1FUWA

Solution structure and backbone dynamics of a double mutant single-chain monellin(scm) determined by nuclear magnetic resonance spectroscopy
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
GEWEIIEIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIKPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Solution structure, backbone dynamics, and stability of a double mutant single-chain monellin. structural origin of sweetness.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1fuwA00
1CYVA 2W9QA 1N9JA 3L0RA 3S67A 5LC6A 3NX0A 1STFI 4EYCA 2KXGA 3Q2PA 3SVAA 2BO9B 3PS8A 1DVDA 4LZIA 5A0OB 5ELJA 3PYJA 1GD3A 3MWZA 1TIJA 1IV9A 3LH4A 1NB5I 3KFQC 1EQKA 1LXEA 1G96A 2OCTA 4N6TA 2W9PA 2CH9A 1RN7A 5EQLA 4CCVA 1CYUA 4N6NB 4N6MA 3UL6A 3KSED 3K9MC 1R4CA 3QRDA 1MOLA 1N5HA 4ZM8A 4N6UA 3IMAB 3PXMA 1FUWA 2O9UX 5ELUA 4N6OB 1FA3A 1IV7A 1A67A 1PFPA 1YVBI 1DVCA 1A90A 4N6LA 1GD4A 1ROAA 5LC7A 1MNLA 1NB3I 1CEWI 4IT7A 1WNHA 1KWIA 4TX4A 1N5PA 4N6V0 3UL5A 3GAXA 1M9GA
chains in the Genus database with same CATH superfamily
1S5AA 2CFGA 1CYVA 2W04A 1BOXA 3LTCA 1Q40B 4XBYA 1RHLA 2W03A 3JUNA 5EEOA 5STDA 1QMAA 1V74A 1S723 3GRDA 4RZMA 3DGMA 3S67A 5LC6A 1B2SA 3SOAA 1BIRA 2E2UA 3GZXB 1EUIC 1JN5B 3WHOA 4HM2B 3CNXA 4BIRA 4HZBB 3G16A 1EA2A 1QALA 3K63A 1JB2A 3Q2PA 4HM0B 1DVDA 9RNTA 4O8SA 1X1XA 2KF5A 2P0MA 1W6YA 1RGAA 4BL3A 4Q53A 5ELJA 1T5YA 4AKYA 1YIJ3 4HM7B 1KSIA 1HYFA 5IENA 3I563 4LEHA 3MWZA 3BU4A 3LXUX 5HGRA 3D5IA 4KT3B 5BXQA 1BSCA 3AHSA 7STDA 4WYKA 3KFQC 5AYSC 2Y74A 4HJLB 1TRPA 1BGSA 2AADA 3S28A 1Q9EA 1YJ93 1C54A 1UCIA 3FG3A 3BNCA 2F86B 1I2EA 2W9PA 1DETA 1UGIA 5AEWB 3HZPA 2IA7A 1IT8A 4XM4A 1RN7A 2UGIA 1DE3A 1MWRA 2XSOB 5AEUB 3FF0A 3SLUA 4NPBA 2QGUA 3SEDA 1W7CA 4BU4A 1STDA 4OK0A 4XBTA 1BSBA 2WGQA 4J8TA 4R4KA 4BTXA 2O3OA 5AIGA 1GY7A 1AY7A 1OHPA 2OOVC 2ML6A 1BNGA 3TDGA 1RNTA 2C11A 2H0GA 2PNCA 3K9MC 1E97A 1R4CA 1W6GA 5IEPA 3LT8A 3MPHA 2E2VA 4LGQA 1ULJB 3RGRA 1OF5A 1N5HA 3SYUA 4ZM8A 5JBSA 3FGYA 4N6UA 2YX9A 4KVHA 4KZ1A 5IF6A 4L7KA 1UCJA 3OW22 1BUJA 3G713 3CNMA 1BSAA 3LMLA 2R4IA 3EN1B 3VF1A 2CHCA 1LNIA 1A2KA 2HMJB 1LOVA 2V1LA 1IDPA 2CG1A 1MGRA 3NUVA 5ELUA 1NJI4 1AVKA 3E99A 1PY3A 3ZG0A 1A67A 4L8PA 1PFPA 1YVBI 3GSPA 3IPTA 2W56A 6RNTA 3B4OA 3JUMA 1BAOA 3CCQ3 3FZWA 1RDSA 3BLZA 4GSPA 1X1UA 5JPPA 2KF6A 3FCSB 3BNDA 3AGOA 3I553 3BIRA 4FMDA 2XF3A 1X1YA 2Z6BA 3DZLA 2OWPA 3LZAA 3H3HA 1JKGA 2F98A 3MSOA 1NB3I 1US1A 3HI7A 1IQ8A 4HM3B 4IT7A 5CLKA 1W6CA 4FCMA 3UJMA 1PYLA 2UUGC 4EV5A 1IQYA 1T2IA 4TX4A 3X40A 3EC9A 3N9HA 3B4PA 4I5QA 1EKMA 4N3VA 3CCV3 1OGZA 1OH0A 1BRNL 1O7MB 3EB8A 1IVVA 2YFIB 3OWYA 1JV2B 4O02B 3HX8A 4WP5A 2OTL3 3MYTA 2W9QA 1DMMA 1RGGA 1VQO3 2GBXB 4XBXA 5AIFA 1VQ73 3HIGA 3CCE3 4FMBA 3LOYA 1DMNA 2QIYA 3NX0A 1I2FA 2HMKB 1B2XA 4EYCA 1V58A 2FNQA 2KXGA 4CPKA 5FGOA 4X2HA 5HOHA 1E3RA 3LT9A 5IG3A 3CPW2 3RDEA 1W02A 2RGQA 3B7CA 3PS8A 4WYKB 1B20A 1AVLA 3FG4A 4FCJA 4HM1B 2CX0A 2YFJB 3FG1A 4HVNA 1Q814 1BSDA 3DM8A 1SPUA 1RCLA 2CFKA 1UI8A 3NHXA 2CC3A 1D6YA 1I2GA 1IV9A 1A2VA 2BHMA 1O7HB 2BU4A 2HOHA 3LH4A 3MG3A 1WTHA 1BU4A 1VQK3 2XFSA 1EEJA 2ZL8A 4HYZA 2F4YA 1I0XA 4HBRA 3JVCA 2RBIA 1LXEA 1BNFA 3EBTA 1G96A 3T0UA 1K28A 5IERA 4JRFA 2OQEA 5D82A 3V92A 3CPOA 1VQ93 1LQMB 3NM7A 4GL6A 4N6TA 3CCR3 3CCU3 4MMYB 4NHFA 3STDA 1KQS2 4QWTA 2IMJA 1CQSA 1OUNA 2CH9A 1SARA 5BU4A 2XFTA 4DKIA 5CF2A 5EQLA 1RCKA 3LTAA 5DREA 3EN8A 1Q864 3PCRA 1OF5B 1KC84 1CYUA 1A2PA 4RNTA 3U1WA 1MGWA 5TGNA 4N6MA 3URPA 3EHCA 2CFDA 2CFLA 3UL6A 4ILFA 3B8LA 4H3UA 3KSED 1MWUA 1RGLA 1E3VA 3VGNA 5IG4A 2IUJA 2QEX3 3KKGA 4R9KA 1U8CB 3WODG 1X1WA 1TFOA 3QRDA 2PZVA 1RSNA 4XDVA 5IEOA 5GSPA 4R1KA 1RGHA 1N8QA 3S29A 2W56B 3F40A 1TTOA 1UW1A 1TUHA 3JUPA 1DMQA 3K0ZA 3CCS3 4KFEA 1JZDA 1BRKA 1UDII 1VQ43 2A15A 3D5GA 3EE1A 3PXMA 1UUGB 3X41A 3FLJA 1ASKA 1D6UA 4IIAA 1Q7Y4 3UNLA 2W2CA 5D83A 3NBJA 5AYRB 3D79A 2OTJ3 3NXJA 1IT7A 1JKGB 3N8BA 1SIHA 5M1AA 1Q7HA 2ML5A 1B21A 3F7SA 4J9AA 1J2BA 4GHOA 1AV4A 1A90A 1FGQA 3NM2A 2GEYA 2GBWB 2K54A 2L4VA 1GMPA 5M19A 1W00A 1AR0A 1ROAA 4MJDA 1RTUA 1OCVA 3O8YA 1GSPA 4J5GA 1CEWI 3AHWA 4BTYA 3F7XA 1KWIA 1HU9A 3GZBA 3NQYA 1K9M4 5G1KA 1VQM3 2RNTA 1U5OA 2FXTA 3GAXA 1M9GA 3Q1CA 3H51A 4RBNA 1FGRA 5CK6A 1YGEA 3PCSA 2CX1A 1O7WB 2L1SA 1SIIA 1GOUA 2D42A 3DY5A 3EJVA 3CU3A 3G4S3 1N9JA 2KCDA 3OX9A 1WMNA 4R80A 3OXAA 1W4NA 3ROBA 2UX0A 1ISKA 3K5TA 3DGLA 4EXRA 1JBSA 3G0KA 3QK9A 3DGOA 1AQZA 2W6JH 3CCL3 1VQP3 3DMCA 3PGBA 2MC8A 4WWUC 5IW9A 1SJWA 3SVAA 2KF3A 1FZUA 2Z76A 2Z77A 5JPUA 2Z7AA 4GB5A 4LZIA 1N9EA 5G1LA 1MWTA 2HMLB 1LOYA 3NBBA 1YI23 4HM4B 3PYJA 4HKVB 3BB9A 3F8HA 2OQEC 1VQ83 1YJN3 1TFKA 3OWSA 3NQZA 3G6E3 4PEJA 3HK4A 4FCZA 3SX1A 1VQL3 2Y73A 4CDLA 1T2HA 1BRSA 2CWVA 3NBRA 3DGYA 3V99A 3CME3 1BUQA 1UCLA 2OCTA 2RSXA 2F99A 3KCHA 3X42A 3F8XA 1M1XB 1RGCA 1RKYA 3JUQA 1RJOA 4EC6A 3LTDA 2JDIH 5KP3A 3DGNA 3WMDA 4IPBA 1D6ZA 3WA2X 2I9WA 3DUKA 2WO0A 2D1WA 3BNBA 2HMNB 2WOHA 3CXC2 1YJW3 1VZZA 2HMMB 1IU7A 1RGEA 2B1XB 3NV0A 1JZOA 3CC43 6GSPA 2XEPA 3EF8A 4G1MB 1UGHI 3X3ZA 2C10A 1W2ZA 1GOYA 1LOWA 1FGOA 2C4BA 1FW7A 3CD63 1BRIA 1G02A 1GYBA 2J8XB 3G8ZA 3CCJ3 2GXFA 1R4YA 5AI1A 2RCDA 2XSHB 3MG1A 4L8OA 4XDWA 1JBRA 4MMXB 2CWUA 3D4AA 2HMOB 1BNRA 5M18A 1CH0A 5CF1A 2FGTA 2WOFA 2YFLB 1BRHA 4HM5B 3CC23 1IQXA 1FUWA 2BMRB 2O9UX 1RRHA 2R41A 4N6OB 3GZRA 4KFDA 2GEXA 3PZWA 4O2HA 3MHEA 3WOFB 1DVCA 1F8NA 2WGOA 3FH1A 3LYGA 2K0MA 3K7CA 1ULIB 1GOVA 2Q07A 2P0XA 4HM8B 1I3FA 1OPYA 3KN4A 3CCM3 4FMCA 3MG2A 1T3BA 1RMSA 1HZ1A 2M7OA 2XRXB 1K41A 3EX9A 1ZS7A 3T8NA 1VQ53 4HAAA 3DXOA 2GU1A 5RNTA 3KE7A 1B3SA 1BVIA 4FR9A 4AKZA 3OV4A 1O7PB 2ZDJA 4KFFA 4OUQA 4X2OA 1QVG2 2CK3H 2H0IA 2CKFB 1SQWA 3HOHA 4LMIA 4J5KA 1OHSA 3V98A 3EBYA 3HIIA 1N5PA 1RN1A 1YIT3 3N54B 3U97A 1IVXA 1B27A 2H0HA 2IUKA 3IJEB 4JF8A 4NREA 8RNTA 1O7GB 1IYYA 3S27A 1W5ZA 3RGAA 2IYJA 5DRVA 3WOEB 1Q824 2SARA 2CW9A 4ORLA 5IG5A 1UUWB 2BIRA 1LQGC 3L0RA 5FW5A 1K734 4LSOA 3GZYB 6STDA 1RGKA 3LTBA 3AMOA 1STFI 2INXA 2P09A 3DH2A 5KP1A 1IVUA 4K61A 1M904 1Z1SA 4OVMA 5EVHA 2BO9B 1FYSA 1LNHA 2GSPA 1TRQA 3EQQB 2XH9A 1BANA 4EW5A 4K1VA 2B24B 1Q40A 5A0OB 3WR2A 5BVBA 2P05A 3D3LA 1NNVA 1GD3A 1TIJA 1JN5A 2XGNA 5AIIA 2KRTA 1FUSA 3M8CA 1FGMA 4FMAA 4HOHA 3WA3A 2P38A 3D9RA 1QAKA 1YGWA 1YNVX 2BNGA 4STDA 3FSDA 4U13A 1L5GB 2CWTA 4XB5A 1NB5I 1BNEA 3GWRA 4K90B 1QVF2 1YVSA 2CFWA 2CG0A 1Q42A 3J7Yd 3NV0B 2RFRA 4BL2A 2IY2A 1C7HA 5KP4A 1K8A4 1I70A 2ZHXB 2F56A 1WMOA 3SXXA 1BRGA 5CXOA 2XR8B 1GS3A 3CMA3 1IK3A 7RNTA 1WQLB 1V57A 2GU3A 2MF7A 1KD14 3X3YA 1B2UA 3S5CA 3UB1A 4CCVA 3A76A 1B2MA 1RGFA 4MMZB 4N6NB 1DYUA 1NO3A 3ZG5A 1JBTA 1TP6A 2AAEA 2E2TA 1JNQA 1O7NB 1ZX2A 2BT3A 3SOYA 4EBGA 1VQ63 1QAFA 1TJDA 3KIIA 1RN4A 4WFOA 1M1K4 3ER7A 2JQ5A 1NDOB 1FGTA 2QA43 1YHQ3 1BNJA 2CIUA 1BRJA 1ROVA 4HZ9B 1W01A 3ZFZA 3F14A 1MOLA 1Y4KA 1WMPA 5D81A 1UUVB 1LRAA 5G2GA 5BIRA 1ZGXA 2OOVA 3AGNA 4R9LA 1LVNA 3IMAB 3X3XA 4MEIA 8CHOA 1RRLA 3KZTA 4K1UA 1GMRA 3ECFA 3I0YA 1BNSA 2F5MA 1OHOA 1GY5A 2SBLA 2LQVA 1PU4A 3CC73 3Q90A 1N8R4 1FA3A 1LOXA 1IV7A 1NWWA 2F5WA 1QJGA 5IG0A 3RNTA 3F9SA 5I97A 1NU3A 1B2ZA 1G0TA 1RLSA 1UCKA 4HM6B 2ZA4A 1GY6A 3FF2A 7GSPA 1RNBA 1I0VA 1OGXA 3FKAA 1UI7A 4EV2A 2STDA 5AIHA 1W2B2 3OWUA 2LYXA 3ALAA 4N6LA 3T8UA 4WHAA 1I3IA 1MWSA 3A5EA 3BNEA 1GMQA 4BTWA 1GD4A 3WDGB 1FUTA 1JRQA 1VQQA 3Q3FA 3VSYA 5LC7A 1TU5A 1MNLA 1BSEA 4CJNA 4LYLB 1EQKA 2BMOB 1ZO2A 2W0QA 4O3VA 4RNYA 1VQN3 1HKXA 1WNHA 2XGLA 1JB5A 3JUOA 1JB4A 2BMQB 3KSPA 3MKIA 2K3DA 2KF4A 1JJ22 4RNZA 3AMOB 1EG9B 2KAAA 4N6V0 3UL5A 1BNIA 1IVWA 1OACA 4H61A 4AEQA 1I8VA 4I4KA
chains in the Genus database with same CATH topology
1S5AA 2CFGA 1CYVA 2W04A 3LTCA 1Q40B 4XBYA 2W03A 3JUNA 5EEOA 5STDA 1QMAA 1V74A 1S723 3GRDA 4RZMA 3DGMA 3S67A 5LC6A 3SOAA 2E2UA 3GZXB 1JN5B 4HM2B 3CNXA 4HZBB 3G16A 1EA2A 1QALA 3K63A 1JB2A 3Q2PA 4HM0B 1DVDA 4O8SA 2P0MA 1W6YA 4Q53A 5ELJA 1T5YA 4AKYA 1YIJ3 4HM7B 1KSIA 5IENA 3I563 4LEHA 3MWZA 3LXUX 5HGRA 5BXQA 7STDA 4WYKA 3KFQC 5AYSC 2Y74A 4HJLB 3S28A 1YJ93 3FG3A 3BNCA 2F86B 2W9PA 5AEWB 3HZPA 2IA7A 1IT8A 4XM4A 1RN7A 2XSOB 5AEUB 3FF0A 3SLUA 2QGUA 3SEDA 1W7CA 1STDA 4OK0A 4XBTA 2WGQA 4J8TA 4R4KA 4BTXA 2O3OA 5AIGA 1GY7A 1OHPA 2OOVC 2ML6A 3TDGA 2C11A 2PNCA 3K9MC 1E97A 1R4CA 1W6GA 5IEPA 3LT8A 3MPHA 2E2VA 4LGQA 1ULJB 3RGRA 1OF5A 1N5HA 4ZM8A 5JBSA 3FGYA 4N6UA 2YX9A 4KVHA 4KZ1A 5IF6A 4L7KA 3OW22 3G713 3CNMA 3LMLA 2R4IA 3EN1B 3VF1A 2CHCA 1A2KA 2HMJB 2V1LA 1IDPA 2CG1A 3NUVA 5ELUA 1NJI4 1AVKA 3E99A 1A67A 4L8PA 1PFPA 1YVBI 3IPTA 2W56A 3B4OA 3JUMA 3CCQ3 3FZWA 3BLZA 5JPPA 3FCSB 3BNDA 3I553 4FMDA 2XF3A 2Z6BA 3DZLA 2OWPA 3LZAA 3H3HA 1JKGA 2F98A 3MSOA 1NB3I 1US1A 3HI7A 1IQ8A 4HM3B 4IT7A 5CLKA 1W6CA 4FCMA 3UJMA 4EV5A 1J2BA 1IQYA 4TX4A 3X40A 3EC9A 3N9HA 3B4PA 1EKMA 4N3VA 3CCV3 1OGZA 1OH0A 1O7MB 3EB8A 1IVVA 2YFIB 3OWYA 1JV2B 4O02B 3HX8A 4WP5A 2OTL3 3MYTA 2W9QA 1DMMA 1VQO3 2GBXB 4XBXA 5AIFA 1VQ73 3HIGA 3CCE3 4FMBA 3LOYA 1DMNA 2QIYA 3NX0A 2HMKB 4EYCA 2FNQA 2KXGA 5FGOA 4X2HA 5IG3A 1E3RA 3LT9A 3CPW2 3RDEA 1W02A 2RGQA 3B7CA 3PS8A 4WYKB 1AVLA 3FG4A 4FCJA 4HM1B 2YFJB 3FG1A 4HVNA 1Q814 3DM8A 1SPUA 2CFKA 1UI8A 3NHXA 2CC3A 1D6YA 1IV9A 1A2VA 2BHMA 1O7HB 3LH4A 3MG3A 1WTHA 1VQK3 2XFSA 2ZL8A 4HYZA 1BUQA 4HBRA 3JVCA 1EQKA 1LXEA 3EBTA 3T0UA 1G96A 5IERA 1K28A 4JRFA 2OQEA 5D82A 3V92A 3CPOA 1VQ93 3NM7A 4GL6A 4N6TA 3CCR3 3CCU3 4MMYB 4NHFA 3STDA 1KQS2 4QWTA 2IMJA 1CQSA 1OUNA 2CH9A 2XFTA 5CF2A 5EQLA 3LTAA 5DREA 3EN8A 1Q864 3PCRA 1OF5B 1KC84 1CYUA 3U1WA 5TGNA 4N6MA 3EHCA 2CFDA 2CFLA 3UL6A 3B8LA 4H3UA 3KSED 2QEX3 1E3VA 3VGNA 5IG4A 2IUJA 3KKGA 4R9KA 1U8CB 3WODG 1TFOA 3QRDA 2PZVA 4XDVA 5IEOA 4R1KA 1N8QA 3S29A 2W56B 3F40A 1UW1A 1TUHA 3JUPA 1DMQA 3K0ZA 3CCS3 4KFEA 1VQ43 2A15A 3EE1A 3PXMA 3X41A 3FLJA 1ASKA 1D6UA 4IIAA 1Q7Y4 3UNLA 2W2CA 5D83A 3NBJA 5AYRB 2OTJ3 3NXJA 1JKGB 1IT7A 3N8BA 1SIHA 2ML5A 3F7SA 4J9AA 1AV4A 1A90A 1FGQA 3NM2A 2GEYA 2GBWB 2K54A 2L4VA 1W00A 1AR0A 1ROAA 4MJDA 1OCVA 3O8YA 1CEWI 4BTYA 3F7XA 1KWIA 1HU9A 3GZBA 3NQYA 1K9M4 1VQM3 1U5OA 2FXTA 3GAXA 1M9GA 3Q1CA 3H51A 4RBNA 1FGRA 5CK6A 1YGEA 3PCSA 1O7WB 1SIIA 2D42A 3DY5A 3EJVA 3CU3A 3G4S3 1N9JA 2KCDA 3OX9A 1WMNA 4R80A 3OXAA 1W4NA 3ROBA 2UX0A 1ISKA 3K5TA 3DGLA 4EXRA 3G0KA 3QK9A 3DGOA 2W6JH 3CCL3 1VQP3 3DMCA 3PGBA 2MC8A 4WWUC 5IW9A 1SJWA 3SVAA 2Z76A 2Z77A 5JPUA 2Z7AA 4GB5A 4LZIA 1N9EA 2HMLB 3NBBA 1YI23 4HM4B 3PYJA 4HKVB 3BB9A 3F8HA 2OQEC 1VQ83 1YJN3 1TFKA 3OWSA 3NQZA 3G6E3 4PEJA 3HK4A 4FCZA 3SX1A 1VQL3 2Y73A 4CDLA 2CWVA 3NBRA 3V99A 3CME3 2OCTA 2RSXA 2F99A 3X42A 3F8XA 1M1XB 1RKYA 3JUQA 1RJOA 4EC6A 3LTDA 2JDIH 5KP3A 3DGNA 3WMDA 4IPBA 1D6ZA 3WA2X 2I9WA 3DUKA 2WO0A 2D1WA 3BNBA 2HMNB 2WOHA 3CXC2 1YJW3 1VZZA 2HMMB 1IU7A 2B1XB 3NV0A 3CC43 2XEPA 3EF8A 4G1MB 3X3ZA 2C10A 1W2ZA 1FGOA 3CD63 3CCJ3 1GYBA 3G8ZA 2GXFA 5AI1A 2RCDA 2XSHB 3MG1A 4L8OA 4XDWA 4MMXB 2CWUA 2HMOB 5CF1A 2FGTA 2WOFA 2YFLB 4HM5B 3CC23 1IQXA 1FUWA 2BMRB 2O9UX 1RRHA 4N6OB 3GZRA 4KFDA 2GEXA 3PZWA 4O2HA 3MHEA 3WOFB 1DVCA 1F8NA 2WGOA 3FH1A 3LYGA 2K0MA 3K7CA 1ULIB 4HM8B 2Q07A 2P0XA 1OPYA 3KN4A 3CCM3 4FMCA 3MG2A 2M7OA 2XRXB 3EX9A 1K41A 3T8NA 1VQ53 3DXOA 2GU1A 3KE7A 4FR9A 4AKZA 3OV4A 1O7PB 2ZDJA 4KFFA 4OUQA 4X2OA 1QVG2 2CK3H 2CKFB 1SQWA 4LMIA 1OHSA 3V98A 3EBYA 3HIIA 1N5PA 1YIT3 3N54B 3U97A 1IVXA 2IUKA 3IJEB 4JF8A 4NREA 1O7GB 3S27A 1W5ZA 3RGAA 3WOEB 5DRVA 1Q824 2CW9A 4ORLA 5IG5A 1UUWB 5FW5A 3L0RA 1K734 4LSOA 3GZYB 6STDA 3LTBA 3AMOA 1STFI 2INXA 2P09A 5KP1A 1IVUA 4K61A 1M904 1Z1SA 4OVMA 5EVHA 2BO9B 1LNHA 3EQQB 2XH9A 4K1VA 2B24B 1Q40A 5A0OB 5BVBA 2P05A 3D3LA 1GD3A 1TIJA 1JN5A 2XGNA 5AIIA 2KRTA 3M8CA 4FMAA 1FGMA 3WA3A 2P38A 3D9RA 1QAKA 4STDA 2BNGA 4U13A 3FSDA 1L5GB 2CWTA 4XB5A 1NB5I 3GWRA 4K90B 1QVF2 2CFWA 2CG0A 1Q42A 3J7Yd 3NV0B 2RFRA 1C7HA 5KP4A 1K8A4 3SXXA 1WMOA 5CXOA 2XR8B 1GS3A 3CMA3 1IK3A 1WQLB 2GU3A 2MF7A 1KD14 3X3YA 3S5CA 3UB1A 4CCVA 3A76A 4MMZB 4N6NB 1DYUA 1NO3A 1TP6A 2E2TA 1JNQA 1O7NB 1ZX2A 2BT3A 3SOYA 4EBGA 1VQ63 1QAFA 3KIIA 4WFOA 1M1K4 3ER7A 2JQ5A 1NDOB 1FGTA 2QA43 1YHQ3 2CIUA 4HZ9B 1ROVA 1W01A 3F14A 1MOLA 1Y4KA 1WMPA 5D81A 1UUVB 5G2GA 2OOVA 4R9LA 1LVNA 3IMAB 3X3XA 4MEIA 8CHOA 1RRLA 3KZTA 4K1UA 3ECFA 3I0YA 1OHOA 1GY5A 2SBLA 2LQVA 1PU4A 3CC73 3Q90A 1N8R4 1FA3A 1LOXA 1IV7A 1NWWA 1QJGA 5IG0A 3F9SA 5I97A 1NU3A 4HM6B 1GY6A 3FF2A 1OGXA 3FKAA 1UI7A 4EV2A 2STDA 5AIHA 1W2B2 3OWUA 2LYXA 3ALAA 4N6LA 3T8UA 4WHAA 3BNEA 4BTWA 1GD4A 3WDGB 1JRQA 1TU5A 3VSYA 5LC7A 1MNLA 2BMOB 1ZO2A 2W0QA 4O3VA 4RNYA 1VQN3 1HKXA 1WNHA 2XGLA 1JB5A 3JUOA 1JB4A 2BMQB 3KSPA 3MKIA 1JJ22 4RNZA 3AMOB 1EG9B 4N6V0 3UL5A 1IVWA 1OACA 4H61A 4AEQA 4I4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYV A;  2W9Q A;  1N9J A;  3L0R A;  3S67 A;  5LC6 A;  3NX0 A;  1STF I;  4EYC A;  2KXG A;  3Q2P A;  3SVA A;  2BO9 B;  3PS8 A;  1DVD A;  4LZI A;  5A0O B;  5ELJ A;  3PYJ A;  1GD3 A;  3MWZ A;  1TIJ A;  1IV9 A;  3LH4 A;  1NB5 I;  3KFQ C;  1EQK A;  1LXE A;  1G96 A;  2OCT A;  4N6T A;  2W9P A;  2CH9 A;  1RN7 A;  5EQL A;  4CCV A;  1CYU A;  4N6N B;  4N6M A;  3UL6 A;  3KSE D;  3K9M C;  1R4C A;  3QRD A;  1MOL A;  1N5H A;  4ZM8 A;  4N6U A;  3IMA B;  3PXM A;  1FUW A;  2O9U X;  5ELU A;  4N6O B;  1FA3 A;  1IV7 A;  1A67 A;  1PFP A;  1YVB I;  1DVC A;  1A90 A;  4N6L A;  1GD4 A;  1ROA A;  5LC7 A;  1MNL A;  1NB3 I;  1CEW I;  4IT7 A;  1WNH A;  1KWI A;  4TX4 A;  1N5P A;  4N6V 0;  3UL5 A;  3GAX A;  1M9G A; 
#chains in the Genus database with same CATH topology
 1S5A A;  2CFG A;  1CYV A;  2W04 A;  1BOX A;  3LTC A;  1Q40 B;  4XBY A;  1RHL A;  2W03 A;  3JUN A;  5EEO A;  5STD A;  1QMA A;  1V74 A;  1S72 3;  3GRD A;  4RZM A;  3DGM A;  3S67 A;  5LC6 A;  1B2S A;  3SOA A;  1BIR A;  2E2U A;  3GZX B;  1EUI C;  1JN5 B;  3WHO A;  4HM2 B;  3CNX A;  4BIR A;  4HZB B;  3G16 A;  1EA2 A;  1QAL A;  3K63 A;  1JB2 A;  3Q2P A;  4HM0 B;  1DVD A;  9RNT A;  4O8S A;  1X1X A;  2KF5 A;  2P0M A;  1W6Y A;  1RGA A;  4BL3 A;  4Q53 A;  5ELJ A;  1T5Y A;  4AKY A;  1YIJ 3;  4HM7 B;  1KSI A;  1HYF A;  5IEN A;  3I56 3;  4LEH A;  3MWZ A;  3BU4 A;  3LXU X;  5HGR A;  3D5I A;  4KT3 B;  5BXQ A;  1BSC A;  3AHS A;  7STD A;  4WYK A;  3KFQ C;  5AYS C;  2Y74 A;  4HJL B;  1TRP A;  1BGS A;  2AAD A;  3S28 A;  1Q9E A;  1YJ9 3;  1C54 A;  1UCI A;  3FG3 A;  3BNC A;  2F86 B;  1I2E A;  2W9P A;  1DET A;  1UGI A;  5AEW B;  3HZP A;  2IA7 A;  1IT8 A;  4XM4 A;  1RN7 A;  2UGI A;  1DE3 A;  1MWR A;  2XSO B;  5AEU B;  3FF0 A;  3SLU A;  4NPB A;  2QGU A;  3SED A;  1W7C A;  4BU4 A;  1STD A;  4OK0 A;  4XBT A;  1BSB A;  2WGQ A;  4J8T A;  4R4K A;  4BTX A;  2O3O A;  5AIG A;  1GY7 A;  1AY7 A;  1OHP A;  2OOV C;  2ML6 A;  1BNG A;  3TDG A;  1RNT A;  2C11 A;  2H0G A;  2PNC A;  3K9M C;  1E97 A;  1R4C A;  1W6G A;  5IEP A;  3LT8 A;  3MPH A;  2E2V A;  4LGQ A;  1ULJ B;  3RGR A;  1OF5 A;  1N5H A;  3SYU A;  4ZM8 A;  5JBS A;  3FGY A;  4N6U A;  2YX9 A;  4KVH A;  4KZ1 A;  5IF6 A;  4L7K A;  1UCJ A;  3OW2 2;  1BUJ A;  3G71 3;  3CNM A;  1BSA A;  3LML A;  2R4I A;  3EN1 B;  3VF1 A;  2CHC A;  1LNI A;  1A2K A;  2HMJ B;  1LOV A;  2V1L A;  1IDP A;  2CG1 A;  1MGR A;  3NUV A;  5ELU A;  1NJI 4;  1AVK A;  3E99 A;  1PY3 A;  3ZG0 A;  1A67 A;  4L8P A;  1PFP A;  1YVB I;  3GSP A;  3IPT A;  2W56 A;  6RNT A;  3B4O A;  3JUM A;  1BAO A;  3CCQ 3;  3FZW A;  1RDS A;  3BLZ A;  4GSP A;  1X1U A;  5JPP A;  2KF6 A;  3FCS B;  3BND A;  3AGO A;  3I55 3;  3BIR A;  4FMD A;  2XF3 A;  1X1Y A;  2Z6B A;  3DZL A;  2OWP A;  3LZA A;  3H3H A;  1JKG A;  2F98 A;  3MSO A;  1NB3 I;  1US1 A;  3HI7 A;  1IQ8 A;  4HM3 B;  4IT7 A;  5CLK A;  1W6C A;  4FCM A;  3UJM A;  1PYL A;  2UUG C;  4EV5 A;  1IQY A;  1T2I A;  4TX4 A;  3X40 A;  3EC9 A;  3N9H A;  3B4P A;  4I5Q A;  1EKM A;  4N3V A;  3CCV 3;  1OGZ A;  1OH0 A;  1BRN L;  1O7M B;  3EB8 A;  1IVV A;  2YFI B;  3OWY A;  1JV2 B;  4O02 B;  3HX8 A;  4WP5 A;  2OTL 3;  3MYT A;  2W9Q A;  1DMM A;  1RGG A;  1VQO 3;  2GBX B;  4XBX A;  5AIF A;  1VQ7 3;  3HIG A;  3CCE 3;  4FMB A;  3LOY A;  1DMN A;  2QIY A;  3NX0 A;  1I2F A;  2HMK B;  1B2X A;  4EYC A;  1V58 A;  2FNQ A;  2KXG A;  4CPK A;  5FGO A;  4X2H A;  5HOH A;  1E3R A;  3LT9 A;  5IG3 A;  3CPW 2;  3RDE A;  1W02 A;  2RGQ A;  3B7C A;  3PS8 A;  4WYK B;  1B20 A;  1AVL A;  3FG4 A;  4FCJ A;  4HM1 B;  2CX0 A;  2YFJ B;  3FG1 A;  4HVN A;  1Q81 4;  1BSD A;  3DM8 A;  1SPU A;  1RCL A;  2CFK A;  1UI8 A;  3NHX A;  2CC3 A;  1D6Y A;  1I2G A;  1IV9 A;  1A2V A;  2BHM A;  1O7H B;  2BU4 A;  2HOH A;  3LH4 A;  3MG3 A;  1WTH A;  1BU4 A;  1VQK 3;  2XFS A;  1EEJ A;  2ZL8 A;  4HYZ A;  2F4Y A;  1I0X A;  4HBR A;  3JVC A;  2RBI A;  1LXE A;  1BNF A;  3EBT A;  1G96 A;  3T0U A;  1K28 A;  5IER A;  4JRF A;  2OQE A;  5D82 A;  3V92 A;  3CPO A;  1VQ9 3;  1LQM B;  3NM7 A;  4GL6 A;  4N6T A;  3CCR 3;  3CCU 3;  4MMY B;  4NHF A;  3STD A;  1KQS 2;  4QWT A;  2IMJ A;  1CQS A;  1OUN A;  2CH9 A;  1SAR A;  5BU4 A;  2XFT A;  4DKI A;  5CF2 A;  5EQL A;  1RCK A;  3LTA A;  5DRE A;  3EN8 A;  1Q86 4;  3PCR A;  1OF5 B;  1KC8 4;  1CYU A;  1A2P A;  4RNT A;  3U1W A;  1MGW A;  5TGN A;  4N6M A;  3URP A;  3EHC A;  2CFD A;  2CFL A;  3UL6 A;  4ILF A;  3B8L A;  4H3U A;  3KSE D;  1MWU A;  1RGL A;  1E3V A;  3VGN A;  5IG4 A;  2IUJ A;  2QEX 3;  3KKG A;  4R9K A;  1U8C B;  3WOD G;  1X1W A;  1TFO A;  3QRD A;  2PZV A;  1RSN A;  4XDV A;  5IEO A;  5GSP A;  4R1K A;  1RGH A;  1N8Q A;  3S29 A;  2W56 B;  3F40 A;  1TTO A;  1UW1 A;  1TUH A;  3JUP A;  1DMQ A;  3K0Z A;  3CCS 3;  4KFE A;  1JZD A;  1BRK A;  1UDI I;  1VQ4 3;  2A15 A;  3D5G A;  3EE1 A;  3PXM A;  1UUG B;  3X41 A;  3FLJ A;  1ASK A;  1D6U A;  4IIA A;  1Q7Y 4;  3UNL A;  2W2C A;  5D83 A;  3NBJ A;  5AYR B;  3D79 A;  2OTJ 3;  3NXJ A;  1IT7 A;  1JKG B;  3N8B A;  1SIH A;  5M1A A;  1Q7H A;  2ML5 A;  1B21 A;  3F7S A;  4J9A A;  1J2B A;  4GHO A;  1AV4 A;  1A90 A;  1FGQ A;  3NM2 A;  2GEY A;  2GBW B;  2K54 A;  2L4V A;  1GMP A;  5M19 A;  1W00 A;  1AR0 A;  1ROA A;  4MJD A;  1RTU A;  1OCV A;  3O8Y A;  1GSP A;  4J5G A;  1CEW I;  3AHW A;  4BTY A;  3F7X A;  1KWI A;  1HU9 A;  3GZB A;  3NQY A;  1K9M 4;  5G1K A;  1VQM 3;  2RNT A;  1U5O A;  2FXT A;  3GAX A;  1M9G A;  3Q1C A;  3H51 A;  4RBN A;  1FGR A;  5CK6 A;  1YGE A;  3PCS A;  2CX1 A;  1O7W B;  2L1S A;  1SII A;  1GOU A;  2D42 A;  3DY5 A;  3EJV A;  3CU3 A;  3G4S 3;  1N9J A;  2KCD A;  3OX9 A;  1WMN A;  4R80 A;  3OXA A;  1W4N A;  3ROB A;  2UX0 A;  1ISK A;  3K5T A;  3DGL A;  4EXR A;  1JBS A;  3G0K A;  3QK9 A;  3DGO A;  1AQZ A;  2W6J H;  3CCL 3;  1VQP 3;  3DMC A;  3PGB A;  2MC8 A;  4WWU C;  5IW9 A;  1SJW A;  3SVA A;  2KF3 A;  1FZU A;  2Z76 A;  2Z77 A;  5JPU A;  2Z7A A;  4GB5 A;  4LZI A;  1N9E A;  5G1L A;  1MWT A;  2HML B;  1LOY A;  3NBB A;  1YI2 3;  4HM4 B;  3PYJ A;  4HKV B;  3BB9 A;  3F8H A;  2OQE C;  1VQ8 3;  1YJN 3;  1TFK A;  3OWS A;  3NQZ A;  3G6E 3;  4PEJ A;  3HK4 A;  4FCZ A;  3SX1 A;  1VQL 3;  2Y73 A;  4CDL A;  1T2H A;  1BRS A;  2CWV A;  3NBR A;  3DGY A;  3V99 A;  3CME 3;  1BUQ A;  1UCL A;  2OCT A;  2RSX A;  2F99 A;  3KCH A;  3X42 A;  3F8X A;  1M1X B;  1RGC A;  1RKY A;  3JUQ A;  1RJO A;  4EC6 A;  3LTD A;  2JDI H;  5KP3 A;  3DGN A;  3WMD A;  4IPB A;  1D6Z A;  3WA2 X;  2I9W A;  3DUK A;  2WO0 A;  2D1W A;  3BNB A;  2HMN B;  2WOH A;  3CXC 2;  1YJW 3;  1VZZ A;  2HMM B;  1IU7 A;  1RGE A;  2B1X B;  3NV0 A;  1JZO A;  3CC4 3;  6GSP A;  2XEP A;  3EF8 A;  4G1M B;  1UGH I;  3X3Z A;  2C10 A;  1W2Z A;  1GOY A;  1LOW A;  1FGO A;  2C4B A;  1FW7 A;  3CD6 3;  1BRI A;  1G02 A;  1GYB A;  2J8X B;  3G8Z A;  3CCJ 3;  2GXF A;  1R4Y A;  5AI1 A;  2RCD A;  2XSH B;  3MG1 A;  4L8O A;  4XDW A;  1JBR A;  4MMX B;  2CWU A;  3D4A A;  2HMO B;  1BNR A;  5M18 A;  1CH0 A;  5CF1 A;  2FGT A;  2WOF A;  2YFL B;  1BRH A;  4HM5 B;  3CC2 3;  1IQX A;  1FUW A;  2BMR B;  2O9U X;  1RRH A;  2R41 A;  4N6O B;  3GZR A;  4KFD A;  2GEX A;  3PZW A;  4O2H A;  3MHE A;  3WOF B;  1DVC A;  1F8N A;  2WGO A;  3FH1 A;  3LYG A;  2K0M A;  3K7C A;  1ULI B;  1GOV A;  2Q07 A;  2P0X A;  4HM8 B;  1I3F A;  1OPY A;  3KN4 A;  3CCM 3;  4FMC A;  3MG2 A;  1T3B A;  1RMS A;  1HZ1 A;  2M7O A;  2XRX B;  1K41 A;  3EX9 A;  1ZS7 A;  3T8N A;  1VQ5 3;  4HAA A;  3DXO A;  2GU1 A;  5RNT A;  3KE7 A;  1B3S A;  1BVI A;  4FR9 A;  4AKZ A;  3OV4 A;  1O7P B;  2ZDJ A;  4KFF A;  4OUQ A;  4X2O A;  1QVG 2;  2CK3 H;  2H0I A;  2CKF B;  1SQW A;  3HOH A;  4LMI A;  4J5K A;  1OHS A;  3V98 A;  3EBY A;  3HII A;  1N5P A;  1RN1 A;  1YIT 3;  3N54 B;  3U97 A;  1IVX A;  1B27 A;  2H0H A;  2IUK A;  3IJE B;  4JF8 A;  4NRE A;  8RNT A;  1O7G B;  1IYY A;  3S27 A;  1W5Z A;  3RGA A;  2IYJ A;  5DRV A;  3WOE B;  1Q82 4;  2SAR A;  2CW9 A;  4ORL A;  5IG5 A;  1UUW B;  2BIR A;  1LQG C;  3L0R A;  5FW5 A;  1K73 4;  4LSO A;  3GZY B;  6STD A;  1RGK A;  3LTB A;  3AMO A;  1STF I;  2INX A;  2P09 A;  3DH2 A;  5KP1 A;  1IVU A;  4K61 A;  1M90 4;  1Z1S A;  4OVM A;  5EVH A;  2BO9 B;  1FYS A;  1LNH A;  2GSP A;  1TRQ A;  3EQQ B;  2XH9 A;  1BAN A;  4EW5 A;  4K1V A;  2B24 B;  1Q40 A;  5A0O B;  3WR2 A;  5BVB A;  2P05 A;  3D3L A;  1NNV A;  1GD3 A;  1TIJ A;  1JN5 A;  2XGN A;  5AII A;  2KRT A;  1FUS A;  3M8C A;  1FGM A;  4FMA A;  4HOH A;  3WA3 A;  2P38 A;  3D9R A;  1QAK A;  1YGW A;  1YNV X;  2BNG A;  4STD A;  3FSD A;  4U13 A;  1L5G B;  2CWT A;  4XB5 A;  1NB5 I;  1BNE A;  3GWR A;  4K90 B;  1QVF 2;  1YVS A;  2CFW A;  2CG0 A;  1Q42 A;  3J7Y d;  3NV0 B;  2RFR A;  4BL2 A;  2IY2 A;  1C7H A;  5KP4 A;  1K8A 4;  1I70 A;  2ZHX B;  2F56 A;  1WMO A;  3SXX A;  1BRG A;  5CXO A;  2XR8 B;  1GS3 A;  3CMA 3;  1IK3 A;  7RNT A;  1WQL B;  1V57 A;  2GU3 A;  2MF7 A;  1KD1 4;  3X3Y A;  1B2U A;  3S5C A;  3UB1 A;  4CCV A;  3A76 A;  1B2M A;  1RGF A;  4MMZ B;  4N6N B;  1DYU A;  1NO3 A;  3ZG5 A;  1JBT A;  1TP6 A;  2AAE A;  2E2T A;  1JNQ A;  1O7N B;  1ZX2 A;  2BT3 A;  3SOY A;  4EBG A;  1VQ6 3;  1QAF A;  1TJD A;  3KII A;  1RN4 A;  4WFO A;  1M1K 4;  3ER7 A;  2JQ5 A;  1NDO B;  1FGT A;  2QA4 3;  1YHQ 3;  1BNJ A;  2CIU A;  1BRJ A;  1ROV A;  4HZ9 B;  1W01 A;  3ZFZ A;  3F14 A;  1MOL A;  1Y4K A;  1WMP A;  5D81 A;  1UUV B;  1LRA A;  5G2G A;  5BIR A;  1ZGX A;  2OOV A;  3AGN A;  4R9L A;  1LVN A;  3IMA B;  3X3X A;  4MEI A;  8CHO A;  1RRL A;  3KZT A;  4K1U A;  1GMR A;  3ECF A;  3I0Y A;  1BNS A;  2F5M A;  1OHO A;  1GY5 A;  2SBL A;  2LQV A;  1PU4 A;  3CC7 3;  3Q90 A;  1N8R 4;  1FA3 A;  1LOX A;  1IV7 A;  1NWW A;  2F5W A;  1QJG A;  5IG0 A;  3RNT A;  3F9S A;  5I97 A;  1NU3 A;  1B2Z A;  1G0T A;  1RLS A;  1UCK A;  4HM6 B;  2ZA4 A;  1GY6 A;  3FF2 A;  7GSP A;  1RNB A;  1I0V A;  1OGX A;  3FKA A;  1UI7 A;  4EV2 A;  2STD A;  5AIH A;  1W2B 2;  3OWU A;  2LYX A;  3ALA A;  4N6L A;  3T8U A;  4WHA A;  1I3I A;  1MWS A;  3A5E A;  3BNE A;  1GMQ A;  4BTW A;  1GD4 A;  3WDG B;  1FUT A;  1JRQ A;  1VQQ A;  3Q3F A;  3VSY A;  5LC7 A;  1TU5 A;  1MNL A;  1BSE A;  4CJN A;  4LYL B;  1EQK A;  2BMO B;  1ZO2 A;  2W0Q A;  4O3V A;  4RNY A;  1VQN 3;  1HKX A;  1WNH A;  2XGL A;  1JB5 A;  3JUO A;  1JB4 A;  2BMQ B;  3KSP A;  3MKI A;  2K3D A;  2KF4 A;  1JJ2 2;  4RNZ A;  3AMO B;  1EG9 B;  2KAA A;  4N6V 0;  3UL5 A;  1BNI A;  1IVW A;  1OAC A;  4H61 A;  4AEQ A;  1I8V A;  4I4K A; 
#chains in the Genus database with same CATH homology
 1S5A A;  2CFG A;  1CYV A;  2W04 A;  3LTC A;  1Q40 B;  4XBY A;  2W03 A;  3JUN A;  5EEO A;  5STD A;  1QMA A;  1V74 A;  1S72 3;  3GRD A;  4RZM A;  3DGM A;  3S67 A;  5LC6 A;  3SOA A;  2E2U A;  3GZX B;  1JN5 B;  4HM2 B;  3CNX A;  4HZB B;  3G16 A;  1EA2 A;  1QAL A;  3K63 A;  1JB2 A;  3Q2P A;  4HM0 B;  1DVD A;  4O8S A;  2P0M A;  1W6Y A;  4Q53 A;  5ELJ A;  1T5Y A;  4AKY A;  1YIJ 3;  4HM7 B;  1KSI A;  5IEN A;  3I56 3;  4LEH A;  3MWZ A;  3LXU X;  5HGR A;  5BXQ A;  7STD A;  4WYK A;  3KFQ C;  5AYS C;  2Y74 A;  4HJL B;  3S28 A;  1YJ9 3;  3FG3 A;  3BNC A;  2F86 B;  2W9P A;  5AEW B;  3HZP A;  2IA7 A;  1IT8 A;  4XM4 A;  1RN7 A;  2XSO B;  5AEU B;  3FF0 A;  3SLU A;  2QGU A;  3SED A;  1W7C A;  1STD A;  4OK0 A;  4XBT A;  2WGQ A;  4J8T A;  4R4K A;  4BTX A;  2O3O A;  5AIG A;  1GY7 A;  1OHP A;  2OOV C;  2ML6 A;  3TDG A;  2C11 A;  2PNC A;  3K9M C;  1E97 A;  1R4C A;  1W6G A;  5IEP A;  3LT8 A;  3MPH A;  2E2V A;  4LGQ A;  1ULJ B;  3RGR A;  1OF5 A;  1N5H A;  4ZM8 A;  5JBS A;  3FGY A;  4N6U A;  2YX9 A;  4KVH A;  4KZ1 A;  5IF6 A;  4L7K A;  3OW2 2;  3G71 3;  3CNM A;  3LML A;  2R4I A;  3EN1 B;  3VF1 A;  2CHC A;  1A2K A;  2HMJ B;  2V1L A;  1IDP A;  2CG1 A;  3NUV A;  5ELU A;  1NJI 4;  1AVK A;  3E99 A;  1A67 A;  4L8P A;  1PFP A;  1YVB I;  3IPT A;  2W56 A;  3B4O A;  3JUM A;  3CCQ 3;  3FZW A;  3BLZ A;  5JPP A;  3FCS B;  3BND A;  3I55 3;  4FMD A;  2XF3 A;  2Z6B A;  3DZL A;  2OWP A;  3LZA A;  3H3H A;  1JKG A;  2F98 A;  3MSO A;  1NB3 I;  1US1 A;  3HI7 A;  1IQ8 A;  4HM3 B;  4IT7 A;  5CLK A;  1W6C A;  4FCM A;  3UJM A;  4EV5 A;  1J2B A;  1IQY A;  4TX4 A;  3X40 A;  3EC9 A;  3N9H A;  3B4P A;  1EKM A;  4N3V A;  3CCV 3;  1OGZ A;  1OH0 A;  1O7M B;  3EB8 A;  1IVV A;  2YFI B;  3OWY A;  1JV2 B;  4O02 B;  3HX8 A;  4WP5 A;  2OTL 3;  3MYT A;  2W9Q A;  1DMM A;  1VQO 3;  2GBX B;  4XBX A;  5AIF A;  1VQ7 3;  3HIG A;  3CCE 3;  4FMB A;  3LOY A;  1DMN A;  2QIY A;  3NX0 A;  2HMK B;  4EYC A;  2FNQ A;  2KXG A;  5FGO A;  4X2H A;  5IG3 A;  1E3R A;  3LT9 A;  3CPW 2;  3RDE A;  1W02 A;  2RGQ A;  3B7C A;  3PS8 A;  4WYK B;  1AVL A;  3FG4 A;  4FCJ A;  4HM1 B;  2YFJ B;  3FG1 A;  4HVN A;  1Q81 4;  3DM8 A;  1SPU A;  2CFK A;  1UI8 A;  3NHX A;  2CC3 A;  1D6Y A;  1IV9 A;  1A2V A;  2BHM A;  1O7H B;  3LH4 A;  3MG3 A;  1WTH A;  1VQK 3;  2XFS A;  2ZL8 A;  4HYZ A;  1BUQ A;  4HBR A;  3JVC A;  1EQK A;  1LXE A;  3EBT A;  3T0U A;  1G96 A;  5IER A;  1K28 A;  4JRF A;  2OQE A;  5D82 A;  3V92 A;  3CPO A;  1VQ9 3;  3NM7 A;  4GL6 A;  4N6T A;  3CCR 3;  3CCU 3;  4MMY B;  4NHF A;  3STD A;  1KQS 2;  4QWT A;  2IMJ A;  1CQS A;  1OUN A;  2CH9 A;  2XFT A;  5CF2 A;  5EQL A;  3LTA A;  5DRE A;  3EN8 A;  1Q86 4;  3PCR A;  1OF5 B;  1KC8 4;  1CYU A;  3U1W A;  5TGN A;  4N6M A;  3EHC A;  2CFD A;  2CFL A;  3UL6 A;  3B8L A;  4H3U A;  3KSE D;  2QEX 3;  1E3V A;  3VGN A;  5IG4 A;  2IUJ A;  3KKG A;  4R9K A;  1U8C B;  3WOD G;  1TFO A;  3QRD A;  2PZV A;  4XDV A;  5IEO A;  4R1K A;  1N8Q A;  3S29 A;  2W56 B;  3F40 A;  1UW1 A;  1TUH A;  3JUP A;  1DMQ A;  3K0Z A;  3CCS 3;  4KFE A;  1VQ4 3;  2A15 A;  3EE1 A;  3PXM A;  3X41 A;  3FLJ A;  1ASK A;  1D6U A;  4IIA A;  1Q7Y 4;  3UNL A;  2W2C A;  5D83 A;  3NBJ A;  5AYR B;  2OTJ 3;  3NXJ A;  1JKG B;  1IT7 A;  3N8B A;  1SIH A;  2ML5 A;  3F7S A;  4J9A A;  1AV4 A;  1A90 A;  1FGQ A;  3NM2 A;  2GEY A;  2GBW B;  2K54 A;  2L4V A;  1W00 A;  1AR0 A;  1ROA A;  4MJD A;  1OCV A;  3O8Y A;  1CEW I;  4BTY A;  3F7X A;  1KWI A;  1HU9 A;  3GZB A;  3NQY A;  1K9M 4;  1VQM 3;  1U5O A;  2FXT A;  3GAX A;  1M9G A;  3Q1C A;  3H51 A;  4RBN A;  1FGR A;  5CK6 A;  1YGE A;  3PCS A;  1O7W B;  1SII A;  2D42 A;  3DY5 A;  3EJV A;  3CU3 A;  3G4S 3;  1N9J A;  2KCD A;  3OX9 A;  1WMN A;  4R80 A;  3OXA A;  1W4N A;  3ROB A;  2UX0 A;  1ISK A;  3K5T A;  3DGL A;  4EXR A;  3G0K A;  3QK9 A;  3DGO A;  2W6J H;  3CCL 3;  1VQP 3;  3DMC A;  3PGB A;  2MC8 A;  4WWU C;  5IW9 A;  1SJW A;  3SVA A;  2Z76 A;  2Z77 A;  5JPU A;  2Z7A A;  4GB5 A;  4LZI A;  1N9E A;  2HML B;  3NBB A;  1YI2 3;  4HM4 B;  3PYJ A;  4HKV B;  3BB9 A;  3F8H A;  2OQE C;  1VQ8 3;  1YJN 3;  1TFK A;  3OWS A;  3NQZ A;  3G6E 3;  4PEJ A;  3HK4 A;  4FCZ A;  3SX1 A;  1VQL 3;  2Y73 A;  4CDL A;  2CWV A;  3NBR A;  3V99 A;  3CME 3;  2OCT A;  2RSX A;  2F99 A;  3X42 A;  3F8X A;  1M1X B;  1RKY A;  3JUQ A;  1RJO A;  4EC6 A;  3LTD A;  2JDI H;  5KP3 A;  3DGN A;  3WMD A;  4IPB A;  1D6Z A;  3WA2 X;  2I9W A;  3DUK A;  2WO0 A;  2D1W A;  3BNB A;  2HMN B;  2WOH A;  3CXC 2;  1YJW 3;  1VZZ A;  2HMM B;  1IU7 A;  2B1X B;  3NV0 A;  3CC4 3;  2XEP A;  3EF8 A;  4G1M B;  3X3Z A;  2C10 A;  1W2Z A;  1FGO A;  3CD6 3;  3CCJ 3;  1GYB A;  3G8Z A;  2GXF A;  5AI1 A;  2RCD A;  2XSH B;  3MG1 A;  4L8O A;  4XDW A;  4MMX B;  2CWU A;  2HMO B;  5CF1 A;  2FGT A;  2WOF A;  2YFL B;  4HM5 B;  3CC2 3;  1IQX A;  1FUW A;  2BMR B;  2O9U X;  1RRH A;  4N6O B;  3GZR A;  4KFD A;  2GEX A;  3PZW A;  4O2H A;  3MHE A;  3WOF B;  1DVC A;  1F8N A;  2WGO A;  3FH1 A;  3LYG A;  2K0M A;  3K7C A;  1ULI B;  4HM8 B;  2Q07 A;  2P0X A;  1OPY A;  3KN4 A;  3CCM 3;  4FMC A;  3MG2 A;  2M7O A;  2XRX B;  3EX9 A;  1K41 A;  3T8N A;  1VQ5 3;  3DXO A;  2GU1 A;  3KE7 A;  4FR9 A;  4AKZ A;  3OV4 A;  1O7P B;  2ZDJ A;  4KFF A;  4OUQ A;  4X2O A;  1QVG 2;  2CK3 H;  2CKF B;  1SQW A;  4LMI A;  1OHS A;  3V98 A;  3EBY A;  3HII A;  1N5P A;  1YIT 3;  3N54 B;  3U97 A;  1IVX A;  2IUK A;  3IJE B;  4JF8 A;  4NRE A;  1O7G B;  3S27 A;  1W5Z A;  3RGA A;  3WOE B;  5DRV A;  1Q82 4;  2CW9 A;  4ORL A;  5IG5 A;  1UUW B;  5FW5 A;  3L0R A;  1K73 4;  4LSO A;  3GZY B;  6STD A;  3LTB A;  3AMO A;  1STF I;  2INX A;  2P09 A;  5KP1 A;  1IVU A;  4K61 A;  1M90 4;  1Z1S A;  4OVM A;  5EVH A;  2BO9 B;  1LNH A;  3EQQ B;  2XH9 A;  4K1V A;  2B24 B;  1Q40 A;  5A0O B;  5BVB A;  2P05 A;  3D3L A;  1GD3 A;  1TIJ A;  1JN5 A;  2XGN A;  5AII A;  2KRT A;  3M8C A;  4FMA A;  1FGM A;  3WA3 A;  2P38 A;  3D9R A;  1QAK A;  4STD A;  2BNG A;  4U13 A;  3FSD A;  1L5G B;  2CWT A;  4XB5 A;  1NB5 I;  3GWR A;  4K90 B;  1QVF 2;  2CFW A;  2CG0 A;  1Q42 A;  3J7Y d;  3NV0 B;  2RFR A;  1C7H A;  5KP4 A;  1K8A 4;  3SXX A;  1WMO A;  5CXO A;  2XR8 B;  1GS3 A;  3CMA 3;  1IK3 A;  1WQL B;  2GU3 A;  2MF7 A;  1KD1 4;  3X3Y A;  3S5C A;  3UB1 A;  4CCV A;  3A76 A;  4MMZ B;  4N6N B;  1DYU A;  1NO3 A;  1TP6 A;  2E2T A;  1JNQ A;  1O7N B;  1ZX2 A;  2BT3 A;  3SOY A;  4EBG A;  1VQ6 3;  1QAF A;  3KII A;  4WFO A;  1M1K 4;  3ER7 A;  2JQ5 A;  1NDO B;  1FGT A;  2QA4 3;  1YHQ 3;  2CIU A;  4HZ9 B;  1ROV A;  1W01 A;  3F14 A;  1MOL A;  1Y4K A;  1WMP A;  5D81 A;  1UUV B;  5G2G A;  2OOV A;  4R9L A;  1LVN A;  3IMA B;  3X3X A;  4MEI A;  8CHO A;  1RRL A;  3KZT A;  4K1U A;  3ECF A;  3I0Y A;  1OHO A;  1GY5 A;  2SBL A;  2LQV A;  1PU4 A;  3CC7 3;  3Q90 A;  1N8R 4;  1FA3 A;  1LOX A;  1IV7 A;  1NWW A;  1QJG A;  5IG0 A;  3F9S A;  5I97 A;  1NU3 A;  4HM6 B;  1GY6 A;  3FF2 A;  1OGX A;  3FKA A;  1UI7 A;  4EV2 A;  2STD A;  5AIH A;  1W2B 2;  3OWU A;  2LYX A;  3ALA A;  4N6L A;  3T8U A;  4WHA A;  3BNE A;  4BTW A;  1GD4 A;  3WDG B;  1JRQ A;  1TU5 A;  3VSY A;  5LC7 A;  1MNL A;  2BMO B;  1ZO2 A;  2W0Q A;  4O3V A;  4RNY A;  1VQN 3;  1HKX A;  1WNH A;  2XGL A;  1JB5 A;  3JUO A;  1JB4 A;  2BMQ B;  3KSP A;  3MKI A;  1JJ2 2;  4RNZ A;  3AMO B;  1EG9 B;  4N6V 0;  3UL5 A;  1IVW A;  1OAC A;  4H61 A;  4AEQ A;  4I4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...