2OTJ3

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2otj300
1K8A4 1YHQ3 1QVF2 1YI23 1KQS2 1YJN3 3CD63 1S723 2OTL3 1VQN3 1VQO3 1Q824 3CME3 1QVG2 3CCS3 1NJI4 1K9M4 3OW22 1M904 1VQ53 1N8R4 3CCV3 3G713 2QA43 1VQM3 3CCL3 1KC84 1VQK3 1Q814 3CCQ3 3CC23 1VQ73 1YIT3 2OTJ3 1W2B2 1YJW3 1Q864 3CC43 3CCE3 3CMA3 1M1K4 1YJ93 1VQ93 3CC73 1VQ83 3I553 3CCM3 3G4S3 3CCJ3 3CCU3 1VQ43 1YIJ3 3CXC2 3I563 1JJ22 2QEX3 1VQ63 3CPW2 3CCR3 1VQL3 1Q7Y4 1KD14 1VQP3 1K734 3G6E3
chains in the Genus database with same CATH superfamily
1K8A4 1DE3A 3NQYA 1RKYA 3HI7A 3B4OA 3D79A 3EQQB 1WMOA 4AEQA 1KQS2 5IEPA 4LEHA 5D83A 5JPUA 2Y73A 1BSCA 4FMDA 2UX0A 1Q824 3DGYA 1UI7A 1TRPA 3BB9A 4Q53A 1VQ53 1B21A 3NM2A 2BMRB 1BRHA 2B24B 3FKAA 2K54A 5IERA 1OUNA 1B2ZA 1AQZA 1D6UA 1WMNA 1T3BA 3HK4A 3G16A 3HIGA 1CEWI 4FCZA 4H61A 4EV2A 5KP1A 1VQ93 3MPHA 5ELJA 1DMMA 2CWTA 3UJMA 2W0QA 1V74A 7RNTA 1GY6A 1EKMA 1ZS7A 3U97A 4HM1B 3STDA 1PYLA 4R80A 2AADA 5IG4A 3UL5A 1B2UA 4HM2B 1U5OA 1T2IA 1GY5A 1TFKA 1MWRA 2F98A 1FUSA 3F8HA 1VQO3 1RGAA 1STDA 2IA7A 3WA3A 1GMQA 5IF6A 2W03A 1UCJA 2BIRA 1RRLA 2XSOB 1RCKA 3BNDA 3H51A 3FH1A 2P0XA 1I8VA 1KC84 4EYCA 5KP4A 3NUVA 1IQXA 1YIT3 1W2B2 1BVIA 1LOVA 2P38A 4WHAA 5CLKA 2GSPA 1A2KA 3AMOA 3EX9A 2WO0A 5FW5A 1B2XA 3WMDA 4EV5A 1YIJ3 1JJ22 3Q1CA 3Q90A 4OK0A 4HM0B 1OF5B 2MC8A 1VQQA 4LGQA 2HOHA 4CCVA 6STDA 2GEYA 3FG1A 1RGEA 2OQEA 3ALAA 1BSAA 1I70A 3NHXA 2HMMB 1TFOA 1L5GB 3I0YA 1MGRA 1W7CA 3MG2A 3SXXA 5BVBA 1SIIA 1N9JA 1Q7HA 1O7NB 5AIFA 1BNSA 1LOWA 1VQN3 2RGQA 4HKVB 3WDGB 2M7OA 3FG3A 1JB4A 2CW9A 3FCSB 3GWRA 1BNIA 1UCKA 3DUKA 1VQK3 3CNMA 1X1UA 1IQYA 1ZO2A 2IY2A 2WOHA 2K3DA 2GEXA 2IMJA 1AVLA 3D5IA 4RBNA 3S29A 3CCJ3 3CCM3 3NBRA 1TIJA 4BIRA 3OWYA 3CPW2 1DETA 1E3VA 1IV7A 4K1UA 3BLZA 3DH2A 3PS8A 1W6GA 4U13A 1JBTA 1CH0A 2RNTA 3F40A 1JB2A 4HOHA 1QJGA 1V58A 3WODG 1YI23 1QVF2 5AEWB 1NO3A 3WOEB 1OPYA 4XDWA 2GBWB 1K9M4 1X1WA 3KSPA 1TTOA 1IVVA 3RGAA 5EVHA 1BRJA 3DGNA 2MF7A 4PEJA 1DVDA 1YGWA 3AHSA 3PGBA 3S67A 2XFSA 2XFTA 4WYKA 4N6TA 2W56B 5LC7A 1UCIA 3I553 3BNCA 2I9WA 3EJVA 1YVBI 1RN7A 4RNYA 1TRQA 4HJLB 3VF1A 1AV4A 1WQLB 3D9RA 1AR0A 1K734 1EEJA 1YGEA 4OVMA 3VSYA 1YHQ3 3B7CA 2QGUA 3D4AA 1Q40A 3OWUA 1PU4A 3GZBA 1ASKA 1O7WB 2UUGC 1BANA 4X2HA 3CU3A 5CK6A 3S28A 5M19A 3CCS3 4MMXB 1SQWA 2CG1A 1STFI 3ER7A 2YFIB 1O7GB 2D1WA 3T8UA 3CCQ3 1BNJA 5STDA 3KE7A 4I5QA 1RGHA 5BXQA 5AYSC 3EB8A 5D81A 4K61A 1G02A 5D82A 1VQ43 5IG5A 4XBTA 3NBJA 2F5WA 5BIRA 1JRQA 1RMSA 2OQEC 1DVCA 1M9GA 2W9QA 3FG4A 5AIIA 3A5EA 4L8OA 4KVHA 1BNRA 1JKGA 2IYJA 2ZL8A 1HKXA 1PFPA 1OGXA 3GRDA 1I2EA 1UDII 4BL3A 4WP5A 3K9MC 4NHFA 4N6LA 3NV0B 2ZDJA 4RZMA 4WWUC 1YJW3 2CFGA 2JQ5A 3EN8A 2F4YA 3HZPA 5CXOA 2J8XB 3M8CA 2A15A 1IT8A 1GS3A 1OGZA 1OHPA 3JUOA 3K5TA 3I563 2R4IA 1BSBA 1NWWA 1OHSA 1MWUA 3LTDA 1BRNL 5AIHA 1RSNA 1IQ8A 1MWSA 4LZIA 1KD14 1W6YA 3KIIA 2OOVA 1JNQA 2W6JH 4MMZB 1FW7A 4HZBB 4FR9A 1CYUA 4CDLA 3EE1A 3OWSA 1S723 4KFFA 3LTAA 1NDOB 3JUMA 5RNTA 1FGRA 1A2PA 2KF6A 1FZUA 3LZAA 3F7XA 3SYUA 4HVNA 5EQLA 2RFRA 1AVKA 1PY3A 3FF2A 3PXMA 1KSIA 1RGCA 2KXGA 1AY7A 2AAEA 2WGOA 2XR8B 1I0VA 3BNEA 4HM8B 4MMYB 4DKIA 3GZYB 3QRDA 1B20A 2C10A 3N9HA 1IU7A 1YVSA 1X1YA 3G4S3 1ZX2A 3CXC2 1N5PA 1ULIB 1UUWB 1TJDA 4MEIA 1TUHA 4WFOA 1RRHA 2SARA 5G1LA 3RNTA 1B3SA 4K1VA 3PCRA 1RCLA 1NNVA 2HMLB 2INXA 6GSPA 1RTUA 1MGWA 3B8LA 4AKZA 3URPA 1JBRA 3WA2X 1RLSA 4HZ9B 3U1WA 1RGLA 3CNXA 3DMCA 4LYLB 1OF5A 1W00A 1Y4KA 1BSDA 5DREA 3F8XA 1KWIA 2IUKA 2Z6BA 3NX0A 2F56A 2XGLA 4LMIA 4O02B 3X41A 1Q814 1I3IA 2PZVA 2RCDA 5I97A 1GY7A 3K63A 1IDPA 5GSPA 4XBXA 3OV4A 2KCDA 1LRAA 4ZM8A 1T5YA 2HMKB 4CPKA 1ULJB 1BNEA 2KRTA 4HM6B 1SIHA 3AHWA 1BOXA 1EA2A 1QMAA 1RNTA 1T2HA 4HM4B 2SBLA 5TGNA 1ROVA 3G0KA 4QWTA 1N5HA 3DGOA 1BRIA 4J5KA 1N8QA 3DM8A 3Q3FA 1LNIA 2LQVA 2GU3A 1WTHA 3MG3A 1IVWA 3HX8A 5ELUA 5JBSA 1RNBA 3GSPA 2CFDA 1JB5A 4L7KA 1RN4A 4STDA 3UL6A 1QVG2 4CJNA 4FMBA 1LNHA 4K90B 2W04A 1VQM3 1Z1SA 4EBGA 1UW1A 2O3OA 3SEDA 3CC23 1BU4A 3EBYA 1K41A 1RDSA 1UI8A 3DY5A 3S27A 1A2VA 3SOAA 2HMOB 3PYJA 1YJ93 1HZ1A 2P09A 3NQZA 1RJOA 4HAAA 3EC9A 3JUQA 7GSPA 4IT7A 1VQ63 3ZFZA 2F99A 5HGRA 3UB1A 3X40A 1JN5B 2OWPA 1BAOA 3SVAA 2CC3A 4NPBA 1TP6A 2F5MA 2W56A 2CX1A 1DMQA 1BNGA 1K28A 1W5ZA 2ML6A 1B2MA 2BU4A 3SLUA 9RNTA 2OOVC 2OCTA 2QIYA 1UGIA 3DGLA 4N6MA 3CME3 1GYBA 3AGOA 1BUQA 1M904 5M18A 4KT3B 1N8R4 1NB5I 4HYZA 1B2SA 2RSXA 3LT8A 3UNLA 4N6V0 1D6ZA 3GZRA 3V98A 1UGHI 1UUVB 3CC43 1WNHA 4N6OB 3CCE3 1HU9A 2XSHB 3F14A 3CMA3 2C11A 2H0HA 3D5GA 1BRGA 2KF5A 1QALA 3F7SA 3DXOA 1DYUA 1W01A 3OX9A 3CCU3 2F86B 3LTBA 4LSOA 1VQ83 5CF2A 2Z76A 2RBIA 2GXFA 2BMOB 4G1MB 4RNTA 2XGNA 1Q7Y4 1IK3A 3KZTA 2BHMA 1W02A 3DGMA 3WR2A 2D42A 3EBTA 1MOLA 2W2CA 2V1LA 2K0MA 3AGNA 1TU5A 3LXUX 2Z7AA 1GOVA 1UCLA 3TDGA 4FCMA 4XDVA 1FGTA 3T8NA 1M1XB 2YFLB 5CF1A 4NREA 4R9LA 5IW9A 3GZXB 3HIIA 1U8CB 3MG1A 3G8ZA 3WOFB 1QAFA 3LT9A 3BU4A 2P0MA 2IUJA 3ROBA 3QK9A 1VQ73 3KKGA 3O8YA 1JBSA 1ISKA 1UUGB 1DMNA 1GD3A 4GSPA 1C7HA 1JZOA 2KF3A 3CPOA 2XRXB 5M1AA 3F9SA 3WHOA 3RDEA 1SPUA 1GSPA 2R41A 3ECFA 1MWTA 3FSDA 5AIGA 5KP3A 2CK3H 1I0XA 1OCVA 4GL6A 3CD63 3EN1B 1US1A 5DRVA 4X2OA 3PZWA 3LMLA 3D3LA 1FGMA 3IJEB 2E2UA 3KSED 1S5AA 2W9PA 1EUIC 3JUNA 1ROAA 1CQSA 2FXTA 3CCV3 4J9AA 3CCL3 1RGGA 3KN4A 4N6UA 2C4BA 2Y74A 1B27A 1QAKA 4BTYA 2CFWA 2CH9A 1NB3I 2H0IA 5FGOA 3MYTA 3J7Yd 3H3HA 3EHCA 4IPBA 5JPPA 5A0OB 1W4NA 2ZHXB 3NBBA 1BSEA 1A90A 4MJDA 2KF4A 2XEPA 4RNZA 1W2ZA 3V99A 3CCR3 1A67A 1LQGC 1OACA 8CHOA 1R4YA 1VQP3 4J5GA 4JRFA 3FZWA 4O2HA 2XF3A 3G6E3 1NU3A 8RNTA 2FNQA 3SX1A 3MSOA 1LVNA 1G96A 3T0UA 3X42A 2OTL3 1BNFA 1BIRA 1LQMB 1RHLA 1Q42A 4HM3B 3LYGA 1OH0A 2YFJB 2ML5A 2CWVA 3AMOB 1BRKA 3FGYA 3L0RA 2CFKA 2WOFA 5IG0A 3RGRA 2QA43 4XBYA 4ILFA 2CKFB 3K0ZA 1SARA 1LOYA 4GB5A 4BU4A 2KAAA 3HOHA 1R4CA 2XH9A 2LYXA 2Q07A 4H3UA 1GD4A 1BUJA 4EXRA 2Z77A 1RGKA 1E97A 1W6CA 3FF0A 2FGTA 5G1KA 1VQL3 2UGIA 4O8SA 1EQKA 3OW22 3ZG5A 2CWUA 3KCHA 5EEOA 1ZGXA 3MKIA 2CIUA 1GMRA 1O7MB 2CHCA 4JF8A 4I4KA 4EC6A 6RNTA 1WMPA 1NJI4 1J2BA 5BU4A 4N3VA 3LOYA 1X1XA 1Q9EA 3BIRA 2HMNB 3N8BA 4FMCA 5LC6A 4XB5A 3FLJA 1IT7A 1M1K4 4J8TA 1JV2B 3LH4A 4KFEA 2WGQA 2H0GA 1GMPA 1IVXA 2B1XB 4BTWA 1RN1A 2BNGA 1GOUA 1JZDA 2CX0A 4FCJA 1FYSA 1FUTA 4BL2A 4R9KA 3OXAA 2BO9B 4O3VA 1BGSA 1BRSA 1O7HB 2BT3A 4WYKB 1JN5A 2BMQB 1VZZA 3NXJA 1FGOA 2E2TA 4AKYA 1GOYA 1RGFA 5AEUB 3X3XA 1Q864 3ZG0A 4GHOA 4IIAA 1IYYA 1HYFA 1I3FA 3N54B 2STDA 4ORLA 3Q2PA 1FGQA 3VGNA 5AI1A 1EG9B 3KFQC 1Q40B 3K7CA 3MWZA 2GU1A 4OUQA 1LXEA 3EF8A 1O7PB 4N6NB 5AYRB 1IV9A 2CFLA 3NM7A 4BTXA 5G2GA 3MHEA 4XM4A 4KZ1A 5IENA 3JVCA 1I2FA 2CG0A 3IMAB 2L1SA 4FMAA 1SJWA 4R4KA 1YJN3 7STDA 2ZA4A 3X3YA 1FUWA 4HM5B 1F8NA 4EW5A 4HM7B 5IEOA 5HOHA 3IPTA 1FA3A 1MNLA 3A76A 2P05A 3SOYA 2L4VA 3G713 4L8PA 1CYVA 4HBRA 3BNBA 3S5CA 2OTJ3 3LTCA 2YX9A 2GBXB 5IG3A 2PNCA 2E2VA 1LOXA 3B4PA 3E99A 4R1KA 1G0TA 1C54A 1IVUA 4TX4A 3CC73 1D6YA 1E3RA 3V92A 1I2GA 3X3ZA 2QEX3 2O9UX 2HMJB 3GAXA 3JUPA 3DZLA 4KFDA 1V57A 2JDIH 1OHOA 3NV0A 1YNVX 1JKGB 3PCSA 1N9EA
chains in the Genus database with same CATH topology
1K8A4 3NQYA 1RKYA 3HI7A 3B4OA 3EQQB 1WMOA 4AEQA 1KQS2 5IEPA 4LEHA 5D83A 5JPUA 2Y73A 4FMDA 2UX0A 1Q824 1UI7A 3BB9A 4Q53A 1VQ53 3NM2A 2BMRB 2B24B 3FKAA 2K54A 5IERA 1OUNA 1D6UA 1WMNA 3HK4A 4H61A 3G16A 3HIGA 1CEWI 4FCZA 4EV2A 5KP1A 1VQ93 3MPHA 5ELJA 1DMMA 2CWTA 3UJMA 2W0QA 1V74A 1GY6A 1EKMA 3U97A 4HM1B 3STDA 4R80A 5IG4A 3UL5A 4HM2B 1U5OA 1GY5A 1TFKA 2F98A 1VQO3 3F8HA 1STDA 2IA7A 3WA3A 5IF6A 2W03A 1RRLA 2XSOB 3BNDA 3H51A 3FH1A 2P0XA 1KC84 4EYCA 5KP4A 3NUVA 1IQXA 1YIT3 1W2B2 2P38A 4WHAA 5CLKA 1A2KA 3AMOA 3EX9A 2WO0A 5FW5A 4EV5A 3WMDA 1YIJ3 1JJ22 3Q1CA 3Q90A 4OK0A 4HM0B 1OF5B 2MC8A 4LGQA 4CCVA 6STDA 2GEYA 3FG1A 2OQEA 3ALAA 3NHXA 2HMMB 1TFOA 1L5GB 3I0YA 1W7CA 3MG2A 3SXXA 5BVBA 1SIIA 1N9JA 1O7NB 5AIFA 1VQN3 2RGQA 4HKVB 3WDGB 2M7OA 3FG3A 1JB4A 2CW9A 3FCSB 3GWRA 3DUKA 1VQK3 3CNMA 1IQYA 1ZO2A 2WOHA 2GEXA 2IMJA 1AVLA 4RBNA 3S29A 3CCJ3 3CCM3 3NBRA 1TIJA 3OWYA 3CPW2 1E3VA 1IV7A 4K1UA 3BLZA 3PS8A 1W6GA 4U13A 3F40A 1JB2A 1QVF2 1QJGA 3WODG 1YI23 5AEWB 1NO3A 3WOEB 1OPYA 4XDWA 2GBWB 1K9M4 3KSPA 1IVVA 3RGAA 5EVHA 4PEJA 3DGNA 2MF7A 1DVDA 3PGBA 3S67A 2XFSA 2XFTA 4WYKA 4N6TA 2W56B 5LC7A 3I553 3BNCA 2I9WA 3EJVA 1YVBI 1RN7A 4RNYA 4HJLB 3VF1A 1AV4A 1WQLB 3D9RA 1AR0A 1K734 1YGEA 4OVMA 3VSYA 1YHQ3 3B7CA 2QGUA 1Q40A 3OWUA 1PU4A 3GZBA 1ASKA 1O7WB 4X2HA 3CU3A 5CK6A 3S28A 3CCS3 4MMXB 1SQWA 2CG1A 1STFI 3ER7A 2YFIB 1O7GB 2D1WA 3T8UA 3CCQ3 5STDA 3KE7A 5BXQA 5AYSC 3EB8A 5D81A 4K61A 5D82A 1VQ43 5IG5A 4XBTA 3NBJA 1JRQA 2OQEC 1DVCA 1M9GA 2W9QA 3FG4A 5AIIA 4L8OA 4KVHA 1JKGA 2ZL8A 1HKXA 1PFPA 1OGXA 3GRDA 4WP5A 3K9MC 4NHFA 4N6LA 3NV0B 2ZDJA 4RZMA 4WWUC 1YJW3 2CFGA 2JQ5A 3EN8A 3HZPA 5CXOA 3M8CA 2A15A 1IT8A 1GS3A 1OGZA 1OHPA 3JUOA 3K5TA 3I563 2R4IA 1OHSA 1NWWA 3LTDA 5AIHA 1IQ8A 4LZIA 1KD14 1W6YA 3KIIA 2OOVA 1JNQA 2W6JH 4MMZB 4HZBB 4FR9A 1CYUA 4CDLA 3EE1A 3OWSA 1S723 4KFFA 3LTAA 1NDOB 3JUMA 1FGRA 3LZAA 3F7XA 4HVNA 5EQLA 2RFRA 1AVKA 3FF2A 3PXMA 1KSIA 2KXGA 2WGOA 2XR8B 3BNEA 4HM8B 4MMYB 3GZYB 3QRDA 2C10A 3N9HA 1IU7A 3G4S3 1ZX2A 3CXC2 1N5PA 1ULIB 1UUWB 4MEIA 1TUHA 4WFOA 1RRHA 4K1VA 3PCRA 2HMLB 2INXA 3B8LA 4AKZA 3WA2X 4HZ9B 3U1WA 3CNXA 3DMCA 1OF5A 1W00A 1Y4KA 5DREA 3F8XA 1KWIA 2IUKA 2Z6BA 3NX0A 2XGLA 4LMIA 4O02B 3X41A 1Q814 2PZVA 2RCDA 5I97A 1GY7A 3K63A 1IDPA 4XBXA 3OV4A 2KCDA 4ZM8A 1T5YA 2HMKB 1ULJB 2KRTA 4HM6B 1SIHA 4HM4B 1EA2A 1QMAA 2SBLA 5TGNA 1ROVA 3G0KA 4QWTA 1N5HA 3DGOA 1N8QA 3DM8A 2LQVA 2GU3A 1WTHA 3MG3A 1IVWA 3HX8A 5ELUA 5JBSA 2CFDA 1JB5A 4L7KA 4STDA 3UL6A 1QVG2 4FMBA 1LNHA 4K90B 2W04A 1VQM3 1Z1SA 4EBGA 1UW1A 2O3OA 3SEDA 3CC23 3EBYA 1K41A 1UI8A 3DY5A 3S27A 1A2VA 3SOAA 2HMOB 3PYJA 1YJ93 2P09A 3NQZA 1RJOA 3EC9A 3JUQA 4IT7A 1VQ63 2F99A 5HGRA 3UB1A 3X40A 1JN5B 2OWPA 3SVAA 2CC3A 1TP6A 2W56A 1DMQA 1K28A 1W5ZA 2ML6A 3SLUA 2OOVC 2OCTA 2QIYA 3DGLA 4N6MA 3CME3 1GYBA 1BUQA 1M904 1N8R4 1NB5I 4HYZA 2RSXA 3LT8A 3UNLA 4N6V0 1D6ZA 3GZRA 3V98A 1UUVB 3CC43 1WNHA 4N6OB 3CCE3 1HU9A 2XSHB 3F14A 3CMA3 2C11A 3F7SA 1QALA 3DXOA 1DYUA 1W01A 3OX9A 3CCU3 2F86B 3LTBA 4LSOA 1VQ83 5CF2A 2Z76A 2GXFA 2BMOB 4G1MB 2XGNA 1Q7Y4 1IK3A 3KZTA 2BHMA 1W02A 3DGMA 2D42A 3EBTA 1MOLA 2W2CA 2V1LA 2K0MA 1TU5A 3LXUX 2Z7AA 3TDGA 4FCMA 4XDVA 1FGTA 3T8NA 1M1XB 2YFLB 5CF1A 4NREA 4R9LA 5IW9A 3GZXB 3HIIA 1U8CB 3MG1A 3G8ZA 3WOFB 1QAFA 3LT9A 1VQ73 2P0MA 2IUJA 3ROBA 3QK9A 1ISKA 3KKGA 3O8YA 1DMNA 1GD3A 1C7HA 3CPOA 2XRXB 3F9SA 3RDEA 1SPUA 3ECFA 3FSDA 5AIGA 5KP3A 2CK3H 1OCVA 4GL6A 3CD63 3EN1B 1US1A 5DRVA 4X2OA 3PZWA 3LMLA 3D3LA 1FGMA 3IJEB 2E2UA 3KSED 1S5AA 2W9PA 3JUNA 1ROAA 1CQSA 2FXTA 3CCV3 4J9AA 3CCL3 3KN4A 4N6UA 2Y74A 1QAKA 4BTYA 2CFWA 2CH9A 1NB3I 5FGOA 3MYTA 3J7Yd 3H3HA 3EHCA 4IPBA 5JPPA 5A0OB 1W4NA 3NBBA 1A90A 4MJDA 2XEPA 3V99A 4RNZA 1W2ZA 3CCR3 1A67A 1OACA 8CHOA 1VQP3 4JRFA 3FZWA 4O2HA 2XF3A 3G6E3 1NU3A 2FNQA 3SX1A 3MSOA 1LVNA 1G96A 3T0UA 3X42A 2OTL3 1Q42A 4HM3B 3LYGA 1OH0A 2YFJB 2ML5A 2CWVA 3AMOB 3FGYA 3L0RA 3RGRA 2CFKA 2WOFA 5IG0A 2QA43 4XBYA 2CKFB 3K0ZA 4GB5A 1R4CA 2XH9A 2LYXA 2Q07A 4H3UA 1GD4A 4EXRA 2Z77A 1E97A 1W6CA 3FF0A 2FGTA 1VQL3 4O8SA 1EQKA 3OW22 2CWUA 5EEOA 3MKIA 2CIUA 1O7MB 2CHCA 4JF8A 4I4KA 4EC6A 1WMPA 1NJI4 1J2BA 4N3VA 3LOYA 2HMNB 3N8BA 4FMCA 5LC6A 4XB5A 3FLJA 1IT7A 1M1K4 4J8TA 1JV2B 3LH4A 4KFEA 2WGQA 1IVXA 2B1XB 4BTWA 2BNGA 4FCJA 4R9KA 3OXAA 2BO9B 4O3VA 1O7HB 2BT3A 4WYKB 1JN5A 2BMQB 1VZZA 3NXJA 1FGOA 2E2TA 4AKYA 5AEUB 3X3XA 1Q864 4IIAA 3N54B 4ORLA 2STDA 3Q2PA 1FGQA 3VGNA 5AI1A 1EG9B 3KFQC 1Q40B 3K7CA 3MWZA 2GU1A 4OUQA 1LXEA 3EF8A 1O7PB 4N6NB 5AYRB 1IV9A 2CFLA 3NM7A 4BTXA 5G2GA 3MHEA 4XM4A 4KZ1A 5IENA 3JVCA 2CG0A 3IMAB 4FMAA 1SJWA 4R4KA 1YJN3 7STDA 1FUWA 3X3YA 4HM5B 1F8NA 1FA3A 4HM7B 5IEOA 3IPTA 1MNLA 3A76A 2P05A 3SOYA 2L4VA 3G713 4L8PA 1CYVA 4HBRA 3BNBA 3S5CA 2OTJ3 3LTCA 2YX9A 2GBXB 5IG3A 2PNCA 2E2VA 1LOXA 3B4PA 3E99A 4R1KA 1IVUA 4TX4A 3CC73 1D6YA 1E3RA 3V92A 3X3ZA 2QEX3 2O9UX 2HMJB 3GAXA 3JUPA 3DZLA 4KFDA 2JDIH 1OHOA 3NV0A 1JKGB 3PCSA 1N9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 4;  1YHQ 3;  1QVF 2;  1YI2 3;  1KQS 2;  1YJN 3;  3CD6 3;  1S72 3;  2OTL 3;  1VQN 3;  1VQO 3;  1Q82 4;  3CME 3;  1QVG 2;  3CCS 3;  1NJI 4;  1K9M 4;  3OW2 2;  1M90 4;  1VQ5 3;  1N8R 4;  3CCV 3;  3G71 3;  2QA4 3;  1VQM 3;  3CCL 3;  1KC8 4;  1VQK 3;  1Q81 4;  3CCQ 3;  3CC2 3;  1VQ7 3;  1YIT 3;  2OTJ 3;  1W2B 2;  1YJW 3;  1Q86 4;  3CC4 3;  3CCE 3;  3CMA 3;  1M1K 4;  1YJ9 3;  1VQ9 3;  3CC7 3;  1VQ8 3;  3I55 3;  3CCM 3;  3G4S 3;  3CCJ 3;  3CCU 3;  1VQ4 3;  1YIJ 3;  3CXC 2;  3I56 3;  1JJ2 2;  2QEX 3;  1VQ6 3;  3CPW 2;  3CCR 3;  1VQL 3;  1Q7Y 4;  1KD1 4;  1VQP 3;  1K73 4;  3G6E 3; 
#chains in the Genus database with same CATH topology
 1K8A 4;  1DE3 A;  3NQY A;  1RKY A;  3HI7 A;  3B4O A;  3D79 A;  3EQQ B;  1WMO A;  4AEQ A;  1KQS 2;  5IEP A;  4LEH A;  5D83 A;  5JPU A;  2Y73 A;  1BSC A;  4FMD A;  2UX0 A;  1Q82 4;  3DGY A;  1UI7 A;  1TRP A;  3BB9 A;  4Q53 A;  1VQ5 3;  1B21 A;  3NM2 A;  2BMR B;  1BRH A;  2B24 B;  3FKA A;  2K54 A;  5IER A;  1OUN A;  1B2Z A;  1AQZ A;  1D6U A;  1WMN A;  1T3B A;  3HK4 A;  3G16 A;  3HIG A;  1CEW I;  4FCZ A;  4H61 A;  4EV2 A;  5KP1 A;  1VQ9 3;  3MPH A;  5ELJ A;  1DMM A;  2CWT A;  3UJM A;  2W0Q A;  1V74 A;  7RNT A;  1GY6 A;  1EKM A;  1ZS7 A;  3U97 A;  4HM1 B;  3STD A;  1PYL A;  4R80 A;  2AAD A;  5IG4 A;  3UL5 A;  1B2U A;  4HM2 B;  1U5O A;  1T2I A;  1GY5 A;  1TFK A;  1MWR A;  2F98 A;  1FUS A;  3F8H A;  1VQO 3;  1RGA A;  1STD A;  2IA7 A;  3WA3 A;  1GMQ A;  5IF6 A;  2W03 A;  1UCJ A;  2BIR A;  1RRL A;  2XSO B;  1RCK A;  3BND A;  3H51 A;  3FH1 A;  2P0X A;  1I8V A;  1KC8 4;  4EYC A;  5KP4 A;  3NUV A;  1IQX A;  1YIT 3;  1W2B 2;  1BVI A;  1LOV A;  2P38 A;  4WHA A;  5CLK A;  2GSP A;  1A2K A;  3AMO A;  3EX9 A;  2WO0 A;  5FW5 A;  1B2X A;  3WMD A;  4EV5 A;  1YIJ 3;  1JJ2 2;  3Q1C A;  3Q90 A;  4OK0 A;  4HM0 B;  1OF5 B;  2MC8 A;  1VQQ A;  4LGQ A;  2HOH A;  4CCV A;  6STD A;  2GEY A;  3FG1 A;  1RGE A;  2OQE A;  3ALA A;  1BSA A;  1I70 A;  3NHX A;  2HMM B;  1TFO A;  1L5G B;  3I0Y A;  1MGR A;  1W7C A;  3MG2 A;  3SXX A;  5BVB A;  1SII A;  1N9J A;  1Q7H A;  1O7N B;  5AIF A;  1BNS A;  1LOW A;  1VQN 3;  2RGQ A;  4HKV B;  3WDG B;  2M7O A;  3FG3 A;  1JB4 A;  2CW9 A;  3FCS B;  3GWR A;  1BNI A;  1UCK A;  3DUK A;  1VQK 3;  3CNM A;  1X1U A;  1IQY A;  1ZO2 A;  2IY2 A;  2WOH A;  2K3D A;  2GEX A;  2IMJ A;  1AVL A;  3D5I A;  4RBN A;  3S29 A;  3CCJ 3;  3CCM 3;  3NBR A;  1TIJ A;  4BIR A;  3OWY A;  3CPW 2;  1DET A;  1E3V A;  1IV7 A;  4K1U A;  3BLZ A;  3DH2 A;  3PS8 A;  1W6G A;  4U13 A;  1JBT A;  1CH0 A;  2RNT A;  3F40 A;  1JB2 A;  4HOH A;  1QJG A;  1V58 A;  3WOD G;  1YI2 3;  1QVF 2;  5AEW B;  1NO3 A;  3WOE B;  1OPY A;  4XDW A;  2GBW B;  1K9M 4;  1X1W A;  3KSP A;  1TTO A;  1IVV A;  3RGA A;  5EVH A;  1BRJ A;  3DGN A;  2MF7 A;  4PEJ A;  1DVD A;  1YGW A;  3AHS A;  3PGB A;  3S67 A;  2XFS A;  2XFT A;  4WYK A;  4N6T A;  2W56 B;  5LC7 A;  1UCI A;  3I55 3;  3BNC A;  2I9W A;  3EJV A;  1YVB I;  1RN7 A;  4RNY A;  1TRQ A;  4HJL B;  3VF1 A;  1AV4 A;  1WQL B;  3D9R A;  1AR0 A;  1K73 4;  1EEJ A;  1YGE A;  4OVM A;  3VSY A;  1YHQ 3;  3B7C A;  2QGU A;  3D4A A;  1Q40 A;  3OWU A;  1PU4 A;  3GZB A;  1ASK A;  1O7W B;  2UUG C;  1BAN A;  4X2H A;  3CU3 A;  5CK6 A;  3S28 A;  5M19 A;  3CCS 3;  4MMX B;  1SQW A;  2CG1 A;  1STF I;  3ER7 A;  2YFI B;  1O7G B;  2D1W A;  3T8U A;  3CCQ 3;  1BNJ A;  5STD A;  3KE7 A;  4I5Q A;  1RGH A;  5BXQ A;  5AYS C;  3EB8 A;  5D81 A;  4K61 A;  1G02 A;  5D82 A;  1VQ4 3;  5IG5 A;  4XBT A;  3NBJ A;  2F5W A;  5BIR A;  1JRQ A;  1RMS A;  2OQE C;  1DVC A;  1M9G A;  2W9Q A;  3FG4 A;  5AII A;  3A5E A;  4L8O A;  4KVH A;  1BNR A;  1JKG A;  2IYJ A;  2ZL8 A;  1HKX A;  1PFP A;  1OGX A;  3GRD A;  1I2E A;  1UDI I;  4BL3 A;  4WP5 A;  3K9M C;  4NHF A;  4N6L A;  3NV0 B;  2ZDJ A;  4RZM A;  4WWU C;  1YJW 3;  2CFG A;  2JQ5 A;  3EN8 A;  2F4Y A;  3HZP A;  5CXO A;  2J8X B;  3M8C A;  2A15 A;  1IT8 A;  1GS3 A;  1OGZ A;  1OHP A;  3JUO A;  3K5T A;  3I56 3;  2R4I A;  1BSB A;  1NWW A;  1OHS A;  1MWU A;  3LTD A;  1BRN L;  5AIH A;  1RSN A;  1IQ8 A;  1MWS A;  4LZI A;  1KD1 4;  1W6Y A;  3KII A;  2OOV A;  1JNQ A;  2W6J H;  4MMZ B;  1FW7 A;  4HZB B;  4FR9 A;  1CYU A;  4CDL A;  3EE1 A;  3OWS A;  1S72 3;  4KFF A;  3LTA A;  1NDO B;  3JUM A;  5RNT A;  1FGR A;  1A2P A;  2KF6 A;  1FZU A;  3LZA A;  3F7X A;  3SYU A;  4HVN A;  5EQL A;  2RFR A;  1AVK A;  1PY3 A;  3FF2 A;  3PXM A;  1KSI A;  1RGC A;  2KXG A;  1AY7 A;  2AAE A;  2WGO A;  2XR8 B;  1I0V A;  3BNE A;  4HM8 B;  4MMY B;  4DKI A;  3GZY B;  3QRD A;  1B20 A;  2C10 A;  3N9H A;  1IU7 A;  1YVS A;  1X1Y A;  3G4S 3;  1ZX2 A;  3CXC 2;  1N5P A;  1ULI B;  1UUW B;  1TJD A;  4MEI A;  1TUH A;  4WFO A;  1RRH A;  2SAR A;  5G1L A;  3RNT A;  1B3S A;  4K1V A;  3PCR A;  1RCL A;  1NNV A;  2HML B;  2INX A;  6GSP A;  1RTU A;  1MGW A;  3B8L A;  4AKZ A;  3URP A;  1JBR A;  3WA2 X;  1RLS A;  4HZ9 B;  3U1W A;  1RGL A;  3CNX A;  3DMC A;  4LYL B;  1OF5 A;  1W00 A;  1Y4K A;  1BSD A;  5DRE A;  3F8X A;  1KWI A;  2IUK A;  2Z6B A;  3NX0 A;  2F56 A;  2XGL A;  4LMI A;  4O02 B;  3X41 A;  1Q81 4;  1I3I A;  2PZV A;  2RCD A;  5I97 A;  1GY7 A;  3K63 A;  1IDP A;  5GSP A;  4XBX A;  3OV4 A;  2KCD A;  1LRA A;  4ZM8 A;  1T5Y A;  2HMK B;  4CPK A;  1ULJ B;  1BNE A;  2KRT A;  4HM6 B;  1SIH A;  3AHW A;  1BOX A;  1EA2 A;  1QMA A;  1RNT A;  1T2H A;  4HM4 B;  2SBL A;  5TGN A;  1ROV A;  3G0K A;  4QWT A;  1N5H A;  3DGO A;  1BRI A;  4J5K A;  1N8Q A;  3DM8 A;  3Q3F A;  1LNI A;  2LQV A;  2GU3 A;  1WTH A;  3MG3 A;  1IVW A;  3HX8 A;  5ELU A;  5JBS A;  1RNB A;  3GSP A;  2CFD A;  1JB5 A;  4L7K A;  1RN4 A;  4STD A;  3UL6 A;  1QVG 2;  4CJN A;  4FMB A;  1LNH A;  4K90 B;  2W04 A;  1VQM 3;  1Z1S A;  4EBG A;  1UW1 A;  2O3O A;  3SED A;  3CC2 3;  1BU4 A;  3EBY A;  1K41 A;  1RDS A;  1UI8 A;  3DY5 A;  3S27 A;  1A2V A;  3SOA A;  2HMO B;  3PYJ A;  1YJ9 3;  1HZ1 A;  2P09 A;  3NQZ A;  1RJO A;  4HAA A;  3EC9 A;  3JUQ A;  7GSP A;  4IT7 A;  1VQ6 3;  3ZFZ A;  2F99 A;  5HGR A;  3UB1 A;  3X40 A;  1JN5 B;  2OWP A;  1BAO A;  3SVA A;  2CC3 A;  4NPB A;  1TP6 A;  2F5M A;  2W56 A;  2CX1 A;  1DMQ A;  1BNG A;  1K28 A;  1W5Z A;  2ML6 A;  1B2M A;  2BU4 A;  3SLU A;  9RNT A;  2OOV C;  2OCT A;  2QIY A;  1UGI A;  3DGL A;  4N6M A;  3CME 3;  1GYB A;  3AGO A;  1BUQ A;  1M90 4;  5M18 A;  4KT3 B;  1N8R 4;  1NB5 I;  4HYZ A;  1B2S A;  2RSX A;  3LT8 A;  3UNL A;  4N6V 0;  1D6Z A;  3GZR A;  3V98 A;  1UGH I;  1UUV B;  3CC4 3;  1WNH A;  4N6O B;  3CCE 3;  1HU9 A;  2XSH B;  3F14 A;  3CMA 3;  2C11 A;  2H0H A;  3D5G A;  1BRG A;  2KF5 A;  1QAL A;  3F7S A;  3DXO A;  1DYU A;  1W01 A;  3OX9 A;  3CCU 3;  2F86 B;  3LTB A;  4LSO A;  1VQ8 3;  5CF2 A;  2Z76 A;  2RBI A;  2GXF A;  2BMO B;  4G1M B;  4RNT A;  2XGN A;  1Q7Y 4;  1IK3 A;  3KZT A;  2BHM A;  1W02 A;  3DGM A;  3WR2 A;  2D42 A;  3EBT A;  1MOL A;  2W2C A;  2V1L A;  2K0M A;  3AGN A;  1TU5 A;  3LXU X;  2Z7A A;  1GOV A;  1UCL A;  3TDG A;  4FCM A;  4XDV A;  1FGT A;  3T8N A;  1M1X B;  2YFL B;  5CF1 A;  4NRE A;  4R9L A;  5IW9 A;  3GZX B;  3HII A;  1U8C B;  3MG1 A;  3G8Z A;  3WOF B;  1QAF A;  3LT9 A;  3BU4 A;  2P0M A;  2IUJ A;  3ROB A;  3QK9 A;  1VQ7 3;  3KKG A;  3O8Y A;  1JBS A;  1ISK A;  1UUG B;  1DMN A;  1GD3 A;  4GSP A;  1C7H A;  1JZO A;  2KF3 A;  3CPO A;  2XRX B;  5M1A A;  3F9S A;  3WHO A;  3RDE A;  1SPU A;  1GSP A;  2R41 A;  3ECF A;  1MWT A;  3FSD A;  5AIG A;  5KP3 A;  2CK3 H;  1I0X A;  1OCV A;  4GL6 A;  3CD6 3;  3EN1 B;  1US1 A;  5DRV A;  4X2O A;  3PZW A;  3LML A;  3D3L A;  1FGM A;  3IJE B;  2E2U A;  3KSE D;  1S5A A;  2W9P A;  1EUI C;  3JUN A;  1ROA A;  1CQS A;  2FXT A;  3CCV 3;  4J9A A;  3CCL 3;  1RGG A;  3KN4 A;  4N6U A;  2C4B A;  2Y74 A;  1B27 A;  1QAK A;  4BTY A;  2CFW A;  2CH9 A;  1NB3 I;  2H0I A;  5FGO A;  3MYT A;  3J7Y d;  3H3H A;  3EHC A;  4IPB A;  5JPP A;  5A0O B;  1W4N A;  2ZHX B;  3NBB A;  1BSE A;  1A90 A;  4MJD A;  2KF4 A;  2XEP A;  4RNZ A;  1W2Z A;  3V99 A;  3CCR 3;  1A67 A;  1LQG C;  1OAC A;  8CHO A;  1R4Y A;  1VQP 3;  4J5G A;  4JRF A;  3FZW A;  4O2H A;  2XF3 A;  3G6E 3;  1NU3 A;  8RNT A;  2FNQ A;  3SX1 A;  3MSO A;  1LVN A;  1G96 A;  3T0U A;  3X42 A;  2OTL 3;  1BNF A;  1BIR A;  1LQM B;  1RHL A;  1Q42 A;  4HM3 B;  3LYG A;  1OH0 A;  2YFJ B;  2ML5 A;  2CWV A;  3AMO B;  1BRK A;  3FGY A;  3L0R A;  2CFK A;  2WOF A;  5IG0 A;  3RGR A;  2QA4 3;  4XBY A;  4ILF A;  2CKF B;  3K0Z A;  1SAR A;  1LOY A;  4GB5 A;  4BU4 A;  2KAA A;  3HOH A;  1R4C A;  2XH9 A;  2LYX A;  2Q07 A;  4H3U A;  1GD4 A;  1BUJ A;  4EXR A;  2Z77 A;  1RGK A;  1E97 A;  1W6C A;  3FF0 A;  2FGT A;  5G1K A;  1VQL 3;  2UGI A;  4O8S A;  1EQK A;  3OW2 2;  3ZG5 A;  2CWU A;  3KCH A;  5EEO A;  1ZGX A;  3MKI A;  2CIU A;  1GMR A;  1O7M B;  2CHC A;  4JF8 A;  4I4K A;  4EC6 A;  6RNT A;  1WMP A;  1NJI 4;  1J2B A;  5BU4 A;  4N3V A;  3LOY A;  1X1X A;  1Q9E A;  3BIR A;  2HMN B;  3N8B A;  4FMC A;  5LC6 A;  4XB5 A;  3FLJ A;  1IT7 A;  1M1K 4;  4J8T A;  1JV2 B;  3LH4 A;  4KFE A;  2WGQ A;  2H0G A;  1GMP A;  1IVX A;  2B1X B;  4BTW A;  1RN1 A;  2BNG A;  1GOU A;  1JZD A;  2CX0 A;  4FCJ A;  1FYS A;  1FUT A;  4BL2 A;  4R9K A;  3OXA A;  2BO9 B;  4O3V A;  1BGS A;  1BRS A;  1O7H B;  2BT3 A;  4WYK B;  1JN5 A;  2BMQ B;  1VZZ A;  3NXJ A;  1FGO A;  2E2T A;  4AKY A;  1GOY A;  1RGF A;  5AEU B;  3X3X A;  1Q86 4;  3ZG0 A;  4GHO A;  4IIA A;  1IYY A;  1HYF A;  1I3F A;  3N54 B;  2STD A;  4ORL A;  3Q2P A;  1FGQ A;  3VGN A;  5AI1 A;  1EG9 B;  3KFQ C;  1Q40 B;  3K7C A;  3MWZ A;  2GU1 A;  4OUQ A;  1LXE A;  3EF8 A;  1O7P B;  4N6N B;  5AYR B;  1IV9 A;  2CFL A;  3NM7 A;  4BTX A;  5G2G A;  3MHE A;  4XM4 A;  4KZ1 A;  5IEN A;  3JVC A;  1I2F A;  2CG0 A;  3IMA B;  2L1S A;  4FMA A;  1SJW A;  4R4K A;  1YJN 3;  7STD A;  2ZA4 A;  3X3Y A;  1FUW A;  4HM5 B;  1F8N A;  4EW5 A;  4HM7 B;  5IEO A;  5HOH A;  3IPT A;  1FA3 A;  1MNL A;  3A76 A;  2P05 A;  3SOY A;  2L4V A;  3G71 3;  4L8P A;  1CYV A;  4HBR A;  3BNB A;  3S5C A;  2OTJ 3;  3LTC A;  2YX9 A;  2GBX B;  5IG3 A;  2PNC A;  2E2V A;  1LOX A;  3B4P A;  3E99 A;  4R1K A;  1G0T A;  1C54 A;  1IVU A;  4TX4 A;  3CC7 3;  1D6Y A;  1E3R A;  3V92 A;  1I2G A;  3X3Z A;  2QEX 3;  2O9U X;  2HMJ B;  3GAX A;  3JUP A;  3DZL A;  4KFD A;  1V57 A;  2JDI H;  1OHO A;  3NV0 A;  1YNV X;  1JKG B;  3PCS A;  1N9E A; 
#chains in the Genus database with same CATH homology
 1K8A 4;  3NQY A;  1RKY A;  3HI7 A;  3B4O A;  3EQQ B;  1WMO A;  4AEQ A;  1KQS 2;  5IEP A;  4LEH A;  5D83 A;  5JPU A;  2Y73 A;  4FMD A;  2UX0 A;  1Q82 4;  1UI7 A;  3BB9 A;  4Q53 A;  1VQ5 3;  3NM2 A;  2BMR B;  2B24 B;  3FKA A;  2K54 A;  5IER A;  1OUN A;  1D6U A;  1WMN A;  3HK4 A;  4H61 A;  3G16 A;  3HIG A;  1CEW I;  4FCZ A;  4EV2 A;  5KP1 A;  1VQ9 3;  3MPH A;  5ELJ A;  1DMM A;  2CWT A;  3UJM A;  2W0Q A;  1V74 A;  1GY6 A;  1EKM A;  3U97 A;  4HM1 B;  3STD A;  4R80 A;  5IG4 A;  3UL5 A;  4HM2 B;  1U5O A;  1GY5 A;  1TFK A;  2F98 A;  1VQO 3;  3F8H A;  1STD A;  2IA7 A;  3WA3 A;  5IF6 A;  2W03 A;  1RRL A;  2XSO B;  3BND A;  3H51 A;  3FH1 A;  2P0X A;  1KC8 4;  4EYC A;  5KP4 A;  3NUV A;  1IQX A;  1YIT 3;  1W2B 2;  2P38 A;  4WHA A;  5CLK A;  1A2K A;  3AMO A;  3EX9 A;  2WO0 A;  5FW5 A;  4EV5 A;  3WMD A;  1YIJ 3;  1JJ2 2;  3Q1C A;  3Q90 A;  4OK0 A;  4HM0 B;  1OF5 B;  2MC8 A;  4LGQ A;  4CCV A;  6STD A;  2GEY A;  3FG1 A;  2OQE A;  3ALA A;  3NHX A;  2HMM B;  1TFO A;  1L5G B;  3I0Y A;  1W7C A;  3MG2 A;  3SXX A;  5BVB A;  1SII A;  1N9J A;  1O7N B;  5AIF A;  1VQN 3;  2RGQ A;  4HKV B;  3WDG B;  2M7O A;  3FG3 A;  1JB4 A;  2CW9 A;  3FCS B;  3GWR A;  3DUK A;  1VQK 3;  3CNM A;  1IQY A;  1ZO2 A;  2WOH A;  2GEX A;  2IMJ A;  1AVL A;  4RBN A;  3S29 A;  3CCJ 3;  3CCM 3;  3NBR A;  1TIJ A;  3OWY A;  3CPW 2;  1E3V A;  1IV7 A;  4K1U A;  3BLZ A;  3PS8 A;  1W6G A;  4U13 A;  3F40 A;  1JB2 A;  1QVF 2;  1QJG A;  3WOD G;  1YI2 3;  5AEW B;  1NO3 A;  3WOE B;  1OPY A;  4XDW A;  2GBW B;  1K9M 4;  3KSP A;  1IVV A;  3RGA A;  5EVH A;  4PEJ A;  3DGN A;  2MF7 A;  1DVD A;  3PGB A;  3S67 A;  2XFS A;  2XFT A;  4WYK A;  4N6T A;  2W56 B;  5LC7 A;  3I55 3;  3BNC A;  2I9W A;  3EJV A;  1YVB I;  1RN7 A;  4RNY A;  4HJL B;  3VF1 A;  1AV4 A;  1WQL B;  3D9R A;  1AR0 A;  1K73 4;  1YGE A;  4OVM A;  3VSY A;  1YHQ 3;  3B7C A;  2QGU A;  1Q40 A;  3OWU A;  1PU4 A;  3GZB A;  1ASK A;  1O7W B;  4X2H A;  3CU3 A;  5CK6 A;  3S28 A;  3CCS 3;  4MMX B;  1SQW A;  2CG1 A;  1STF I;  3ER7 A;  2YFI B;  1O7G B;  2D1W A;  3T8U A;  3CCQ 3;  5STD A;  3KE7 A;  5BXQ A;  5AYS C;  3EB8 A;  5D81 A;  4K61 A;  5D82 A;  1VQ4 3;  5IG5 A;  4XBT A;  3NBJ A;  1JRQ A;  2OQE C;  1DVC A;  1M9G A;  2W9Q A;  3FG4 A;  5AII A;  4L8O A;  4KVH A;  1JKG A;  2ZL8 A;  1HKX A;  1PFP A;  1OGX A;  3GRD A;  4WP5 A;  3K9M C;  4NHF A;  4N6L A;  3NV0 B;  2ZDJ A;  4RZM A;  4WWU C;  1YJW 3;  2CFG A;  2JQ5 A;  3EN8 A;  3HZP A;  5CXO A;  3M8C A;  2A15 A;  1IT8 A;  1GS3 A;  1OGZ A;  1OHP A;  3JUO A;  3K5T A;  3I56 3;  2R4I A;  1OHS A;  1NWW A;  3LTD A;  5AIH A;  1IQ8 A;  4LZI A;  1KD1 4;  1W6Y A;  3KII A;  2OOV A;  1JNQ A;  2W6J H;  4MMZ B;  4HZB B;  4FR9 A;  1CYU A;  4CDL A;  3EE1 A;  3OWS A;  1S72 3;  4KFF A;  3LTA A;  1NDO B;  3JUM A;  1FGR A;  3LZA A;  3F7X A;  4HVN A;  5EQL A;  2RFR A;  1AVK A;  3FF2 A;  3PXM A;  1KSI A;  2KXG A;  2WGO A;  2XR8 B;  3BNE A;  4HM8 B;  4MMY B;  3GZY B;  3QRD A;  2C10 A;  3N9H A;  1IU7 A;  3G4S 3;  1ZX2 A;  3CXC 2;  1N5P A;  1ULI B;  1UUW B;  4MEI A;  1TUH A;  4WFO A;  1RRH A;  4K1V A;  3PCR A;  2HML B;  2INX A;  3B8L A;  4AKZ A;  3WA2 X;  4HZ9 B;  3U1W A;  3CNX A;  3DMC A;  1OF5 A;  1W00 A;  1Y4K A;  5DRE A;  3F8X A;  1KWI A;  2IUK A;  2Z6B A;  3NX0 A;  2XGL A;  4LMI A;  4O02 B;  3X41 A;  1Q81 4;  2PZV A;  2RCD A;  5I97 A;  1GY7 A;  3K63 A;  1IDP A;  4XBX A;  3OV4 A;  2KCD A;  4ZM8 A;  1T5Y A;  2HMK B;  1ULJ B;  2KRT A;  4HM6 B;  1SIH A;  4HM4 B;  1EA2 A;  1QMA A;  2SBL A;  5TGN A;  1ROV A;  3G0K A;  4QWT A;  1N5H A;  3DGO A;  1N8Q A;  3DM8 A;  2LQV A;  2GU3 A;  1WTH A;  3MG3 A;  1IVW A;  3HX8 A;  5ELU A;  5JBS A;  2CFD A;  1JB5 A;  4L7K A;  4STD A;  3UL6 A;  1QVG 2;  4FMB A;  1LNH A;  4K90 B;  2W04 A;  1VQM 3;  1Z1S A;  4EBG A;  1UW1 A;  2O3O A;  3SED A;  3CC2 3;  3EBY A;  1K41 A;  1UI8 A;  3DY5 A;  3S27 A;  1A2V A;  3SOA A;  2HMO B;  3PYJ A;  1YJ9 3;  2P09 A;  3NQZ A;  1RJO A;  3EC9 A;  3JUQ A;  4IT7 A;  1VQ6 3;  2F99 A;  5HGR A;  3UB1 A;  3X40 A;  1JN5 B;  2OWP A;  3SVA A;  2CC3 A;  1TP6 A;  2W56 A;  1DMQ A;  1K28 A;  1W5Z A;  2ML6 A;  3SLU A;  2OOV C;  2OCT A;  2QIY A;  3DGL A;  4N6M A;  3CME 3;  1GYB A;  1BUQ A;  1M90 4;  1N8R 4;  1NB5 I;  4HYZ A;  2RSX A;  3LT8 A;  3UNL A;  4N6V 0;  1D6Z A;  3GZR A;  3V98 A;  1UUV B;  3CC4 3;  1WNH A;  4N6O B;  3CCE 3;  1HU9 A;  2XSH B;  3F14 A;  3CMA 3;  2C11 A;  3F7S A;  1QAL A;  3DXO A;  1DYU A;  1W01 A;  3OX9 A;  3CCU 3;  2F86 B;  3LTB A;  4LSO A;  1VQ8 3;  5CF2 A;  2Z76 A;  2GXF A;  2BMO B;  4G1M B;  2XGN A;  1Q7Y 4;  1IK3 A;  3KZT A;  2BHM A;  1W02 A;  3DGM A;  2D42 A;  3EBT A;  1MOL A;  2W2C A;  2V1L A;  2K0M A;  1TU5 A;  3LXU X;  2Z7A A;  3TDG A;  4FCM A;  4XDV A;  1FGT A;  3T8N A;  1M1X B;  2YFL B;  5CF1 A;  4NRE A;  4R9L A;  5IW9 A;  3GZX B;  3HII A;  1U8C B;  3MG1 A;  3G8Z A;  3WOF B;  1QAF A;  3LT9 A;  1VQ7 3;  2P0M A;  2IUJ A;  3ROB A;  3QK9 A;  1ISK A;  3KKG A;  3O8Y A;  1DMN A;  1GD3 A;  1C7H A;  3CPO A;  2XRX B;  3F9S A;  3RDE A;  1SPU A;  3ECF A;  3FSD A;  5AIG A;  5KP3 A;  2CK3 H;  1OCV A;  4GL6 A;  3CD6 3;  3EN1 B;  1US1 A;  5DRV A;  4X2O A;  3PZW A;  3LML A;  3D3L A;  1FGM A;  3IJE B;  2E2U A;  3KSE D;  1S5A A;  2W9P A;  3JUN A;  1ROA A;  1CQS A;  2FXT A;  3CCV 3;  4J9A A;  3CCL 3;  3KN4 A;  4N6U A;  2Y74 A;  1QAK A;  4BTY A;  2CFW A;  2CH9 A;  1NB3 I;  5FGO A;  3MYT A;  3J7Y d;  3H3H A;  3EHC A;  4IPB A;  5JPP A;  5A0O B;  1W4N A;  3NBB A;  1A90 A;  4MJD A;  2XEP A;  3V99 A;  4RNZ A;  1W2Z A;  3CCR 3;  1A67 A;  1OAC A;  8CHO A;  1VQP 3;  4JRF A;  3FZW A;  4O2H A;  2XF3 A;  3G6E 3;  1NU3 A;  2FNQ A;  3SX1 A;  3MSO A;  1LVN A;  1G96 A;  3T0U A;  3X42 A;  2OTL 3;  1Q42 A;  4HM3 B;  3LYG A;  1OH0 A;  2YFJ B;  2ML5 A;  2CWV A;  3AMO B;  3FGY A;  3L0R A;  3RGR A;  2CFK A;  2WOF A;  5IG0 A;  2QA4 3;  4XBY A;  2CKF B;  3K0Z A;  4GB5 A;  1R4C A;  2XH9 A;  2LYX A;  2Q07 A;  4H3U A;  1GD4 A;  4EXR A;  2Z77 A;  1E97 A;  1W6C A;  3FF0 A;  2FGT A;  1VQL 3;  4O8S A;  1EQK A;  3OW2 2;  2CWU A;  5EEO A;  3MKI A;  2CIU A;  1O7M B;  2CHC A;  4JF8 A;  4I4K A;  4EC6 A;  1WMP A;  1NJI 4;  1J2B A;  4N3V A;  3LOY A;  2HMN B;  3N8B A;  4FMC A;  5LC6 A;  4XB5 A;  3FLJ A;  1IT7 A;  1M1K 4;  4J8T A;  1JV2 B;  3LH4 A;  4KFE A;  2WGQ A;  1IVX A;  2B1X B;  4BTW A;  2BNG A;  4FCJ A;  4R9K A;  3OXA A;  2BO9 B;  4O3V A;  1O7H B;  2BT3 A;  4WYK B;  1JN5 A;  2BMQ B;  1VZZ A;  3NXJ A;  1FGO A;  2E2T A;  4AKY A;  5AEU B;  3X3X A;  1Q86 4;  4IIA A;  3N54 B;  4ORL A;  2STD A;  3Q2P A;  1FGQ A;  3VGN A;  5AI1 A;  1EG9 B;  3KFQ C;  1Q40 B;  3K7C A;  3MWZ A;  2GU1 A;  4OUQ A;  1LXE A;  3EF8 A;  1O7P B;  4N6N B;  5AYR B;  1IV9 A;  2CFL A;  3NM7 A;  4BTX A;  5G2G A;  3MHE A;  4XM4 A;  4KZ1 A;  5IEN A;  3JVC A;  2CG0 A;  3IMA B;  4FMA A;  1SJW A;  4R4K A;  1YJN 3;  7STD A;  1FUW A;  3X3Y A;  4HM5 B;  1F8N A;  1FA3 A;  4HM7 B;  5IEO A;  3IPT A;  1MNL A;  3A76 A;  2P05 A;  3SOY A;  2L4V A;  3G71 3;  4L8P A;  1CYV A;  4HBR A;  3BNB A;  3S5C A;  2OTJ 3;  3LTC A;  2YX9 A;  2GBX B;  5IG3 A;  2PNC A;  2E2V A;  1LOX A;  3B4P A;  3E99 A;  4R1K A;  1IVU A;  4TX4 A;  3CC7 3;  1D6Y A;  1E3R A;  3V92 A;  3X3Z A;  2QEX 3;  2O9U X;  2HMJ B;  3GAX A;  3JUP A;  3DZL A;  4KFD A;  2JDI H;  1OHO A;  3NV0 A;  1JKG B;  3PCS A;  1N9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...