1FUWA

Solution structure and backbone dynamics of a double mutant single-chain monellin(scm) determined by nuclear magnetic resonance spectroscopy
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
GEWEIIEIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIKPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords MONELLIN
publication title Solution structure, backbone dynamics, and stability of a double mutant single-chain monellin. structural origin of sweetness.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1fuwA00
2BO9B 4LZIA 2W9QA 1NB3I 1MOLA 5LC6A 4N6MA 1CYVA 3PS8A 1IV9A 4ZM8A 3NX0A 1YVBI 3UL5A 2KXGA 1A67A 1FUWA 1IV7A 3LH4A 3SVAA 2CH9A 1N5HA 3GAXA 3QRDA 4TX4A 4N6LA 3PYJA 2W9PA 5ELJA 3PXMA 4EYCA 1DVDA 1CEWI 1N9JA 1NB5I 1WNHA 1STFI 1N5PA 2OCTA 1A90A 3Q2PA 3KSED 3L0RA 1KWIA 4N6V0 3IMAB 3MWZA 1FA3A 1M9GA 1RN7A 1DVCA 4IT7A 4CCVA 1GD4A 3KFQC 4N6UA 4N6TA 2O9UX 1PFPA 4N6OB 4N6NB 1TIJA 3S67A 3UL6A 1EQKA 1R4CA 5LC7A 1LXEA 5A0OB 1G96A 1GD3A 3K9MC 5ELUA 1ROAA 1MNLA 1CYUA 5EQLA
chains in the Genus database with same CATH superfamily
1SPUA 3PGBA 1YVSA 4OUQA 1JKGB 1G0TA 2BO9B 1YGEA 2UX0A 3V99A 4HM3B 1K9M4 2IUKA 2FXTA 1BNGA 1VQO3 1BUQA 1PYLA 2PZVA 2F5WA 3D79A 2XGLA 1BAOA 3ECFA 4KVHA 8RNTA 1NB3I 4O8SA 1LRAA 5LC6A 3F40A 1GMRA 1LNIA 1U5OA 1QJGA 1Z1SA 4O2HA 1NWWA 4K61A 3T0UA 1JBTA 7GSPA 4BU4A 2P38A 2RCDA 4BTXA 3G4S3 4HM1B 1OF5A 2XFSA 2GU3A 7STDA 1A67A 2CC3A 3EBTA 4RBNA 1EEJA 1MGWA 2HMKB 4FMDA 3NM2A 3LH4A 3LT9A 1BNRA 1LVNA 2P09A 3D5IA 1TP6A 2LYXA 2INXA 3SVAA 3ZG5A 1I70A 1IQXA 5FW5A 2XH9A 2CH9A 2BNGA 4PEJA 5I97A 4I5QA 3BU4A 5IG0A 1E3VA 3J7Yd 1TUHA 1UI8A 2MF7A 2GXFA 2OOVA 2Z7AA 4BTYA 5EVHA 4FMCA 1FGOA 3VF1A 3D3LA 3D5GA 4MEIA 2V1LA 3HI7A 3PXMA 3KIIA 3TDGA 3CCS3 1KQS2 1BNIA 5D83A 5HOHA 2GEXA 5JPUA 4XBXA 1B2ZA 1JBRA 1NB5I 1STFI 1W02A 4FCMA 2CHCA 4G1MB 3DMCA 2E2VA 2CX1A 3O8YA 1YIT3 3CNXA 3G6E3 3EE1A 5STDA 2YFJB 1BNEA 5BU4A 3ZFZA 1RGLA 4AEQA 3DGLA 4KZ1A 1K8A4 1DVCA 2HMJB 2WOHA 1US1A 5IG4A 1BANA 3CC73 3WOFB 2XSHB 3DGMA 3JUMA 2PNCA 3KFQC 1FYSA 1I0XA 1FGMA 3CCU3 2CFWA 3DM8A 3WOEB 1FZUA 4AKYA 5M18A 1E3RA 2O9UX 4DKIA 2IY2A 1DMMA 1BNJA 1J2BA 4ILFA 1KSIA 3SYUA 1RSNA 1YJW3 2B24B 1SIIA 2BMOB 2YX9A 1FUTA 4EC6A 1DE3A 2F99A 3SOAA 3S67A 3UL6A 3EJVA 1MWUA 4HM5B 1VQ53 4R1KA 1ULIB 4LSOA 1W7CA 3FKAA 1IVVA 2HMOB 2C10A 3SEDA 4FCZA 2BIRA 4Q53A 3MKIA 3NBJA 3RGAA 5LC7A 2HMLB 3WMDA 1LOYA 1WMNA 1OH0A 1BNSA 3CCM3 3FGYA 1DMNA 2KF5A 3FF2A 3BIRA 3G16A 2IA7A 3GZBA 3FCSB 1BRNL 3G0KA 2P0XA 1JN5A 2XF3A 4OVMA 1YHQ3 2Z76A 1K734 3GRDA 4K90B 2ZDJA 1W4NA 1IT8A 3KKGA 1MNLA 1ZO2A 3CCL3 1JV2B 1V57A 1UDII 1AV4A 1WMPA 2J8XB 2ZA4A 1UI7A 1W2ZA 1VQN3 2SBLA 2D1WA 3MPHA 1X1UA 1BRHA 1UCJA 3URPA 1C54A 2C4BA 1JJ22 1UGIA 4WHAA 1RJOA 1B2UA 2R41A 2W03A 3OW22 3OWSA 2BHMA 2RGQA 1W00A 1YNVX 3EN8A 1YIJ3 3FG3A 1MOLA 1RGCA 1JN5B 1VQK3 2XEPA 1GY5A 1RLSA 1AR0A 3E99A 4HYZA 1IV9A 2K54A 4RNTA 5AIGA 4CJNA 1YVBI 4J5GA 1O7HB 3UL5A 5KP3A 1IVUA 1I8VA 3MG1A 4MMZB 5AYSC 5BIRA 1FUWA 1EA2A 2Q07A 3F7SA 3HIIA 1LNHA 1TJDA 3NQZA 3JUOA 4EXRA 4X2HA 6STDA 3UNLA 2B1XB 1STDA 1EKMA 1GSPA 3X42A 4LGQA 3BNBA 1RN4A 1RKYA 2JDIH 3S27A 1AY7A 1OPYA 1AQZA 2UUGC 1O7GB 2E2TA 1LOWA 1I2FA 4AKZA 4RZMA 3X40A 5KP1A 4HM6B 4O3VA 1SIHA 3A5EA 4N6LA 2GBXB 2CX0A 1X1YA 1A2KA 4BL2A 3NBRA 3DGNA 2W9PA 3U97A 3HZPA 5IENA 1SQWA 5M1AA 1Q7Y4 4HVNA 1O7WB 3NUVA 2HMNB 1UCIA 3PZWA 1GY7A 2SARA 1BSCA 3EBYA 3FG1A 4WYKA 3LT8A 5CXOA 5ELJA 5BXQA 1FGRA 1CEWI 1DVDA 1RDSA 3AHWA 3NV0A 1QAFA 1RN1A 1CH0A 2OCTA 4JF8A 3JUQA 5AI1A 3ROBA 1G02A 1A90A 1BRGA 4BIRA 3DY5A 1RGAA 3CC43 3KSED 1K28A 3L0RA 4N6V0 3Q1CA 3IMAB 4MMXB 1GOUA 1GMPA 3MWZA 2BMQB 1SARA 1RN7A 1BSDA 1OF5B 4WYKB 1QVF2 3AGOA 3AGNA 4L8OA 3V98A 3CNMA 4EV5A 3V92A 1I0VA 1HKXA 3K7CA 2CWUA 2XSOB 2CW9A 4HZBB 4HM2B 4KFFA 1O7MB 3EB8A 4N6UA 4N6TA 4R9KA 4RNYA 2OTL3 1C7HA 1MWRA 2CK3H 2KCDA 3EC9A 3EHCA 1OHSA 2RFRA 4EV2A 3X3XA 1VQM3 1IQYA 3FH1A 1W2B2 3ER7A 1W5ZA 2P05A 2WOFA 2H0IA 1IVWA 2YFLB 3F9SA 3JVCA 4R4KA 1FW7A 1UUVB 4LEHA 1IDPA 1A2PA 3F14A 1BOXA 3WR2A 1B20A 3ALAA 1OHPA 1NJI4 1EQKA 1RTUA 3U1WA 1W01A 1HYFA 3VSYA 3RGRA 7RNTA 3MHEA 2CFDA 1IK3A 1R4CA 2CIUA 4I4KA 1B3SA 3G8ZA 3BNCA 1VQP3 4J5KA 1F8NA 2RSXA 6RNTA 5DRVA 1SJWA 3IPTA 1T3BA 3T8NA 2WGQA 3CXC2 3CD63 1GY6A 3NM7A 1Q42A 3SXXA 3OX9A 3DGOA 4RNZA 1Q40A 1T5YA 1RNTA 2F56A 2H0HA 3Q3FA 5ELUA 1NO3A 2IYJA 1ISKA 3FZWA 1ROAA 1UGHI 2ZL8A 5CF2A 1WNHA 3FG4A 1BVIA 1QALA 1B27A 1QMAA 4GL6A 4LZIA 4CPKA 5IEOA 2W9QA 2XRXB 3JUNA 4HBRA 3N54B 2E2UA 5AEUB 3I0YA 1Q7HA 1GS3A 2BMRB 1Q40B 2C11A 2Z77A 5IEPA 1W6GA 1W6CA 4XB5A 1N9EA 1EUIC 1NDOB 2K3DA 3KN4A 1B2XA 5EEOA 5IG5A 1WTHA 1M1K4 4WFOA 1V58A 2BU4A 1FGTA 1RGFA 3UB1A 2F98A 1VQQA 3DGYA 5DREA 4X2OA 3OXAA 2QGUA 1IU7A 1LOVA 1RMSA 5EQLA 5HGRA 3LYGA 3PCSA 4R80A 2LQVA 4LMIA 4XDWA 1VZZA 2QEX3 3CCV3 3BLZA 3WODG 1Q814 1KC84 2CWTA 1NU3A 1I3IA 3GWRA 3WHOA 1PY3A 1IYYA 2L1SA 1N5HA 2OOVC 2XGNA 3WA3A 1GOYA 3GAXA 3MG3A 1OGXA 1GMQA 3SLUA 2XFTA 3SOYA 2WGOA 4TX4A 2Y73A 4H3UA 3LOYA 2WO0A 5AEWB 3GZRA 3PYJA 1JB5A 3A76A 3LTAA 4CDLA 2O3OA 3T8UA 1LQMB 3N9HA 1FGQA 3NBBA 1V74A 2H0GA 4OK0A 1WMOA 3HX8A 3LTCA 3F8XA 1E97A 3LMLA 4HZ9B 4XM4A 1JNQA 3K63A 2FNQA 3WDGB 3X41A 5BVBA 3CC23 1B2MA 1VQ63 1AVLA 1RCLA 1N9JA 4LYLB 1D6ZA 5AIHA 2CFLA 1MGRA 1N5PA 1OACA 1RRLA 1X1XA 1UW1A 3FSDA 1QAKA 1RRHA 3RDEA 1ZS7A 6GSPA 5TGNA 4JRFA 4HM8B 3HOHA 3NXJA 5AYRB 5RNTA 3DH2A 3FLJA 4GSPA 1KD14 1KWIA 1R4YA 2F5MA 2ZHXB 5G1KA 2QA43 4L7KA 1UCKA 4J9AA 5AIFA 4CCVA 5IF6A 2OQEA 1GD4A 1RGEA 3HIGA 1UCLA 1HZ1A 3CME3 4FR9A 1T2HA 1T2IA 3B4OA 2RNTA 2CFKA 1IT7A 3OV4A 5CF1A 2KRTA 3BNDA 1ASKA 2RBIA 3CCQ3 4KT3B 4N6OB 4GHOA 3MG2A 4KFDA 2IUJA 2GU1A 4XBYA 2W56A 4HKVB 4HOHA 3UJMA 4N6NB 1RGGA 1A2VA 2FGTA 1BRKA 1BSEA 2P0MA 3MYTA 3CMA3 2W2CA 1UUGB 3DUKA 1WQLB 1JB4A 2GEYA 2I9WA 3PCRA 1GOVA 4N3VA 2STDA 5CK6A 5D81A 3MSOA 1HU9A 3KSPA 2XR8B 2K0MA 1RGHA 4EW5A 1K41A 1DETA 3GZXB 3NQYA 1OHOA 5KP4A 2W56B 1X1WA 2UGIA 3NV0B 3X3ZA 4EBGA 5A0OB 1BRIA 2CFGA 3X3YA 3JUPA 2AAEA 1LQGC 4WP5A 5IW9A 4ORLA 4O02B 2Y74A 1CQSA 2CG0A 3QK9A 2M7OA 1VQ83 2Z6BA 1ROVA 4STDA 3D4AA 3D9RA 3AHSA 1CYUA 3KZTA 2OTJ3 2MC8A 1TU5A 1W6YA 4MJDA 1TFKA 3F7XA 8CHOA 2CWVA 2CG1A 1I3FA 5FGOA 3HK4A 3WA2X 4FMAA 4U13A 1PU4A 1RNBA 1I2GA 4N6MA 1BNFA 2CKFB 1VQ93 1OUNA 1CYVA 1TFOA 2W6JH 3PS8A 3STDA 2A15A 4ZM8A 3NX0A 1OGZA 2QIYA 1EG9B 5IG3A 2KXGA 5JBSA 1FUSA 3EF8A 3IJEB 3S29A 5M19A 4HM0B 1IV7A 1MWSA 3NHXA 1Q824 4H61A 3DXOA 3CU3A 1LOXA 2L4VA 1DMQA 3H51A 1ULJB 1JRQA 1BU4A 2OQEC 5G2GA 1YGWA 3KCHA 1L5GB 1O7PB 9RNTA 3GSPA 3SX1A 3AMOA 3QRDA 4XBTA 3I563 1M1XB 1YI23 2GSPA 1S5AA 1BIRA 2OWPA 4FMBA 2F4YA 3LTBA 4HM4B 1BRJA 1QVG2 1VQL3 3CCJ3 4R9LA 1BSBA 1VQ73 3F8HA 1I2EA 3LXUX 3LZAA 1BGSA 3VGNA 4EYCA 5CLKA 4BTWA 5GSPA 4QWTA 3AMOB 2BT3A 3M8CA 1D6UA 1VQ43 1B2SA 2W04A 3EN1B 4FCJA 1YJ93 4NPBA 4IIAA 1N8R4 2GBWB 1Y4KA 5AIIA 1JBSA 3OWYA 1OCVA 2D42A 3Q2PA 1RHLA 1YJN3 3EX9A 4IPBA 1IQ8A 5IERA 1FA3A 2AADA 1M9GA 3CPOA 4WWUC 1BUJA 4IT7A 1UUWB 1TRPA 1N8QA 2ML6A 2HMMB 3H3HA 1S723 3EQQB 3RNTA 2KF4A 4J8TA 4K1VA 4BL3A 4NHFA 2ML5A 2W0QA 1U8CB 4HAAA 1PFPA 3B4PA 3S28A 3ZG0A 3CCE3 1B21A 3S5CA 2IMJA 1IVXA 3CCR3 4HM7B 3FF0A 4L8PA 1TIJA 1ZX2A 1TRQA 1Q864 1RGKA 3N8BA 1JB2A 4MMYB 1AVKA 3B7CA 1JZOA 2F86B 3K5TA 4KFEA 5JPPA 4K1UA 1M904 3CPW2 5D82A 2JQ5A 3G713 1GYBA 3GZYB 1BSAA 1DYUA 3BB9A 1ZGXA 1JKGA 1Q9EA 1TTOA 4NREA 5G1LA 3LTDA 1LXEA 1MWTA 2KF6A 2KF3A 1BRSA 1JZDA 2KAAA 1D6YA 2YFIB 3I553 2HOHA 3BNEA 1G96A 3B8LA 3KE7A 1RCKA 3OWUA 3Q90A 1GD3A 1O7NB 3DZLA 3K9MC 4XDVA 2R4IA 3K0ZA 1NNVA 4GB5A 4HJLB
chains in the Genus database with same CATH topology
1SPUA 3PGBA 4OUQA 1JKGB 2BO9B 1YGEA 2UX0A 3V99A 4HM3B 1K9M4 2IUKA 2FXTA 1VQO3 1BUQA 2PZVA 2XGLA 3ECFA 4KVHA 1NB3I 4O8SA 5LC6A 3F40A 1U5OA 1QJGA 1Z1SA 4O2HA 1NWWA 4K61A 3T0UA 4BTXA 2P38A 2RCDA 3G4S3 4HM1B 1OF5A 2XFSA 2GU3A 7STDA 1A67A 2CC3A 3EBTA 4RBNA 2HMKB 4FMDA 3NM2A 3LH4A 3LT9A 1LVNA 2P09A 1TP6A 2LYXA 2INXA 3SVAA 1IQXA 5FW5A 2XH9A 2CH9A 2BNGA 4PEJA 5I97A 5IG0A 1E3VA 3J7Yd 1TUHA 1UI8A 2MF7A 2GXFA 2OOVA 2Z7AA 4BTYA 5EVHA 4FMCA 1FGOA 3VF1A 3D3LA 4MEIA 2V1LA 3HI7A 3PXMA 3KIIA 3TDGA 3CCS3 1KQS2 5D83A 5JPUA 2GEXA 4XBXA 1NB5I 1STFI 1W02A 4FCMA 2CHCA 4G1MB 3DMCA 2E2VA 3O8YA 1YIT3 3CNXA 3G6E3 3EE1A 5STDA 4AEQA 3DGLA 4KZ1A 1K8A4 1DVCA 2HMJB 2WOHA 1US1A 5IG4A 3CC73 3WOFB 2XSHB 3DGMA 3JUMA 2PNCA 3KFQC 1FGMA 3CCU3 2CFWA 3DM8A 3WOEB 4AKYA 1E3RA 2O9UX 1J2BA 1DMMA 1KSIA 1YJW3 2B24B 1SIIA 2BMOB 2YX9A 4EC6A 2F99A 3SOAA 3S67A 3UL6A 3EJVA 4HM5B 1VQ53 4R1KA 1ULIB 4LSOA 1W7CA 3FKAA 1IVVA 2HMOB 2C10A 3SEDA 4FCZA 4Q53A 3MKIA 3NBJA 3RGAA 5LC7A 2HMLB 3WMDA 1WMNA 1OH0A 3CCM3 3FGYA 1DMNA 3FF2A 3G16A 2IA7A 3GZBA 3FCSB 3G0KA 2P0XA 1JN5A 2XF3A 4OVMA 1YHQ3 2Z76A 1K734 3GRDA 4K90B 2ZDJA 1W4NA 1IT8A 3KKGA 1MNLA 1ZO2A 3CCL3 1JV2B 1AV4A 1WMPA 1VQN3 1UI7A 1W2ZA 2SBLA 2D1WA 3MPHA 1JJ22 4WHAA 1RJOA 2W03A 3OW22 3OWSA 2BHMA 2RGQA 1W00A 3EN8A 1YIJ3 3FG3A 1MOLA 1JN5B 1VQK3 2XEPA 1GY5A 1AR0A 3E99A 4HYZA 1IV9A 2K54A 5AIGA 1YVBI 1O7HB 3UL5A 5KP3A 1IVUA 3MG1A 4MMZB 5AYSC 1FUWA 1EA2A 2Q07A 3F7SA 3HIIA 1LNHA 3NQZA 3JUOA 4EXRA 4X2HA 6STDA 3UNLA 2B1XB 1STDA 1EKMA 3X42A 4LGQA 3BNBA 1RKYA 2JDIH 3S27A 1OPYA 1O7GB 2E2TA 4AKZA 4RZMA 3X40A 5KP1A 4HM6B 4O3VA 1SIHA 4N6LA 2GBXB 1A2KA 3NBRA 3DGNA 2W9PA 3U97A 3HZPA 5IENA 1SQWA 1Q7Y4 4HVNA 1O7WB 3NUVA 2HMNB 3PZWA 5ELJA 1GY7A 4WYKA 3FG1A 3EBYA 5CXOA 3LT8A 5BXQA 1FGRA 1CEWI 1DVDA 3NV0A 1QAFA 2OCTA 4JF8A 3JUQA 5AI1A 3ROBA 1A90A 3DY5A 3CC43 3KSED 1K28A 3L0RA 4N6V0 3Q1CA 3IMAB 4MMXB 3MWZA 2BMQB 1RN7A 1OF5B 4WYKB 1QVF2 3V98A 4L8OA 3CNMA 4EV5A 3V92A 1HKXA 3K7CA 2CWUA 2XSOB 2CW9A 4HZBB 4HM2B 4KFFA 1O7MB 3EB8A 4N6UA 4N6TA 4R9KA 4RNYA 2OTL3 1C7HA 2CK3H 2KCDA 3EC9A 3EHCA 4EV2A 1OHSA 2RFRA 1VQM3 3X3XA 1IQYA 3FH1A 1W2B2 3ER7A 1W5ZA 2P05A 2WOFA 2YFLB 1IVWA 3F9SA 3JVCA 4R4KA 1UUVB 4LEHA 1IDPA 3F14A 3ALAA 1OHPA 1NJI4 1EQKA 3U1WA 1W01A 3VSYA 3RGRA 3MHEA 2CFDA 1IK3A 1R4CA 2CIUA 4I4KA 3G8ZA 3BNCA 1VQP3 1F8NA 2RSXA 5DRVA 1SJWA 3IPTA 3T8NA 2WGQA 3CXC2 3CD63 1GY6A 3NM7A 1Q42A 3SXXA 3OX9A 3DGOA 4RNZA 1Q40A 1T5YA 5ELUA 1NO3A 1ISKA 3FZWA 1ROAA 2ZL8A 5CF2A 1WNHA 3FG4A 1QALA 1QMAA 4GL6A 4LZIA 5IEOA 2W9QA 2XRXB 3JUNA 4HBRA 3N54B 2E2UA 5AEUB 3I0YA 1GS3A 2BMRB 1Q40B 2C11A 2Z77A 5IEPA 1W6CA 1W6GA 4XB5A 1N9EA 1NDOB 3KN4A 5EEOA 5IG5A 1WTHA 1M1K4 4WFOA 1FGTA 3UB1A 2F98A 5DREA 4X2OA 3OXAA 2QGUA 1IU7A 5HGRA 5EQLA 3LYGA 3PCSA 4R80A 2LQVA 4LMIA 4XDWA 1VZZA 2QEX3 3CCV3 3BLZA 3WODG 1Q814 1KC84 2CWTA 1NU3A 3GWRA 1N5HA 2OOVC 2XGNA 3WA3A 3GAXA 3MG3A 1OGXA 3SLUA 2XFTA 3SOYA 2WGOA 4TX4A 2Y73A 4H3UA 3LOYA 2WO0A 5AEWB 3GZRA 3PYJA 1JB5A 3A76A 3LTAA 4CDLA 2O3OA 3T8UA 3N9HA 1FGQA 3NBBA 1V74A 4OK0A 1WMOA 3HX8A 3LTCA 3F8XA 1E97A 3LMLA 4HZ9B 4XM4A 1JNQA 3K63A 2FNQA 3WDGB 3X41A 5BVBA 3CC23 1VQ63 1AVLA 1N9JA 1D6ZA 5AIHA 2CFLA 1N5PA 1OACA 1RRLA 1UW1A 3FSDA 1QAKA 1RRHA 3RDEA 5TGNA 4JRFA 4HM8B 3NXJA 1KD14 5AYRB 3FLJA 1KWIA 2QA43 4L7KA 4J9AA 5AIFA 4CCVA 5IF6A 2OQEA 1GD4A 3HIGA 3CME3 4FR9A 3B4OA 5CF1A 2CFKA 1IT7A 3OV4A 2KRTA 3BNDA 1ASKA 3CCQ3 4N6OB 4KFDA 3MG2A 2IUJA 2GU1A 4XBYA 2W56A 4HKVB 3UJMA 4N6NB 1A2VA 2FGTA 2P0MA 3MYTA 3CMA3 2W2CA 3DUKA 1WQLB 1JB4A 2GEYA 2I9WA 3PCRA 4N3VA 5CK6A 2STDA 5D81A 3MSOA 1HU9A 3KSPA 2XR8B 2K0MA 1K41A 3GZXB 3NQYA 1OHOA 5KP4A 2W56B 3NV0B 3X3ZA 4EBGA 5A0OB 2CFGA 3X3YA 3JUPA 4WP5A 5IW9A 4ORLA 4O02B 2Y74A 1CQSA 2CG0A 3QK9A 2M7OA 1VQ83 2Z6BA 1ROVA 4STDA 3D9RA 1CYUA 3KZTA 2OTJ3 2MC8A 1TU5A 1W6YA 4MJDA 1TFKA 3F7XA 8CHOA 2CWVA 2CG1A 5FGOA 3HK4A 3WA2X 4FMAA 4U13A 1PU4A 4N6MA 2CKFB 1VQ93 1OUNA 1CYVA 1TFOA 2W6JH 3PS8A 3STDA 2A15A 4ZM8A 3NX0A 1OGZA 2QIYA 1EG9B 5IG3A 2KXGA 5JBSA 3EF8A 3IJEB 3S29A 4HM0B 1IV7A 1Q824 3NHXA 4H61A 3DXOA 3CU3A 1LOXA 2L4VA 1DMQA 3H51A 1ULJB 1JRQA 5G2GA 2OQEC 1L5GB 1O7PB 3SX1A 3AMOA 3QRDA 4XBTA 3I563 1M1XB 1YI23 1S5AA 2OWPA 4FMBA 3LTBA 4HM4B 1QVG2 1VQL3 3CCJ3 4R9LA 1VQ73 3F8HA 3LXUX 3LZAA 3VGNA 4EYCA 5CLKA 4BTWA 4QWTA 3AMOB 2BT3A 3M8CA 1D6UA 1VQ43 2W04A 3EN1B 4FCJA 1YJ93 4IIAA 1N8R4 2GBWB 1Y4KA 5AIIA 3OWYA 1OCVA 2D42A 3Q2PA 1YJN3 3EX9A 4IPBA 1IQ8A 5IERA 1FA3A 1M9GA 3CPOA 4WWUC 4IT7A 1UUWB 1N8QA 2ML6A 2HMMB 3H3HA 1S723 3EQQB 4J8TA 4K1VA 4NHFA 2ML5A 2W0QA 1U8CB 1PFPA 3B4PA 3S28A 3CCE3 3S5CA 2IMJA 1IVXA 3CCR3 4HM7B 3FF0A 4L8PA 1TIJA 1ZX2A 1Q864 3N8BA 1JB2A 4MMYB 1AVKA 3B7CA 2F86B 3K5TA 4KFEA 5JPPA 4K1UA 1M904 3CPW2 5D82A 2JQ5A 3G713 1GYBA 3GZYB 1DYUA 3BB9A 1JKGA 4NREA 3LTDA 1LXEA 1D6YA 2YFIB 3I553 3BNEA 1G96A 3B8LA 3KE7A 3OWUA 3Q90A 1GD3A 1O7NB 3DZLA 3K9MC 4XDVA 2R4IA 3K0ZA 2YFJB 4GB5A 4HJLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO9 B;  4LZI A;  2W9Q A;  1NB3 I;  1MOL A;  5LC6 A;  4N6M A;  1CYV A;  3PS8 A;  1IV9 A;  4ZM8 A;  3NX0 A;  1YVB I;  3UL5 A;  2KXG A;  1A67 A;  1FUW A;  1IV7 A;  3LH4 A;  3SVA A;  2CH9 A;  1N5H A;  3GAX A;  3QRD A;  4TX4 A;  4N6L A;  3PYJ A;  2W9P A;  5ELJ A;  3PXM A;  4EYC A;  1DVD A;  1CEW I;  1N9J A;  1NB5 I;  1WNH A;  1STF I;  1N5P A;  2OCT A;  1A90 A;  3Q2P A;  3KSE D;  3L0R A;  1KWI A;  4N6V 0;  3IMA B;  3MWZ A;  1FA3 A;  1M9G A;  1RN7 A;  1DVC A;  4IT7 A;  4CCV A;  1GD4 A;  3KFQ C;  4N6U A;  4N6T A;  2O9U X;  1PFP A;  4N6O B;  4N6N B;  1TIJ A;  3S67 A;  3UL6 A;  1EQK A;  1R4C A;  5LC7 A;  1LXE A;  5A0O B;  1G96 A;  1GD3 A;  3K9M C;  5ELU A;  1ROA A;  1MNL A;  1CYU A;  5EQL A; 
#chains in the Genus database with same CATH topology
 1SPU A;  3PGB A;  1YVS A;  4OUQ A;  1JKG B;  1G0T A;  2BO9 B;  1YGE A;  2UX0 A;  3V99 A;  4HM3 B;  1K9M 4;  2IUK A;  2FXT A;  1BNG A;  1VQO 3;  1BUQ A;  1PYL A;  2PZV A;  2F5W A;  3D79 A;  2XGL A;  1BAO A;  3ECF A;  4KVH A;  8RNT A;  1NB3 I;  4O8S A;  1LRA A;  5LC6 A;  3F40 A;  1GMR A;  1LNI A;  1U5O A;  1QJG A;  1Z1S A;  4O2H A;  1NWW A;  4K61 A;  3T0U A;  1JBT A;  7GSP A;  4BU4 A;  2P38 A;  2RCD A;  4BTX A;  3G4S 3;  4HM1 B;  1OF5 A;  2XFS A;  2GU3 A;  7STD A;  1A67 A;  2CC3 A;  3EBT A;  4RBN A;  1EEJ A;  1MGW A;  2HMK B;  4FMD A;  3NM2 A;  3LH4 A;  3LT9 A;  1BNR A;  1LVN A;  2P09 A;  3D5I A;  1TP6 A;  2LYX A;  2INX A;  3SVA A;  3ZG5 A;  1I70 A;  1IQX A;  5FW5 A;  2XH9 A;  2CH9 A;  2BNG A;  4PEJ A;  5I97 A;  4I5Q A;  3BU4 A;  5IG0 A;  1E3V A;  3J7Y d;  1TUH A;  1UI8 A;  2MF7 A;  2GXF A;  2OOV A;  2Z7A A;  4BTY A;  5EVH A;  4FMC A;  1FGO A;  3VF1 A;  3D3L A;  3D5G A;  4MEI A;  2V1L A;  3HI7 A;  3PXM A;  3KII A;  3TDG A;  3CCS 3;  1KQS 2;  1BNI A;  5D83 A;  5HOH A;  2GEX A;  5JPU A;  4XBX A;  1B2Z A;  1JBR A;  1NB5 I;  1STF I;  1W02 A;  4FCM A;  2CHC A;  4G1M B;  3DMC A;  2E2V A;  2CX1 A;  3O8Y A;  1YIT 3;  3CNX A;  3G6E 3;  3EE1 A;  5STD A;  2YFJ B;  1BNE A;  5BU4 A;  3ZFZ A;  1RGL A;  4AEQ A;  3DGL A;  4KZ1 A;  1K8A 4;  1DVC A;  2HMJ B;  2WOH A;  1US1 A;  5IG4 A;  1BAN A;  3CC7 3;  3WOF B;  2XSH B;  3DGM A;  3JUM A;  2PNC A;  3KFQ C;  1FYS A;  1I0X A;  1FGM A;  3CCU 3;  2CFW A;  3DM8 A;  3WOE B;  1FZU A;  4AKY A;  5M18 A;  1E3R A;  2O9U X;  4DKI A;  2IY2 A;  1DMM A;  1BNJ A;  1J2B A;  4ILF A;  1KSI A;  3SYU A;  1RSN A;  1YJW 3;  2B24 B;  1SII A;  2BMO B;  2YX9 A;  1FUT A;  4EC6 A;  1DE3 A;  2F99 A;  3SOA A;  3S67 A;  3UL6 A;  3EJV A;  1MWU A;  4HM5 B;  1VQ5 3;  4R1K A;  1ULI B;  4LSO A;  1W7C A;  3FKA A;  1IVV A;  2HMO B;  2C10 A;  3SED A;  4FCZ A;  2BIR A;  4Q53 A;  3MKI A;  3NBJ A;  3RGA A;  5LC7 A;  2HML B;  3WMD A;  1LOY A;  1WMN A;  1OH0 A;  1BNS A;  3CCM 3;  3FGY A;  1DMN A;  2KF5 A;  3FF2 A;  3BIR A;  3G16 A;  2IA7 A;  3GZB A;  3FCS B;  1BRN L;  3G0K A;  2P0X A;  1JN5 A;  2XF3 A;  4OVM A;  1YHQ 3;  2Z76 A;  1K73 4;  3GRD A;  4K90 B;  2ZDJ A;  1W4N A;  1IT8 A;  3KKG A;  1MNL A;  1ZO2 A;  3CCL 3;  1JV2 B;  1V57 A;  1UDI I;  1AV4 A;  1WMP A;  2J8X B;  2ZA4 A;  1UI7 A;  1W2Z A;  1VQN 3;  2SBL A;  2D1W A;  3MPH A;  1X1U A;  1BRH A;  1UCJ A;  3URP A;  1C54 A;  2C4B A;  1JJ2 2;  1UGI A;  4WHA A;  1RJO A;  1B2U A;  2R41 A;  2W03 A;  3OW2 2;  3OWS A;  2BHM A;  2RGQ A;  1W00 A;  1YNV X;  3EN8 A;  1YIJ 3;  3FG3 A;  1MOL A;  1RGC A;  1JN5 B;  1VQK 3;  2XEP A;  1GY5 A;  1RLS A;  1AR0 A;  3E99 A;  4HYZ A;  1IV9 A;  2K54 A;  4RNT A;  5AIG A;  4CJN A;  1YVB I;  4J5G A;  1O7H B;  3UL5 A;  5KP3 A;  1IVU A;  1I8V A;  3MG1 A;  4MMZ B;  5AYS C;  5BIR A;  1FUW A;  1EA2 A;  2Q07 A;  3F7S A;  3HII A;  1LNH A;  1TJD A;  3NQZ A;  3JUO A;  4EXR A;  4X2H A;  6STD A;  3UNL A;  2B1X B;  1STD A;  1EKM A;  1GSP A;  3X42 A;  4LGQ A;  3BNB A;  1RN4 A;  1RKY A;  2JDI H;  3S27 A;  1AY7 A;  1OPY A;  1AQZ A;  2UUG C;  1O7G B;  2E2T A;  1LOW A;  1I2F A;  4AKZ A;  4RZM A;  3X40 A;  5KP1 A;  4HM6 B;  4O3V A;  1SIH A;  3A5E A;  4N6L A;  2GBX B;  2CX0 A;  1X1Y A;  1A2K A;  4BL2 A;  3NBR A;  3DGN A;  2W9P A;  3U97 A;  3HZP A;  5IEN A;  1SQW A;  5M1A A;  1Q7Y 4;  4HVN A;  1O7W B;  3NUV A;  2HMN B;  1UCI A;  3PZW A;  1GY7 A;  2SAR A;  1BSC A;  3EBY A;  3FG1 A;  4WYK A;  3LT8 A;  5CXO A;  5ELJ A;  5BXQ A;  1FGR A;  1CEW I;  1DVD A;  1RDS A;  3AHW A;  3NV0 A;  1QAF A;  1RN1 A;  1CH0 A;  2OCT A;  4JF8 A;  3JUQ A;  5AI1 A;  3ROB A;  1G02 A;  1A90 A;  1BRG A;  4BIR A;  3DY5 A;  1RGA A;  3CC4 3;  3KSE D;  1K28 A;  3L0R A;  4N6V 0;  3Q1C A;  3IMA B;  4MMX B;  1GOU A;  1GMP A;  3MWZ A;  2BMQ B;  1SAR A;  1RN7 A;  1BSD A;  1OF5 B;  4WYK B;  1QVF 2;  3AGO A;  3AGN A;  4L8O A;  3V98 A;  3CNM A;  4EV5 A;  3V92 A;  1I0V A;  1HKX A;  3K7C A;  2CWU A;  2XSO B;  2CW9 A;  4HZB B;  4HM2 B;  4KFF A;  1O7M B;  3EB8 A;  4N6U A;  4N6T A;  4R9K A;  4RNY A;  2OTL 3;  1C7H A;  1MWR A;  2CK3 H;  2KCD A;  3EC9 A;  3EHC A;  1OHS A;  2RFR A;  4EV2 A;  3X3X A;  1VQM 3;  1IQY A;  3FH1 A;  1W2B 2;  3ER7 A;  1W5Z A;  2P05 A;  2WOF A;  2H0I A;  1IVW A;  2YFL B;  3F9S A;  3JVC A;  4R4K A;  1FW7 A;  1UUV B;  4LEH A;  1IDP A;  1A2P A;  3F14 A;  1BOX A;  3WR2 A;  1B20 A;  3ALA A;  1OHP A;  1NJI 4;  1EQK A;  1RTU A;  3U1W A;  1W01 A;  1HYF A;  3VSY A;  3RGR A;  7RNT A;  3MHE A;  2CFD A;  1IK3 A;  1R4C A;  2CIU A;  4I4K A;  1B3S A;  3G8Z A;  3BNC A;  1VQP 3;  4J5K A;  1F8N A;  2RSX A;  6RNT A;  5DRV A;  1SJW A;  3IPT A;  1T3B A;  3T8N A;  2WGQ A;  3CXC 2;  3CD6 3;  1GY6 A;  3NM7 A;  1Q42 A;  3SXX A;  3OX9 A;  3DGO A;  4RNZ A;  1Q40 A;  1T5Y A;  1RNT A;  2F56 A;  2H0H A;  3Q3F A;  5ELU A;  1NO3 A;  2IYJ A;  1ISK A;  3FZW A;  1ROA A;  1UGH I;  2ZL8 A;  5CF2 A;  1WNH A;  3FG4 A;  1BVI A;  1QAL A;  1B27 A;  1QMA A;  4GL6 A;  4LZI A;  4CPK A;  5IEO A;  2W9Q A;  2XRX B;  3JUN A;  4HBR A;  3N54 B;  2E2U A;  5AEU B;  3I0Y A;  1Q7H A;  1GS3 A;  2BMR B;  1Q40 B;  2C11 A;  2Z77 A;  5IEP A;  1W6G A;  1W6C A;  4XB5 A;  1N9E A;  1EUI C;  1NDO B;  2K3D A;  3KN4 A;  1B2X A;  5EEO A;  5IG5 A;  1WTH A;  1M1K 4;  4WFO A;  1V58 A;  2BU4 A;  1FGT A;  1RGF A;  3UB1 A;  2F98 A;  1VQQ A;  3DGY A;  5DRE A;  4X2O A;  3OXA A;  2QGU A;  1IU7 A;  1LOV A;  1RMS A;  5EQL A;  5HGR A;  3LYG A;  3PCS A;  4R80 A;  2LQV A;  4LMI A;  4XDW A;  1VZZ A;  2QEX 3;  3CCV 3;  3BLZ A;  3WOD G;  1Q81 4;  1KC8 4;  2CWT A;  1NU3 A;  1I3I A;  3GWR A;  3WHO A;  1PY3 A;  1IYY A;  2L1S A;  1N5H A;  2OOV C;  2XGN A;  3WA3 A;  1GOY A;  3GAX A;  3MG3 A;  1OGX A;  1GMQ A;  3SLU A;  2XFT A;  3SOY A;  2WGO A;  4TX4 A;  2Y73 A;  4H3U A;  3LOY A;  2WO0 A;  5AEW B;  3GZR A;  3PYJ A;  1JB5 A;  3A76 A;  3LTA A;  4CDL A;  2O3O A;  3T8U A;  1LQM B;  3N9H A;  1FGQ A;  3NBB A;  1V74 A;  2H0G A;  4OK0 A;  1WMO A;  3HX8 A;  3LTC A;  3F8X A;  1E97 A;  3LML A;  4HZ9 B;  4XM4 A;  1JNQ A;  3K63 A;  2FNQ A;  3WDG B;  3X41 A;  5BVB A;  3CC2 3;  1B2M A;  1VQ6 3;  1AVL A;  1RCL A;  1N9J A;  4LYL B;  1D6Z A;  5AIH A;  2CFL A;  1MGR A;  1N5P A;  1OAC A;  1RRL A;  1X1X A;  1UW1 A;  3FSD A;  1QAK A;  1RRH A;  3RDE A;  1ZS7 A;  6GSP A;  5TGN A;  4JRF A;  4HM8 B;  3HOH A;  3NXJ A;  5AYR B;  5RNT A;  3DH2 A;  3FLJ A;  4GSP A;  1KD1 4;  1KWI A;  1R4Y A;  2F5M A;  2ZHX B;  5G1K A;  2QA4 3;  4L7K A;  1UCK A;  4J9A A;  5AIF A;  4CCV A;  5IF6 A;  2OQE A;  1GD4 A;  1RGE A;  3HIG A;  1UCL A;  1HZ1 A;  3CME 3;  4FR9 A;  1T2H A;  1T2I A;  3B4O A;  2RNT A;  2CFK A;  1IT7 A;  3OV4 A;  5CF1 A;  2KRT A;  3BND A;  1ASK A;  2RBI A;  3CCQ 3;  4KT3 B;  4N6O B;  4GHO A;  3MG2 A;  4KFD A;  2IUJ A;  2GU1 A;  4XBY A;  2W56 A;  4HKV B;  4HOH A;  3UJM A;  4N6N B;  1RGG A;  1A2V A;  2FGT A;  1BRK A;  1BSE A;  2P0M A;  3MYT A;  3CMA 3;  2W2C A;  1UUG B;  3DUK A;  1WQL B;  1JB4 A;  2GEY A;  2I9W A;  3PCR A;  1GOV A;  4N3V A;  2STD A;  5CK6 A;  5D81 A;  3MSO A;  1HU9 A;  3KSP A;  2XR8 B;  2K0M A;  1RGH A;  4EW5 A;  1K41 A;  1DET A;  3GZX B;  3NQY A;  1OHO A;  5KP4 A;  2W56 B;  1X1W A;  2UGI A;  3NV0 B;  3X3Z A;  4EBG A;  5A0O B;  1BRI A;  2CFG A;  3X3Y A;  3JUP A;  2AAE A;  1LQG C;  4WP5 A;  5IW9 A;  4ORL A;  4O02 B;  2Y74 A;  1CQS A;  2CG0 A;  3QK9 A;  2M7O A;  1VQ8 3;  2Z6B A;  1ROV A;  4STD A;  3D4A A;  3D9R A;  3AHS A;  1CYU A;  3KZT A;  2OTJ 3;  2MC8 A;  1TU5 A;  1W6Y A;  4MJD A;  1TFK A;  3F7X A;  8CHO A;  2CWV A;  2CG1 A;  1I3F A;  5FGO A;  3HK4 A;  3WA2 X;  4FMA A;  4U13 A;  1PU4 A;  1RNB A;  1I2G A;  4N6M A;  1BNF A;  2CKF B;  1VQ9 3;  1OUN A;  1CYV A;  1TFO A;  2W6J H;  3PS8 A;  3STD A;  2A15 A;  4ZM8 A;  3NX0 A;  1OGZ A;  2QIY A;  1EG9 B;  5IG3 A;  2KXG A;  5JBS A;  1FUS A;  3EF8 A;  3IJE B;  3S29 A;  5M19 A;  4HM0 B;  1IV7 A;  1MWS A;  3NHX A;  1Q82 4;  4H61 A;  3DXO A;  3CU3 A;  1LOX A;  2L4V A;  1DMQ A;  3H51 A;  1ULJ B;  1JRQ A;  1BU4 A;  2OQE C;  5G2G A;  1YGW A;  3KCH A;  1L5G B;  1O7P B;  9RNT A;  3GSP A;  3SX1 A;  3AMO A;  3QRD A;  4XBT A;  3I56 3;  1M1X B;  1YI2 3;  2GSP A;  1S5A A;  1BIR A;  2OWP A;  4FMB A;  2F4Y A;  3LTB A;  4HM4 B;  1BRJ A;  1QVG 2;  1VQL 3;  3CCJ 3;  4R9L A;  1BSB A;  1VQ7 3;  3F8H A;  1I2E A;  3LXU X;  3LZA A;  1BGS A;  3VGN A;  4EYC A;  5CLK A;  4BTW A;  5GSP A;  4QWT A;  3AMO B;  2BT3 A;  3M8C A;  1D6U A;  1VQ4 3;  1B2S A;  2W04 A;  3EN1 B;  4FCJ A;  1YJ9 3;  4NPB A;  4IIA A;  1N8R 4;  2GBW B;  1Y4K A;  5AII A;  1JBS A;  3OWY A;  1OCV A;  2D42 A;  3Q2P A;  1RHL A;  1YJN 3;  3EX9 A;  4IPB A;  1IQ8 A;  5IER A;  1FA3 A;  2AAD A;  1M9G A;  3CPO A;  4WWU C;  1BUJ A;  4IT7 A;  1UUW B;  1TRP A;  1N8Q A;  2ML6 A;  2HMM B;  3H3H A;  1S72 3;  3EQQ B;  3RNT A;  2KF4 A;  4J8T A;  4K1V A;  4BL3 A;  4NHF A;  2ML5 A;  2W0Q A;  1U8C B;  4HAA A;  1PFP A;  3B4P A;  3S28 A;  3ZG0 A;  3CCE 3;  1B21 A;  3S5C A;  2IMJ A;  1IVX A;  3CCR 3;  4HM7 B;  3FF0 A;  4L8P A;  1TIJ A;  1ZX2 A;  1TRQ A;  1Q86 4;  1RGK A;  3N8B A;  1JB2 A;  4MMY B;  1AVK A;  3B7C A;  1JZO A;  2F86 B;  3K5T A;  4KFE A;  5JPP A;  4K1U A;  1M90 4;  3CPW 2;  5D82 A;  2JQ5 A;  3G71 3;  1GYB A;  3GZY B;  1BSA A;  1DYU A;  3BB9 A;  1ZGX A;  1JKG A;  1Q9E A;  1TTO A;  4NRE A;  5G1L A;  3LTD A;  1LXE A;  1MWT A;  2KF6 A;  2KF3 A;  1BRS A;  1JZD A;  2KAA A;  1D6Y A;  2YFI B;  3I55 3;  2HOH A;  3BNE A;  1G96 A;  3B8L A;  3KE7 A;  1RCK A;  3OWU A;  3Q90 A;  1GD3 A;  1O7N B;  3DZL A;  3K9M C;  4XDV A;  2R4I A;  3K0Z A;  1NNV A;  4GB5 A;  4HJL B; 
#chains in the Genus database with same CATH homology
 1SPU A;  3PGB A;  4OUQ A;  1JKG B;  2BO9 B;  1YGE A;  2UX0 A;  3V99 A;  4HM3 B;  1K9M 4;  2IUK A;  2FXT A;  1VQO 3;  1BUQ A;  2PZV A;  2XGL A;  3ECF A;  4KVH A;  1NB3 I;  4O8S A;  5LC6 A;  3F40 A;  1U5O A;  1QJG A;  1Z1S A;  4O2H A;  1NWW A;  4K61 A;  3T0U A;  4BTX A;  2P38 A;  2RCD A;  3G4S 3;  4HM1 B;  1OF5 A;  2XFS A;  2GU3 A;  7STD A;  1A67 A;  2CC3 A;  3EBT A;  4RBN A;  2HMK B;  4FMD A;  3NM2 A;  3LH4 A;  3LT9 A;  1LVN A;  2P09 A;  1TP6 A;  2LYX A;  2INX A;  3SVA A;  1IQX A;  5FW5 A;  2XH9 A;  2CH9 A;  2BNG A;  4PEJ A;  5I97 A;  5IG0 A;  1E3V A;  3J7Y d;  1TUH A;  1UI8 A;  2MF7 A;  2GXF A;  2OOV A;  2Z7A A;  4BTY A;  5EVH A;  4FMC A;  1FGO A;  3VF1 A;  3D3L A;  4MEI A;  2V1L A;  3HI7 A;  3PXM A;  3KII A;  3TDG A;  3CCS 3;  1KQS 2;  5D83 A;  5JPU A;  2GEX A;  4XBX A;  1NB5 I;  1STF I;  1W02 A;  4FCM A;  2CHC A;  4G1M B;  3DMC A;  2E2V A;  3O8Y A;  1YIT 3;  3CNX A;  3G6E 3;  3EE1 A;  5STD A;  4AEQ A;  3DGL A;  4KZ1 A;  1K8A 4;  1DVC A;  2HMJ B;  2WOH A;  1US1 A;  5IG4 A;  3CC7 3;  3WOF B;  2XSH B;  3DGM A;  3JUM A;  2PNC A;  3KFQ C;  1FGM A;  3CCU 3;  2CFW A;  3DM8 A;  3WOE B;  4AKY A;  1E3R A;  2O9U X;  1J2B A;  1DMM A;  1KSI A;  1YJW 3;  2B24 B;  1SII A;  2BMO B;  2YX9 A;  4EC6 A;  2F99 A;  3SOA A;  3S67 A;  3UL6 A;  3EJV A;  4HM5 B;  1VQ5 3;  4R1K A;  1ULI B;  4LSO A;  1W7C A;  3FKA A;  1IVV A;  2HMO B;  2C10 A;  3SED A;  4FCZ A;  4Q53 A;  3MKI A;  3NBJ A;  3RGA A;  5LC7 A;  2HML B;  3WMD A;  1WMN A;  1OH0 A;  3CCM 3;  3FGY A;  1DMN A;  3FF2 A;  3G16 A;  2IA7 A;  3GZB A;  3FCS B;  3G0K A;  2P0X A;  1JN5 A;  2XF3 A;  4OVM A;  1YHQ 3;  2Z76 A;  1K73 4;  3GRD A;  4K90 B;  2ZDJ A;  1W4N A;  1IT8 A;  3KKG A;  1MNL A;  1ZO2 A;  3CCL 3;  1JV2 B;  1AV4 A;  1WMP A;  1VQN 3;  1UI7 A;  1W2Z A;  2SBL A;  2D1W A;  3MPH A;  1JJ2 2;  4WHA A;  1RJO A;  2W03 A;  3OW2 2;  3OWS A;  2BHM A;  2RGQ A;  1W00 A;  3EN8 A;  1YIJ 3;  3FG3 A;  1MOL A;  1JN5 B;  1VQK 3;  2XEP A;  1GY5 A;  1AR0 A;  3E99 A;  4HYZ A;  1IV9 A;  2K54 A;  5AIG A;  1YVB I;  1O7H B;  3UL5 A;  5KP3 A;  1IVU A;  3MG1 A;  4MMZ B;  5AYS C;  1FUW A;  1EA2 A;  2Q07 A;  3F7S A;  3HII A;  1LNH A;  3NQZ A;  3JUO A;  4EXR A;  4X2H A;  6STD A;  3UNL A;  2B1X B;  1STD A;  1EKM A;  3X42 A;  4LGQ A;  3BNB A;  1RKY A;  2JDI H;  3S27 A;  1OPY A;  1O7G B;  2E2T A;  4AKZ A;  4RZM A;  3X40 A;  5KP1 A;  4HM6 B;  4O3V A;  1SIH A;  4N6L A;  2GBX B;  1A2K A;  3NBR A;  3DGN A;  2W9P A;  3U97 A;  3HZP A;  5IEN A;  1SQW A;  1Q7Y 4;  4HVN A;  1O7W B;  3NUV A;  2HMN B;  3PZW A;  5ELJ A;  1GY7 A;  4WYK A;  3FG1 A;  3EBY A;  5CXO A;  3LT8 A;  5BXQ A;  1FGR A;  1CEW I;  1DVD A;  3NV0 A;  1QAF A;  2OCT A;  4JF8 A;  3JUQ A;  5AI1 A;  3ROB A;  1A90 A;  3DY5 A;  3CC4 3;  3KSE D;  1K28 A;  3L0R A;  4N6V 0;  3Q1C A;  3IMA B;  4MMX B;  3MWZ A;  2BMQ B;  1RN7 A;  1OF5 B;  4WYK B;  1QVF 2;  3V98 A;  4L8O A;  3CNM A;  4EV5 A;  3V92 A;  1HKX A;  3K7C A;  2CWU A;  2XSO B;  2CW9 A;  4HZB B;  4HM2 B;  4KFF A;  1O7M B;  3EB8 A;  4N6U A;  4N6T A;  4R9K A;  4RNY A;  2OTL 3;  1C7H A;  2CK3 H;  2KCD A;  3EC9 A;  3EHC A;  4EV2 A;  1OHS A;  2RFR A;  1VQM 3;  3X3X A;  1IQY A;  3FH1 A;  1W2B 2;  3ER7 A;  1W5Z A;  2P05 A;  2WOF A;  2YFL B;  1IVW A;  3F9S A;  3JVC A;  4R4K A;  1UUV B;  4LEH A;  1IDP A;  3F14 A;  3ALA A;  1OHP A;  1NJI 4;  1EQK A;  3U1W A;  1W01 A;  3VSY A;  3RGR A;  3MHE A;  2CFD A;  1IK3 A;  1R4C A;  2CIU A;  4I4K A;  3G8Z A;  3BNC A;  1VQP 3;  1F8N A;  2RSX A;  5DRV A;  1SJW A;  3IPT A;  3T8N A;  2WGQ A;  3CXC 2;  3CD6 3;  1GY6 A;  3NM7 A;  1Q42 A;  3SXX A;  3OX9 A;  3DGO A;  4RNZ A;  1Q40 A;  1T5Y A;  5ELU A;  1NO3 A;  1ISK A;  3FZW A;  1ROA A;  2ZL8 A;  5CF2 A;  1WNH A;  3FG4 A;  1QAL A;  1QMA A;  4GL6 A;  4LZI A;  5IEO A;  2W9Q A;  2XRX B;  3JUN A;  4HBR A;  3N54 B;  2E2U A;  5AEU B;  3I0Y A;  1GS3 A;  2BMR B;  1Q40 B;  2C11 A;  2Z77 A;  5IEP A;  1W6C A;  1W6G A;  4XB5 A;  1N9E A;  1NDO B;  3KN4 A;  5EEO A;  5IG5 A;  1WTH A;  1M1K 4;  4WFO A;  1FGT A;  3UB1 A;  2F98 A;  5DRE A;  4X2O A;  3OXA A;  2QGU A;  1IU7 A;  5HGR A;  5EQL A;  3LYG A;  3PCS A;  4R80 A;  2LQV A;  4LMI A;  4XDW A;  1VZZ A;  2QEX 3;  3CCV 3;  3BLZ A;  3WOD G;  1Q81 4;  1KC8 4;  2CWT A;  1NU3 A;  3GWR A;  1N5H A;  2OOV C;  2XGN A;  3WA3 A;  3GAX A;  3MG3 A;  1OGX A;  3SLU A;  2XFT A;  3SOY A;  2WGO A;  4TX4 A;  2Y73 A;  4H3U A;  3LOY A;  2WO0 A;  5AEW B;  3GZR A;  3PYJ A;  1JB5 A;  3A76 A;  3LTA A;  4CDL A;  2O3O A;  3T8U A;  3N9H A;  1FGQ A;  3NBB A;  1V74 A;  4OK0 A;  1WMO A;  3HX8 A;  3LTC A;  3F8X A;  1E97 A;  3LML A;  4HZ9 B;  4XM4 A;  1JNQ A;  3K63 A;  2FNQ A;  3WDG B;  3X41 A;  5BVB A;  3CC2 3;  1VQ6 3;  1AVL A;  1N9J A;  1D6Z A;  5AIH A;  2CFL A;  1N5P A;  1OAC A;  1RRL A;  1UW1 A;  3FSD A;  1QAK A;  1RRH A;  3RDE A;  5TGN A;  4JRF A;  4HM8 B;  3NXJ A;  1KD1 4;  5AYR B;  3FLJ A;  1KWI A;  2QA4 3;  4L7K A;  4J9A A;  5AIF A;  4CCV A;  5IF6 A;  2OQE A;  1GD4 A;  3HIG A;  3CME 3;  4FR9 A;  3B4O A;  5CF1 A;  2CFK A;  1IT7 A;  3OV4 A;  2KRT A;  3BND A;  1ASK A;  3CCQ 3;  4N6O B;  4KFD A;  3MG2 A;  2IUJ A;  2GU1 A;  4XBY A;  2W56 A;  4HKV B;  3UJM A;  4N6N B;  1A2V A;  2FGT A;  2P0M A;  3MYT A;  3CMA 3;  2W2C A;  3DUK A;  1WQL B;  1JB4 A;  2GEY A;  2I9W A;  3PCR A;  4N3V A;  5CK6 A;  2STD A;  5D81 A;  3MSO A;  1HU9 A;  3KSP A;  2XR8 B;  2K0M A;  1K41 A;  3GZX B;  3NQY A;  1OHO A;  5KP4 A;  2W56 B;  3NV0 B;  3X3Z A;  4EBG A;  5A0O B;  2CFG A;  3X3Y A;  3JUP A;  4WP5 A;  5IW9 A;  4ORL A;  4O02 B;  2Y74 A;  1CQS A;  2CG0 A;  3QK9 A;  2M7O A;  1VQ8 3;  2Z6B A;  1ROV A;  4STD A;  3D9R A;  1CYU A;  3KZT A;  2OTJ 3;  2MC8 A;  1TU5 A;  1W6Y A;  4MJD A;  1TFK A;  3F7X A;  8CHO A;  2CWV A;  2CG1 A;  5FGO A;  3HK4 A;  3WA2 X;  4FMA A;  4U13 A;  1PU4 A;  4N6M A;  2CKF B;  1VQ9 3;  1OUN A;  1CYV A;  1TFO A;  2W6J H;  3PS8 A;  3STD A;  2A15 A;  4ZM8 A;  3NX0 A;  1OGZ A;  2QIY A;  1EG9 B;  5IG3 A;  2KXG A;  5JBS A;  3EF8 A;  3IJE B;  3S29 A;  4HM0 B;  1IV7 A;  1Q82 4;  3NHX A;  4H61 A;  3DXO A;  3CU3 A;  1LOX A;  2L4V A;  1DMQ A;  3H51 A;  1ULJ B;  1JRQ A;  5G2G A;  2OQE C;  1L5G B;  1O7P B;  3SX1 A;  3AMO A;  3QRD A;  4XBT A;  3I56 3;  1M1X B;  1YI2 3;  1S5A A;  2OWP A;  4FMB A;  3LTB A;  4HM4 B;  1QVG 2;  1VQL 3;  3CCJ 3;  4R9L A;  1VQ7 3;  3F8H A;  3LXU X;  3LZA A;  3VGN A;  4EYC A;  5CLK A;  4BTW A;  4QWT A;  3AMO B;  2BT3 A;  3M8C A;  1D6U A;  1VQ4 3;  2W04 A;  3EN1 B;  4FCJ A;  1YJ9 3;  4IIA A;  1N8R 4;  2GBW B;  1Y4K A;  5AII A;  3OWY A;  1OCV A;  2D42 A;  3Q2P A;  1YJN 3;  3EX9 A;  4IPB A;  1IQ8 A;  5IER A;  1FA3 A;  1M9G A;  3CPO A;  4WWU C;  4IT7 A;  1UUW B;  1N8Q A;  2ML6 A;  2HMM B;  3H3H A;  1S72 3;  3EQQ B;  4J8T A;  4K1V A;  4NHF A;  2ML5 A;  2W0Q A;  1U8C B;  1PFP A;  3B4P A;  3S28 A;  3CCE 3;  3S5C A;  2IMJ A;  1IVX A;  3CCR 3;  4HM7 B;  3FF0 A;  4L8P A;  1TIJ A;  1ZX2 A;  1Q86 4;  3N8B A;  1JB2 A;  4MMY B;  1AVK A;  3B7C A;  2F86 B;  3K5T A;  4KFE A;  5JPP A;  4K1U A;  1M90 4;  3CPW 2;  5D82 A;  2JQ5 A;  3G71 3;  1GYB A;  3GZY B;  1DYU A;  3BB9 A;  1JKG A;  4NRE A;  3LTD A;  1LXE A;  1D6Y A;  2YFI B;  3I55 3;  3BNE A;  1G96 A;  3B8L A;  3KE7 A;  3OWU A;  3Q90 A;  1GD3 A;  1O7N B;  3DZL A;  3K9M C;  4XDV A;  2R4I A;  3K0Z A;  2YFJ B;  4GB5 A;  4HJL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...