2Z76A

X-ray crystal structure of rv0760c from mycobacterium tuberculosis at 1.82 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative steroid isomerase
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 42
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2z76A00
4XBTA 1JN5B 5AEWB 1JN5A 2HMOB 5CK6A 2HMNB 5G2GA 5CF2A 3F8XA 3FH1A 3NM2A 3EBTA 3B4OA 4HKVB 2Z76A 3MKIA 2QIYA 5STDA 4HM0B 2GBXB 5HGRA 2GEXA 3EBYA 2YFIB 3H3HA 3JUPA 2F86B 3BLZA 3I0YA 3DM8A 5IG0A 5IG5A 3MG2A 4HZ9B 3SEDA 3FGYA 5CLKA 1UUWB 4U13A 5AIHA 3EF8A 3CU3A 4HM4B 1WQLB 4LEHA 3EX9A 3JUOA 3NXJA 1O7NB 1OHSA 4LMIA 4XBYA 1O7HB 2XR8B 3ECFA 4IIAA 1VZZA 1Z1SA 3K0ZA 5FW5A 4L8PA 3FF0A 3VGNA 3F7SA 3G0KA 4WYKB 4HJLB 1K41A 4WYKA 4H3UA 1U5OA 1O7WB 4X2OA 3G16A 2A15A 3VSYA 3LZAA 5BXQA 5IG4A 2YFJB 1EG9B 3HZPA 3JUNA 3MG3A 3GZXB 3DMCA 2K54A 1Q40B 5IEOA 1TP6A 1QJGA 1Q40A 4KVHA 3UNLA 2HMMB 3DXOA 4XDWA 4HM3B 3LYGA 2UX0A 4WWUC 5TGNA 4L7KA 1A2KA 3EC9A 3MYTA 2Z7AA 1O7PB 3HK4A 1GY6A 1OGXA 1GYBA 3NHXA 1W00A 1AR0A 3H51A 4HM7B 4OVMA 3E99A 1OPYA 1GY7A 3EJVA 3GRDA 3CNXA 5KP4A 3F9SA 3ER7A 2R4IA 1E3VA 3DZLA 3BB9A 4K1UA 3FLJA 3G8ZA 3JUQA 5IF6A 1ASKA 1TUHA 4J8TA 3A76A 1OCVA 3MG1A 5IENA 4XM4A 3F14A 3CNMA 2GXFA 1NU3A 3B4PA 1IDPA 3M8CA 5AEUB 4CDLA 1S5AA 5DRVA 3OWYA 4HVNA 3UJMA 4PEJA 3B8LA 2BMOB 3OXAA 1JKGB 4STDA 1JKGA 4I4KA 4FCJA 1E3RA 4J9AA 4HM1B 3OWUA 2CKFB 3SOAA 4R9KA 2BNGA 3IPTA 5KP1A 4HM5B 2INXA 5IEPA 2B1XB 7STDA 6STDA 3FSDA 1DMQA 4K1VA 3SOYA 1QMAA 1Q42A 3S5CA 1O7GB 5BVBA 5CXOA 3NBRA 2BMRB 1DMMA 1ZO2A 3EHCA 2QGUA 1W6YA 3OX9A 4MJDA 3F40A 3MHEA 1JB5A 2YFLB 2RCDA 4HM8B 1ULIB 4FCMA 3JUMA 4WP5A 3FZWA 3OV4A 4HZBB 3Q90A 3DUKA 3NV0B 2I9WA 3EQQB 3NV0A 5DREA 3F7XA 3NUVA 3T8NA 2F98A 2RGQA 1STDA 1ULJB 5D81A 3B7CA 1C7HA 2F99A 4HM2B 1UUVB 8CHOA 2PZVA 3GZYB 2W2CA 4L8OA 1BUQA 5JPUA 5D82A 5KP3A 1NDOB 5IG3A 3KZTA 2CHCA 2XSHB 2OWPA 4XB5A 1O7MB 3GZBA 2JQ5A 2XRXB 2HMKB 4X2HA 1OHPA 2HMJB 3KKGA 2XSOB 5AI1A 3RGRA 3T8UA 5EVHA 3ROBA 3GWRA 1JB2A 5D83A 4RZMA 1GY5A 4ORLA 1EA2A 1E97A 3STDA 4R1KA 3EN1B 2RFRA 2IMJA 3GZRA 3K7CA 3HX8A 3KSPA 2GBWB 1OUNA 1OF5B 5AIFA 4LGQA 1W01A 1OF5A 1SJWA 5IERA 5AIGA 3FKAA 3D9RA 3RGAA 1JB4A 4N3VA 5AIIA 1DMNA 1W02A 4R9LA 1CQSA 5JPPA 1OGZA 3MSOA 2B24B 3EN8A 2Z77A 4OUQA 3KE7A 3WMDA 2GEYA 3F8HA 1HKXA 2STDA 4XBXA 1GS3A 1OHOA 4Q53A 4GB5A 5CF1A 4HM6B 1OH0A 1NWWA 1ZX2A 1ISKA 3FF2A 3OWSA 3CPOA 2HMLB 4XDVA 2BMQB
chains in the Genus database with same CATH superfamily
2CX1A 1LQMB 3NBJA 1QVG2 4XBTA 1JN5B 1EQKA 2OTJ3 1BRHA 5AEWB 2IY2A 1JN5A 1GMPA 2HMOB 4RNZA 5CK6A 2HMNB 5G2GA 5CF2A 1BRSA 1W6CA 5ELJA 1VQ83 4FMCA 1IT7A 2L1SA 2WOFA 2OCTA 2CG1A 2CWVA 3F8XA 3FH1A 4O2HA 1X1UA 1UCJA 3NM2A 3EBTA 2BHMA 3B4OA 8RNTA 4HKVB 4KFDA 2Z76A 3MKIA 2QIYA 4BIRA 5STDA 3AMOB 4J5KA 4HM0B 1R4YA 2GBXB 4TX4A 2IA7A 1BSEA 1EUIC 1FGTA 3X3XA 5HGRA 2HOHA 1IVWA 2GEXA 1Q864 3EBYA 1UW1A 5G1LA 1RNTA 1RGKA 2YFIB 3H3HA 2F56A 1VQ53 2KF3A 3JUPA 1D6UA 3J7Yd 4AKYA 3LTCA 2UGIA 3K63A 2F86B 2GSPA 2C10A 3BLZA 3CC43 1Q9EA 3X41A 4EV2A 3I0YA 3CCR3 1ROAA 3DM8A 5ELUA 1KQS2 5IG0A 5IG5A 1SIHA 1AQZA 3MG2A 1FGOA 4HZ9B 1LQGC 3SEDA 4BL3A 3FGYA 5CLKA 1UUWB 1AV4A 1KWIA 4U13A 5AIHA 3EF8A 3CU3A 4RNYA 3WOFB 2CG0A 4HM4B 4EBGA 1BNFA 1N5PA 3DGNA 1WQLB 2W0QA 4LEHA 1RTUA 2Y73A 1LVNA 3EB8A 3Q3FA 1RJOA 1MNLA 1IVXA 3EX9A 4O3VA 3JUOA 3CME3 3NXJA 1O7NB 1VQM3 4RNTA 1GMRA 1OHSA 2XEPA 1BRIA 3IJEB 4LMIA 1O7HB 4XBYA 2XR8B 5JBSA 2M7OA 3CCS3 3ECFA 4IIAA 1VZZA 2QA43 1Z1SA 6GSPA 1BNGA 1K28A 3K0ZA 1BU4A 2XFSA 2L4VA 4L8PA 5FW5A 1CYVA 3HOHA 4FR9A 3FF0A 3LH4A 5AYRB 1B20A 3VGNA 3F7SA 2J8XB 3G0KA 1KC84 4WYKB 1PFPA 3AGNA 3DY5A 4HJLB 3N9HA 1K41A 3O8YA 2IYJA 2MC8A 4GL6A 4WYKA 3ZFZA 1RGEA 3NBBA 4H3UA 1U5OA 4JF8A 3PXMA 1O7WB 2P0XA 4X2OA 1I0XA 1RN7A 3G16A 5GSPA 2A15A 4ZM8A 3VSYA 3LZAA 1BRGA 4N6NB 5BXQA 5IG4A 1UI8A 2YFJB 2ZHXB 1Y4KA 1EG9B 3HZPA 1X1WA 3JUNA 1B2UA 2D1WA 1RCKA 1TRQA 3D79A 3GZXB 3MG3A 3X42A 2WO0A 3DGMA 4I5QA 1GOYA 2K54A 1YGEA 1Q40B 1TIJA 2C11A 3DMCA 1M1XB 2CW9A 5IEOA 4WHAA 1TP6A 1QJGA 1Q40A 4KVHA 4BL2A 1MWRA 3UNLA 1FGQA 4MMYB 2HMMB 1W2B2 3DXOA 4XDWA 7RNTA 3TDGA 1QALA 3BU4A 4BU4A 4HM3B 4MEIA 4AKZA 4FCZA 3LMLA 1I8VA 1NO3A 2UX0A 1W5ZA 3LYGA 1BRJA 4WWUC 5TGNA 4L7KA 3T0UA 1Q814 1A2KA 3Q2PA 4N6V0 1FYSA 3AHSA 2OOVA 4EXRA 1BIRA 1AVKA 2W56B 1YGWA 3EC9A 3MYTA 3PS8A 3I563 2H0IA 2W56A 1DE3A 1RGHA 2Z7AA 1O7PB 2RBIA 3HK4A 4KFFA 1BNSA 1JBSA 1GY6A 1M9GA 2FGTA 1G96A 1B2MA 2K0MA 1LXEA 1OGXA 1BVIA 2IUKA 1GYBA 1I2GA 2K3DA 3KFQC 3FG3A 4KFEA 4R80A 3NHXA 3PZWA 1W00A 1AR0A 1RSNA 3H51A 1B2ZA 4HM7B 4OVMA 2P05A 3E99A 1OPYA 1GY7A 3EJVA 3GRDA 1PY3A 1MGWA 2XF3A 3CNXA 1DVCA 3JVCA 3U1WA 1Q7HA 5KP4A 2Q07A 4NHFA 1RLSA 2OOVC 1BSCA 3WA3A 3N54B 3DGLA 3F9SA 1T3BA 3ER7A 4CPKA 1HU9A 2R4IA 4IPBA 2W9QA 2RNTA 1E3VA 2CFLA 2KF4A 4RBNA 3SYUA 1UCLA 1YJ93 2C4BA 3DZLA 3NQZA 1IVUA 2UUGC 1FUTA 4LSOA 1VQQA 3BB9A 5EQLA 3BIRA 4K1UA 2W03A 1N9JA 3FLJA 1YVSA 3G8ZA 3JUQA 5IF6A 3I553 1IV9A 1FGMA 2FNQA 1ASKA 3WDGB 3CCM3 1TUHA 4J8TA 1BOXA 1JZOA 2YX9A 1GMQA 4WFOA 3A76A 3AGOA 1T2HA 1UUGB 1T2IA 3S67A 1GD3A 1CH0A 1RN1A 3ZG5A 1DVDA 1I2FA 1OCVA 3MG1A 3D5IA 1I2EA 4QWTA 5IENA 2E2TA 1L5GB 4XM4A 2P09A 1ZS7A 1AVLA 3CNMA 3F14A 2GXFA 1VQ73 1YI23 3UL5A 2P0MA 3V92A 1I0VA 1BRNL 1Q7Y4 3AHWA 2GU1A 1JV2B 1HZ1A 1NJI4 1N9EA 1NU3A 1IDPA 2ML6A 3B4PA 3LTDA 3M8CA 5AEUB 3KCHA 1RKYA 3GSPA 4CDLA 1A90A 1A2PA 3IMAB 1S5AA 3SLUA 4BTWA 3X3YA 1PU4A 1GOUA 5DRVA 3CCE3 3OWYA 1LOVA 4H61A 3RNTA 3PCSA 4HVNA 1D6ZA 4LYLB 4PEJA 1UCKA 3UJMA 3B8LA 2E2UA 1LNHA 2BMOB 1VQ63 3OXAA 1M904 1JKGB 1FZUA 4STDA 1JKGA 4HYZA 3S27A 4I4KA 4FCJA 1E3RA 2CC3A 4J9AA 3A5EA 2CIUA 1YNVX 3HI7A 3CXC2 2WOHA 2LYXA 4HM1B 2F4YA 3OWUA 4CCVA 1STFI 2CKFB 1B3SA 3SOAA 4R9KA 4N6UA 1W7CA 2O3OA 2BNGA 3BNEA 3DGOA 2V1LA 3IPTA 1QAKA 1JBTA 5KP1A 3CCQ3 4HM5B 1TRPA 9RNTA 2INXA 4MMZB 2FXTA 1JZDA 4EW5A 2Y74A 1NB5I 1RGLA 1TFOA 1W6GA 1LOXA 2B1XB 2KXGA 1RRHA 2MF7A 5LC7A 7STDA 5IEPA 6STDA 3D5GA 1IK3A 4HBRA 1V74A 4FMBA 4GSPA 3WOEB 3LTAA 3FSDA 4BTXA 1JRQA 1DMQA 4K1VA 5RNTA 1R4CA 3FCSB 3UB1A 3NM7A 1GD4A 2CWUA 4LZIA 3SOYA 1MGRA 1AY7A 1UGHI 1YVBI 1QMAA 1Q42A 1IU7A 1WTHA 4AEQA 3D3LA 1O7GB 1BSAA 3S5CA 5BVBA 4J5GA 5CXOA 3NBRA 3S28A 2BMRB 1IQYA 1DMMA 2CWTA 1DETA 1ZO2A 2Z6BA 3CC73 4CJNA 2AADA 5AYSC 2R41A 3WHOA 4IT7A 5M18A 2CFDA 4HOHA 1W2ZA 2BT3A 3EHCA 1BNJA 1RGGA 2QGUA 2WGQA 1W6YA 3OX9A 4MJDA 2XFTA 3F40A 5G1KA 1MOLA 1JB5A 3MHEA 4EV5A 2YFLB 3S29A 2LQVA 2RCDA 3SVAA 4HM8B 6RNTA 1RGCA 3CCJ3 3DH2A 1YJW3 1LRAA 1ULIB 3PGBA 1WMOA 3WA2X 4FCMA 2CFWA 2ZA4A 3JUMA 4WP5A 1LOWA 1J2BA 3V99A 3FZWA 1YHQ3 2CH9A 3OV4A 3KIIA 1IT8A 1D6YA 4HZBB 1K8A4 3PCRA 3CPW2 1IYYA 4FMAA 1GSPA 3Q90A 3G4S3 3DUKA 3CC23 3NV0B 1I3IA 2D42A 1RCLA 2I9WA 4JRFA 5LC6A 1W4NA 1PYLA 2KF6A 3EQQB 3NV0A 3PYJA 2KAAA 3CMA3 5DREA 1IQXA 4EYCA 3F7XA 7GSPA 1NNVA 3NUVA 3T8NA 1ROVA 1RMSA 2F98A 2H0HA 2RGQA 1STDA 1TJDA 5IW9A 5EEOA 1ULJB 2IUJA 1N5HA 4MMXB 5D81A 3CCL3 3WODG 1UI7A 4NPBA 3X40A 1MWTA 1TFKA 2WGOA 3LT8A 3B7CA 1C7HA 2F99A 2F5WA 4KZ1A 4EC6A 4HM2B 1UUVB 1A2VA 3SX1A 1UCIA 3U97A 2OTL3 2RSXA 1SIIA 1TTOA 8CHOA 2PZVA 3GZYB 2W04A 3N8BA 2W2CA 3GAXA 4L8OA 1BUQA 3BNCA 4GHOA 5JPUA 1I3FA 5D82A 5KP3A 1NDOB 3AMOA 1SARA 3FG1A 4N6LA 4K90B 1GOVA 1UDII 2O9UX 3URPA 5IG3A 2H0GA 3KZTA 2CHCA 2XSHB 2OWPA 4XB5A 1T5YA 2AAEA 1O7MB 1M1K4 4O8SA 1EEJA 3GZBA 2P38A 3LT9A 2JDIH 1K734 1VQN3 4DKIA 2JQ5A 3Q1CA 3CCU3 1JJ22 2XRXB 1BSBA 1BAOA 2HMKB 1C54A 4O02B 4X2HA 1OHPA 2HMJB 1B2SA 1MWSA 3KKGA 1SPUA 2XSOB 1ZGXA 4G1MB 5AI1A 1N8R4 1A67A 3RGRA 3T8UA 3HIGA 3LXUX 2E2VA 2SBLA 5EVHA 3ROBA 1HYFA 3GWRA 3SXXA 3L0RA 1BGSA 1JB2A 3K5TA 4RZMA 1EKMA 5D83A 2XH9A 1IQ8A 5BIRA 1F8NA 3NX0A 1G02A 1GY5A 1RN4A 4ORLA 1BSDA 1FUWA 1CEWI 1EA2A 3HIIA 1IVVA 1FUSA 1E97A 3STDA 2BU4A 3EN1B 4R1KA 5M19A 4K61A 3QRDA 3KN4A 5BU4A 1B21A 5M1AA 1DYUA 1QAFA 1IV7A 5FGOA 1YIJ3 2OQEA 1U8CB 2RFRA 2W6JH 2IMJA 4FMDA 1Q824 3GZRA 1RGFA 1SQWA 3K7CA 2XGLA 2PNCA 3BNDA 1V57A 3HX8A 3KSPA 3LTBA 3NQYA 3KSED 2CFGA 1WMPA 2GBWB 2BO9B 2ZDJA 3LOYA 1OUNA 1OF5B 2CX0A 3QK9A 5AIFA 3CD63 2KF5A 4LGQA 1FA3A 1FGRA 3WR2A 1W01A 4N6MA 1OF5A 3G713 1SJWA 1VQK3 1BUJA 2BIRA 4N6OB 5IERA 5AIGA 2W9PA 3D4AA 1RDSA 3FKAA 4KT3B 3BNBA 1RHLA 3MPHA 3D9RA 3RDEA 1MWUA 1LOYA 3RGAA 3X3ZA 1JNQA 1KSIA 3UL6A 1BNIA 1JB4A 4HAAA 4N3VA 1YIT3 1FW7A 3K9MC 1UGIA 1DMNA 1W02A 1BRKA 2KRTA 4R9LA 5AIIA 2OQEC 4ILFA 2KCDA 1CQSA 4OK0A 1X1XA 1N8QA 1OGZA 1WNHA 5JPPA 3MSOA 5A0OB 2QEX3 1CYUA 1S723 2B24B 3EN8A 2Z77A 3ZG0A 1VQO3 4OUQA 1US1A 1B2XA 1RNBA 2CK3H 3KE7A 1BANA 2F5MA 1RRLA 1TU5A 4N6TA 3VF1A 3OW22 3WMDA 3ALAA 2CFKA 2GEYA 1OACA 1WMNA 1I70A 1QVF2 1LNIA 1V58A 1X1YA 3F8HA 1HKXA 2STDA 1JBRA 5I97A 4XBXA 1GS3A 4R4KA 2ML5A 3FG4A 1VQ93 1B27A 1BNRA 3DGYA 3EE1A 4NREA 1KD14 3G6E3 1OHOA 2SARA 4Q53A 5HOHA 3CCV3 1K9M4 4GB5A 5CF1A 3MWZA 1VQP3 2XGNA 4HM6B 1NB3I 1OH0A 1NWWA 1ZX2A 1ISKA 3FF2A 3OWSA 3CPOA 2HMLB 3V98A 2GU3A 1RGAA 1VQL3 1YJN3 2ZL8A 4XDVA 1G0TA 1BNEA 4BTYA 1VQ43 2BMQB
chains in the Genus database with same CATH topology
3NBJA 1QVG2 4XBTA 1JN5B 1EQKA 2OTJ3 5AEWB 1JN5A 2HMOB 4RNZA 5CK6A 2HMNB 5G2GA 5CF2A 1W6CA 5ELJA 1VQ83 4FMCA 1IT7A 2WOFA 2OCTA 2CG1A 2CWVA 3F8XA 3FH1A 4O2HA 3NM2A 3EBTA 2BHMA 3B4OA 4HKVB 4KFDA 2Z76A 3MKIA 2QIYA 5STDA 3AMOB 4HM0B 4TX4A 2GBXB 2IA7A 1FGTA 3X3XA 5HGRA 1IVWA 2GEXA 1Q864 3EBYA 1UW1A 2YFIB 3H3HA 1VQ53 3JUPA 1D6UA 3J7Yd 4AKYA 3LTCA 3K63A 2F86B 2C10A 3BLZA 3CC43 3X41A 4EV2A 3I0YA 3CCR3 1ROAA 3DM8A 5ELUA 1KQS2 5IG0A 5IG5A 1SIHA 3MG2A 1FGOA 4HZ9B 3SEDA 3FGYA 5CLKA 1UUWB 1AV4A 1KWIA 4U13A 5AIHA 3EF8A 3CU3A 4RNYA 3WOFB 2CG0A 4HM4B 4EBGA 1N5PA 3DGNA 1WQLB 2W0QA 4LEHA 2Y73A 1LVNA 3EB8A 1RJOA 1MNLA 1IVXA 3EX9A 4O3VA 3JUOA 3CME3 3NXJA 1O7NB 1VQM3 1OHSA 2XEPA 3IJEB 4LMIA 4XBYA 1O7HB 2XR8B 5JBSA 2M7OA 3CCS3 3ECFA 4IIAA 1VZZA 2QA43 1Z1SA 1K28A 3K0ZA 2XFSA 4L8PA 2L4VA 5FW5A 1CYVA 4FR9A 3FF0A 3LH4A 5AYRB 3VGNA 3F7SA 3G0KA 1KC84 4WYKB 1PFPA 3DY5A 4HJLB 3N9HA 1K41A 3O8YA 2MC8A 4GL6A 4WYKA 4JF8A 3NBBA 4H3UA 1U5OA 3PXMA 1O7WB 2P0XA 4X2OA 1RN7A 3G16A 2A15A 4ZM8A 3VSYA 3LZAA 4N6NB 5BXQA 5IG4A 1UI8A 2YFJB 1Y4KA 1EG9B 3HZPA 3JUNA 3X42A 2D1WA 3MG3A 3GZXB 2WO0A 3DGMA 3DMCA 2K54A 1YGEA 1Q40B 1TIJA 2C11A 1M1XB 2CW9A 5IEOA 4WHAA 1TP6A 1QJGA 1Q40A 4KVHA 3UNLA 1FGQA 4MMYB 2HMMB 1W2B2 3DXOA 4XDWA 3TDGA 1QALA 4HM3B 4MEIA 4AKZA 4FCZA 3LMLA 1NO3A 3LYGA 2UX0A 1W5ZA 4WWUC 5TGNA 4L7KA 3T0UA 1Q814 1A2KA 3Q2PA 4N6V0 2OOVA 4EXRA 1AVKA 2W56B 3EC9A 3MYTA 3PS8A 3I563 2W56A 2Z7AA 1O7PB 3HK4A 4KFFA 1GY6A 1M9GA 2FGTA 1G96A 2K0MA 1LXEA 1OGXA 2IUKA 1GYBA 3KFQC 3FG3A 4KFEA 4R80A 3NHXA 3PZWA 1W00A 1AR0A 3H51A 4HM7B 4OVMA 2P05A 3E99A 1OPYA 1GY7A 3EJVA 3GRDA 3CNXA 2XF3A 3U1WA 1DVCA 3JVCA 5KP4A 2Q07A 4NHFA 2OOVC 3WA3A 3N54B 3DGLA 3F9SA 3ER7A 1HU9A 2R4IA 4IPBA 2W9QA 1E3VA 2CFLA 4RBNA 1YJ93 3DZLA 3NQZA 1IVUA 4LSOA 3BB9A 5EQLA 4K1UA 2W03A 1N9JA 3FLJA 3G8ZA 3JUQA 3I553 5IF6A 1IV9A 1FGMA 2FNQA 1ASKA 3WDGB 3CCM3 1TUHA 4J8TA 2YX9A 4WFOA 3A76A 3S67A 1GD3A 1DVDA 1OCVA 3MG1A 5IENA 4QWTA 2E2TA 1L5GB 4XM4A 2P09A 3F14A 1AVLA 3CNMA 1VQ73 2GXFA 1YI23 3UL5A 2P0MA 3V92A 1Q7Y4 2GU1A 1JV2B 1NJI4 1N9EA 1NU3A 1IDPA 2ML6A 3B4PA 3LTDA 3M8CA 5AEUB 1RKYA 4CDLA 1A90A 3IMAB 1S5AA 3SLUA 4BTWA 3X3YA 1PU4A 5DRVA 3CCE3 3OWYA 4H61A 3PCSA 4HVNA 1D6ZA 4PEJA 3UJMA 3B8LA 2E2UA 1LNHA 2BMOB 1VQ63 3OXAA 1M904 1JKGB 4STDA 1JKGA 4HYZA 3S27A 4I4KA 4FCJA 1E3RA 2CC3A 4J9AA 2CIUA 3HI7A 3CXC2 2WOHA 2LYXA 4HM1B 3OWUA 4CCVA 1STFI 2CKFB 3SOAA 4R9KA 4N6UA 1W7CA 2O3OA 2BNGA 3BNEA 3DGOA 2V1LA 3IPTA 1QAKA 5KP1A 3CCQ3 4HM5B 2INXA 4MMZB 2FXTA 2Y74A 1NB5I 1W6GA 1TFOA 5LC7A 1LOXA 2B1XB 2KXGA 1RRHA 2MF7A 7STDA 5IEPA 6STDA 4HBRA 1V74A 4FMBA 3WOEB 3LTAA 3FSDA 4BTXA 1JRQA 1DMQA 4K1VA 1R4CA 3FCSB 3UB1A 3NM7A 1GD4A 2CWUA 4LZIA 3SOYA 1YVBI 1QMAA 1Q42A 1IU7A 1WTHA 4AEQA 3D3LA 1O7GB 3S5CA 5BVBA 5CXOA 3NBRA 3S28A 2BMRB 1IQYA 1DMMA 2CWTA 1ZO2A 2Z6BA 3CC73 5AYSC 4IT7A 2CFDA 1W2ZA 2BT3A 3EHCA 2QGUA 2WGQA 1W6YA 3OX9A 4MJDA 2XFTA 3F40A 1MOLA 1JB5A 3MHEA 4EV5A 2YFLB 3S29A 2LQVA 2RCDA 3SVAA 4HM8B 3CCJ3 1YJW3 1ULIB 3PGBA 1WMOA 3WA2X 4FCMA 2CFWA 3JUMA 4WP5A 1J2BA 3V99A 3FZWA 1YHQ3 2CH9A 3OV4A 3KIIA 1IT8A 1D6YA 4HZBB 1K8A4 3PCRA 3CPW2 4FMAA 3Q90A 3G4S3 3DUKA 3CC23 3NV0B 2D42A 2I9WA 4JRFA 5LC6A 1W4NA 3EQQB 3NV0A 3PYJA 3CMA3 5DREA 1IQXA 4EYCA 3F7XA 3NUVA 3T8NA 1ROVA 2F98A 2RGQA 1STDA 5IW9A 5EEOA 1ULJB 2IUJA 1N5HA 4MMXB 5D81A 3CCL3 3WODG 1UI7A 3X40A 1TFKA 2WGOA 3LT8A 3B7CA 1C7HA 2F99A 4KZ1A 4EC6A 4HM2B 1UUVB 1A2VA 3SX1A 2OTL3 3U97A 2RSXA 1SIIA 8CHOA 2PZVA 3GZYB 2W04A 3N8BA 2W2CA 3GAXA 4L8OA 1BUQA 3BNCA 5JPUA 5D82A 5KP3A 1NDOB 3AMOA 3FG1A 4N6LA 4K90B 2O9UX 5IG3A 3KZTA 2CHCA 2XSHB 2OWPA 4XB5A 1T5YA 1O7MB 1M1K4 4O8SA 3GZBA 3LT9A 2P38A 2JDIH 1K734 1VQN3 2JQ5A 3Q1CA 3CCU3 1JJ22 2XRXB 2HMKB 4O02B 4X2HA 1OHPA 2HMJB 1N8R4 3KKGA 4G1MB 1SPUA 2XSOB 1A67A 5AI1A 3RGRA 3T8UA 3HIGA 3LXUX 2E2VA 2SBLA 5EVHA 3ROBA 3GWRA 3SXXA 3L0RA 1JB2A 5D83A 3K5TA 4RZMA 1EKMA 2XH9A 1IQ8A 1F8NA 3NX0A 1GY5A 4ORLA 1FUWA 1CEWI 1EA2A 3HIIA 1IVVA 1E97A 3STDA 4R1KA 3EN1B 4K61A 3QRDA 3KN4A 1DYUA 1QAFA 1IV7A 5FGOA 1YIJ3 2OQEA 1U8CB 2RFRA 2W6JH 2IMJA 4FMDA 1Q824 3GZRA 1SQWA 3K7CA 2XGLA 2PNCA 3BNDA 3NQYA 3HX8A 3KSPA 3LTBA 3KSED 2CFGA 1WMPA 2GBWB 2BO9B 2ZDJA 3LOYA 1OUNA 1OF5B 3QK9A 3CD63 5AIFA 4LGQA 1FA3A 1FGRA 1W01A 4N6MA 1OF5A 3G713 1SJWA 1VQK3 4N6OB 5IERA 5AIGA 2W9PA 3FKAA 3BNBA 3MPHA 3D9RA 3RDEA 3RGAA 3X3ZA 1JNQA 1KSIA 3UL6A 1YIT3 1JB4A 4N3VA 3K9MC 5AIIA 1DMNA 1W02A 2KRTA 4R9LA 2OQEC 2KCDA 1CQSA 4OK0A 5JPPA 1N8QA 1OGZA 1WNHA 2QEX3 3MSOA 5A0OB 1CYUA 1S723 2B24B 3EN8A 2Z77A 1VQO3 4OUQA 1US1A 2CK3H 3KE7A 1RRLA 1TU5A 4N6TA 3VF1A 3OW22 3WMDA 3ALAA 2CFKA 2GEYA 1OACA 1WMNA 1QVF2 3F8HA 1HKXA 2STDA 5I97A 4XBXA 1GS3A 4R4KA 2ML5A 3FG4A 1VQ93 3EE1A 4NREA 1KD14 3G6E3 1OHOA 3CCV3 4Q53A 1K9M4 4GB5A 5CF1A 3MWZA 1VQP3 2XGNA 4HM6B 1NB3I 1OH0A 1NWWA 1ZX2A 1ISKA 3FF2A 3OWSA 3CPOA 2HMLB 3V98A 2GU3A 1VQL3 1YJN3 2ZL8A 4XDVA 1IK3A 4BTYA 1VQ43 2BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBT A;  1JN5 B;  5AEW B;  1JN5 A;  2HMO B;  5CK6 A;  2HMN B;  5G2G A;  5CF2 A;  3F8X A;  3FH1 A;  3NM2 A;  3EBT A;  3B4O A;  4HKV B;  2Z76 A;  3MKI A;  2QIY A;  5STD A;  4HM0 B;  2GBX B;  5HGR A;  2GEX A;  3EBY A;  2YFI B;  3H3H A;  3JUP A;  2F86 B;  3BLZ A;  3I0Y A;  3DM8 A;  5IG0 A;  5IG5 A;  3MG2 A;  4HZ9 B;  3SED A;  3FGY A;  5CLK A;  1UUW B;  4U13 A;  5AIH A;  3EF8 A;  3CU3 A;  4HM4 B;  1WQL B;  4LEH A;  3EX9 A;  3JUO A;  3NXJ A;  1O7N B;  1OHS A;  4LMI A;  4XBY A;  1O7H B;  2XR8 B;  3ECF A;  4IIA A;  1VZZ A;  1Z1S A;  3K0Z A;  5FW5 A;  4L8P A;  3FF0 A;  3VGN A;  3F7S A;  3G0K A;  4WYK B;  4HJL B;  1K41 A;  4WYK A;  4H3U A;  1U5O A;  1O7W B;  4X2O A;  3G16 A;  2A15 A;  3VSY A;  3LZA A;  5BXQ A;  5IG4 A;  2YFJ B;  1EG9 B;  3HZP A;  3JUN A;  3MG3 A;  3GZX B;  3DMC A;  2K54 A;  1Q40 B;  5IEO A;  1TP6 A;  1QJG A;  1Q40 A;  4KVH A;  3UNL A;  2HMM B;  3DXO A;  4XDW A;  4HM3 B;  3LYG A;  2UX0 A;  4WWU C;  5TGN A;  4L7K A;  1A2K A;  3EC9 A;  3MYT A;  2Z7A A;  1O7P B;  3HK4 A;  1GY6 A;  1OGX A;  1GYB A;  3NHX A;  1W00 A;  1AR0 A;  3H51 A;  4HM7 B;  4OVM A;  3E99 A;  1OPY A;  1GY7 A;  3EJV A;  3GRD A;  3CNX A;  5KP4 A;  3F9S A;  3ER7 A;  2R4I A;  1E3V A;  3DZL A;  3BB9 A;  4K1U A;  3FLJ A;  3G8Z A;  3JUQ A;  5IF6 A;  1ASK A;  1TUH A;  4J8T A;  3A76 A;  1OCV A;  3MG1 A;  5IEN A;  4XM4 A;  3F14 A;  3CNM A;  2GXF A;  1NU3 A;  3B4P A;  1IDP A;  3M8C A;  5AEU B;  4CDL A;  1S5A A;  5DRV A;  3OWY A;  4HVN A;  3UJM A;  4PEJ A;  3B8L A;  2BMO B;  3OXA A;  1JKG B;  4STD A;  1JKG A;  4I4K A;  4FCJ A;  1E3R A;  4J9A A;  4HM1 B;  3OWU A;  2CKF B;  3SOA A;  4R9K A;  2BNG A;  3IPT A;  5KP1 A;  4HM5 B;  2INX A;  5IEP A;  2B1X B;  7STD A;  6STD A;  3FSD A;  1DMQ A;  4K1V A;  3SOY A;  1QMA A;  1Q42 A;  3S5C A;  1O7G B;  5BVB A;  5CXO A;  3NBR A;  2BMR B;  1DMM A;  1ZO2 A;  3EHC A;  2QGU A;  1W6Y A;  3OX9 A;  4MJD A;  3F40 A;  3MHE A;  1JB5 A;  2YFL B;  2RCD A;  4HM8 B;  1ULI B;  4FCM A;  3JUM A;  4WP5 A;  3FZW A;  3OV4 A;  4HZB B;  3Q90 A;  3DUK A;  3NV0 B;  2I9W A;  3EQQ B;  3NV0 A;  5DRE A;  3F7X A;  3NUV A;  3T8N A;  2F98 A;  2RGQ A;  1STD A;  1ULJ B;  5D81 A;  3B7C A;  1C7H A;  2F99 A;  4HM2 B;  1UUV B;  8CHO A;  2PZV A;  3GZY B;  2W2C A;  4L8O A;  1BUQ A;  5JPU A;  5D82 A;  5KP3 A;  1NDO B;  5IG3 A;  3KZT A;  2CHC A;  2XSH B;  2OWP A;  4XB5 A;  1O7M B;  3GZB A;  2JQ5 A;  2XRX B;  2HMK B;  4X2H A;  1OHP A;  2HMJ B;  3KKG A;  2XSO B;  5AI1 A;  3RGR A;  3T8U A;  5EVH A;  3ROB A;  3GWR A;  1JB2 A;  5D83 A;  4RZM A;  1GY5 A;  4ORL A;  1EA2 A;  1E97 A;  3STD A;  4R1K A;  3EN1 B;  2RFR A;  2IMJ A;  3GZR A;  3K7C A;  3HX8 A;  3KSP A;  2GBW B;  1OUN A;  1OF5 B;  5AIF A;  4LGQ A;  1W01 A;  1OF5 A;  1SJW A;  5IER A;  5AIG A;  3FKA A;  3D9R A;  3RGA A;  1JB4 A;  4N3V A;  5AII A;  1DMN A;  1W02 A;  4R9L A;  1CQS A;  5JPP A;  1OGZ A;  3MSO A;  2B24 B;  3EN8 A;  2Z77 A;  4OUQ A;  3KE7 A;  3WMD A;  2GEY A;  3F8H A;  1HKX A;  2STD A;  4XBX A;  1GS3 A;  1OHO A;  4Q53 A;  4GB5 A;  5CF1 A;  4HM6 B;  1OH0 A;  1NWW A;  1ZX2 A;  1ISK A;  3FF2 A;  3OWS A;  3CPO A;  2HML B;  4XDV A;  2BMQ B; 
#chains in the Genus database with same CATH topology
 2CX1 A;  1LQM B;  3NBJ A;  1QVG 2;  4XBT A;  1JN5 B;  1EQK A;  2OTJ 3;  1BRH A;  5AEW B;  2IY2 A;  1JN5 A;  1GMP A;  2HMO B;  4RNZ A;  5CK6 A;  2HMN B;  5G2G A;  5CF2 A;  1BRS A;  1W6C A;  5ELJ A;  1VQ8 3;  4FMC A;  1IT7 A;  2L1S A;  2WOF A;  2OCT A;  2CG1 A;  2CWV A;  3F8X A;  3FH1 A;  4O2H A;  1X1U A;  1UCJ A;  3NM2 A;  3EBT A;  2BHM A;  3B4O A;  8RNT A;  4HKV B;  4KFD A;  2Z76 A;  3MKI A;  2QIY A;  4BIR A;  5STD A;  3AMO B;  4J5K A;  4HM0 B;  1R4Y A;  2GBX B;  4TX4 A;  2IA7 A;  1BSE A;  1EUI C;  1FGT A;  3X3X A;  5HGR A;  2HOH A;  1IVW A;  2GEX A;  1Q86 4;  3EBY A;  1UW1 A;  5G1L A;  1RNT A;  1RGK A;  2YFI B;  3H3H A;  2F56 A;  1VQ5 3;  2KF3 A;  3JUP A;  1D6U A;  3J7Y d;  4AKY A;  3LTC A;  2UGI A;  3K63 A;  2F86 B;  2GSP A;  2C10 A;  3BLZ A;  3CC4 3;  1Q9E A;  3X41 A;  4EV2 A;  3I0Y A;  3CCR 3;  1ROA A;  3DM8 A;  5ELU A;  1KQS 2;  5IG0 A;  5IG5 A;  1SIH A;  1AQZ A;  3MG2 A;  1FGO A;  4HZ9 B;  1LQG C;  3SED A;  4BL3 A;  3FGY A;  5CLK A;  1UUW B;  1AV4 A;  1KWI A;  4U13 A;  5AIH A;  3EF8 A;  3CU3 A;  4RNY A;  3WOF B;  2CG0 A;  4HM4 B;  4EBG A;  1BNF A;  1N5P A;  3DGN A;  1WQL B;  2W0Q A;  4LEH A;  1RTU A;  2Y73 A;  1LVN A;  3EB8 A;  3Q3F A;  1RJO A;  1MNL A;  1IVX A;  3EX9 A;  4O3V A;  3JUO A;  3CME 3;  3NXJ A;  1O7N B;  1VQM 3;  4RNT A;  1GMR A;  1OHS A;  2XEP A;  1BRI A;  3IJE B;  4LMI A;  1O7H B;  4XBY A;  2XR8 B;  5JBS A;  2M7O A;  3CCS 3;  3ECF A;  4IIA A;  1VZZ A;  2QA4 3;  1Z1S A;  6GSP A;  1BNG A;  1K28 A;  3K0Z A;  1BU4 A;  2XFS A;  2L4V A;  4L8P A;  5FW5 A;  1CYV A;  3HOH A;  4FR9 A;  3FF0 A;  3LH4 A;  5AYR B;  1B20 A;  3VGN A;  3F7S A;  2J8X B;  3G0K A;  1KC8 4;  4WYK B;  1PFP A;  3AGN A;  3DY5 A;  4HJL B;  3N9H A;  1K41 A;  3O8Y A;  2IYJ A;  2MC8 A;  4GL6 A;  4WYK A;  3ZFZ A;  1RGE A;  3NBB A;  4H3U A;  1U5O A;  4JF8 A;  3PXM A;  1O7W B;  2P0X A;  4X2O A;  1I0X A;  1RN7 A;  3G16 A;  5GSP A;  2A15 A;  4ZM8 A;  3VSY A;  3LZA A;  1BRG A;  4N6N B;  5BXQ A;  5IG4 A;  1UI8 A;  2YFJ B;  2ZHX B;  1Y4K A;  1EG9 B;  3HZP A;  1X1W A;  3JUN A;  1B2U A;  2D1W A;  1RCK A;  1TRQ A;  3D79 A;  3GZX B;  3MG3 A;  3X42 A;  2WO0 A;  3DGM A;  4I5Q A;  1GOY A;  2K54 A;  1YGE A;  1Q40 B;  1TIJ A;  2C11 A;  3DMC A;  1M1X B;  2CW9 A;  5IEO A;  4WHA A;  1TP6 A;  1QJG A;  1Q40 A;  4KVH A;  4BL2 A;  1MWR A;  3UNL A;  1FGQ A;  4MMY B;  2HMM B;  1W2B 2;  3DXO A;  4XDW A;  7RNT A;  3TDG A;  1QAL A;  3BU4 A;  4BU4 A;  4HM3 B;  4MEI A;  4AKZ A;  4FCZ A;  3LML A;  1I8V A;  1NO3 A;  2UX0 A;  1W5Z A;  3LYG A;  1BRJ A;  4WWU C;  5TGN A;  4L7K A;  3T0U A;  1Q81 4;  1A2K A;  3Q2P A;  4N6V 0;  1FYS A;  3AHS A;  2OOV A;  4EXR A;  1BIR A;  1AVK A;  2W56 B;  1YGW A;  3EC9 A;  3MYT A;  3PS8 A;  3I56 3;  2H0I A;  2W56 A;  1DE3 A;  1RGH A;  2Z7A A;  1O7P B;  2RBI A;  3HK4 A;  4KFF A;  1BNS A;  1JBS A;  1GY6 A;  1M9G A;  2FGT A;  1G96 A;  1B2M A;  2K0M A;  1LXE A;  1OGX A;  1BVI A;  2IUK A;  1GYB A;  1I2G A;  2K3D A;  3KFQ C;  3FG3 A;  4KFE A;  4R80 A;  3NHX A;  3PZW A;  1W00 A;  1AR0 A;  1RSN A;  3H51 A;  1B2Z A;  4HM7 B;  4OVM A;  2P05 A;  3E99 A;  1OPY A;  1GY7 A;  3EJV A;  3GRD A;  1PY3 A;  1MGW A;  2XF3 A;  3CNX A;  1DVC A;  3JVC A;  3U1W A;  1Q7H A;  5KP4 A;  2Q07 A;  4NHF A;  1RLS A;  2OOV C;  1BSC A;  3WA3 A;  3N54 B;  3DGL A;  3F9S A;  1T3B A;  3ER7 A;  4CPK A;  1HU9 A;  2R4I A;  4IPB A;  2W9Q A;  2RNT A;  1E3V A;  2CFL A;  2KF4 A;  4RBN A;  3SYU A;  1UCL A;  1YJ9 3;  2C4B A;  3DZL A;  3NQZ A;  1IVU A;  2UUG C;  1FUT A;  4LSO A;  1VQQ A;  3BB9 A;  5EQL A;  3BIR A;  4K1U A;  2W03 A;  1N9J A;  3FLJ A;  1YVS A;  3G8Z A;  3JUQ A;  5IF6 A;  3I55 3;  1IV9 A;  1FGM A;  2FNQ A;  1ASK A;  3WDG B;  3CCM 3;  1TUH A;  4J8T A;  1BOX A;  1JZO A;  2YX9 A;  1GMQ A;  4WFO A;  3A76 A;  3AGO A;  1T2H A;  1UUG B;  1T2I A;  3S67 A;  1GD3 A;  1CH0 A;  1RN1 A;  3ZG5 A;  1DVD A;  1I2F A;  1OCV A;  3MG1 A;  3D5I A;  1I2E A;  4QWT A;  5IEN A;  2E2T A;  1L5G B;  4XM4 A;  2P09 A;  1ZS7 A;  1AVL A;  3CNM A;  3F14 A;  2GXF A;  1VQ7 3;  1YI2 3;  3UL5 A;  2P0M A;  3V92 A;  1I0V A;  1BRN L;  1Q7Y 4;  3AHW A;  2GU1 A;  1JV2 B;  1HZ1 A;  1NJI 4;  1N9E A;  1NU3 A;  1IDP A;  2ML6 A;  3B4P A;  3LTD A;  3M8C A;  5AEU B;  3KCH A;  1RKY A;  3GSP A;  4CDL A;  1A90 A;  1A2P A;  3IMA B;  1S5A A;  3SLU A;  4BTW A;  3X3Y A;  1PU4 A;  1GOU A;  5DRV A;  3CCE 3;  3OWY A;  1LOV A;  4H61 A;  3RNT A;  3PCS A;  4HVN A;  1D6Z A;  4LYL B;  4PEJ A;  1UCK A;  3UJM A;  3B8L A;  2E2U A;  1LNH A;  2BMO B;  1VQ6 3;  3OXA A;  1M90 4;  1JKG B;  1FZU A;  4STD A;  1JKG A;  4HYZ A;  3S27 A;  4I4K A;  4FCJ A;  1E3R A;  2CC3 A;  4J9A A;  3A5E A;  2CIU A;  1YNV X;  3HI7 A;  3CXC 2;  2WOH A;  2LYX A;  4HM1 B;  2F4Y A;  3OWU A;  4CCV A;  1STF I;  2CKF B;  1B3S A;  3SOA A;  4R9K A;  4N6U A;  1W7C A;  2O3O A;  2BNG A;  3BNE A;  3DGO A;  2V1L A;  3IPT A;  1QAK A;  1JBT A;  5KP1 A;  3CCQ 3;  4HM5 B;  1TRP A;  9RNT A;  2INX A;  4MMZ B;  2FXT A;  1JZD A;  4EW5 A;  2Y74 A;  1NB5 I;  1RGL A;  1TFO A;  1W6G A;  1LOX A;  2B1X B;  2KXG A;  1RRH A;  2MF7 A;  5LC7 A;  7STD A;  5IEP A;  6STD A;  3D5G A;  1IK3 A;  4HBR A;  1V74 A;  4FMB A;  4GSP A;  3WOE B;  3LTA A;  3FSD A;  4BTX A;  1JRQ A;  1DMQ A;  4K1V A;  5RNT A;  1R4C A;  3FCS B;  3UB1 A;  3NM7 A;  1GD4 A;  2CWU A;  4LZI A;  3SOY A;  1MGR A;  1AY7 A;  1UGH I;  1YVB I;  1QMA A;  1Q42 A;  1IU7 A;  1WTH A;  4AEQ A;  3D3L A;  1O7G B;  1BSA A;  3S5C A;  5BVB A;  4J5G A;  5CXO A;  3NBR A;  3S28 A;  2BMR B;  1IQY A;  1DMM A;  2CWT A;  1DET A;  1ZO2 A;  2Z6B A;  3CC7 3;  4CJN A;  2AAD A;  5AYS C;  2R41 A;  3WHO A;  4IT7 A;  5M18 A;  2CFD A;  4HOH A;  1W2Z A;  2BT3 A;  3EHC A;  1BNJ A;  1RGG A;  2QGU A;  2WGQ A;  1W6Y A;  3OX9 A;  4MJD A;  2XFT A;  3F40 A;  5G1K A;  1MOL A;  1JB5 A;  3MHE A;  4EV5 A;  2YFL B;  3S29 A;  2LQV A;  2RCD A;  3SVA A;  4HM8 B;  6RNT A;  1RGC A;  3CCJ 3;  3DH2 A;  1YJW 3;  1LRA A;  1ULI B;  3PGB A;  1WMO A;  3WA2 X;  4FCM A;  2CFW A;  2ZA4 A;  3JUM A;  4WP5 A;  1LOW A;  1J2B A;  3V99 A;  3FZW A;  1YHQ 3;  2CH9 A;  3OV4 A;  3KII A;  1IT8 A;  1D6Y A;  4HZB B;  1K8A 4;  3PCR A;  3CPW 2;  1IYY A;  4FMA A;  1GSP A;  3Q90 A;  3G4S 3;  3DUK A;  3CC2 3;  3NV0 B;  1I3I A;  2D42 A;  1RCL A;  2I9W A;  4JRF A;  5LC6 A;  1W4N A;  1PYL A;  2KF6 A;  3EQQ B;  3NV0 A;  3PYJ A;  2KAA A;  3CMA 3;  5DRE A;  1IQX A;  4EYC A;  3F7X A;  7GSP A;  1NNV A;  3NUV A;  3T8N A;  1ROV A;  1RMS A;  2F98 A;  2H0H A;  2RGQ A;  1STD A;  1TJD A;  5IW9 A;  5EEO A;  1ULJ B;  2IUJ A;  1N5H A;  4MMX B;  5D81 A;  3CCL 3;  3WOD G;  1UI7 A;  4NPB A;  3X40 A;  1MWT A;  1TFK A;  2WGO A;  3LT8 A;  3B7C A;  1C7H A;  2F99 A;  2F5W A;  4KZ1 A;  4EC6 A;  4HM2 B;  1UUV B;  1A2V A;  3SX1 A;  1UCI A;  3U97 A;  2OTL 3;  2RSX A;  1SII A;  1TTO A;  8CHO A;  2PZV A;  3GZY B;  2W04 A;  3N8B A;  2W2C A;  3GAX A;  4L8O A;  1BUQ A;  3BNC A;  4GHO A;  5JPU A;  1I3F A;  5D82 A;  5KP3 A;  1NDO B;  3AMO A;  1SAR A;  3FG1 A;  4N6L A;  4K90 B;  1GOV A;  1UDI I;  2O9U X;  3URP A;  5IG3 A;  2H0G A;  3KZT A;  2CHC A;  2XSH B;  2OWP A;  4XB5 A;  1T5Y A;  2AAE A;  1O7M B;  1M1K 4;  4O8S A;  1EEJ A;  3GZB A;  2P38 A;  3LT9 A;  2JDI H;  1K73 4;  1VQN 3;  4DKI A;  2JQ5 A;  3Q1C A;  3CCU 3;  1JJ2 2;  2XRX B;  1BSB A;  1BAO A;  2HMK B;  1C54 A;  4O02 B;  4X2H A;  1OHP A;  2HMJ B;  1B2S A;  1MWS A;  3KKG A;  1SPU A;  2XSO B;  1ZGX A;  4G1M B;  5AI1 A;  1N8R 4;  1A67 A;  3RGR A;  3T8U A;  3HIG A;  3LXU X;  2E2V A;  2SBL A;  5EVH A;  3ROB A;  1HYF A;  3GWR A;  3SXX A;  3L0R A;  1BGS A;  1JB2 A;  3K5T A;  4RZM A;  1EKM A;  5D83 A;  2XH9 A;  1IQ8 A;  5BIR A;  1F8N A;  3NX0 A;  1G02 A;  1GY5 A;  1RN4 A;  4ORL A;  1BSD A;  1FUW A;  1CEW I;  1EA2 A;  3HII A;  1IVV A;  1FUS A;  1E97 A;  3STD A;  2BU4 A;  3EN1 B;  4R1K A;  5M19 A;  4K61 A;  3QRD A;  3KN4 A;  5BU4 A;  1B21 A;  5M1A A;  1DYU A;  1QAF A;  1IV7 A;  5FGO A;  1YIJ 3;  2OQE A;  1U8C B;  2RFR A;  2W6J H;  2IMJ A;  4FMD A;  1Q82 4;  3GZR A;  1RGF A;  1SQW A;  3K7C A;  2XGL A;  2PNC A;  3BND A;  1V57 A;  3HX8 A;  3KSP A;  3LTB A;  3NQY A;  3KSE D;  2CFG A;  1WMP A;  2GBW B;  2BO9 B;  2ZDJ A;  3LOY A;  1OUN A;  1OF5 B;  2CX0 A;  3QK9 A;  5AIF A;  3CD6 3;  2KF5 A;  4LGQ A;  1FA3 A;  1FGR A;  3WR2 A;  1W01 A;  4N6M A;  1OF5 A;  3G71 3;  1SJW A;  1VQK 3;  1BUJ A;  2BIR A;  4N6O B;  5IER A;  5AIG A;  2W9P A;  3D4A A;  1RDS A;  3FKA A;  4KT3 B;  3BNB A;  1RHL A;  3MPH A;  3D9R A;  3RDE A;  1MWU A;  1LOY A;  3RGA A;  3X3Z A;  1JNQ A;  1KSI A;  3UL6 A;  1BNI A;  1JB4 A;  4HAA A;  4N3V A;  1YIT 3;  1FW7 A;  3K9M C;  1UGI A;  1DMN A;  1W02 A;  1BRK A;  2KRT A;  4R9L A;  5AII A;  2OQE C;  4ILF A;  2KCD A;  1CQS A;  4OK0 A;  1X1X A;  1N8Q A;  1OGZ A;  1WNH A;  5JPP A;  3MSO A;  5A0O B;  2QEX 3;  1CYU A;  1S72 3;  2B24 B;  3EN8 A;  2Z77 A;  3ZG0 A;  1VQO 3;  4OUQ A;  1US1 A;  1B2X A;  1RNB A;  2CK3 H;  3KE7 A;  1BAN A;  2F5M A;  1RRL A;  1TU5 A;  4N6T A;  3VF1 A;  3OW2 2;  3WMD A;  3ALA A;  2CFK A;  2GEY A;  1OAC A;  1WMN A;  1I70 A;  1QVF 2;  1LNI A;  1V58 A;  1X1Y A;  3F8H A;  1HKX A;  2STD A;  1JBR A;  5I97 A;  4XBX A;  1GS3 A;  4R4K A;  2ML5 A;  3FG4 A;  1VQ9 3;  1B27 A;  1BNR A;  3DGY A;  3EE1 A;  4NRE A;  1KD1 4;  3G6E 3;  1OHO A;  2SAR A;  4Q53 A;  5HOH A;  3CCV 3;  1K9M 4;  4GB5 A;  5CF1 A;  3MWZ A;  1VQP 3;  2XGN A;  4HM6 B;  1NB3 I;  1OH0 A;  1NWW A;  1ZX2 A;  1ISK A;  3FF2 A;  3OWS A;  3CPO A;  2HML B;  3V98 A;  2GU3 A;  1RGA A;  1VQL 3;  1YJN 3;  2ZL8 A;  4XDV A;  1G0T A;  1BNE A;  4BTY A;  1VQ4 3;  2BMQ B; 
#chains in the Genus database with same CATH homology
 3NBJ A;  1QVG 2;  4XBT A;  1JN5 B;  1EQK A;  2OTJ 3;  5AEW B;  1JN5 A;  2HMO B;  4RNZ A;  5CK6 A;  2HMN B;  5G2G A;  5CF2 A;  1W6C A;  5ELJ A;  1VQ8 3;  4FMC A;  1IT7 A;  2WOF A;  2OCT A;  2CG1 A;  2CWV A;  3F8X A;  3FH1 A;  4O2H A;  3NM2 A;  3EBT A;  2BHM A;  3B4O A;  4HKV B;  4KFD A;  2Z76 A;  3MKI A;  2QIY A;  5STD A;  3AMO B;  4HM0 B;  4TX4 A;  2GBX B;  2IA7 A;  1FGT A;  3X3X A;  5HGR A;  1IVW A;  2GEX A;  1Q86 4;  3EBY A;  1UW1 A;  2YFI B;  3H3H A;  1VQ5 3;  3JUP A;  1D6U A;  3J7Y d;  4AKY A;  3LTC A;  3K63 A;  2F86 B;  2C10 A;  3BLZ A;  3CC4 3;  3X41 A;  4EV2 A;  3I0Y A;  3CCR 3;  1ROA A;  3DM8 A;  5ELU A;  1KQS 2;  5IG0 A;  5IG5 A;  1SIH A;  3MG2 A;  1FGO A;  4HZ9 B;  3SED A;  3FGY A;  5CLK A;  1UUW B;  1AV4 A;  1KWI A;  4U13 A;  5AIH A;  3EF8 A;  3CU3 A;  4RNY A;  3WOF B;  2CG0 A;  4HM4 B;  4EBG A;  1N5P A;  3DGN A;  1WQL B;  2W0Q A;  4LEH A;  2Y73 A;  1LVN A;  3EB8 A;  1RJO A;  1MNL A;  1IVX A;  3EX9 A;  4O3V A;  3JUO A;  3CME 3;  3NXJ A;  1O7N B;  1VQM 3;  1OHS A;  2XEP A;  3IJE B;  4LMI A;  4XBY A;  1O7H B;  2XR8 B;  5JBS A;  2M7O A;  3CCS 3;  3ECF A;  4IIA A;  1VZZ A;  2QA4 3;  1Z1S A;  1K28 A;  3K0Z A;  2XFS A;  4L8P A;  2L4V A;  5FW5 A;  1CYV A;  4FR9 A;  3FF0 A;  3LH4 A;  5AYR B;  3VGN A;  3F7S A;  3G0K A;  1KC8 4;  4WYK B;  1PFP A;  3DY5 A;  4HJL B;  3N9H A;  1K41 A;  3O8Y A;  2MC8 A;  4GL6 A;  4WYK A;  4JF8 A;  3NBB A;  4H3U A;  1U5O A;  3PXM A;  1O7W B;  2P0X A;  4X2O A;  1RN7 A;  3G16 A;  2A15 A;  4ZM8 A;  3VSY A;  3LZA A;  4N6N B;  5BXQ A;  5IG4 A;  1UI8 A;  2YFJ B;  1Y4K A;  1EG9 B;  3HZP A;  3JUN A;  3X42 A;  2D1W A;  3MG3 A;  3GZX B;  2WO0 A;  3DGM A;  3DMC A;  2K54 A;  1YGE A;  1Q40 B;  1TIJ A;  2C11 A;  1M1X B;  2CW9 A;  5IEO A;  4WHA A;  1TP6 A;  1QJG A;  1Q40 A;  4KVH A;  3UNL A;  1FGQ A;  4MMY B;  2HMM B;  1W2B 2;  3DXO A;  4XDW A;  3TDG A;  1QAL A;  4HM3 B;  4MEI A;  4AKZ A;  4FCZ A;  3LML A;  1NO3 A;  3LYG A;  2UX0 A;  1W5Z A;  4WWU C;  5TGN A;  4L7K A;  3T0U A;  1Q81 4;  1A2K A;  3Q2P A;  4N6V 0;  2OOV A;  4EXR A;  1AVK A;  2W56 B;  3EC9 A;  3MYT A;  3PS8 A;  3I56 3;  2W56 A;  2Z7A A;  1O7P B;  3HK4 A;  4KFF A;  1GY6 A;  1M9G A;  2FGT A;  1G96 A;  2K0M A;  1LXE A;  1OGX A;  2IUK A;  1GYB A;  3KFQ C;  3FG3 A;  4KFE A;  4R80 A;  3NHX A;  3PZW A;  1W00 A;  1AR0 A;  3H51 A;  4HM7 B;  4OVM A;  2P05 A;  3E99 A;  1OPY A;  1GY7 A;  3EJV A;  3GRD A;  3CNX A;  2XF3 A;  3U1W A;  1DVC A;  3JVC A;  5KP4 A;  2Q07 A;  4NHF A;  2OOV C;  3WA3 A;  3N54 B;  3DGL A;  3F9S A;  3ER7 A;  1HU9 A;  2R4I A;  4IPB A;  2W9Q A;  1E3V A;  2CFL A;  4RBN A;  1YJ9 3;  3DZL A;  3NQZ A;  1IVU A;  4LSO A;  3BB9 A;  5EQL A;  4K1U A;  2W03 A;  1N9J A;  3FLJ A;  3G8Z A;  3JUQ A;  3I55 3;  5IF6 A;  1IV9 A;  1FGM A;  2FNQ A;  1ASK A;  3WDG B;  3CCM 3;  1TUH A;  4J8T A;  2YX9 A;  4WFO A;  3A76 A;  3S67 A;  1GD3 A;  1DVD A;  1OCV A;  3MG1 A;  5IEN A;  4QWT A;  2E2T A;  1L5G B;  4XM4 A;  2P09 A;  3F14 A;  1AVL A;  3CNM A;  1VQ7 3;  2GXF A;  1YI2 3;  3UL5 A;  2P0M A;  3V92 A;  1Q7Y 4;  2GU1 A;  1JV2 B;  1NJI 4;  1N9E A;  1NU3 A;  1IDP A;  2ML6 A;  3B4P A;  3LTD A;  3M8C A;  5AEU B;  1RKY A;  4CDL A;  1A90 A;  3IMA B;  1S5A A;  3SLU A;  4BTW A;  3X3Y A;  1PU4 A;  5DRV A;  3CCE 3;  3OWY A;  4H61 A;  3PCS A;  4HVN A;  1D6Z A;  4PEJ A;  3UJM A;  3B8L A;  2E2U A;  1LNH A;  2BMO B;  1VQ6 3;  3OXA A;  1M90 4;  1JKG B;  4STD A;  1JKG A;  4HYZ A;  3S27 A;  4I4K A;  4FCJ A;  1E3R A;  2CC3 A;  4J9A A;  2CIU A;  3HI7 A;  3CXC 2;  2WOH A;  2LYX A;  4HM1 B;  3OWU A;  4CCV A;  1STF I;  2CKF B;  3SOA A;  4R9K A;  4N6U A;  1W7C A;  2O3O A;  2BNG A;  3BNE A;  3DGO A;  2V1L A;  3IPT A;  1QAK A;  5KP1 A;  3CCQ 3;  4HM5 B;  2INX A;  4MMZ B;  2FXT A;  2Y74 A;  1NB5 I;  1W6G A;  1TFO A;  5LC7 A;  1LOX A;  2B1X B;  2KXG A;  1RRH A;  2MF7 A;  7STD A;  5IEP A;  6STD A;  4HBR A;  1V74 A;  4FMB A;  3WOE B;  3LTA A;  3FSD A;  4BTX A;  1JRQ A;  1DMQ A;  4K1V A;  1R4C A;  3FCS B;  3UB1 A;  3NM7 A;  1GD4 A;  2CWU A;  4LZI A;  3SOY A;  1YVB I;  1QMA A;  1Q42 A;  1IU7 A;  1WTH A;  4AEQ A;  3D3L A;  1O7G B;  3S5C A;  5BVB A;  5CXO A;  3NBR A;  3S28 A;  2BMR B;  1IQY A;  1DMM A;  2CWT A;  1ZO2 A;  2Z6B A;  3CC7 3;  5AYS C;  4IT7 A;  2CFD A;  1W2Z A;  2BT3 A;  3EHC A;  2QGU A;  2WGQ A;  1W6Y A;  3OX9 A;  4MJD A;  2XFT A;  3F40 A;  1MOL A;  1JB5 A;  3MHE A;  4EV5 A;  2YFL B;  3S29 A;  2LQV A;  2RCD A;  3SVA A;  4HM8 B;  3CCJ 3;  1YJW 3;  1ULI B;  3PGB A;  1WMO A;  3WA2 X;  4FCM A;  2CFW A;  3JUM A;  4WP5 A;  1J2B A;  3V99 A;  3FZW A;  1YHQ 3;  2CH9 A;  3OV4 A;  3KII A;  1IT8 A;  1D6Y A;  4HZB B;  1K8A 4;  3PCR A;  3CPW 2;  4FMA A;  3Q90 A;  3G4S 3;  3DUK A;  3CC2 3;  3NV0 B;  2D42 A;  2I9W A;  4JRF A;  5LC6 A;  1W4N A;  3EQQ B;  3NV0 A;  3PYJ A;  3CMA 3;  5DRE A;  1IQX A;  4EYC A;  3F7X A;  3NUV A;  3T8N A;  1ROV A;  2F98 A;  2RGQ A;  1STD A;  5IW9 A;  5EEO A;  1ULJ B;  2IUJ A;  1N5H A;  4MMX B;  5D81 A;  3CCL 3;  3WOD G;  1UI7 A;  3X40 A;  1TFK A;  2WGO A;  3LT8 A;  3B7C A;  1C7H A;  2F99 A;  4KZ1 A;  4EC6 A;  4HM2 B;  1UUV B;  1A2V A;  3SX1 A;  2OTL 3;  3U97 A;  2RSX A;  1SII A;  8CHO A;  2PZV A;  3GZY B;  2W04 A;  3N8B A;  2W2C A;  3GAX A;  4L8O A;  1BUQ A;  3BNC A;  5JPU A;  5D82 A;  5KP3 A;  1NDO B;  3AMO A;  3FG1 A;  4N6L A;  4K90 B;  2O9U X;  5IG3 A;  3KZT A;  2CHC A;  2XSH B;  2OWP A;  4XB5 A;  1T5Y A;  1O7M B;  1M1K 4;  4O8S A;  3GZB A;  3LT9 A;  2P38 A;  2JDI H;  1K73 4;  1VQN 3;  2JQ5 A;  3Q1C A;  3CCU 3;  1JJ2 2;  2XRX B;  2HMK B;  4O02 B;  4X2H A;  1OHP A;  2HMJ B;  1N8R 4;  3KKG A;  4G1M B;  1SPU A;  2XSO B;  1A67 A;  5AI1 A;  3RGR A;  3T8U A;  3HIG A;  3LXU X;  2E2V A;  2SBL A;  5EVH A;  3ROB A;  3GWR A;  3SXX A;  3L0R A;  1JB2 A;  5D83 A;  3K5T A;  4RZM A;  1EKM A;  2XH9 A;  1IQ8 A;  1F8N A;  3NX0 A;  1GY5 A;  4ORL A;  1FUW A;  1CEW I;  1EA2 A;  3HII A;  1IVV A;  1E97 A;  3STD A;  4R1K A;  3EN1 B;  4K61 A;  3QRD A;  3KN4 A;  1DYU A;  1QAF A;  1IV7 A;  5FGO A;  1YIJ 3;  2OQE A;  1U8C B;  2RFR A;  2W6J H;  2IMJ A;  4FMD A;  1Q82 4;  3GZR A;  1SQW A;  3K7C A;  2XGL A;  2PNC A;  3BND A;  3NQY A;  3HX8 A;  3KSP A;  3LTB A;  3KSE D;  2CFG A;  1WMP A;  2GBW B;  2BO9 B;  2ZDJ A;  3LOY A;  1OUN A;  1OF5 B;  3QK9 A;  3CD6 3;  5AIF A;  4LGQ A;  1FA3 A;  1FGR A;  1W01 A;  4N6M A;  1OF5 A;  3G71 3;  1SJW A;  1VQK 3;  4N6O B;  5IER A;  5AIG A;  2W9P A;  3FKA A;  3BNB A;  3MPH A;  3D9R A;  3RDE A;  3RGA A;  3X3Z A;  1JNQ A;  1KSI A;  3UL6 A;  1YIT 3;  1JB4 A;  4N3V A;  3K9M C;  5AII A;  1DMN A;  1W02 A;  2KRT A;  4R9L A;  2OQE C;  2KCD A;  1CQS A;  4OK0 A;  5JPP A;  1N8Q A;  1OGZ A;  1WNH A;  2QEX 3;  3MSO A;  5A0O B;  1CYU A;  1S72 3;  2B24 B;  3EN8 A;  2Z77 A;  1VQO 3;  4OUQ A;  1US1 A;  2CK3 H;  3KE7 A;  1RRL A;  1TU5 A;  4N6T A;  3VF1 A;  3OW2 2;  3WMD A;  3ALA A;  2CFK A;  2GEY A;  1OAC A;  1WMN A;  1QVF 2;  3F8H A;  1HKX A;  2STD A;  5I97 A;  4XBX A;  1GS3 A;  4R4K A;  2ML5 A;  3FG4 A;  1VQ9 3;  3EE1 A;  4NRE A;  1KD1 4;  3G6E 3;  1OHO A;  3CCV 3;  4Q53 A;  1K9M 4;  4GB5 A;  5CF1 A;  3MWZ A;  1VQP 3;  2XGN A;  4HM6 B;  1NB3 I;  1OH0 A;  1NWW A;  1ZX2 A;  1ISK A;  3FF2 A;  3OWS A;  3CPO A;  2HML B;  3V98 A;  2GU3 A;  1VQL 3;  1YJN 3;  2ZL8 A;  4XDV A;  1IK3 A;  4BTY A;  1VQ4 3;  2BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...