;  1O7H B;  3DUK A;  4K1V A;  4HBR A;  4MMY B;  5EVH A;  1IQY A;  1A67 A;  5IEP A;  3GSP A;  1EKM A;  1LXE A;  3WA2 X;  1IQX A;  5CF2 A;  3I55 3;  2CK3 H;  1YJ9 3;  1OAC A;  1OHS A;  1PYL A;  2A15 A;  4BTX A;  2HMK B;  5ELJ A;  4J8T A;  1NNV A;  1SAR A;  3SLU A;  1G02 A;  3KKG A;  2GXF A;  3K9M C;  2P38 A;  1GMQ A;  3GZY B;  4HM2 B;  4N6N B;  3T0U A;  2H0I A;  2Q07 A;  3DGY A;  1YHQ 3;  3V92 A;  1Q7H A;  1V74 A;  2LQV A;  4KFE A;  1BU4 A;  2OCT A;  3CXC 2;  4L8O A;  3HX8 A;  3PYJ A;  1BRI A;  2SAR A;  1O7N B;  2BHM A;  1BSA A;  5JPP A;  1C54 A;  1ZX2 A;  4FMA A;  2XRX B;  1OPY A;  4FMD A;  1FYS A;  2KAA A;  4BIR A;  3IJE B;  2RFR A;  1YVS A;  5AIH A;  1UCJ A;  4KFD A;  3CCE 3;  1JB5 A;  1W2Z A;  2FXT A;  1YNV X;  2RGQ A;  3M8C A;  4N6L A;  5AI1 A;  1D6Y A;  1PU4 A;  1JNQ A;  1B2M A;  4GL6 A;  4CPK A;  4MEI A;  1DMM A;  1FUW A;  5KP1 A;  3SVA A;  1FGQ A;  3HIG A;  3X41 A;  3X40 A;  1UUG B;  4R9L A;  2P09 A;  3JUQ A;  4N6V 0;  3CU3 A;  2HMN B;  1UGI A;  1RTU A;  1W00 A;  3KSE D;  3DGL A;  2KCD A;  3NM2 A;  1I2F A;  3FSD A;  1BNI A;  4LYL B;  4EC6 A;  3LTC A;  5IG3 A;  1CH0 A;  4HZ9 B;  5M1A A;  2D1W A;  1WMP A;  1QVG 2;  4ILF A;  2B1X B;  1N9E A;  2KXG A;  1ROA A;  2L1S A;  5IF6 A;  3NBB A;  2H0G A;  1BNS A;  2CKF B;  2HOH A;  2CG1 A;  3LML A;  5IW9 A;  1W02 A;  1GY7 A;  3K63 A;  2ZHX B;  1AVK A;  3NUV A;  4XB5 A;  1IU7 A;  3DGO A;  3N8B A;  1FGT A;  1IT8 A;  1BNJ A;  1GSP A;  1MWR A;  4IPB A;  1MWT A;  2XH9 A;  1RDS A;  4XBT A;  1SII A;  4AKY A;  3ECF A;  3UL5 A;  3EX9 A;  2BU4 A;  3D9R A;  3SX1 A;  4N6U A;  4RNZ A;  1FUT A;  2PNC A;  1RGE A;  3GZX B;  5AIF A;  3WHO A;  1U5O A;  1R4C A;  1BRN L;  2FNQ A;  3AHW A;  1V58 A;  3L0R A;  3WOF B;  2Z6B A;  1W01 A;  1YIT 3;  3KZT A;  3ZG5 A;  3Q2P A;  1SPU A;  1T3B A;  1TRP A;  4GSP A;  4BL3 A;  4BTW A;  1WMO A;  5BXQ A;  3JVC A;  1GYB A;  3PZW A;  3KN4 A;  3V98 A;  3MG3 A;  4DKI A;  4EV2 A;  1CYV A;  4LMI A;  1LOV A;  1C7H A;  5CF1 A;  1TU5 A;  2W03 A;  3N54 B;  4R1K A;  2XF3 A;  1I2G A;  3X3Y A;  1DVD A;  5FGO A;  8RNT A;  3FGY A;  9RNT A;  1RNB A;  1WMN A;  1IVU A;  3LT8 A;  5KP3 A;  4HVN A;  4BTY A;  1E3V A;  4AKZ A;  5D81 A;  5KP4 A;  2R4I A;  3G71 3;  1Q42 A;  1AY7 A;  5AYS C;  1STD A;  3B8L A;  3H3H A;  4HJL B;  2CW9 A;  1TFO A;  1A2V A;  5A0O B;  1W6C A;  3F14 A;  4N6O B;  1RSN A;  4HKV B;  4HOH A;  7GSP A;  1V57 A;  2HMJ B;  3LH4 A;  4L8P A;  3FH1 A;  3I56 3;  1VQO 3;  1BSB A;  2GU3 A;  2CFW A;  2O3O A;  5JPU A;  1Z1S A;  4H3U A;  4FCM A;  1KQS 2;  2V1L A;  3AHS A;  2BT3 A;  1BAO A;  2WGQ A;  3B7C A;  1G96 A;  3LTD A;  1IK3 A;  1E3R A;  4L7K A;  3DGN A;  1RGF A;  1RGK A;  2ML5 A;  1T2H A;  5FW5 A;  2HMO B;  3BNC A;  2UGI A;  3H51 A;  1B2X A;  2RSX A;  3AMO B;  3T8U A;  3B4O A;  2Y73 A;  3JUO A;  1VQL 3;  3E99 A;  2PZV A;  3F7S A;  4NRE A;  1Q81 4;  2UX0 A;  3BLZ A;  1GY6 A;  3QRD A;  1OH0 A;  3BB9 A;  3X3Z A;  3EHC A;  3PCR A;  4GHO A;  1UUW B;  1J2B A;  1LOW A;  1I3F A;  2YFI B;  1IV7 A;  1HYF A;  5EEO A;  3LZA A;  4RNY A;  1QMA A;  1A2P A;  5AEW B;  1JKG B;  1NU3 A;  3EJV A;  2BMQ B;  5DRV A;  2CX1 A;  6STD A;  4XDV A;  1T2I A;  1BNE A;  1N5P A;  1RN1 A;  2CG0 A;  1SQW A;  3CMA 3;  1FGR A;  1IVX A;  2YX9 A;  3DXO A;  1TUH A;  1X1U A;  3BU4 A;  1JN5 A;  3RDE A;  2F5W A;  4ORL A;  4IIA A;  3NM7 A;  1Q7Y 4;  5DRE A;  4X2O A;  3OW2 2;  3PGB A;  3DY5 A;  1LNI A;  2K3D A;  3VF1 A;  3CC2 3;  3Q3F A;  1I3I A;  1W4N A;  1JKG A;  1D6Z A;  1B27 A;  1R4Y A;  1OUN A;  3BNB A;  3MYT A;  5IEN A;  3DMC A;  4ZM8 A;  5IG5 A;  4BL2 A;  4K1U A;  4R9K A;  2OOV A;  4CJN A;  1OF5 B;  4GB5 A;  1RGA A;  3GZB A;  2BNG A;  3NX0 A;  4OUQ A;  4MMZ B;  2WOH A;  1X1Y A;  3MG1 A;  4HM6 B;  1UI7 A;  5BU4 A;  5JBS A;  1B2S A;  5BIR A;  2JQ5 A;  3SXX A;  4QWT A;  1FUS A;  2WOF A;  3D5G A;  3STD A;  3Q90 A;  2P0X A;  2D42 A;  2YFL B;  3IPT A;  5CLK A;  2XGL A;  5GSP A;  1KSI A;  2FGT A;  1BAN A;  4XDW A;  3EC9 A;  3WDG B;  1TRQ A;  3GWR A;  1OF5 A;  3CCM 3;  3SOY A;  1ZS7 A;  1Q86 4;  4KZ1 A;  1JJ2 2;  1ASK A;  3EE1 A;  1BGS A;  2GEY A;  1O7M B;  2B24 B;  2Y74 A;  1M90 4;  2BMO B;  1BUJ A;  1GD3 A;  3CPW 2;  1MNL A;  3NQZ A;  1IVW A;  1JN5 B;  7STD A;  1SJW A;  3CCR 3;  4J5G A;  1VQM 3;  3EBT A;  3HZP A;  4O02 B;  1VQP 3;  2GSP A;  4FMB A;  1L5G B;  1RGH A;  1NB5 I;  2CFL A;  1GMR A;  4HM7 B;  4OK0 A;  1BRS A;  4RNT A;  1DMQ A;  2W9Q A;  1I70 A;  3AMO A;  1BNF A;  1FW7 A;  1MWU A;  2YFJ B;  3O8Y A;  4H61 A;  3HK4 A;  3V99 A;  2Z77 A;  3F40 A;  1LOX A;  2P05 A;  2F86 B;  1QAL A;  3FF0 A;  4WFO A;  3CCV 3;  4J5K A;  3CNM A;  1ZO2 A;  2CH9 A;  3CD6 3;  1JRQ A;  1GMP A;  2OWP A;  1RJO A;  4LGQ A;  4LSO A;  4XM4 A;  1YI2 3;  3URP A;  2OTJ 3;  3OX9 A;  1MOL A;  1RGC A;  2K0M A;  5M19 A;  5AII A;  4HM4 B;  3G4S 3;  1SIH A;  4LZI A;  4LEH A;  3UL6 A;  1NDO B;  1W5Z A;  5IER A;  1RGL A;  3G6E 3;  1KD1 4;  1WTH A;  3LYG A;  5STD A;  1OCV A;  5RNT A;  1TFK A;  1VQ9 3;  3DGM A;  1BRH A;  4N6T A;  1YGW A;  2ZDJ A;  4I5Q A;  4KFF A;  4Q53 A;  4PEJ A;  4EW5 A;  2F56 A;  8CHO A;  2IYJ A;  3ER7 A;  2ZA4 A;  2E2V A;  2IMJ A;  3I0Y A;  1US1 A;  4R4K A;  2OTL 3;  1MWS A;  1W2B 2;  3UNL A;  4O8S A;  1GOY A;  2CIU A;  2L4V A;  3MG2 A;  1AVL A;  2K54 A;  4K90 B;  2P0M A;  2QIY A;  3BIR A;  3CNX A;  3VGN A;  3T8N A;  3CC4 3;  2IUJ A;  5AYR B;  3CME 3;  1HKX A;  2BMR B;  3JUN A;  4XBY A;  3FLJ A;  1O7W B;  1RKY A;  3CCU 3;  1ROV A;  2GEX A;  3PS8 A;  2MC8 A;  1W6Y A;  3FKA A;  1N9J A;  3HI7 A;  1YJN 3;  1TP6 A;  3PCS A;  2QEX 3;  1BUQ A;  4K61 A;  3F9S A;  1VQ5 3;  5HOH A;  4HYZ A;  3RGR A;  5IG4 A;  2W9P A;  3Q1C A;  3BNE A;  1W6G A;  1JBT A;  1W7C A;  2OQE C;  2KF5 A;  1I0V A;  5TGN A;  3X42 A;  1IYY A;  3AGO A;  3S5C A;  1NJI 4;  2XGN A;  3FG3 A;  1QJG A;  4JRF A;  1AV4 A;  1B2U A;  1EA2 A;  1K8A 4;  1ZGX A;  2RBI A;  3EN1 B;  3FF2 A;  1BRJ A;  1RHL A;  1MGW A;  1B3S A;  2C11 A;  2KF3 A;  2BO9 B;  2F99 A;  1IVV A;  1RRH A;  6RNT A;  1BIR A;  1BSE A;  2I9W A;  2E2U A;  2W56 A;  3CCQ 3;  3CPO A;  3IMA B;  5I97 A;  3A5E A;  4EBG A;  1UCI A;  3RGA A;  2LYX A;  1FZU A;  2ZL8 A;  3CCS 3;  2M7O A;  2H0H A;  1ULI B;  4O2H A;  3MWZ A;  3F8X A;  2JDI H;  1FGO A;  1GS3 A;  1O7P B;  1Q9E A;  1UI8 A;  1EUI C;  3PXM A;  3UJM A;  3ZG0 A;  4CCV A;  4G1M B;  1RMS A;  3ROB A;  2OQE A;  1G0T A;  1S5A A;  2UUG C;  1E97 A;  1LVN A;  3OXA A;  1KC8 4;  1TJD A;  3K7C A;  5CK6 A;  3WOD G;  3EF8 A;  1RN7 A;  2XFT A;  1JB4 A;  2XFS A;  1NB3 I;  1MGR A;  1LRA A;  1K28 A;  3WOE B;  4RBN A;  3GAX A;  1I8V A;  2W2C A;  1ULJ B;  4HAA A;  1K73 4;  1JV2 B;  2W6J H;  1BRG A;  3LTA A;  2HML B;  3NBJ A;  3G0K A;  3CC7 3;  3QK9 A;  2WO0 A;  4WP5 A;  3ZFZ A;  1QVF 2;  2QGU A;  4MMX B;  3HOH A;  5G1K A;  2XSH B;  1K41 A;  4RZM A;  3KII A;  2GBW B;  1M9G A;  4OVM A;  2CWV A;  5IEO A;  2Z76 A;  4I4K A;  3RNT A;  3U1W A;  3VSY A;  3DZL A;  1Q40 A;  2WGO A;  3G16 A;  1U8C B;  1GOU A;  1JBR A;  1GY5 A;  3FZW A;  4X2H A;  2XR8 B;  5AIG A;  1JZO A;  1EEJ A;  2INX A;  3TDG A;  2AAE A;  4J9A A;  1JZD A;  3OWU A;  3D79 A;  1UW1 A;  3LXU X;  1RGG A;  1OGX A;  1RCK A;  4WYK B;  4FR9 A;  1WQL B;  4TX4 A;  1DET A;  1B20 A;  1GOV A;  3BND A;  2CFG A;  2MF7 A;  3MPH A;  3EBY A;  1F8N A;  4AEQ A;  2QA4 3;  4KT3 B;  3OV4 A;  4HM3 B;  2CHC A;  3WR2 A;  1LQG C;  2XEP A;  1IV9 A;  2F98 A;  1S72 3;  4IT7 A;  1Q82 4;  3NQY A;  1YVB I;  2IY2 A;  1NWW A;  1QAK A;  3JUP A;  1GD4 A;  4HZB B;  2E2T A;  1DVC A;  1PY3 A;  1BNG A;  1HZ1 A;  5G2G A;  3NHX A;  2GBX B;  3AGN A;  1WNH A;  3N9H A;  1UCL A;  4HM8 B;  4EYC A;  1JBS A;  3A76 A;  3ALA A;  2C4B A;  2O9U X;  1DYU A;  3FG1 A;  1ISK A;  2STD A;  1UCK A;  3F8H A;  3MSO A;  4HM1 B;  1VQ8 3;  4U13 A;  1YIJ 3;  1IDP A;  5IG0 A;  3KE7 A;  1OGZ A;  2CWT A;  1VQ6 3;  1STF I;  1Y4K A;  3K5T A;  1RN4 A;  1N8Q A;  2RCD A;  3U97 A;  2F5M A;  1AR0 A;  1LNH A;  5HGR A;  1I2E A;  3G8Z A;  4KVH A;  3WMD A;  1B2Z A;  3S29 A;  4EV5 A;  1FGM A;  1Q40 B;  1BOX A;  3NBR A;  2CWU A;  5D82 A;  1BVI A;  2KRT A;  3MKI A;  5D83 A;  1A2K A;  1YGE A;  2CX0 A;  5CXO A;  1T5Y A;  6GSP A;  2F4Y A;  2W04 A;  3DM8 A;  5ELU A;  3WA3 A;  1RNT A;  1AQZ A;  1IT7 A;  2KF4 A;  5BVB A;  1TTO A;  2CC3 A;  3SYU A;  4STD A;  4R80 A;  1BSC A;  1HU9 A;  1X1X A;  1CQS A;  1RLS A;  2Z7A A;  3EN8 A;  1BSD A;  2BIR A;  4CDL A;  1BRK A;  3S28 A;  1RRL A;  4EXR A;  4NPB A;  1K9M 4;  1VQK 3;  1KWI A;  1TIJ A;  3KCH A;  1VQ4 3;  3B4P A;  3CCJ 3;  2W56 B;  2CFK A;  3F7X A;  1FA3 A;  3D3L A;  3MHE A;  2ML6 A;  3KSP A;  4MJD A;  4BU4 A;  3FG4 A;  3J7Y d;  3CCL 3;  3GRD A;  2W0Q A;  3LT9 A;  5LC6 A;  1DMN A;  3EQQ B;  3KFQ C;  3FCS B;  1RCL A;  1JB2 A;  3HII A;  1IQ8 A;  3UB1 A;  1DE3 A;  2RNT A;  1X1W A;  2CFD A;  3JUM A;  3SOA A;  7RNT A;  2HMM B;  4JF8 A;  3DH2 A;  2J8X B;  4WYK A;  1I0X A;  4XBX A;  3GZR A;  3EB8 A;  4HM0 B;  4FCZ A;  1NO3 A;  5G1L A;  5LC7 A;  5EQL A;  2OOV C;  1VQQ A;  3K0Z A;  3D5I A;  1M1X B;  3NXJ A;  1O7G B;  3NV0 B;  1BNR A;  3SED A;  1UGH I;  1VQ7 3;  1D6U A;  1LQM B;  1VQN 3;  3S27 A;  4O3V A;  1M1K 4;  1QAF A;  3D4A A;  4N3V A;  2IA7 A;  2C10 A; 
#chains in the Genus database with same CATH homology
 1CEW I;  4N6M A;  3LOY A;  4HM5 B;  1UUV B;  1YJW 3;  3OWY A;  3LTB A;  5AEU B;  2XSO B;  1CYU A;  4NHF A;  4FMC A;  4WWU C;  1N8R 4;  3S67 A;  1OHO A;  1N5H A;  1OHP A;  1PFP A;  3NV0 A;  4FCJ A;  2GU1 A;  3X3X A;  1EQK A;  2IUK A;  1A90 A;  1VZZ A;  1EG9 B;  3OWS A;  4WHA A;  2SBL A;  1O7H B;  3DUK A;  4K1V A;  4HBR A;  4MMY B;  5EVH A;  1IQY A;  1A67 A;  5IEP A;  1EKM A;  1LXE A;  3WA2 X;  1IQX A;  5CF2 A;  3I55 3;  2CK3 H;  1YJ9 3;  1OAC A;  1OHS A;  2A15 A;  4BTX A;  2HMK B;  5ELJ A;  4J8T A;  3SLU A;  3KKG A;  4HM2 B;  2GXF A;  3K9M C;  2P38 A;  3GZY B;  4N6N B;  3T0U A;  1YHQ 3;  2Q07 A;  3V92 A;  1V74 A;  2LQV A;  4KFE A;  2OCT A;  3CXC 2;  4L8O A;  3HX8 A;  3PYJ A;  1O7N B;  2BHM A;  5JPP A;  1ZX2 A;  4FMA A;  2XRX B;  1OPY A;  4FMD A;  3IJE B;  2RFR A;  5AIH A;  4KFD A;  3CCE 3;  1JB5 A;  1W2Z A;  2FXT A;  2RGQ A;  3M8C A;  1M1K 4;  4N6L A;  5AI1 A;  1D6Y A;  1PU4 A;  1JNQ A;  4GL6 A;  4MEI A;  1DMM A;  1FUW A;  5KP1 A;  3SVA A;  1FGQ A;  3HIG A;  3X41 A;  3X40 A;  4R9L A;  2P09 A;  3JUQ A;  4N6V 0;  3CU3 A;  2HMN B;  1W00 A;  3KSE D;  3DGL A;  2KCD A;  3NM2 A;  3FSD A;  4EC6 A;  3LTC A;  5IG3 A;  1QVG 2;  4HZ9 B;  2D1W A;  1WMP A;  2B1X B;  1N9E A;  2KXG A;  1ROA A;  5IF6 A;  3NBB A;  2CKF B;  2CG1 A;  3LML A;  5IW9 A;  1W02 A;  1GY7 A;  3K63 A;  1AVK A;  3NUV A;  4XB5 A;  1IU7 A;  3DGO A;  3N8B A;  1FGT A;  1IT8 A;  4IPB A;  2XH9 A;  4XBT A;  1SII A;  4AKY A;  3ECF A;  3UL5 A;  3EX9 A;  3D9R A;  3SX1 A;  4N6U A;  4RNZ A;  2PNC A;  3GZX B;  5AIF A;  1U5O A;  1R4C A;  2FNQ A;  3L0R A;  3WOF B;  2Z6B A;  1W01 A;  1YIT 3;  3KZT A;  3Q2P A;  1SPU A;  4BTW A;  1WMO A;  5BXQ A;  3JVC A;  1GYB A;  3PZW A;  3KN4 A;  3V98 A;  3MG3 A;  5CF1 A;  4EV2 A;  1CYV A;  4LMI A;  1C7H A;  1TU5 A;  2W03 A;  3N54 B;  4R1K A;  2XF3 A;  3X3Y A;  1DVD A;  5FGO A;  3FGY A;  1WMN A;  1IVU A;  3LT8 A;  5KP3 A;  4HVN A;  4BTY A;  1E3V A;  4AKZ A;  5D81 A;  5KP4 A;  2R4I A;  3G71 3;  1Q42 A;  5AYS C;  1STD A;  3B8L A;  3H3H A;  4HJL B;  2CW9 A;  1TFO A;  1A2V A;  5A0O B;  1W6C A;  3F14 A;  4N6O B;  4HKV B;  2HMJ B;  3LH4 A;  4L8P A;  3FH1 A;  3I56 3;  1VQO 3;  2GU3 A;  2CFW A;  2O3O A;  5JPU A;  1Z1S A;  4H3U A;  4FCM A;  1KQS 2;  2V1L A;  2BT3 A;  2WGQ A;  3B7C A;  1IK3 A;  1G96 A;  3LTD A;  1E3R A;  4L7K A;  3DGN A;  5FW5 A;  2ML5 A;  2HMO B;  3BNC A;  3H51 A;  2RSX A;  3AMO B;  3T8U A;  3B4O A;  2Y73 A;  3JUO A;  1VQL 3;  3E99 A;  2PZV A;  3F7S A;  4NRE A;  1Q81 4;  2UX0 A;  3BLZ A;  1GY6 A;  3QRD A;  1OH0 A;  3BB9 A;  3X3Z A;  3EHC A;  3PCR A;  1UUW B;  1J2B A;  2YFI B;  1IV7 A;  5EEO A;  3LZA A;  4RNY A;  1QMA A;  5AEW B;  1JKG B;  1NU3 A;  3EJV A;  2BMQ B;  5DRV A;  6STD A;  4XDV A;  1N5P A;  2CG0 A;  3CMA 3;  1SQW A;  1FGR A;  3DXO A;  1IVX A;  2YX9 A;  1TUH A;  3RDE A;  1JN5 A;  4ORL A;  4IIA A;  3NM7 A;  1Q7Y 4;  5DRE A;  4X2O A;  3OW2 2;  3PGB A;  3DY5 A;  3VF1 A;  3CC2 3;  1W4N A;  1JKG A;  1D6Z A;  1OUN A;  3BNB A;  3MYT A;  5IEN A;  3DMC A;  5IG5 A;  4K1U A;  4R9K A;  2OOV A;  1OF5 B;  4GB5 A;  3GZB A;  2BNG A;  3NX0 A;  4OUQ A;  4MMZ B;  2WOH A;  3MG1 A;  4HM6 B;  1UI7 A;  5JBS A;  2JQ5 A;  3SXX A;  4QWT A;  2WOF A;  3STD A;  3Q90 A;  2P0X A;  2D42 A;  2YFL B;  3IPT A;  5CLK A;  2XGL A;  1KSI A;  2FGT A;  4XDW A;  3EC9 A;  3WDG B;  3GWR A;  1OF5 A;  3CCM 3;  3SOY A;  1Q86 4;  4KZ1 A;  1JJ2 2;  1ASK A;  3EE1 A;  2GEY A;  1O7M B;  2B24 B;  2Y74 A;  1M90 4;  2BMO B;  1GD3 A;  3CPW 2;  1MNL A;  3NQZ A;  1IVW A;  1JN5 B;  7STD A;  1SJW A;  3CCR 3;  1VQM 3;  1VQP 3;  3EBT A;  3HZP A;  4O02 B;  4FMB A;  1L5G B;  1NB5 I;  2CFL A;  4HM7 B;  4OK0 A;  1DMQ A;  2W9Q A;  3AMO A;  2YFJ B;  3O8Y A;  4H61 A;  3HK4 A;  3V99 A;  2Z77 A;  3F40 A;  1LOX A;  2P05 A;  2F86 B;  1QAL A;  3FF0 A;  4WFO A;  3CCV 3;  3CNM A;  1ZO2 A;  2CH9 A;  3CD6 3;  1JRQ A;  2OWP A;  4LGQ A;  1RJO A;  4LSO A;  4XM4 A;  1YI2 3;  2OTJ 3;  3OX9 A;  1MOL A;  2K0M A;  5AII A;  4HM4 B;  3G4S 3;  1SIH A;  4LZI A;  4LEH A;  3UL6 A;  1NDO B;  1W5Z A;  5IER A;  3G6E 3;  1KD1 4;  1WTH A;  3LYG A;  5STD A;  1OCV A;  1VQ9 3;  1TFK A;  3DGM A;  4N6T A;  4Q53 A;  2ZDJ A;  4KFF A;  4PEJ A;  8CHO A;  3ER7 A;  2E2V A;  2IMJ A;  3I0Y A;  1US1 A;  4R4K A;  2OTL 3;  1W2B 2;  3UNL A;  4O8S A;  2CIU A;  2L4V A;  3MG2 A;  1AVL A;  2K54 A;  4K90 B;  2P0M A;  2QIY A;  3CNX A;  3VGN A;  3T8N A;  3CC4 3;  2IUJ A;  5AYR B;  3CME 3;  1HKX A;  2BMR B;  3JUN A;  4XBY A;  3FLJ A;  1O7W B;  1RKY A;  3CCU 3;  1ROV A;  2GEX A;  3PS8 A;  2MC8 A;  1W6Y A;  3FKA A;  1N9J A;  3HI7 A;  1YJN 3;  1TP6 A;  3PCS A;  2QEX 3;  1BUQ A;  4K61 A;  3F9S A;  1VQ5 3;  4HYZ A;  3RGR A;  5IG4 A;  2W9P A;  3Q1C A;  3BNE A;  1W6G A;  1W7C A;  2OQE C;  5TGN A;  3X42 A;  3S5C A;  1NJI 4;  2XGN A;  3FG3 A;  1QJG A;  4JRF A;  1AV4 A;  1EA2 A;  1K8A 4;  3FF2 A;  3EN1 B;  2C11 A;  2BO9 B;  2F99 A;  1IVV A;  1RRH A;  2I9W A;  2E2U A;  2W56 A;  3CCQ 3;  3CPO A;  3IMA B;  5I97 A;  4EBG A;  3RGA A;  2LYX A;  2ZL8 A;  3CCS 3;  2M7O A;  1ULI B;  4O2H A;  3MWZ A;  3F8X A;  2JDI H;  1FGO A;  1GS3 A;  1O7P B;  1UI8 A;  3PXM A;  3UJM A;  4CCV A;  4G1M B;  3ROB A;  2OQE A;  1S5A A;  1E97 A;  1LVN A;  3OXA A;  1KC8 4;  3K7C A;  5CK6 A;  3WOD G;  3EF8 A;  1RN7 A;  2XFT A;  1JB4 A;  2XFS A;  1NB3 I;  1K28 A;  3WOE B;  4RBN A;  3GAX A;  2W2C A;  1ULJ B;  1K73 4;  1JV2 B;  2W6J H;  3LTA A;  3NBJ A;  2HML B;  3G0K A;  3CC7 3;  3QK9 A;  2WO0 A;  4WP5 A;  1QVF 2;  2QGU A;  4MMX B;  2XSH B;  1K41 A;  4RZM A;  3KII A;  2GBW B;  1M9G A;  4OVM A;  2CWV A;  5IEO A;  2Z76 A;  4I4K A;  3U1W A;  3VSY A;  4ZM8 A;  3DZL A;  1Q40 A;  2WGO A;  3G16 A;  1U8C B;  1GY5 A;  3FZW A;  4X2H A;  2XR8 B;  5AIG A;  2INX A;  3TDG A;  4J9A A;  3OWU A;  1UW1 A;  3LXU X;  4WYK B;  1OGX A;  4FR9 A;  1WQL B;  4TX4 A;  3BND A;  2CFG A;  2MF7 A;  3MPH A;  3EBY A;  1F8N A;  4AEQ A;  2QA4 3;  3OV4 A;  4HM3 B;  2CHC A;  2XEP A;  1IV9 A;  2F98 A;  1S72 3;  4IT7 A;  1Q82 4;  3NQY A;  1YVB I;  1NWW A;  1QAK A;  3JUP A;  1GD4 A;  4HZB B;  1DVC A;  2E2T A;  5G2G A;  3NHX A;  2GBX B;  1WNH A;  3N9H A;  4HM8 B;  4EYC A;  3A76 A;  3ALA A;  2O9U X;  1DYU A;  3FG1 A;  1ISK A;  2STD A;  3F8H A;  3MSO A;  4HM1 B;  1VQ8 3;  4U13 A;  1YIJ 3;  1IDP A;  5IG0 A;  3KE7 A;  1OGZ A;  2CWT A;  1VQ6 3;  1STF I;  1Y4K A;  3K5T A;  1N8Q A;  2RCD A;  3U97 A;  1AR0 A;  1LNH A;  5HGR A;  3G8Z A;  4KVH A;  3WMD A;  3S29 A;  4EV5 A;  1FGM A;  1Q40 B;  5D82 A;  3NBR A;  2CWU A;  2KRT A;  3MKI A;  5D83 A;  1A2K A;  1YGE A;  3WA3 A;  5CXO A;  1T5Y A;  5ELU A;  2W04 A;  3DM8 A;  1IT7 A;  5BVB A;  2CC3 A;  4STD A;  4R80 A;  1HU9 A;  1CQS A;  2Z7A A;  3EN8 A;  4CDL A;  4EXR A;  3S28 A;  1RRL A;  1K9M 4;  1VQK 3;  1KWI A;  1TIJ A;  1VQ4 3;  3B4P A;  3CCJ 3;  2W56 B;  2CFK A;  3F7X A;  1FA3 A;  3D3L A;  3MHE A;  2ML6 A;  3KSP A;  4MJD A;  3J7Y d;  3FG4 A;  3CCL 3;  3GRD A;  2W0Q A;  3LT9 A;  5LC6 A;  1DMN A;  3EQQ B;  3KFQ C;  3FCS B;  3UB1 A;  1JB2 A;  3HII A;  1IQ8 A;  2CFD A;  3JUM A;  3SOA A;  2HMM B;  4JF8 A;  4WYK A;  4XBX A;  3GZR A;  3EB8 A;  4HM0 B;  4FCZ A;  1NO3 A;  5LC7 A;  5EQL A;  2OOV C;  3K0Z A;  1M1X B;  3NXJ A;  1O7G B;  3NV0 B;  3SED A;  1VQ7 3;  1D6U A;  1VQN 3;  3S27 A;  4O3V A;  1QAF A;  4N3V A;  2IA7 A;  2C10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...