2Z76A

X-ray crystal structure of rv0760c from mycobacterium tuberculosis at 1.82 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative steroid isomerase
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 42
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2z76A00
4N3VA 4HM7B 1VZZA 1NDOB 1OHPA 3JUNA 4WWUC 4HZ9B 5DREA 1U5OA 4HM4B 5KP4A 4HZBB 2GEXA 3B8LA 3OX9A 1JKGB 2GBWB 3WMDA 1O7PB 1EG9B 4XB5A 2PZVA 1STDA 1JKGA 3DUKA 3OXAA 3SOYA 2YFJB 3G16A 3T8UA 2STDA 2XSOB 1OGXA 3BLZA 1O7HB 1UUVB 1JN5A 3DXOA 3GZRA 5KP1A 4L8PA 3JUMA 2F86B 1WQLB 2YFLB 3OWUA 1OF5B 1E97A 2OWPA 5STDA 3LZAA 1K41A 5IERA 1TP6A 2GXFA 3NBRA 3OWSA 3S5CA 1O7NB 3F40A 3OV4A 5CXOA 2QGUA 4R1KA 5IG0A 3FKAA 1E3VA 4XDVA 3KZTA 1ULJB 2GBXB 1GS3A 3I0YA 3SOAA 4FCMA 3KKGA 5D81A 8CHOA 1QMAA 3EF8A 4L8OA 1HKXA 1OGZA 4LMIA 5BXQA 5KP3A 5DRVA 4U13A 5AIHA 1OCVA 3HK4A 5BVBA 5D83A 3EBYA 5AEWB 3MYTA 3D9RA 1ULIB 1OHSA 2Z76A 1NWWA 1GY5A 3EN8A 1Q42A 2B24B 3NV0A 4HM6B 1W6YA 3KE7A 3E99A 1UUWB 3A76A 3CNXA 4XBYA 3NM2A 3EJVA 1W00A 3H51A 5IENA 3EQQB 3NXJA 4HM8B 4LEHA 4H3UA 3JUOA 2HMMB 1GY6A 1JN5B 1OUNA 2I9WA 4XM4A 4I4KA 2RFRA 4XBXA 1S5AA 3ROBA 3MHEA 1TUHA 4IIAA 3LYGA 3RGAA 2INXA 3T8NA 2QIYA 2XSHB 4MJDA 2BNGA 1JB5A 1W01A 4Q53A 3GZBA 1Z1SA 4X2OA 1GYBA 2UX0A 3GZXB 3K0ZA 4R9KA 3UNLA 1E3RA 1SJWA 4XDWA 3SEDA 3DZLA 4STDA 3FLJA 5JPPA 3F8XA 1NU3A 5IG3A 1O7GB 3MG1A 4XBTA 4ORLA 3MSOA 1OH0A 3IPTA 4HKVB 3G0KA 4K1UA 3ER7A 1A2KA 3F7XA 2HMOB 5G2GA 2A15A 5JPUA 2W2CA 1ZO2A 2GEYA 3FF2A 3MKIA 1JB4A 1CQSA 3MG2A 2Z7AA 3GZYB 3NV0B 3B4PA 1Q40B 3F14A 5CK6A 1JB2A 5AEUB 2BMRB 2JQ5A 3ECFA 4K1VA 1DMQA 3F7SA 3Q90A 3HZPA 3FSDA 3DM8A 3JUQA 3EHCA 4HM2B 2RGQA 1Q40A 1OHOA 3FF0A 3STDA 2XRXB 4HM0B 4FCJA 3EBTA 2RCDA 1O7WB 5IF6A 1QJGA 4KVHA 3F8HA 2YFIB 4HM1B 3VGNA 1C7HA 1ISKA 5IG5A 3EC9A 5IEOA 5EVHA 5CF2A 1ASKA 3F9SA 1AR0A 5AI1A 2CKFB 3G8ZA 2F99A 3M8CA 1IDPA 4OUQA 5D82A 3B4OA 3DMCA 2BMQB 3CPOA 3OWYA 3H3HA 1ZX2A 2HMKB 5AIGA 1DMNA 3VSYA 4HVNA 3K7CA 3B7CA 3CU3A 2IMJA 2Z77A 2F98A 1GY7A 4HJLB 2HMLB 1O7MB 4J8TA 4HM3B 3UJMA 1DMMA 3CNMA 3KSPA 1BUQA 6STDA 3BB9A 3EN1B 5CLKA 3EX9A 3NHXA 1OF5A 3RGRA 7STDA 1EA2A 5IEPA 3HX8A 4GB5A 4RZMA 5HGRA 3GRDA 2R4IA 2K54A 3FH1A 4WYKB 5AIIA 3FZWA 5TGNA 4WP5A 4R9LA 4OVMA 2XR8B 2B1XB 5AIFA 5CF1A 4LGQA 4CDLA 3JUPA 4WYKA 4X2HA 2BMOB 2HMJB 4HM5B 4J9AA 5IG4A 3NUVA 4PEJA 5FW5A 4L7KA 2CHCA 1OPYA 1W02A 3FGYA 2HMNB 3MG3A 3GWRA
chains in the Genus database with same CATH superfamily
3MWZA 4N3VA 3DGNA 4HM7B 4O02B 1IV9A 1US1A 2BT3A 1LNIA 3SX1A 1BOXA 1VZZA 2OTL3 3CMA3 1NDOB 1STFI 1OHPA 1FZUA 4LZIA 2MC8A 1F8NA 2IUKA 3JUNA 2H0IA 4WWUC 4HZ9B 2CH9A 1IQYA 5DREA 4FMAA 4BL2A 2KAAA 2GSPA 1RRLA 1TFOA 2CX0A 1U5OA 7RNTA 5M19A 3EE1A 1JV2B 5RNTA 4HM4B 2OQEA 5KP4A 3L0RA 4HZBB 1BRJA 1N8R4 2GEXA 1UCIA 3B8LA 1A2PA 3WOEB 2H0GA 3FG3A 3OX9A 1JKGB 4NPBA 4BTXA 1NB5I 1RNBA 2GBWB 4KFFA 3WMDA 3CCM3 1O7PB 4IT7A 3I553 3LXUX 4G1MB 4EV2A 1EG9B 1BNGA 4OK0A 3K63A 1IV7A 1N9EA 3AGNA 1HU9A 4GHOA 4IPBA 5EEOA 4XB5A 1L5GB 2QA43 2PZVA 1CYVA 3X41A 2V1LA 1STDA 3DGOA 1TFKA 1BRGA 4EC6A 1SARA 1JKGA 3DUKA 3OXAA 4KFEA 3V92A 3CCL3 1MWUA 1IT7A 2KRTA 3LTDA 1IQ8A 1YVSA 3AGOA 3ZG0A 2CFDA 3SOYA 2YFJB 3G16A 3SXXA 3T8UA 1RN4A 2STDA 2W03A 2XSOB 1OGXA 3BLZA 1DETA 2WGOA 3G713 1O7HB 2CWTA 1KQS2 1SIIA 1B20A 1UDII 1UUVB 1JN5A 3DXOA 1JJ22 1RGCA 2BIRA 3D4AA 3GZRA 2P38A 1IQXA 1CEWI 4L8PA 2CX1A 5KP1A 3N9HA 5EQLA 1BANA 3JUMA 1LQGC 1GD4A 2F86B 1WQLB 2YFLB 3OWUA 1OF5B 3DY5A 3PGBA 1VQK3 1WNHA 2L1SA 1E97A 2OWPA 5STDA 3S27A 3LZAA 1K41A 1VQP3 5IERA 3N8BA 1BNIA 1TP6A 1VQN3 2GXFA 3NBRA 3OWSA 3CCS3 3FG1A 3S5CA 1Q7HA 3NQZA 1BVIA 1O7NB 2IUJA 4BTYA 1VQ73 3PCSA 1WMOA 3F40A 5IW9A 3OV4A 1G96A 2CWVA 2WOHA 3BNEA 4J5GA 1IVVA 2QGUA 5CXOA 3ALAA 4LYLB 2H0HA 3D3LA 5AYSC 1K734 4FMCA 4R1KA 2KF6A 1Q7Y4 5IG0A 1X1UA 5GSPA 1BAOA 3TDGA 3FKAA 4K61A 3IMAB 1E3VA 3NBBA 4XDVA 1RSNA 1TTOA 1ULJB 2GBXB 3KZTA 1A2VA 4O8SA 4FR9A 1GS3A 3ZG5A 1GOYA 1BRIA 1R4CA 2F56A 3I0YA 3SOAA 4FCMA 3KKGA 3RNTA 1W4NA 3FG4A 3V98A 2D42A 3GSPA 2CC3A 3U1WA 5FGOA 3G6E3 1PU4A 3KCHA 1X1WA 2IA7A 3WHOA 1UW1A 5D81A 3BU4A 1RGKA 8CHOA 1QMAA 8RNTA 1PY3A 3EF8A 1DVDA 4L8OA 1HKXA 1OGZA 4LMIA 5BXQA 5KP3A 1EKMA 2M7OA 1PFPA 4N6TA 3EB8A 5DRVA 1T3BA 4O2HA 4U13A 3FCSB 5AIHA 4KFDA 1IVXA 2CG0A 1I3FA 1OCVA 3HK4A 1D6UA 1GOUA 2ZDJA 1YHQ3 5BVBA 1GMRA 1V74A 5D83A 1EUIC 1DYUA 3EBYA 5AEWB 1RGGA 1VQ53 3MYTA 1UGHI 1W7CA 2C11A 1LXEA 1JNQA 5LC6A 2JDIH 1BRSA 1IT8A 2W56B 3KIIA 3D9RA 1W6GA 1ULIB 2W6JH 1OHSA 2Z76A 1QAFA 1NWWA 3DGLA 3SYUA 4CJNA 1LNHA 1T5YA 1GY5A 3LTAA 3EN8A 1Q42A 2BO9B 1SPUA 2XF3A 2P09A 3I563 2B24B 3NV0A 3OW22 1BRKA 4HM6B 1W6YA 2SBLA 3KE7A 4HAAA 3ZFZA 4HBRA 3AHSA 3E99A 1R4YA 1UUWB 4RNYA 3A76A 4EXRA 3CNXA 6RNTA 2W56A 4XBYA 3NM2A 1BSAA 2XEPA 1FGMA 3EJVA 1W00A 3BNBA 2E2UA 2W0QA 3H51A 1BSBA 4JRFA 5A0OB 1BU4A 1MGWA 3HIGA 4BU4A 3PZWA 1MWTA 3QK9A 1MOLA 4DKIA 5IENA 5G1KA 4KT3B 1BSDA 3EQQB 3NXJA 4HM8B 1MWRA 1X1YA 3X3ZA 1WMPA 4LEHA 1BNJA 4QWTA 2OOVC 1LVNA 1RCKA 1UCLA 3LTBA 1FGTA 4H3UA 3CC23 3HI7A 1D6ZA 3JUOA 1IK3A 5BIRA 3CXC2 2HMMB 5I97A 1GY6A 2XGNA 1JN5B 1OUNA 1AVKA 2E2TA 3DH2A 2FXTA 2I9WA 3CCU3 4N6OB 2R41A 2CFWA 4XM4A 3SLUA 1RN7A 1KC84 4I4KA 1YJN3 1OACA 1FGRA 1AY7A 2ZA4A 3GAXA 1KSIA 3LT8A 4GSPA 3VF1A 1VQ83 3BNCA 3X3XA 4HOHA 2RFRA 1G0TA 3D5IA 1NJI4 4XBXA 1S5AA 1QVF2 3DGMA 3KSED 1K28A 3ROBA 3MHEA 1B2MA 6GSPA 1TUHA 3CCR3 2HOHA 4IIAA 1LOWA 2F4YA 3IJEB 1RCLA 1RNTA 3LYGA 3A5EA 3RGAA 1SQWA 1BRHA 4FCZA 2INXA 1KWIA 3Q3FA 2QIYA 2XSHB 3T8NA 1RTUA 4I5QA 4MJDA 1X1XA 2BNGA 1JB5A 1JRQA 2LQVA 1W01A 4Q53A 3GZBA 1Z1SA 2WOFA 2CFGA 4X2OA 1GYBA 2UX0A 3AHWA 2IYJA 4CPKA 2XGLA 1TRPA 3GZXB 3N54B 1YIT3 3CC43 1BIRA 1VQL3 1NO3A 1B2UA 1W5ZA 3K0ZA 4R9KA 3UNLA 1E3RA 1SJWA 4LSOA 4XDWA 3SEDA 3CCE3 4MEIA 3CD63 3BIRA 3DZLA 4ZM8A 3U97A 1FW7A 2O3OA 2Y74A 3S28A 1VQM3 1RMSA 3UB1A 4STDA 3FLJA 4EW5A 1GSPA 5JPPA 4EYCA 3F8XA 2KF3A 1NU3A 5IG3A 1O7GB 3NX0A 4CCVA 9RNTA 1TIJA 3MG1A 4XBTA 3WDGB 4ORLA 3MSOA 1YGEA 1N8QA 3LOYA 2CIUA 2CK3H 2C10A 3K9MC 2CFLA 4MMYB 1OH0A 1ROAA 3IPTA 4HKVB 2GU1A 3G0KA 4K90B 1Q814 3WA2X 1W6CA 2K0MA 1I2FA 3BNDA 3S29A 2ZL8A 1DVCA 4N6V0 5HOHA 4K1UA 1QALA 5G1LA 2GU3A 1HYFA 1RGAA 3T0UA 3UL6A 3ER7A 1A2KA 2KF4A 3LT9A 3F7XA 2HMOB 5G2GA 3KFQC 1RGEA 2P0XA 5AYRB 1BSEA 1FYSA 1GD3A 2A15A 2W2CA 1RGFA 1ZO2A 2GEYA 3FF2A 3MKIA 3PS8A 1LOVA 2PNCA 1S723 1JZDA 1VQQA 1JB4A 4O3VA 1CQSA 5BU4A 5M18A 3MG2A 1U8CB 2Z7AA 4FMDA 5LC7A 1I2EA 3GZYB 2CW9A 1RGHA 1MNLA 1FGOA 3NV0B 1M904 1BUJA 1JBRA 3B4PA 2OCTA 1Q40B 1IYYA 3F14A 3LMLA 5CK6A 1JB2A 4AKYA 4EV5A 1RN1A 5AEUB 5JBSA 3WA3A 1RRHA 1B2SA 4H61A 3UL5A 1Y4KA 2BMRB 2JQ5A 2KXGA 1ROVA 3ECFA 1Q9EA 4K1VA 1DMQA 3F7SA 1MGRA 1AV4A 1LOXA 3Q90A 1SIHA 3HZPA 3FSDA 1RHLA 3KN4A 3DM8A 4RBNA 4BL3A 3JUQA 1RKYA 3EHCA 2RGQA 4HM2B 3J7Yd 1Q40A 1OHOA 2RNTA 3FF0A 2BHMA 4WHAA 3STDA 2XRXB 4HM0B 4AEQA 2XH9A 2K3DA 3MPHA 3EBTA 4FCJA 1B27A 1TU5A 1WTHA 1WMNA 2RCDA 2OOVA 1BGSA 1GMPA 1T2HA 1O7WB 1TRQA 2OTJ3 1FUTA 5IF6A 1QJGA 3G4S3 1FGQA 2WGQA 2CWUA 1K9M4 4RNTA 4KVHA 1LOYA 1N5HA 1M9GA 2L4VA 1I0VA 3LH4A 1D6YA 3F8HA 1RDSA 2YFIB 3PCRA 1GMQA 3WOFB 3CCQ3 1J2BA 1UGIA 5M1AA 1V57A 1BNSA 1I0XA 2Q07A 3HOHA 3QRDA 1UCKA 1AVLA 4HM1B 4MMZB 1C7HA 1IU7A 1PYLA 1UCJA 2O9UX 3VGNA 4R4KA 5ELJA 1NB3I 3EC9A 4ILFA 5IG5A 1KD14 2P05A 2F5MA 5IEOA 5JPUA 1ZS7A 1IVWA 5EVHA 1B21A 2AAEA 3WODG 5CF2A 3Q1CA 2IY2A 1ASKA 2OQEC 3F9SA 2W9QA 1AR0A 2W9PA 4N6LA 1MWSA 5AI1A 1I8VA 2UGIA 4NHFA 1VQ63 2E2VA 1IVUA 1BNRA 1N9JA 2CKFB 3G8ZA 2F99A 3M8CA 1BNEA 7GSPA 1VQO3 1ISKA 2KF5A 4GL6A 1N5PA 1IDPA 1YJW3 4OUQA 3V99A 5D82A 3B4OA 3DMCA 3RDEA 1T2IA 3CCJ3 3WR2A 2BMQB 2RBIA 1C54A 3CPOA 3OWYA 3H3HA 4TX4A 1ZX2A 2HMKB 1YIJ3 1W2ZA 1Q864 5AIGA 1DMNA 1I2GA 3VSYA 4HVNA 3X42A 3K7CA 1W2B2 1BRNL 1UI8A 3B7CA 2KCDA 4N6UA 2XFSA 1JBTA 3CU3A 2CG1A 2F5WA 2XFTA 2RSXA 1EQKA 1FUWA 3O8YA 5ELUA 3URPA 4BTWA 2BU4A 2IMJA 2Z77A 2F98A 1FA3A 3PYJA 1GY7A 3Q2PA 3JVCA 1GOVA 4HJLB 2HMLB 2Y73A 1QAKA 1O7MB 4J8TA 2FNQA 1RGLA 2FGTA 4RNZA 4HM3B 3CME3 3UJMA 1DMMA 2Z6BA 3CNMA 3KSPA 2QEX3 1K8A4 1BUQA 6STDA 3BB9A 1YJ93 3EN1B 5CLKA 3S67A 2ML5A 3EX9A 1CH0A 3NHXA 4FMBA 4JF8A 4R80A 1DE3A 1OF5A 2W04A 1EEJA 1A67A 2MF7A 3RGRA 7STDA 2P0MA 1YGWA 3D79A 1I3IA 1EA2A 2ZHXB 4KZ1A 5IEPA 1UI7A 3NQYA 3AMOB 1B2XA 2SARA 3HX8A 3NM7A 4WFOA 1M1XB 2YX9A 4GB5A 1JBSA 2ML6A 4RZMA 1RLSA 5HGRA 4BIRA 3GRDA 2R4IA 3CPW2 4HYZA 2K54A 4N6NB 3FH1A 3X40A 4WYKB 5AIIA 2J8XB 2WO0A 3FZWA 2AADA 5TGNA 4WP5A 1RJOA 4R9LA 3SVAA 4OVMA 2D1WA 1LRAA 1V58A 1FUSA 3AMOA 1YI23 3NBJA 1M1K4 2XR8B 1VQ43 2B1XB 5AIFA 5CF1A 1YVBI 4LGQA 3CCV3 1HZ1A 1BNFA 1LQMB 2CFKA 3X3YA 1CYUA 4CDLA 3D5GA 1NNVA 4N6MA 1QVG2 4NREA 1Q824 1JZOA 3JUPA 4WYKA 1UUGB 1I70A 3DGYA 2LYXA 4X2HA 4EBGA 2BMOB 2UUGC 2HMJB 3K5TA 1AQZA 4HM5B 4J9AA 3NUVA 5IG4A 3CC73 1BSCA 3PXMA 4PEJA 1YNVX 5FW5A 4L7KA 1B2ZA 2CHCA 3HIIA 4MMXB 2C4BA 1OPYA 1W02A 3LTCA 1TJDA 4AKZA 1VQ93 4J5KA 1G02A 1B3SA 3FGYA 2HMNB 1ZGXA 3MG3A 3GWRA 1A90A
chains in the Genus database with same CATH topology
3MWZA 4N3VA 3DGNA 4HM7B 4O02B 1IV9A 1US1A 2BT3A 3SX1A 1VZZA 2OTL3 3CMA3 1NDOB 1STFI 1OHPA 4LZIA 2MC8A 1F8NA 2IUKA 3JUNA 4WWUC 4HZ9B 2CH9A 1IQYA 5DREA 4FMAA 1RRLA 1TFOA 1U5OA 3EE1A 1JV2B 4HM4B 2OQEA 5KP4A 3L0RA 4HZBB 1N8R4 2GEXA 3B8LA 3WOEB 3FG3A 3OX9A 1JKGB 4BTXA 1NB5I 2GBWB 4KFFA 3WMDA 3CCM3 1O7PB 4IT7A 3I553 3LXUX 4G1MB 4EV2A 1EG9B 4OK0A 3K63A 1IV7A 1N9EA 1HU9A 4IPBA 5EEOA 4XB5A 1L5GB 2QA43 2PZVA 1CYVA 3X41A 2V1LA 1STDA 3DGOA 1TFKA 4EC6A 3V92A 1JKGA 3DUKA 3OXAA 4KFEA 3CCL3 1IT7A 2KRTA 3LTDA 1IQ8A 2CFDA 3SOYA 2YFJB 3G16A 3SXXA 3T8UA 2STDA 2W03A 2XSOB 1OGXA 3BLZA 2WGOA 3G713 1O7HB 2CWTA 1KQS2 1SIIA 1UUVB 1JN5A 3DXOA 1JJ22 3GZRA 2P38A 1IQXA 1CEWI 4L8PA 5KP1A 3N9HA 5EQLA 3JUMA 1GD4A 2F86B 1WQLB 2YFLB 3OWUA 1OF5B 3DY5A 3PGBA 1VQK3 1WNHA 1E97A 2OWPA 5STDA 3S27A 3LZAA 1K41A 1VQP3 5IERA 3N8BA 1TP6A 1VQN3 2GXFA 3NBRA 3OWSA 3CCS3 3FG1A 3S5CA 2IUJA 3NQZA 4BTYA 1O7NB 1VQ73 3PCSA 1WMOA 3F40A 5IW9A 3OV4A 1G96A 2CWVA 2WOHA 3BNEA 5CXOA 1IVVA 2QGUA 3ALAA 5AYSC 3D3LA 1K734 4FMCA 4R1KA 1Q7Y4 5IG0A 3TDGA 3FKAA 4K61A 3IMAB 1E3VA 3NBBA 4XDVA 3KZTA 1ULJB 2GBXB 1A2VA 4O8SA 4FR9A 1GS3A 1R4CA 3I0YA 3SOAA 4FCMA 3KKGA 1W4NA 3FG4A 3V98A 2D42A 2CC3A 3U1WA 5FGOA 3G6E3 1PU4A 2IA7A 1UW1A 5D81A 8CHOA 1QMAA 3EF8A 1DVDA 4L8OA 1HKXA 1OGZA 4LMIA 5BXQA 5KP3A 1EKMA 2M7OA 1PFPA 4N6TA 3EB8A 5DRVA 4O2HA 4U13A 3FCSB 5AIHA 4KFDA 1IVXA 2CG0A 1OCVA 3HK4A 1D6UA 2ZDJA 1YHQ3 5BVBA 1V74A 5D83A 1DYUA 3EBYA 5AEWB 1VQ53 3MYTA 1W7CA 2C11A 1LXEA 1JNQA 5LC6A 2JDIH 1IT8A 2W56B 3KIIA 3D9RA 1W6GA 1ULIB 2W6JH 1OHSA 2Z76A 1QAFA 1NWWA 3DGLA 1LNHA 1T5YA 1GY5A 3LTAA 3EN8A 1Q42A 2BO9B 1SPUA 2XF3A 2P09A 3I563 2B24B 3NV0A 3OW22 4HM6B 1W6YA 2SBLA 3KE7A 4HBRA 3E99A 1UUWB 4RNYA 3A76A 4EXRA 3CNXA 2W56A 4XBYA 3NM2A 2XEPA 1FGMA 3EJVA 1W00A 3BNBA 2E2UA 2W0QA 3H51A 4JRFA 5A0OB 3HIGA 3PZWA 3QK9A 1MOLA 5IENA 3EQQB 3NXJA 4HM8B 3X3ZA 1WMPA 4LEHA 4QWTA 2OOVC 1LVNA 3LTBA 1FGTA 4H3UA 3CC23 3HI7A 1D6ZA 3JUOA 1IK3A 3CXC2 2HMMB 5I97A 1GY6A 2XGNA 1JN5B 1OUNA 1AVKA 2E2TA 2FXTA 2I9WA 3CCU3 4N6OB 2CFWA 4XM4A 3SLUA 1RN7A 1KC84 4I4KA 1YJN3 1OACA 1FGRA 3GAXA 1KSIA 3LT8A 3VF1A 1VQ83 3BNCA 3X3XA 2RFRA 1NJI4 4XBXA 1S5AA 1QVF2 3DGMA 3KSED 1K28A 3ROBA 3MHEA 1TUHA 3CCR3 4IIAA 3IJEB 3LYGA 3RGAA 1SQWA 4FCZA 2INXA 1KWIA 3T8NA 2QIYA 2XSHB 4MJDA 2BNGA 1JB5A 1JRQA 2LQVA 1W01A 4Q53A 3GZBA 1Z1SA 2WOFA 2CFGA 4X2OA 1GYBA 2UX0A 2XGLA 3GZXB 1YIT3 3N54B 3CC43 1VQL3 1NO3A 1W5ZA 3K0ZA 4R9KA 3UNLA 1E3RA 1SJWA 4LSOA 4XDWA 3SEDA 3CCE3 4MEIA 3CD63 3DZLA 4ZM8A 3U97A 2O3OA 2Y74A 3S28A 1VQM3 3UB1A 4STDA 3FLJA 5JPPA 4EYCA 3F8XA 1NU3A 5IG3A 1O7GB 3NX0A 4CCVA 1TIJA 3MG1A 4XBTA 3WDGB 4ORLA 3MSOA 1YGEA 1N8QA 3LOYA 2CIUA 2CK3H 2C10A 3K9MC 2CFLA 4MMYB 1OH0A 1ROAA 3IPTA 4HKVB 2GU1A 3G0KA 4K90B 1Q814 3WA2X 1W6CA 2K0MA 3BNDA 3S29A 2ZL8A 1DVCA 4N6V0 4K1UA 1QALA 2GU3A 3T0UA 3UL6A 3ER7A 1A2KA 3LT9A 3F7XA 2HMOB 5G2GA 3KFQC 5AYRB 2P0XA 2A15A 5JPUA 1GD3A 2W2CA 3PS8A 1ZO2A 2GEYA 3FF2A 3MKIA 1S723 2PNCA 1JB4A 4O3VA 1CQSA 3MG2A 1U8CB 2Z7AA 4FMDA 5LC7A 3GZYB 2CW9A 1MNLA 1FGOA 3NV0B 1M904 3B4PA 2OCTA 1Q40B 3F14A 3LMLA 5CK6A 1JB2A 4AKYA 4EV5A 3WA3A 5AEUB 5JBSA 1RRHA 4H61A 3UL5A 1Y4KA 2BMRB 2JQ5A 2KXGA 1ROVA 3ECFA 4K1VA 1DMQA 3F7SA 1AV4A 1LOXA 3Q90A 1SIHA 3HZPA 3FSDA 3KN4A 4RBNA 3DM8A 3JUQA 1RKYA 3EHCA 2RGQA 4HM2B 3J7Yd 1Q40A 1OHOA 3FF0A 2BHMA 4WHAA 3STDA 2XRXB 4HM0B 4AEQA 2XH9A 3MPHA 4FCJA 3EBTA 1TU5A 1WTHA 1WMNA 2RCDA 2OOVA 1O7WB 2OTJ3 5IF6A 1QJGA 3G4S3 1FGQA 2WGQA 2CWUA 1K9M4 4KVHA 1N5HA 1M9GA 2L4VA 3LH4A 1D6YA 3F8HA 2YFIB 3PCRA 3WOFB 3CCQ3 1J2BA 2Q07A 3QRDA 4HM1B 1AVLA 3VGNA 4MMZB 1C7HA 1IU7A 1VQ93 2O9UX 5IG5A 1ISKA 4R4KA 5ELJA 1NB3I 3EC9A 1KD14 2P05A 5IEOA 1IVWA 5EVHA 3WODG 5CF2A 3Q1CA 1ASKA 2OQEC 3F9SA 2W9QA 1AR0A 2W9PA 4N6LA 5AI1A 4NHFA 1VQ63 2E2VA 1IVUA 1N9JA 2CKFB 3G8ZA 2F99A 3M8CA 1VQO3 4GL6A 1N5PA 1IDPA 1YJW3 4OUQA 3V99A 5D82A 3B4OA 3DMCA 3RDEA 3CCJ3 2BMQB 3CPOA 3OWYA 3H3HA 4TX4A 1ZX2A 2HMKB 1YIJ3 1W2ZA 1Q864 5AIGA 1DMNA 3VSYA 4HVNA 3X42A 3K7CA 1W2B2 1UI8A 3B7CA 2KCDA 4N6UA 2XFSA 3CU3A 2CG1A 2XFTA 1EQKA 2RSXA 1FUWA 3O8YA 5ELUA 4BTWA 2IMJA 2Z77A 2F98A 1FA3A 3PYJA 1GY7A 3Q2PA 3JVCA 4HJLB 2HMLB 2Y73A 1QAKA 1O7MB 4J8TA 2FNQA 2FGTA 4RNZA 4HM3B 3CME3 3UJMA 1DMMA 2Z6BA 3CNMA 3KSPA 2QEX3 1K8A4 1BUQA 6STDA 3BB9A 1YJ93 3EN1B 5CLKA 3S67A 2ML5A 3EX9A 3NHXA 4FMBA 4JF8A 4R80A 1OF5A 2W04A 1A67A 2MF7A 3RGRA 7STDA 2P0MA 1EA2A 4KZ1A 5IEPA 1UI7A 3NQYA 3AMOB 3HX8A 3NM7A 4WFOA 1M1XB 2YX9A 4GB5A 2ML6A 4RZMA 5HGRA 3GRDA 2R4IA 3CPW2 4HYZA 2K54A 4N6NB 3FH1A 3X40A 4WYKB 5AIIA 2WO0A 3FZWA 5TGNA 4WP5A 1RJOA 4R9LA 3SVAA 4OVMA 2D1WA 3AMOA 1YI23 3NBJA 1M1K4 2XR8B 1VQ43 2B1XB 5AIFA 5CF1A 1YVBI 4LGQA 3CCV3 2CFKA 3X3YA 1CYUA 4CDLA 1QVG2 4N6MA 4NREA 1Q824 3JUPA 4WYKA 2LYXA 4X2HA 4EBGA 2BMOB 2HMJB 3K5TA 4HM5B 4J9AA 5IG4A 3NUVA 3CC73 4PEJA 3PXMA 5FW5A 4L7KA 2CHCA 3HIIA 4MMXB 1OPYA 1W02A 3LTCA 4AKZA 3FGYA 2HMNB 3MG3A 3GWRA 1A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3V A;  4HM7 B;  1VZZ A;  1NDO B;  1OHP A;  3JUN A;  4WWU C;  4HZ9 B;  5DRE A;  1U5O A;  4HM4 B;  5KP4 A;  4HZB B;  2GEX A;  3B8L A;  3OX9 A;  1JKG B;  2GBW B;  3WMD A;  1O7P B;  1EG9 B;  4XB5 A;  2PZV A;  1STD A;  1JKG A;  3DUK A;  3OXA A;  3SOY A;  2YFJ B;  3G16 A;  3T8U A;  2STD A;  2XSO B;  1OGX A;  3BLZ A;  1O7H B;  1UUV B;  1JN5 A;  3DXO A;  3GZR A;  5KP1 A;  4L8P A;  3JUM A;  2F86 B;  1WQL B;  2YFL B;  3OWU A;  1OF5 B;  1E97 A;  2OWP A;  5STD A;  3LZA A;  1K41 A;  5IER A;  1TP6 A;  2GXF A;  3NBR A;  3OWS A;  3S5C A;  1O7N B;  3F40 A;  3OV4 A;  5CXO A;  2QGU A;  4R1K A;  5IG0 A;  3FKA A;  1E3V A;  4XDV A;  3KZT A;  1ULJ B;  2GBX B;  1GS3 A;  3I0Y A;  3SOA A;  4FCM A;  3KKG A;  5D81 A;  8CHO A;  1QMA A;  3EF8 A;  4L8O A;  1HKX A;  1OGZ A;  4LMI A;  5BXQ A;  5KP3 A;  5DRV A;  4U13 A;  5AIH A;  1OCV A;  3HK4 A;  5BVB A;  5D83 A;  3EBY A;  5AEW B;  3MYT A;  3D9R A;  1ULI B;  1OHS A;  2Z76 A;  1NWW A;  1GY5 A;  3EN8 A;  1Q42 A;  2B24 B;  3NV0 A;  4HM6 B;  1W6Y A;  3KE7 A;  3E99 A;  1UUW B;  3A76 A;  3CNX A;  4XBY A;  3NM2 A;  3EJV A;  1W00 A;  3H51 A;  5IEN A;  3EQQ B;  3NXJ A;  4HM8 B;  4LEH A;  4H3U A;  3JUO A;  2HMM B;  1GY6 A;  1JN5 B;  1OUN A;  2I9W A;  4XM4 A;  4I4K A;  2RFR A;  4XBX A;  1S5A A;  3ROB A;  3MHE A;  1TUH A;  4IIA A;  3LYG A;  3RGA A;  2INX A;  3T8N A;  2QIY A;  2XSH B;  4MJD A;  2BNG A;  1JB5 A;  1W01 A;  4Q53 A;  3GZB A;  1Z1S A;  4X2O A;  1GYB A;  2UX0 A;  3GZX B;  3K0Z A;  4R9K A;  3UNL A;  1E3R A;  1SJW A;  4XDW A;  3SED A;  3DZL A;  4STD A;  3FLJ A;  5JPP A;  3F8X A;  1NU3 A;  5IG3 A;  1O7G B;  3MG1 A;  4XBT A;  4ORL A;  3MSO A;  1OH0 A;  3IPT A;  4HKV B;  3G0K A;  4K1U A;  3ER7 A;  1A2K A;  3F7X A;  2HMO B;  5G2G A;  2A15 A;  5JPU A;  2W2C A;  1ZO2 A;  2GEY A;  3FF2 A;  3MKI A;  1JB4 A;  1CQS A;  3MG2 A;  2Z7A A;  3GZY B;  3NV0 B;  3B4P A;  1Q40 B;  3F14 A;  5CK6 A;  1JB2 A;  5AEU B;  2BMR B;  2JQ5 A;  3ECF A;  4K1V A;  1DMQ A;  3F7S A;  3Q90 A;  3HZP A;  3FSD A;  3DM8 A;  3JUQ A;  3EHC A;  4HM2 B;  2RGQ A;  1Q40 A;  1OHO A;  3FF0 A;  3STD A;  2XRX B;  4HM0 B;  4FCJ A;  3EBT A;  2RCD A;  1O7W B;  5IF6 A;  1QJG A;  4KVH A;  3F8H A;  2YFI B;  4HM1 B;  3VGN A;  1C7H A;  1ISK A;  5IG5 A;  3EC9 A;  5IEO A;  5EVH A;  5CF2 A;  1ASK A;  3F9S A;  1AR0 A;  5AI1 A;  2CKF B;  3G8Z A;  2F99 A;  3M8C A;  1IDP A;  4OUQ A;  5D82 A;  3B4O A;  3DMC A;  2BMQ B;  3CPO A;  3OWY A;  3H3H A;  1ZX2 A;  2HMK B;  5AIG A;  1DMN A;  3VSY A;  4HVN A;  3K7C A;  3B7C A;  3CU3 A;  2IMJ A;  2Z77 A;  2F98 A;  1GY7 A;  4HJL B;  2HML B;  1O7M B;  4J8T A;  4HM3 B;  3UJM A;  1DMM A;  3CNM A;  3KSP A;  1BUQ A;  6STD A;  3BB9 A;  3EN1 B;  5CLK A;  3EX9 A;  3NHX A;  1OF5 A;  3RGR A;  7STD A;  1EA2 A;  5IEP A;  3HX8 A;  4GB5 A;  4RZM A;  5HGR A;  3GRD A;  2R4I A;  2K54 A;  3FH1 A;  4WYK B;  5AII A;  3FZW A;  5TGN A;  4WP5 A;  4R9L A;  4OVM A;  2XR8 B;  2B1X B;  5AIF A;  5CF1 A;  4LGQ A;  4CDL A;  3JUP A;  4WYK A;  4X2H A;  2BMO B;  2HMJ B;  4HM5 B;  4J9A A;  5IG4 A;  3NUV A;  4PEJ A;  5FW5 A;  4L7K A;  2CHC A;  1OPY A;  1W02 A;  3FGY A;  2HMN B;  3MG3 A;  3GWR A; 
#chains in the Genus database with same CATH topology
 3MWZ A;  4N3V A;  3DGN A;  4HM7 B;  4O02 B;  1IV9 A;  1US1 A;  2BT3 A;  1LNI A;  3SX1 A;  1BOX A;  1VZZ A;  2OTL 3;  3CMA 3;  1NDO B;  1STF I;  1OHP A;  1FZU A;  4LZI A;  2MC8 A;  1F8N A;  2IUK A;  3JUN A;  2H0I A;  4WWU C;  4HZ9 B;  2CH9 A;  1IQY A;  5DRE A;  4FMA A;  4BL2 A;  2KAA A;  2GSP A;  1RRL A;  1TFO A;  2CX0 A;  1U5O A;  7RNT A;  5M19 A;  3EE1 A;  1JV2 B;  5RNT A;  4HM4 B;  2OQE A;  5KP4 A;  3L0R A;  4HZB B;  1BRJ A;  1N8R 4;  2GEX A;  1UCI A;  3B8L A;  1A2P A;  3WOE B;  2H0G A;  3FG3 A;  3OX9 A;  1JKG B;  4NPB A;  4BTX A;  1NB5 I;  1RNB A;  2GBW B;  4KFF A;  3WMD A;  3CCM 3;  1O7P B;  4IT7 A;  3I55 3;  3LXU X;  4G1M B;  4EV2 A;  1EG9 B;  1BNG A;  4OK0 A;  3K63 A;  1IV7 A;  1N9E A;  3AGN A;  1HU9 A;  4GHO A;  4IPB A;  5EEO A;  4XB5 A;  1L5G B;  2QA4 3;  2PZV A;  1CYV A;  3X41 A;  2V1L A;  1STD A;  3DGO A;  1TFK A;  1BRG A;  4EC6 A;  1SAR A;  1JKG A;  3DUK A;  3OXA A;  4KFE A;  3V92 A;  3CCL 3;  1MWU A;  1IT7 A;  2KRT A;  3LTD A;  1IQ8 A;  1YVS A;  3AGO A;  3ZG0 A;  2CFD A;  3SOY A;  2YFJ B;  3G16 A;  3SXX A;  3T8U A;  1RN4 A;  2STD A;  2W03 A;  2XSO B;  1OGX A;  3BLZ A;  1DET A;  2WGO A;  3G71 3;  1O7H B;  2CWT A;  1KQS 2;  1SII A;  1B20 A;  1UDI I;  1UUV B;  1JN5 A;  3DXO A;  1JJ2 2;  1RGC A;  2BIR A;  3D4A A;  3GZR A;  2P38 A;  1IQX A;  1CEW I;  4L8P A;  2CX1 A;  5KP1 A;  3N9H A;  5EQL A;  1BAN A;  3JUM A;  1LQG C;  1GD4 A;  2F86 B;  1WQL B;  2YFL B;  3OWU A;  1OF5 B;  3DY5 A;  3PGB A;  1VQK 3;  1WNH A;  2L1S A;  1E97 A;  2OWP A;  5STD A;  3S27 A;  3LZA A;  1K41 A;  1VQP 3;  5IER A;  3N8B A;  1BNI A;  1TP6 A;  1VQN 3;  2GXF A;  3NBR A;  3OWS A;  3CCS 3;  3FG1 A;  3S5C A;  1Q7H A;  3NQZ A;  1BVI A;  1O7N B;  2IUJ A;  4BTY A;  1VQ7 3;  3PCS A;  1WMO A;  3F40 A;  5IW9 A;  3OV4 A;  1G96 A;  2CWV A;  2WOH A;  3BNE A;  4J5G A;  1IVV A;  2QGU A;  5CXO A;  3ALA A;  4LYL B;  2H0H A;  3D3L A;  5AYS C;  1K73 4;  4FMC A;  4R1K A;  2KF6 A;  1Q7Y 4;  5IG0 A;  1X1U A;  5GSP A;  1BAO A;  3TDG A;  3FKA A;  4K61 A;  3IMA B;  1E3V A;  3NBB A;  4XDV A;  1RSN A;  1TTO A;  1ULJ B;  2GBX B;  3KZT A;  1A2V A;  4O8S A;  4FR9 A;  1GS3 A;  3ZG5 A;  1GOY A;  1BRI A;  1R4C A;  2F56 A;  3I0Y A;  3SOA A;  4FCM A;  3KKG A;  3RNT A;  1W4N A;  3FG4 A;  3V98 A;  2D42 A;  3GSP A;  2CC3 A;  3U1W A;  5FGO A;  3G6E 3;  1PU4 A;  3KCH A;  1X1W A;  2IA7 A;  3WHO A;  1UW1 A;  5D81 A;  3BU4 A;  1RGK A;  8CHO A;  1QMA A;  8RNT A;  1PY3 A;  3EF8 A;  1DVD A;  4L8O A;  1HKX A;  1OGZ A;  4LMI A;  5BXQ A;  5KP3 A;  1EKM A;  2M7O A;  1PFP A;  4N6T A;  3EB8 A;  5DRV A;  1T3B A;  4O2H A;  4U13 A;  3FCS B;  5AIH A;  4KFD A;  1IVX A;  2CG0 A;  1I3F A;  1OCV A;  3HK4 A;  1D6U A;  1GOU A;  2ZDJ A;  1YHQ 3;  5BVB A;  1GMR A;  1V74 A;  5D83 A;  1EUI C;  1DYU A;  3EBY A;  5AEW B;  1RGG A;  1VQ5 3;  3MYT A;  1UGH I;  1W7C A;  2C11 A;  1LXE A;  1JNQ A;  5LC6 A;  2JDI H;  1BRS A;  1IT8 A;  2W56 B;  3KII A;  3D9R A;  1W6G A;  1ULI B;  2W6J H;  1OHS A;  2Z76 A;  1QAF A;  1NWW A;  3DGL A;  3SYU A;  4CJN A;  1LNH A;  1T5Y A;  1GY5 A;  3LTA A;  3EN8 A;  1Q42 A;  2BO9 B;  1SPU A;  2XF3 A;  2P09 A;  3I56 3;  2B24 B;  3NV0 A;  3OW2 2;  1BRK A;  4HM6 B;  1W6Y A;  2SBL A;  3KE7 A;  4HAA A;  3ZFZ A;  4HBR A;  3AHS A;  3E99 A;  1R4Y A;  1UUW B;  4RNY A;  3A76 A;  4EXR A;  3CNX A;  6RNT A;  2W56 A;  4XBY A;  3NM2 A;  1BSA A;  2XEP A;  1FGM A;  3EJV A;  1W00 A;  3BNB A;  2E2U A;  2W0Q A;  3H51 A;  1BSB A;  4JRF A;  5A0O B;  1BU4 A;  1MGW A;  3HIG A;  4BU4 A;  3PZW A;  1MWT A;  3QK9 A;  1MOL A;  4DKI A;  5IEN A;  5G1K A;  4KT3 B;  1BSD A;  3EQQ B;  3NXJ A;  4HM8 B;  1MWR A;  1X1Y A;  3X3Z A;  1WMP A;  4LEH A;  1BNJ A;  4QWT A;  2OOV C;  1LVN A;  1RCK A;  1UCL A;  3LTB A;  1FGT A;  4H3U A;  3CC2 3;  3HI7 A;  1D6Z A;  3JUO A;  1IK3 A;  5BIR A;  3CXC 2;  2HMM B;  5I97 A;  1GY6 A;  2XGN A;  1JN5 B;  1OUN A;  1AVK A;  2E2T A;  3DH2 A;  2FXT A;  2I9W A;  3CCU 3;  4N6O B;  2R41 A;  2CFW A;  4XM4 A;  3SLU A;  1RN7 A;  1KC8 4;  4I4K A;  1YJN 3;  1OAC A;  1FGR A;  1AY7 A;  2ZA4 A;  3GAX A;  1KSI A;  3LT8 A;  4GSP A;  3VF1 A;  1VQ8 3;  3BNC A;  3X3X A;  4HOH A;  2RFR A;  1G0T A;  3D5I A;  1NJI 4;  4XBX A;  1S5A A;  1QVF 2;  3DGM A;  3KSE D;  1K28 A;  3ROB A;  3MHE A;  1B2M A;  6GSP A;  1TUH A;  3CCR 3;  2HOH A;  4IIA A;  1LOW A;  2F4Y A;  3IJE B;  1RCL A;  1RNT A;  3LYG A;  3A5E A;  3RGA A;  1SQW A;  1BRH A;  4FCZ A;  2INX A;  1KWI A;  3Q3F A;  2QIY A;  2XSH B;  3T8N A;  1RTU A;  4I5Q A;  4MJD A;  1X1X A;  2BNG A;  1JB5 A;  1JRQ A;  2LQV A;  1W01 A;  4Q53 A;  3GZB A;  1Z1S A;  2WOF A;  2CFG A;  4X2O A;  1GYB A;  2UX0 A;  3AHW A;  2IYJ A;  4CPK A;  2XGL A;  1TRP A;  3GZX B;  3N54 B;  1YIT 3;  3CC4 3;  1BIR A;  1VQL 3;  1NO3 A;  1B2U A;  1W5Z A;  3K0Z A;  4R9K A;  3UNL A;  1E3R A;  1SJW A;  4LSO A;  4XDW A;  3SED A;  3CCE 3;  4MEI A;  3CD6 3;  3BIR A;  3DZL A;  4ZM8 A;  3U97 A;  1FW7 A;  2O3O A;  2Y74 A;  3S28 A;  1VQM 3;  1RMS A;  3UB1 A;  4STD A;  3FLJ A;  4EW5 A;  1GSP A;  5JPP A;  4EYC A;  3F8X A;  2KF3 A;  1NU3 A;  5IG3 A;  1O7G B;  3NX0 A;  4CCV A;  9RNT A;  1TIJ A;  3MG1 A;  4XBT A;  3WDG B;  4ORL A;  3MSO A;  1YGE A;  1N8Q A;  3LOY A;  2CIU A;  2CK3 H;  2C10 A;  3K9M C;  2CFL A;  4MMY B;  1OH0 A;  1ROA A;  3IPT A;  4HKV B;  2GU1 A;  3G0K A;  4K90 B;  1Q81 4;  3WA2 X;  1W6C A;  2K0M A;  1I2F A;  3BND A;  3S29 A;  2ZL8 A;  1DVC A;  4N6V 0;  5HOH A;  4K1U A;  1QAL A;  5G1L A;  2GU3 A;  1HYF A;  1RGA A;  3T0U A;  3UL6 A;  3ER7 A;  1A2K A;  2KF4 A;  3LT9 A;  3F7X A;  2HMO B;  5G2G A;  3KFQ C;  1RGE A;  2P0X A;  5AYR B;  1BSE A;  1FYS A;  1GD3 A;  2A15 A;  2W2C A;  1RGF A;  1ZO2 A;  2GEY A;  3FF2 A;  3MKI A;  3PS8 A;  1LOV A;  2PNC A;  1S72 3;  1JZD A;  1VQQ A;  1JB4 A;  4O3V A;  1CQS A;  5BU4 A;  5M18 A;  3MG2 A;  1U8C B;  2Z7A A;  4FMD A;  5LC7 A;  1I2E A;  3GZY B;  2CW9 A;  1RGH A;  1MNL A;  1FGO A;  3NV0 B;  1M90 4;  1BUJ A;  1JBR A;  3B4P A;  2OCT A;  1Q40 B;  1IYY A;  3F14 A;  3LML A;  5CK6 A;  1JB2 A;  4AKY A;  4EV5 A;  1RN1 A;  5AEU B;  5JBS A;  3WA3 A;  1RRH A;  1B2S A;  4H61 A;  3UL5 A;  1Y4K A;  2BMR B;  2JQ5 A;  2KXG A;  1ROV A;  3ECF A;  1Q9E A;  4K1V A;  1DMQ A;  3F7S A;  1MGR A;  1AV4 A;  1LOX A;  3Q90 A;  1SIH A;  3HZP A;  3FSD A;  1RHL A;  3KN4 A;  3DM8 A;  4RBN A;  4BL3 A;  3JUQ A;  1RKY A;  3EHC A;  2RGQ A;  4HM2 B;  3J7Y d;  1Q40 A;  1OHO A;  2RNT A;  3FF0 A;  2BHM A;  4WHA A;  3STD A;  2XRX B;  4HM0 B;  4AEQ A;  2XH9 A;  2K3D A;  3MPH A;  3EBT A;  4FCJ A;  1B27 A;  1TU5 A;  1WTH A;  1WMN A;  2RCD A;  2OOV A;  1BGS A;  1GMP A;  1T2H A;  1O7W B;  1TRQ A;  2OTJ 3;  1FUT A;  5IF6 A;  1QJG A;  3G4S 3;  1FGQ A;  2WGQ A;  2CWU A;  1K9M 4;  4RNT A;  4KVH A;  1LOY A;  1N5H A;  1M9G A;  2L4V A;  1I0V A;  3LH4 A;  1D6Y A;  3F8H A;  1RDS A;  2YFI B;  3PCR A;  1GMQ A;  3WOF B;  3CCQ 3;  1J2B A;  1UGI A;  5M1A A;  1V57 A;  1BNS A;  1I0X A;  2Q07 A;  3HOH A;  3QRD A;  1UCK A;  1AVL A;  4HM1 B;  4MMZ B;  1C7H A;  1IU7 A;  1PYL A;  1UCJ A;  2O9U X;  3VGN A;  4R4K A;  5ELJ A;  1NB3 I;  3EC9 A;  4ILF A;  5IG5 A;  1KD1 4;  2P05 A;  2F5M A;  5IEO A;  5JPU A;  1ZS7 A;  1IVW A;  5EVH A;  1B21 A;  2AAE A;  3WOD G;  5CF2 A;  3Q1C A;  2IY2 A;  1ASK A;  2OQE C;  3F9S A;  2W9Q A;  1AR0 A;  2W9P A;  4N6L A;  1MWS A;  5AI1 A;  1I8V A;  2UGI A;  4NHF A;  1VQ6 3;  2E2V A;  1IVU A;  1BNR A;  1N9J A;  2CKF B;  3G8Z A;  2F99 A;  3M8C A;  1BNE A;  7GSP A;  1VQO 3;  1ISK A;  2KF5 A;  4GL6 A;  1N5P A;  1IDP A;  1YJW 3;  4OUQ A;  3V99 A;  5D82 A;  3B4O A;  3DMC A;  3RDE A;  1T2I A;  3CCJ 3;  3WR2 A;  2BMQ B;  2RBI A;  1C54 A;  3CPO A;  3OWY A;  3H3H A;  4TX4 A;  1ZX2 A;  2HMK B;  1YIJ 3;  1W2Z A;  1Q86 4;  5AIG A;  1DMN A;  1I2G A;  3VSY A;  4HVN A;  3X42 A;  3K7C A;  1W2B 2;  1BRN L;  1UI8 A;  3B7C A;  2KCD A;  4N6U A;  2XFS A;  1JBT A;  3CU3 A;  2CG1 A;  2F5W A;  2XFT A;  2RSX A;  1EQK A;  1FUW A;  3O8Y A;  5ELU A;  3URP A;  4BTW A;  2BU4 A;  2IMJ A;  2Z77 A;  2F98 A;  1FA3 A;  3PYJ A;  1GY7 A;  3Q2P A;  3JVC A;  1GOV A;  4HJL B;  2HML B;  2Y73 A;  1QAK A;  1O7M B;  4J8T A;  2FNQ A;  1RGL A;  2FGT A;  4RNZ A;  4HM3 B;  3CME 3;  3UJM A;  1DMM A;  2Z6B A;  3CNM A;  3KSP A;  2QEX 3;  1K8A 4;  1BUQ A;  6STD A;  3BB9 A;  1YJ9 3;  3EN1 B;  5CLK A;  3S67 A;  2ML5 A;  3EX9 A;  1CH0 A;  3NHX A;  4FMB A;  4JF8 A;  4R80 A;  1DE3 A;  1OF5 A;  2W04 A;  1EEJ A;  1A67 A;  2MF7 A;  3RGR A;  7STD A;  2P0M A;  1YGW A;  3D79 A;  1I3I A;  1EA2 A;  2ZHX B;  4KZ1 A;  5IEP A;  1UI7 A;  3NQY A;  3AMO B;  1B2X A;  2SAR A;  3HX8 A;  3NM7 A;  4WFO A;  1M1X B;  2YX9 A;  4GB5 A;  1JBS A;  2ML6 A;  4RZM A;  1RLS A;  5HGR A;  4BIR A;  3GRD A;  2R4I A;  3CPW 2;  4HYZ A;  2K54 A;  4N6N B;  3FH1 A;  3X40 A;  4WYK B;  5AII A;  2J8X B;  2WO0 A;  3FZW A;  2AAD A;  5TGN A;  4WP5 A;  1RJO A;  4R9L A;  3SVA A;  4OVM A;  2D1W A;  1LRA A;  1V58 A;  1FUS A;  3AMO A;  1YI2 3;  3NBJ A;  1M1K 4;  2XR8 B;  1VQ4 3;  2B1X B;  5AIF A;  5CF1 A;  1YVB I;  4LGQ A;  3CCV 3;  1HZ1 A;  1BNF A;  1LQM B;  2CFK A;  3X3Y A;  1CYU A;  4CDL A;  3D5G A;  1NNV A;  4N6M A;  1QVG 2;  4NRE A;  1Q82 4;  1JZO A;  3JUP A;  4WYK A;  1UUG B;  1I70 A;  3DGY A;  2LYX A;  4X2H A;  4EBG A;  2BMO B;  2UUG C;  2HMJ B;  3K5T A;  1AQZ A;  4HM5 B;  4J9A A;  3NUV A;  5IG4 A;  3CC7 3;  1BSC A;  3PXM A;  4PEJ A;  1YNV X;  5FW5 A;  4L7K A;  1B2Z A;  2CHC A;  3HII A;  4MMX B;  2C4B A;  1OPY A;  1W02 A;  3LTC A;  1TJD A;  4AKZ A;  1VQ9 3;  4J5K A;  1G02 A;  1B3S A;  3FGY A;  2HMN B;  1ZGX A;  3MG3 A;  3GWR A;  1A90 A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  4N3V A;  3DGN A;  4HM7 B;  4O02 B;  1IV9 A;  1US1 A;  2BT3 A;  3SX1 A;  1VZZ A;  2OTL 3;  3CMA 3;  1NDO B;  1STF I;  1OHP A;  4LZI A;  2MC8 A;  1F8N A;  2IUK A;  3JUN A;  4WWU C;  4HZ9 B;  2CH9 A;  1IQY A;  5DRE A;  4FMA A;  1RRL A;  1TFO A;  1U5O A;  3EE1 A;  1JV2 B;  4HM4 B;  2OQE A;  5KP4 A;  3L0R A;  4HZB B;  1N8R 4;  2GEX A;  3B8L A;  3WOE B;  3FG3 A;  3OX9 A;  1JKG B;  4BTX A;  1NB5 I;  2GBW B;  4KFF A;  3WMD A;  3CCM 3;  1O7P B;  4IT7 A;  3I55 3;  3LXU X;  4G1M B;  4EV2 A;  1EG9 B;  4OK0 A;  3K63 A;  1IV7 A;  1N9E A;  1HU9 A;  4IPB A;  5EEO A;  4XB5 A;  1L5G B;  2QA4 3;  2PZV A;  1CYV A;  3X41 A;  2V1L A;  1STD A;  3DGO A;  1TFK A;  4EC6 A;  3V92 A;  1JKG A;  3DUK A;  3OXA A;  4KFE A;  3CCL 3;  1IT7 A;  2KRT A;  3LTD A;  1IQ8 A;  2CFD A;  3SOY A;  2YFJ B;  3G16 A;  3SXX A;  3T8U A;  2STD A;  2W03 A;  2XSO B;  1OGX A;  3BLZ A;  2WGO A;  3G71 3;  1O7H B;  2CWT A;  1KQS 2;  1SII A;  1UUV B;  1JN5 A;  3DXO A;  1JJ2 2;  3GZR A;  2P38 A;  1IQX A;  1CEW I;  4L8P A;  5KP1 A;  3N9H A;  5EQL A;  3JUM A;  1GD4 A;  2F86 B;  1WQL B;  2YFL B;  3OWU A;  1OF5 B;  3DY5 A;  3PGB A;  1VQK 3;  1WNH A;  1E97 A;  2OWP A;  5STD A;  3S27 A;  3LZA A;  1K41 A;  1VQP 3;  5IER A;  3N8B A;  1TP6 A;  1VQN 3;  2GXF A;  3NBR A;  3OWS A;  3CCS 3;  3FG1 A;  3S5C A;  2IUJ A;  3NQZ A;  4BTY A;  1O7N B;  1VQ7 3;  3PCS A;  1WMO A;  3F40 A;  5IW9 A;  3OV4 A;  1G96 A;  2CWV A;  2WOH A;  3BNE A;  5CXO A;  1IVV A;  2QGU A;  3ALA A;  5AYS C;  3D3L A;  1K73 4;  4FMC A;  4R1K A;  1Q7Y 4;  5IG0 A;  3TDG A;  3FKA A;  4K61 A;  3IMA B;  1E3V A;  3NBB A;  4XDV A;  3KZT A;  1ULJ B;  2GBX B;  1A2V A;  4O8S A;  4FR9 A;  1GS3 A;  1R4C A;  3I0Y A;  3SOA A;  4FCM A;  3KKG A;  1W4N A;  3FG4 A;  3V98 A;  2D42 A;  2CC3 A;  3U1W A;  5FGO A;  3G6E 3;  1PU4 A;  2IA7 A;  1UW1 A;  5D81 A;  8CHO A;  1QMA A;  3EF8 A;  1DVD A;  4L8O A;  1HKX A;  1OGZ A;  4LMI A;  5BXQ A;  5KP3 A;  1EKM A;  2M7O A;  1PFP A;  4N6T A;  3EB8 A;  5DRV A;  4O2H A;  4U13 A;  3FCS B;  5AIH A;  4KFD A;  1IVX A;  2CG0 A;  1OCV A;  3HK4 A;  1D6U A;  2ZDJ A;  1YHQ 3;  5BVB A;  1V74 A;  5D83 A;  1DYU A;  3EBY A;  5AEW B;  1VQ5 3;  3MYT A;  1W7C A;  2C11 A;  1LXE A;  1JNQ A;  5LC6 A;  2JDI H;  1IT8 A;  2W56 B;  3KII A;  3D9R A;  1W6G A;  1ULI B;  2W6J H;  1OHS A;  2Z76 A;  1QAF A;  1NWW A;  3DGL A;  1LNH A;  1T5Y A;  1GY5 A;  3LTA A;  3EN8 A;  1Q42 A;  2BO9 B;  1SPU A;  2XF3 A;  2P09 A;  3I56 3;  2B24 B;  3NV0 A;  3OW2 2;  4HM6 B;  1W6Y A;  2SBL A;  3KE7 A;  4HBR A;  3E99 A;  1UUW B;  4RNY A;  3A76 A;  4EXR A;  3CNX A;  2W56 A;  4XBY A;  3NM2 A;  2XEP A;  1FGM A;  3EJV A;  1W00 A;  3BNB A;  2E2U A;  2W0Q A;  3H51 A;  4JRF A;  5A0O B;  3HIG A;  3PZW A;  3QK9 A;  1MOL A;  5IEN A;  3EQQ B;  3NXJ A;  4HM8 B;  3X3Z A;  1WMP A;  4LEH A;  4QWT A;  2OOV C;  1LVN A;  3LTB A;  1FGT A;  4H3U A;  3CC2 3;  3HI7 A;  1D6Z A;  3JUO A;  1IK3 A;  3CXC 2;  2HMM B;  5I97 A;  1GY6 A;  2XGN A;  1JN5 B;  1OUN A;  1AVK A;  2E2T A;  2FXT A;  2I9W A;  3CCU 3;  4N6O B;  2CFW A;  4XM4 A;  3SLU A;  1RN7 A;  1KC8 4;  4I4K A;  1YJN 3;  1OAC A;  1FGR A;  3GAX A;  1KSI A;  3LT8 A;  3VF1 A;  1VQ8 3;  3BNC A;  3X3X A;  2RFR A;  1NJI 4;  4XBX A;  1S5A A;  1QVF 2;  3DGM A;  3KSE D;  1K28 A;  3ROB A;  3MHE A;  1TUH A;  3CCR 3;  4IIA A;  3IJE B;  3LYG A;  3RGA A;  1SQW A;  4FCZ A;  2INX A;  1KWI A;  3T8N A;  2QIY A;  2XSH B;  4MJD A;  2BNG A;  1JB5 A;  1JRQ A;  2LQV A;  1W01 A;  4Q53 A;  3GZB A;  1Z1S A;  2WOF A;  2CFG A;  4X2O A;  1GYB A;  2UX0 A;  2XGL A;  3GZX B;  1YIT 3;  3N54 B;  3CC4 3;  1VQL 3;  1NO3 A;  1W5Z A;  3K0Z A;  4R9K A;  3UNL A;  1E3R A;  1SJW A;  4LSO A;  4XDW A;  3SED A;  3CCE 3;  4MEI A;  3CD6 3;  3DZL A;  4ZM8 A;  3U97 A;  2O3O A;  2Y74 A;  3S28 A;  1VQM 3;  3UB1 A;  4STD A;  3FLJ A;  5JPP A;  4EYC A;  3F8X A;  1NU3 A;  5IG3 A;  1O7G B;  3NX0 A;  4CCV A;  1TIJ A;  3MG1 A;  4XBT A;  3WDG B;  4ORL A;  3MSO A;  1YGE A;  1N8Q A;  3LOY A;  2CIU A;  2CK3 H;  2C10 A;  3K9M C;  2CFL A;  4MMY B;  1OH0 A;  1ROA A;  3IPT A;  4HKV B;  2GU1 A;  3G0K A;  4K90 B;  1Q81 4;  3WA2 X;  1W6C A;  2K0M A;  3BND A;  3S29 A;  2ZL8 A;  1DVC A;  4N6V 0;  4K1U A;  1QAL A;  2GU3 A;  3T0U A;  3UL6 A;  3ER7 A;  1A2K A;  3LT9 A;  3F7X A;  2HMO B;  5G2G A;  3KFQ C;  5AYR B;  2P0X A;  2A15 A;  5JPU A;  1GD3 A;  2W2C A;  3PS8 A;  1ZO2 A;  2GEY A;  3FF2 A;  3MKI A;  1S72 3;  2PNC A;  1JB4 A;  4O3V A;  1CQS A;  3MG2 A;  1U8C B;  2Z7A A;  4FMD A;  5LC7 A;  3GZY B;  2CW9 A;  1MNL A;  1FGO A;  3NV0 B;  1M90 4;  3B4P A;  2OCT A;  1Q40 B;  3F14 A;  3LML A;  5CK6 A;  1JB2 A;  4AKY A;  4EV5 A;  3WA3 A;  5AEU B;  5JBS A;  1RRH A;  4H61 A;  3UL5 A;  1Y4K A;  2BMR B;  2JQ5 A;  2KXG A;  1ROV A;  3ECF A;  4K1V A;  1DMQ A;  3F7S A;  1AV4 A;  1LOX A;  3Q90 A;  1SIH A;  3HZP A;  3FSD A;  3KN4 A;  4RBN A;  3DM8 A;  3JUQ A;  1RKY A;  3EHC A;  2RGQ A;  4HM2 B;  3J7Y d;  1Q40 A;  1OHO A;  3FF0 A;  2BHM A;  4WHA A;  3STD A;  2XRX B;  4HM0 B;  4AEQ A;  2XH9 A;  3MPH A;  4FCJ A;  3EBT A;  1TU5 A;  1WTH A;  1WMN A;  2RCD A;  2OOV A;  1O7W B;  2OTJ 3;  5IF6 A;  1QJG A;  3G4S 3;  1FGQ A;  2WGQ A;  2CWU A;  1K9M 4;  4KVH A;  1N5H A;  1M9G A;  2L4V A;  3LH4 A;  1D6Y A;  3F8H A;  2YFI B;  3PCR A;  3WOF B;  3CCQ 3;  1J2B A;  2Q07 A;  3QRD A;  4HM1 B;  1AVL A;  3VGN A;  4MMZ B;  1C7H A;  1IU7 A;  1VQ9 3;  2O9U X;  5IG5 A;  1ISK A;  4R4K A;  5ELJ A;  1NB3 I;  3EC9 A;  1KD1 4;  2P05 A;  5IEO A;  1IVW A;  5EVH A;  3WOD G;  5CF2 A;  3Q1C A;  1ASK A;  2OQE C;  3F9S A;  2W9Q A;  1AR0 A;  2W9P A;  4N6L A;  5AI1 A;  4NHF A;  1VQ6 3;  2E2V A;  1IVU A;  1N9J A;  2CKF B;  3G8Z A;  2F99 A;  3M8C A;  1VQO 3;  4GL6 A;  1N5P A;  1IDP A;  1YJW 3;  4OUQ A;  3V99 A;  5D82 A;  3B4O A;  3DMC A;  3RDE A;  3CCJ 3;  2BMQ B;  3CPO A;  3OWY A;  3H3H A;  4TX4 A;  1ZX2 A;  2HMK B;  1YIJ 3;  1W2Z A;  1Q86 4;  5AIG A;  1DMN A;  3VSY A;  4HVN A;  3X42 A;  3K7C A;  1W2B 2;  1UI8 A;  3B7C A;  2KCD A;  4N6U A;  2XFS A;  3CU3 A;  2CG1 A;  2XFT A;  1EQK A;  2RSX A;  1FUW A;  3O8Y A;  5ELU A;  4BTW A;  2IMJ A;  2Z77 A;  2F98 A;  1FA3 A;  3PYJ A;  1GY7 A;  3Q2P A;  3JVC A;  4HJL B;  2HML B;  2Y73 A;  1QAK A;  1O7M B;  4J8T A;  2FNQ A;  2FGT A;  4RNZ A;  4HM3 B;  3CME 3;  3UJM A;  1DMM A;  2Z6B A;  3CNM A;  3KSP A;  2QEX 3;  1K8A 4;  1BUQ A;  6STD A;  3BB9 A;  1YJ9 3;  3EN1 B;  5CLK A;  3S67 A;  2ML5 A;  3EX9 A;  3NHX A;  4FMB A;  4JF8 A;  4R80 A;  1OF5 A;  2W04 A;  1A67 A;  2MF7 A;  3RGR A;  7STD A;  2P0M A;  1EA2 A;  4KZ1 A;  5IEP A;  1UI7 A;  3NQY A;  3AMO B;  3HX8 A;  3NM7 A;  4WFO A;  1M1X B;  2YX9 A;  4GB5 A;  2ML6 A;  4RZM A;  5HGR A;  3GRD A;  2R4I A;  3CPW 2;  4HYZ A;  2K54 A;  4N6N B;  3FH1 A;  3X40 A;  4WYK B;  5AII A;  2WO0 A;  3FZW A;  5TGN A;  4WP5 A;  1RJO A;  4R9L A;  3SVA A;  4OVM A;  2D1W A;  3AMO A;  1YI2 3;  3NBJ A;  1M1K 4;  2XR8 B;  1VQ4 3;  2B1X B;  5AIF A;  5CF1 A;  1YVB I;  4LGQ A;  3CCV 3;  2CFK A;  3X3Y A;  1CYU A;  4CDL A;  1QVG 2;  4N6M A;  4NRE A;  1Q82 4;  3JUP A;  4WYK A;  2LYX A;  4X2H A;  4EBG A;  2BMO B;  2HMJ B;  3K5T A;  4HM5 B;  4J9A A;  5IG4 A;  3NUV A;  3CC7 3;  4PEJ A;  3PXM A;  5FW5 A;  4L7K A;  2CHC A;  3HII A;  4MMX B;  1OPY A;  1W02 A;  3LTC A;  4AKZ A;  3FGY A;  2HMN B;  3MG3 A;  3GWR A;  1A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...