2Z76A

X-ray crystal structure of rv0760c from mycobacterium tuberculosis at 1.82 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
b'QSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative steroid isomerase
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 42
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2z76A00
3GZYB 3G16A 3BLZA 1HKXA 4HM7B 4R9LA 1Z1SA 1BUQA 3F40A 4LMIA 1OGZA 3F8HA 4MJDA 2INXA 2BMQB 3KE7A 4J8TA 3RGAA 3A76A 3FF0A 2YFLB 3OX9A 3CNMA 3KSPA 1NWWA 1NDOB 3D9RA 3VSYA 4WYKA 5AEUB 2XR8B 1AR0A 4HM5B 3B4PA 2K54A 3H51A 2B24B 5IG0A 3MG2A 5HGRA 4FCMA 3EJVA 3EX9A 4Q53A 4XDWA 1GYBA 3FGYA 2HMOB 5IG4A 2RCDA 1C7HA 4XM4A 3B8LA 4L8OA 5AIGA 4FCJA 3JUNA 2B1XB 3DM8A 4XB5A 5AEWB 5IF6A 3G0KA 5IENA 3OWSA 3FZWA 4H3UA 3NHXA 5CK6A 4XBXA 3OV4A 5STDA 4WYKB 2IMJA 1VZZA 3GZBA 2GBXB 4LEHA 3F14A 2YFIB 1UUWB 3FKAA 1OHOA 3VGNA 4HZ9B 5BXQA 3EN8A 3K7CA 1OGXA 5CF2A 4R9KA 4HZBB 1OF5A 3ROBA 4CDLA 4STDA 1GS3A 1DMQA 3E99A 4U13A 3NV0A 3DUKA 1DMMA 1O7PB 3MKIA 1SJWA 4XDVA 3F8XA 3CNXA 3F7XA 2OWPA 4HM3B 3OXAA 2F99A 3UNLA 2JQ5A 2A15A 3RGRA 2QGUA 3S5CA 1O7GB 2GBWB 2HMKB 3DMCA 3F7SA 3FLJA 5IERA 1W01A 3CU3A 5DRVA 2F86B 3EN1B 4L8PA 5JPUA 4OVMA 5KP3A 5IG3A 3T8NA 2RGQA 3WMDA 3FF2A 4HM4B 1O7NB 2XRXB 1JB4A 3SOAA 1OF5B 3FH1A 1QMAA 4PEJA 5AI1A 1IDPA 3GZXB 4RZMA 2HMLB 3NBRA 4X2OA 3UJMA 4WWUC 4HKVB 1QJGA 1A2KA 2F98A 3NV0B 4WP5A 4LGQA 1ZX2A 3MHEA 2PZVA 3LZAA 3CPOA 3FSDA 2Z7AA 5KP1A 3EHCA 4ORLA 3GWRA 3B7CA 2STDA 3MG1A 1Q40B 3NM2A 1EA2A 3M8CA 3Q90A 2GEXA 1JN5A 2GEYA 1GY6A 3KKGA 1ISKA 1STDA 1CQSA 4HVNA 4OUQA 4HM1B 3GRDA 1OHSA 5D83A 3ECFA 1ZO2A 3B4OA 3DXOA 1U5OA 2BNGA 1W00A 2R4IA 3EF8A 2GXFA 1E3RA 3MSOA 1OCVA 5D82A 5FW5A 5IG5A 1JKGB 5EVHA 4J9AA 2BMRB 2XSHB 5JPPA 4HM0B 3DZLA 3JUOA 4KVHA 1Q40A 4IIAA 4HM6B 2BMOB 1NU3A 1JN5B 2HMJB 1O7MB 4XBYA 3JUMA 3HX8A 2CKFB 5IEPA 4K1UA 5TGNA 5CXOA 3MG3A 3NUVA 5IEOA 5CF1A 3I0YA 1O7WB 1E3VA 3EBTA 8CHOA 3EBYA 1GY7A 2HMMB 2HMNB 2W2CA 1OHPA 1O7HB 1TP6A 3NXJA 5AIIA 1W02A 1JKGA 1JB2A 2YFJB 3ER7A 3STDA 1Q42A 3JUQA 5D81A 1UUVB 2XSOB 3F9SA 5KP4A 4HM8B 4R1KA 1JB5A 1DMNA 3HK4A 3G8ZA 2Z77A 4K1VA 2Z76A 4L7KA 3IPTA 4N3VA 3HZPA 4HJLB 1WQLB 3SOYA 1GY5A 3SEDA 3BB9A 3MYTA 1OUNA 1ULJB 5AIHA 1S5AA 7STDA 3EC9A 3OWYA 1E97A 1OPYA 3JUPA 5DREA 2QIYA 4I4KA 4X2HA 1OH0A 3EQQB 1W6YA 3OWUA 4HM2B 3K0ZA 2RFRA 1K41A 3LYGA 2I9WA 4XBTA 6STDA 1EG9B 5CLKA 1ULIB 5AIFA 2CHCA 3GZRA 3H3HA 1ASKA 3T8UA 5G2GA 1TUHA 5BVBA 3KZTA 4GB5A 2UX0A
chains in the Genus database with same CATH superfamily
3GZYB 1PYLA 3G16A 3BLZA 2OQEA 4AEQA 3X41A 1TU5A 3MPHA 1T5YA 1BIRA 1T3BA 1HKXA 1R4YA 1TRPA 4HM7B 4R9LA 1Z1SA 4CCVA 3F40A 1BUQA 3Q1CA 3HIIA 3PGBA 4LMIA 1RDSA 2P0XA 2QA43 1OGZA 3F8HA 1LOWA 4MJDA 1YIJ3 1JV2B 2INXA 2BMQB 3KE7A 4TX4A 2P38A 4J8TA 3RGAA 3DGNA 1V74A 1T2HA 1X1XA 3A76A 1FUWA 3FF0A 1RN4A 3D3LA 2IYJA 3WOFB 2WGQA 2YFLB 1I3FA 3OX9A 3CNMA 1CEWI 3KSPA 1TJDA 1U8CB 1NWWA 1NDOB 3D9RA 4AKYA 3K5TA 4CPKA 3VSYA 4WYKA 5AEUB 3PCRA 2IUJA 5RNTA 2C10A 2XR8B 5BIRA 1MOLA 4N6NB 3DY5A 1AY7A 2GU3A 5EEOA 1AR0A 1ROVA 2CWVA 4J5GA 1I2FA 4QWTA 1DVDA 4HM5B 1W6GA 3B4PA 2K54A 1V57A 2XFSA 3H51A 2B24B 4BTYA 2SBLA 5IG0A 1HYFA 1RN1A 1RNBA 1RJOA 1X1WA 3MG2A 2CG1A 1JZDA 1BRJA 1M1XB 2IA7A 2ML5A 5JPPA 1ZS7A 4N6OB 5JBSA 5HGRA 1JBRA 2XH9A 3SVAA 1VQO3 4NREA 1V58A 2F56A 1S723 3L0RA 1IQ8A 3EJVA 4FCMA 3EX9A 1SIHA 4Q53A 3S29A 3I553 1W7CA 1GOYA 4XDWA 1GYBA 4BTWA 3FGYA 2HMOB 5IG4A 1X1YA 5M19A 1KSIA 1LNIA 2RCDA 1C7HA 1US1A 2FNQA 4XM4A 1VQ83 1JBSA 2OQEC 2SARA 3B8LA 2IY2A 4L8OA 5AIGA 1VQ43 2W56B 4FCJA 1OACA 4EV2A 3JUNA 1Q9EA 2B1XB 3DM8A 1PY3A 4XB5A 7RNTA 5AEWB 1LXEA 2FGTA 3LTCA 5I97A 4NPBA 5IF6A 1RN7A 1BGSA 1FUTA 2PNCA 3G0KA 4N6V0 4AKZA 5IENA 2GU1A 1A67A 1I2EA 1UDII 1B2UA 1B2MA 3OWSA 4N6TA 4OK0A 1YHQ3 1N8QA 2C11A 3FZWA 1I2GA 2CK3H 4H3UA 5AYRB 1GD4A 3UL6A 4KZ1A 3NHXA 5CK6A 1YJN3 1FGTA 1G0TA 1SQWA 3LT8A 4XBXA 3T0UA 2LYXA 3WA2X 1IQXA 4KT3B 2CFDA 4FMAA 3BNCA 3OV4A 1BNEA 5STDA 1IYYA 4WYKB 2F5MA 1BUJA 4RNTA 3CCM3 2IMJA 1VZZA 1BRNL 3LTAA 2CFLA 2R41A 3X40A 1BOXA 1N9JA 1FGQA 1IU7A 3GZBA 2GBXB 4LEHA 3F14A 4BIRA 2YFIB 3HOHA 1UUWB 2XEPA 3FKAA 4WFOA 1C54A 1BAOA 1OHOA 2RSXA 3VGNA 1VQN3 2OTJ3 1RSNA 3GSPA 4HZ9B 5BXQA 1AV4A 1BNGA 1BNIA 3AHSA 5IW9A 1BRHA 4R4KA 3EN8A 3K7CA 4O2HA 1OGXA 1M904 2ZA4A 5CF2A 1MWTA 1QALA 4R9KA 3IMAB 2BO9B 1AVLA 3CXC2 4HZBB 2CIUA 3K63A 1OF5A 1B27A 3DGMA 1I3IA 1UGHI 4FR9A 1WMPA 5ELJA 3ROBA 2MC8A 3U97A 4CDLA 1IT8A 3S28A 1BU4A 4STDA 3QK9A 1GS3A 1DMQA 2KF4A 1Q824 4H61A 1BSDA 3E99A 4U13A 1G96A 1VQK3 3NV0A 3DUKA 1PU4A 1DMMA 4EXRA 1O7PB 2W56A 1FYSA 2QEX3 3MKIA 1G02A 1SJWA 1QAFA 6RNTA 4XDVA 3F8XA 1VQQA 1FUSA 4LYLB 3O8YA 1IVVA 3CNXA 1RGLA 3F7XA 2OWPA 3K9MC 2P09A 1K9M4 4HM3B 3OXAA 2F99A 1UCLA 2Q07A 3UNLA 2E2VA 2CG0A 1LRAA 3N8BA 1RLSA 2JQ5A 4HOHA 2A15A 2W9PA 1SPUA 3LH4A 4HAAA 7GSPA 1YIT3 1EKMA 3FG4A 3RGRA 1B20A 2QGUA 3S5CA 3FG3A 1O7GB 2GBWB 2HMKB 3DMCA 3F7SA 4CJNA 3FLJA 4N6UA 5IERA 3UB1A 1J2BA 1W01A 3CU3A 4G1MB 1UI8A 3KSED 1W6CA 2CX1A 2CWTA 1MGWA 5BU4A 1JBTA 1B3SA 2E2TA 3PZWA 5DRVA 2F86B 2M7OA 1RCLA 2W9QA 3EN1B 4K90B 4L8PA 5JPUA 1VQ93 1LQMB 4EBGA 1TIJA 4OVMA 3CCS3 1NB3I 3BU4A 1YJW3 3G713 1UCIA 5KP3A 5IG3A 2WOFA 1YJ93 1TRQA 2CX0A 1ZGXA 3T8NA 1RRHA 1W5ZA 2BHMA 2RGQA 3IJEB 3WMDA 3FF2A 4HM4B 2OTL3 1O7NB 1AVKA 2XRXB 1JB4A 1LNHA 3SOAA 2Y74A 1OF5B 4MMXB 4MMYB 2HOHA 4NHFA 3FH1A 1LVNA 4KFEA 1QMAA 3D79A 4PEJA 4EV5A 5AI1A 3PS8A 1D6UA 1FGOA 1IDPA 1JNQA 1MWUA 1BSBA 2D42A 1KWIA 3GZXB 3NM7A 2HMLB 3NBRA 4RZMA 4O8SA 3S27A 1FGMA 3SYUA 3AMOB 4X2OA 3UJMA 3WA3A 4WWUC 1TFOA 1QJGA 1A2KA 1N9EA 2F98A 2XGNA 3NV0B 1BRIA 4HKVB 4LGQA 1ZX2A 2P0MA 3MHEA 4WP5A 4EYCA 1GSPA 1LOYA 1VQL3 1R4CA 2PZVA 3BNBA 5A0OB 3LZAA 3CPOA 3FSDA 1PFPA 2Z7AA 2F4YA 1HU9A 5KP1A 4JF8A 3SLUA 3D5IA 3EHCA 4ORLA 3GWRA 3B7CA 1WNHA 1N5PA 1GOUA 1VQM3 2RBIA 2STDA 1TTOA 4BU4A 3N54B 3MG1A 2FXTA 1BSEA 1K28A 1Q40B 1KC84 1IVUA 3CCU3 1IK3A 1IV9A 1D6YA 5GSPA 3CC23 5LC6A 3NM2A 1VQP3 3WODG 3V99A 3MWZA 6GSPA 1KD14 1EA2A 2JDIH 3M8CA 3Q90A 2GEXA 1JN5A 2GEYA 3BIRA 5LC7A 4EW5A 4GSPA 2KF5A 1GY6A 2ZHXB 3AHWA 1BANA 2L1SA 3GAXA 2W6JH 3KKGA 3X3ZA 1K8A4 1ISKA 1STDA 2RNTA 1N8R4 1DYUA 5EQLA 5G1LA 5HOHA 1X1UA 1SIIA 1IT7A 1CQSA 2K3DA 4HVNA 4FMBA 4OUQA 4HM1B 1GMQA 3VF1A 3V92A 1AQZA 3GRDA 3CD63 1OHSA 2OCTA 1MWRA 1T2IA 1TFKA 3CCL3 5D83A 1MNLA 3ZFZA 3CCJ3 3ECFA 1ZO2A 3B4OA 1RHLA 1UCKA 1RCKA 4JRFA 3ZG0A 3DXOA 1RGCA 1U5OA 2UUGC 2O9UX 1UI7A 3WDGB 1GMRA 3BNEA 3JVCA 2BNGA 1UGIA 1W00A 2Y73A 3ALAA 2KCDA 2R4IA 3EF8A 3FCSB 1RNTA 2GXFA 5ELUA 1EQKA 2WO0A 4MEIA 3KIIA 3AMOA 1E3RA 1YGEA 3MSOA 1F8NA 1OCVA 5D82A 5FW5A 5IG5A 3CCR3 1JKGB 1I0VA 5EVHA 4FCZA 3EE1A 2BIRA 4J9AA 4O02B 8RNTA 1WTHA 2L4VA 1RGHA 2BMRB 4LZIA 2KRTA 2CFKA 1BSAA 3DGYA 1K734 2YX9A 1EEJA 2J8XB 2MF7A 2XSHB 3D4AA 3KN4A 1QAKA 3DZLA 1BNFA 3JUOA 4HM0B 1B2ZA 3DGLA 1EUIC 4J5KA 4KFFA 3KCHA 4KVHA 1WMNA 1BNJA 1UUGB 1WMOA 1D6ZA 5G1KA 4RNZA 1GMPA 1W2B2 3V98A 3PCSA 1RGEA 1Y4KA 1Q40A 4IIAA 9RNTA 4HM6B 3OW22 1YVSA 3NBBA 2BMOB 3J7Yd 1NU3A 3SX1A 2KF6A 4IT7A 4KFDA 1JN5B 2HMJB 1ROAA 2OOVA 1O7MB 3LTDA 4XBYA 3JUMA 1RRLA 3HX8A 1MWSA 1N5HA 1W4NA 3NBJA 3QRDA 1NO3A 2CKFB 5AYSC 1Q814 5IEPA 1BRGA 3HIGA 4K1UA 3S67A 4R80A 5CXOA 5TGNA 2W04A 1IQYA 3MG3A 2CWUA 1QVG2 3NUVA 1VQ53 5IEOA 3U1WA 5CF1A 1LQGC 2XF3A 1O7WB 1E3VA 1HZ1A 3I0YA 1JZOA 4BL2A 3CCQ3 1B2XA 1NB5I 1VQ73 2KXGA 3EBTA 8CHOA 2C4BA 3EBYA 1GY7A 1NNVA 1RGGA 4FMDA 1BNRA 1B2SA 3WOEB 2HMMB 2HMNB 3UL5A 3CMA3 3ZG5A 4GL6A 2ZDJA 2W2CA 2H0IA 1MGRA 1OHPA 1GOVA 1DVCA 1Q7HA 3WHOA 3A5EA 2BT3A 1O7HB 2Z6BA 3LXUX 3G6E3 1TP6A 3CPW2 2LQVA 3NXJA 1I8VA 1M9GA 1W02A 2UGIA 5AIIA 1JKGA 2XGLA 3AGOA 1CH0A 1YVBI 3LTBA 4HBRA 5M1AA 2F5WA 1Q864 1JB2A 3NX0A 3X3YA 1NJI4 2AAEA 2W03A 1DE3A 2E2UA 4RBNA 2YFJB 3N9HA 1YGWA 1A2VA 3CC43 3I563 3ER7A 3STDA 1JRQA 1Q42A 3JUQA 5D81A 1UUVB 2XSOB 1RGAA 2OOVC 2WOHA 3F9SA 5KP4A 3HI7A 4ILFA 2BU4A 1CYUA 1IVXA 1BSCA 3RNTA 4HM8B 2P05A 1A2PA 3Q2PA 4MMZB 2XFTA 3X3XA 3LOYA 2AADA 3KFQC 4R1KA 1JB5A 1DMNA 3HK4A 3G8ZA 2Z77A 1A90A 4K1VA 2Z76A 4L7KA 2CFWA 3RDEA 4EC6A 1BNSA 1UCJA 2K0MA 4RNYA 3IPTA 4FMCA 3TDGA 4N3VA 3HZPA 2O3OA 4HJLB 2KAAA 3CCE3 1I0XA 4N6LA 1WQLB 3SOYA 3URPA 1GY5A 3DH2A 3SEDA 2H0HA 1RTUA 3BB9A 1W2ZA 3MYTA 4I5QA 1OUNA 1M1K4 2ZL8A 1B21A 1SARA 1ULJB 3PXMA 4GHOA 2V1LA 5AIHA 3CCV3 1BRSA 1S5AA 3SXXA 1CYVA 1L5GB 7STDA 3D5GA 3EC9A 1IVWA 4BL3A 3OWYA 1DETA 4N6MA 1KQS2 3FG1A 1E97A 1Q7Y4 1OPYA 1BRKA 3JUPA 1LOXA 3LT9A 3NQZA 5DREA 5FGOA 4HYZA 3Q3FA 3PYJA 2QIYA 4I4KA 1IV7A 1FW7A 4X2HA 1OH0A 3EQQB 3AGNA 1W6YA 3OWUA 4K61A 2GSPA 4HM2B 2KF3A 3K0ZA 2RFRA 1UW1A 1K41A 1YNVX 1YI23 3LYGA 3CME3 2I9WA 4XBTA 6STDA 3BNDA 2CFGA 2H0GA 2IUKA 4IPBA 3DGOA 1JJ22 1EG9B 4WHAA 5CLKA 1I70A 1ULIB 1GD3A 4BTXA 3WR2A 1VQ63 2CW9A 2D1WA 3NQYA 2CHCA 5AIFA 3GZRA 3H3HA 4ZM8A 3EB8A 1ASKA 1RGKA 5G2GA 3T8UA 1TUHA 3G4S3 1BVIA 4LSOA 2W0QA 4O3VA 2CC3A 5BVBA 1FA3A 4DKIA 1QVF2 2ML6A 1STFI 2CH9A 3KZTA 1FZUA 1LOVA 3CC73 2WGOA 1FGRA 1RMSA 3X42A 1RGFA 4GB5A 5M18A 2UX0A 1RKYA 3LMLA
chains in the Genus database with same CATH topology
3GZYB 3G16A 3BLZA 2OQEA 4AEQA 3X41A 1TU5A 3MPHA 1T5YA 1HKXA 4HM7B 4R9LA 1Z1SA 4CCVA 3F40A 1BUQA 3Q1CA 3HIIA 3PGBA 4LMIA 2P0XA 2QA43 1OGZA 3F8HA 4MJDA 1YIJ3 1JV2B 2INXA 2BMQB 3KE7A 4TX4A 2P38A 4J8TA 3RGAA 3DGNA 1V74A 3A76A 1FUWA 3FF0A 3D3LA 3WOFB 2WGQA 2YFLB 3OX9A 3CNMA 1CEWI 3KSPA 1U8CB 1NWWA 1NDOB 3D9RA 4AKYA 3K5TA 3VSYA 4WYKA 5AEUB 3PCRA 2IUJA 2C10A 2XR8B 1MOLA 4N6NB 3DY5A 2GU3A 5EEOA 1AR0A 1ROVA 2CWVA 4QWTA 1DVDA 4HM5B 1W6GA 3B4PA 2K54A 3H51A 2XFSA 4BTYA 2B24B 2SBLA 5IG0A 1RJOA 3MG2A 2CG1A 1M1XB 2IA7A 2ML5A 4N6OB 5JBSA 5HGRA 2XH9A 3SVAA 1VQO3 4NREA 1S723 3L0RA 1IQ8A 3EJVA 4FCMA 3EX9A 1SIHA 4Q53A 3S29A 3I553 1W7CA 4XDWA 1GYBA 4BTWA 3FGYA 2HMOB 5IG4A 1KSIA 2RCDA 1C7HA 1US1A 2FNQA 4XM4A 1VQ83 2OQEC 3B8LA 4L8OA 5AIGA 1VQ43 2W56B 4FCJA 1OACA 4EV2A 3JUNA 2B1XB 3DM8A 4XB5A 5I97A 5AEWB 1LXEA 2FGTA 3LTCA 5IF6A 1RN7A 3G0KA 2PNCA 4N6V0 5IENA 2GU1A 3OWSA 4N6TA 4OK0A 1YHQ3 1N8QA 2C11A 3FZWA 2CK3H 4H3UA 5AYRB 1GD4A 3UL6A 4KZ1A 3NHXA 5CK6A 1YJN3 1FGTA 3LT8A 1SQWA 3T0UA 4XBXA 2LYXA 3WA2X 1IQXA 2CFDA 4FMAA 3BNCA 3OV4A 5STDA 4WYKB 3CCM3 2IMJA 1VZZA 3LTAA 2CFLA 3X40A 1N9JA 1FGQA 1IU7A 3GZBA 2GBXB 4LEHA 3F14A 2YFIB 1UUWB 2XEPA 3FKAA 4WFOA 1OHOA 2RSXA 3VGNA 1VQN3 2OTJ3 4HZ9B 5BXQA 1AV4A 5IW9A 4R4KA 3EN8A 3K7CA 4O2HA 1OGXA 1M904 5CF2A 1QALA 4R9KA 3IMAB 2BO9B 1AVLA 4HZBB 2CIUA 3K63A 1OF5A 3DGMA 4FR9A 1WMPA 5ELJA 3ROBA 2MC8A 3U97A 4CDLA 1IT8A 3S28A 4STDA 3QK9A 1GS3A 1DMQA 1Q824 4H61A 3E99A 4U13A 1G96A 1VQK3 3NV0A 3DUKA 1PU4A 1DMMA 4EXRA 1O7PB 2W56A 2QEX3 3MKIA 1SJWA 1QAFA 4XDVA 3F8XA 3O8YA 1IVVA 3CNXA 3F7XA 2OWPA 3K9MC 2P09A 1K9M4 4HM3B 3OXAA 2F99A 3UNLA 2Q07A 2E2VA 2CG0A 3N8BA 2JQ5A 2A15A 2W9PA 1SPUA 3LH4A 1YIT3 1EKMA 3FG4A 3RGRA 2QGUA 3S5CA 3FG3A 1O7GB 2GBWB 2HMKB 3DMCA 3F7SA 3FLJA 4N6UA 5IERA 3UB1A 1J2BA 1W01A 3CU3A 4G1MB 1UI8A 3KSED 1W6CA 2CWTA 2E2TA 3PZWA 5DRVA 2F86B 2M7OA 2W9QA 3EN1B 4K90B 4L8PA 5JPUA 1VQ93 4EBGA 1TIJA 4OVMA 3CCS3 1NB3I 1YJW3 3G713 5KP3A 5IG3A 2WOFA 1YJ93 3T8NA 1RRHA 1W5ZA 2BHMA 2RGQA 3IJEB 3WMDA 3FF2A 4HM4B 2OTL3 1O7NB 1AVKA 2XRXB 1JB4A 1LNHA 3SOAA 2Y74A 1OF5B 4MMXB 4MMYB 4NHFA 3FH1A 1LVNA 4KFEA 1QMAA 4PEJA 4EV5A 5AI1A 3PS8A 1D6UA 1FGOA 1IDPA 1JNQA 3GZXB 4AKZA 2D42A 1KWIA 4RZMA 3NM7A 2HMLB 3NBRA 3S27A 4O8SA 3CXC2 1FGMA 3AMOB 4X2OA 3UJMA 3WA3A 4WWUC 1TFOA 1QJGA 1A2KA 1N9EA 2F98A 2XGNA 3NV0B 4HKVB 4LGQA 4WP5A 1ZX2A 2P0MA 3MHEA 4EYCA 1VQL3 1R4CA 2PZVA 3BNBA 5A0OB 3LZAA 3CPOA 3FSDA 1PFPA 2Z7AA 5KP1A 1HU9A 4JF8A 3SLUA 3EHCA 4ORLA 3GWRA 3B7CA 1WNHA 1N5PA 1VQM3 2STDA 3N54B 3MG1A 2FXTA 1K28A 1Q40B 1KC84 1IVUA 3CCU3 1IK3A 1IV9A 1D6YA 3CC23 1VQP3 5LC6A 3NM2A 3WODG 3V99A 3MWZA 1KD14 1EA2A 2JDIH 3M8CA 3Q90A 2GEXA 1JN5A 2GEYA 5LC7A 1GY6A 3GAXA 3X3ZA 2W6JH 3KKGA 1K8A4 1ISKA 1STDA 1N8R4 1DYUA 5EQLA 1SIIA 1IT7A 1CQSA 4HVNA 4FMBA 4OUQA 4HM1B 3VF1A 3V92A 3CD63 3GRDA 1OHSA 2OCTA 1TFKA 3CCL3 5D83A 1MNLA 3CCJ3 3ECFA 1ZO2A 3B4OA 4JRFA 3DXOA 1U5OA 2O9UX 1UI7A 3WDGB 3BNEA 3JVCA 2BNGA 1W00A 3ALAA 2Y73A 2KCDA 2R4IA 3EF8A 3FCSB 2GXFA 5ELUA 1EQKA 2WO0A 4MEIA 3KIIA 3AMOA 1E3RA 1YGEA 3MSOA 1F8NA 1OCVA 5D82A 5FW5A 5IG5A 3CCR3 1JKGB 5EVHA 4FCZA 3EE1A 4J9AA 4O02B 1WTHA 2L4VA 2BMRB 4LZIA 2KRTA 2CFKA 1K734 2YX9A 2XSHB 2MF7A 3KN4A 5JPPA 1A67A 4HM0B 1QAKA 3DZLA 4KFFA 3JUOA 3DGLA 4KVHA 1WMNA 1W2B2 1WMOA 1D6ZA 4RNZA 3V98A 3PCSA 1Y4KA 1Q40A 4IIAA 4HM6B 3OW22 3NBBA 2BMOB 3J7Yd 1NU3A 3SX1A 4IT7A 4KFDA 2OOVA 1JN5B 2HMJB 1ROAA 1O7MB 3LTDA 4XBYA 3JUMA 1RRLA 3HX8A 3NBJA 1N5HA 1W4NA 3QRDA 1NO3A 2CKFB 5AYSC 1Q814 5IEPA 3HIGA 4K1UA 3S67A 4R80A 5CXOA 5TGNA 2W04A 1IQYA 3MG3A 2CWUA 1QVG2 3NUVA 1VQ53 5IEOA 3U1WA 5CF1A 2XF3A 3I0YA 1O7WB 1E3VA 3CCQ3 1NB5I 1VQ73 2KXGA 3EBTA 8CHOA 3EBYA 1GY7A 4FMDA 3WOEB 2HMMB 2HMNB 3UL5A 3CMA3 4GL6A 2ZDJA 2W2CA 1OHPA 1DVCA 2BT3A 1O7HB 2Z6BA 3LXUX 3G6E3 1TP6A 3CPW2 2LQVA 3NXJA 1M9GA 1W02A 5AIIA 1JKGA 2XGLA 3LTBA 1YVBI 4HBRA 1Q864 1JB2A 3NX0A 3X3YA 1NJI4 2W03A 2E2UA 4RBNA 2YFJB 3N9HA 1A2VA 3CC43 3I563 3ER7A 3STDA 1JRQA 1Q42A 3JUQA 5D81A 1UUVB 2XSOB 2WOHA 2OOVC 3F9SA 5KP4A 3HI7A 1CYUA 1IVXA 4HM8B 2P05A 3Q2PA 4MMZB 3X3XA 2XFTA 3LOYA 3KFQC 4R1KA 1JB5A 1DMNA 3HK4A 3G8ZA 2Z77A 1A90A 4K1VA 2Z76A 4L7KA 2CFWA 3RDEA 4EC6A 2K0MA 4RNYA 3IPTA 4FMCA 3TDGA 4N3VA 3HZPA 2O3OA 4HJLB 3CCE3 4N6LA 1WQLB 3SOYA 1GY5A 3SEDA 3BB9A 1W2ZA 3MYTA 1OUNA 1M1K4 2ZL8A 1ULJB 3PXMA 5AIHA 2V1LA 3CCV3 1S5AA 3SXXA 1CYVA 1L5GB 7STDA 3EC9A 1IVWA 3OWYA 4N6MA 1KQS2 3FG1A 1E97A 1Q7Y4 1OPYA 3JUPA 3LT9A 1LOXA 3NQZA 5DREA 5FGOA 4HYZA 3PYJA 2QIYA 4I4KA 1IV7A 4X2HA 1OH0A 3EQQB 1W6YA 3OWUA 4K61A 4HM2B 3K0ZA 2RFRA 1UW1A 1K41A 1YI23 3LYGA 3CME3 2I9WA 4XBTA 6STDA 3BNDA 2CFGA 4IPBA 2IUKA 3DGOA 1JJ22 1EG9B 4WHAA 5CLKA 1ULIB 1GD3A 4BTXA 1VQ63 2CW9A 2D1WA 3NQYA 2CHCA 5AIFA 3GZRA 3H3HA 4ZM8A 3EB8A 1ASKA 3T8UA 5G2GA 1TUHA 3G4S3 4LSOA 2W0QA 4O3VA 2CC3A 5BVBA 1FA3A 1QVF2 2ML6A 1STFI 2CH9A 3KZTA 3CC73 2WGOA 1FGRA 3X42A 4GB5A 2UX0A 1RKYA 3LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZY B;  3G16 A;  3BLZ A;  1HKX A;  4HM7 B;  4R9L A;  1Z1S A;  1BUQ A;  3F40 A;  4LMI A;  1OGZ A;  3F8H A;  4MJD A;  2INX A;  2BMQ B;  3KE7 A;  4J8T A;  3RGA A;  3A76 A;  3FF0 A;  2YFL B;  3OX9 A;  3CNM A;  3KSP A;  1NWW A;  1NDO B;  3D9R A;  3VSY A;  4WYK A;  5AEU B;  2XR8 B;  1AR0 A;  4HM5 B;  3B4P A;  2K54 A;  3H51 A;  2B24 B;  5IG0 A;  3MG2 A;  5HGR A;  4FCM A;  3EJV A;  3EX9 A;  4Q53 A;  4XDW A;  1GYB A;  3FGY A;  2HMO B;  5IG4 A;  2RCD A;  1C7H A;  4XM4 A;  3B8L A;  4L8O A;  5AIG A;  4FCJ A;  3JUN A;  2B1X B;  3DM8 A;  4XB5 A;  5AEW B;  5IF6 A;  3G0K A;  5IEN A;  3OWS A;  3FZW A;  4H3U A;  3NHX A;  5CK6 A;  4XBX A;  3OV4 A;  5STD A;  4WYK B;  2IMJ A;  1VZZ A;  3GZB A;  2GBX B;  4LEH A;  3F14 A;  2YFI B;  1UUW B;  3FKA A;  1OHO A;  3VGN A;  4HZ9 B;  5BXQ A;  3EN8 A;  3K7C A;  1OGX A;  5CF2 A;  4R9K A;  4HZB B;  1OF5 A;  3ROB A;  4CDL A;  4STD A;  1GS3 A;  1DMQ A;  3E99 A;  4U13 A;  3NV0 A;  3DUK A;  1DMM A;  1O7P B;  3MKI A;  1SJW A;  4XDV A;  3F8X A;  3CNX A;  3F7X A;  2OWP A;  4HM3 B;  3OXA A;  2F99 A;  3UNL A;  2JQ5 A;  2A15 A;  3RGR A;  2QGU A;  3S5C A;  1O7G B;  2GBW B;  2HMK B;  3DMC A;  3F7S A;  3FLJ A;  5IER A;  1W01 A;  3CU3 A;  5DRV A;  2F86 B;  3EN1 B;  4L8P A;  5JPU A;  4OVM A;  5KP3 A;  5IG3 A;  3T8N A;  2RGQ A;  3WMD A;  3FF2 A;  4HM4 B;  1O7N B;  2XRX B;  1JB4 A;  3SOA A;  1OF5 B;  3FH1 A;  1QMA A;  4PEJ A;  5AI1 A;  1IDP A;  3GZX B;  4RZM A;  2HML B;  3NBR A;  4X2O A;  3UJM A;  4WWU C;  4HKV B;  1QJG A;  1A2K A;  2F98 A;  3NV0 B;  4WP5 A;  4LGQ A;  1ZX2 A;  3MHE A;  2PZV A;  3LZA A;  3CPO A;  3FSD A;  2Z7A A;  5KP1 A;  3EHC A;  4ORL A;  3GWR A;  3B7C A;  2STD A;  3MG1 A;  1Q40 B;  3NM2 A;  1EA2 A;  3M8C A;  3Q90 A;  2GEX A;  1JN5 A;  2GEY A;  1GY6 A;  3KKG A;  1ISK A;  1STD A;  1CQS A;  4HVN A;  4OUQ A;  4HM1 B;  3GRD A;  1OHS A;  5D83 A;  3ECF A;  1ZO2 A;  3B4O A;  3DXO A;  1U5O A;  2BNG A;  1W00 A;  2R4I A;  3EF8 A;  2GXF A;  1E3R A;  3MSO A;  1OCV A;  5D82 A;  5FW5 A;  5IG5 A;  1JKG B;  5EVH A;  4J9A A;  2BMR B;  2XSH B;  5JPP A;  4HM0 B;  3DZL A;  3JUO A;  4KVH A;  1Q40 A;  4IIA A;  4HM6 B;  2BMO B;  1NU3 A;  1JN5 B;  2HMJ B;  1O7M B;  4XBY A;  3JUM A;  3HX8 A;  2CKF B;  5IEP A;  4K1U A;  5TGN A;  5CXO A;  3MG3 A;  3NUV A;  5IEO A;  5CF1 A;  3I0Y A;  1O7W B;  1E3V A;  3EBT A;  8CHO A;  3EBY A;  1GY7 A;  2HMM B;  2HMN B;  2W2C A;  1OHP A;  1O7H B;  1TP6 A;  3NXJ A;  5AII A;  1W02 A;  1JKG A;  1JB2 A;  2YFJ B;  3ER7 A;  3STD A;  1Q42 A;  3JUQ A;  5D81 A;  1UUV B;  2XSO B;  3F9S A;  5KP4 A;  4HM8 B;  4R1K A;  1JB5 A;  1DMN A;  3HK4 A;  3G8Z A;  2Z77 A;  4K1V A;  2Z76 A;  4L7K A;  3IPT A;  4N3V A;  3HZP A;  4HJL B;  1WQL B;  3SOY A;  1GY5 A;  3SED A;  3BB9 A;  3MYT A;  1OUN A;  1ULJ B;  5AIH A;  1S5A A;  7STD A;  3EC9 A;  3OWY A;  1E97 A;  1OPY A;  3JUP A;  5DRE A;  2QIY A;  4I4K A;  4X2H A;  1OH0 A;  3EQQ B;  1W6Y A;  3OWU A;  4HM2 B;  3K0Z A;  2RFR A;  1K41 A;  3LYG A;  2I9W A;  4XBT A;  6STD A;  1EG9 B;  5CLK A;  1ULI B;  5AIF A;  2CHC A;  3GZR A;  3H3H A;  1ASK A;  3T8U A;  5G2G A;  1TUH A;  5BVB A;  3KZT A;  4GB5 A;  2UX0 A; 
#chains in the Genus database with same CATH topology
 3GZY B;  1PYL A;  3G16 A;  3BLZ A;  2OQE A;  4AEQ A;  3X41 A;  1TU5 A;  3MPH A;  1T5Y A;  1BIR A;  1T3B A;  1HKX A;  1R4Y A;  1TRP A;  4HM7 B;  4R9L A;  1Z1S A;  4CCV A;  3F40 A;  1BUQ A;  3Q1C A;  3HII A;  3PGB A;  4LMI A;  1RDS A;  2P0X A;  2QA4 3;  1OGZ A;  3F8H A;  1LOW A;  4MJD A;  1YIJ 3;  1JV2 B;  2INX A;  2BMQ B;  3KE7 A;  4TX4 A;  2P38 A;  4J8T A;  3RGA A;  3DGN A;  1V74 A;  1T2H A;  1X1X A;  3A76 A;  1FUW A;  3FF0 A;  1RN4 A;  3D3L A;  2IYJ A;  3WOF B;  2WGQ A;  2YFL B;  1I3F A;  3OX9 A;  3CNM A;  1CEW I;  3KSP A;  1TJD A;  1U8C B;  1NWW A;  1NDO B;  3D9R A;  4AKY A;  3K5T A;  4CPK A;  3VSY A;  4WYK A;  5AEU B;  3PCR A;  2IUJ A;  5RNT A;  2C10 A;  2XR8 B;  5BIR A;  1MOL A;  4N6N B;  3DY5 A;  1AY7 A;  2GU3 A;  5EEO A;  1AR0 A;  1ROV A;  2CWV A;  4J5G A;  1I2F A;  4QWT A;  1DVD A;  4HM5 B;  1W6G A;  3B4P A;  2K54 A;  1V57 A;  2XFS A;  3H51 A;  2B24 B;  4BTY A;  2SBL A;  5IG0 A;  1HYF A;  1RN1 A;  1RNB A;  1RJO A;  1X1W A;  3MG2 A;  2CG1 A;  1JZD A;  1BRJ A;  1M1X B;  2IA7 A;  2ML5 A;  5JPP A;  1ZS7 A;  4N6O B;  5JBS A;  5HGR A;  1JBR A;  2XH9 A;  3SVA A;  1VQO 3;  4NRE A;  1V58 A;  2F56 A;  1S72 3;  3L0R A;  1IQ8 A;  3EJV A;  4FCM A;  3EX9 A;  1SIH A;  4Q53 A;  3S29 A;  3I55 3;  1W7C A;  1GOY A;  4XDW A;  1GYB A;  4BTW A;  3FGY A;  2HMO B;  5IG4 A;  1X1Y A;  5M19 A;  1KSI A;  1LNI A;  2RCD A;  1C7H A;  1US1 A;  2FNQ A;  4XM4 A;  1VQ8 3;  1JBS A;  2OQE C;  2SAR A;  3B8L A;  2IY2 A;  4L8O A;  5AIG A;  1VQ4 3;  2W56 B;  4FCJ A;  1OAC A;  4EV2 A;  3JUN A;  1Q9E A;  2B1X B;  3DM8 A;  1PY3 A;  4XB5 A;  7RNT A;  5AEW B;  1LXE A;  2FGT A;  3LTC A;  5I97 A;  4NPB A;  5IF6 A;  1RN7 A;  1BGS A;  1FUT A;  2PNC A;  3G0K A;  4N6V 0;  4AKZ A;  5IEN A;  2GU1 A;  1A67 A;  1I2E A;  1UDI I;  1B2U A;  1B2M A;  3OWS A;  4N6T A;  4OK0 A;  1YHQ 3;  1N8Q A;  2C11 A;  3FZW A;  1I2G A;  2CK3 H;  4H3U A;  5AYR B;  1GD4 A;  3UL6 A;  4KZ1 A;  3NHX A;  5CK6 A;  1YJN 3;  1FGT A;  1G0T A;  1SQW A;  3LT8 A;  4XBX A;  3T0U A;  2LYX A;  3WA2 X;  1IQX A;  4KT3 B;  2CFD A;  4FMA A;  3BNC A;  3OV4 A;  1BNE A;  5STD A;  1IYY A;  4WYK B;  2F5M A;  1BUJ A;  4RNT A;  3CCM 3;  2IMJ A;  1VZZ A;  1BRN L;  3LTA A;  2CFL A;  2R41 A;  3X40 A;  1BOX A;  1N9J A;  1FGQ A;  1IU7 A;  3GZB A;  2GBX B;  4LEH A;  3F14 A;  4BIR A;  2YFI B;  3HOH A;  1UUW B;  2XEP A;  3FKA A;  4WFO A;  1C54 A;  1BAO A;  1OHO A;  2RSX A;  3VGN A;  1VQN 3;  2OTJ 3;  1RSN A;  3GSP A;  4HZ9 B;  5BXQ A;  1AV4 A;  1BNG A;  1BNI A;  3AHS A;  5IW9 A;  1BRH A;  4R4K A;  3EN8 A;  3K7C A;  4O2H A;  1OGX A;  1M90 4;  2ZA4 A;  5CF2 A;  1MWT A;  1QAL A;  4R9K A;  3IMA B;  2BO9 B;  1AVL A;  3CXC 2;  4HZB B;  2CIU A;  3K63 A;  1OF5 A;  1B27 A;  3DGM A;  1I3I A;  1UGH I;  4FR9 A;  1WMP A;  5ELJ A;  3ROB A;  2MC8 A;  3U97 A;  4CDL A;  1IT8 A;  3S28 A;  1BU4 A;  4STD A;  3QK9 A;  1GS3 A;  1DMQ A;  2KF4 A;  1Q82 4;  4H61 A;  1BSD A;  3E99 A;  4U13 A;  1G96 A;  1VQK 3;  3NV0 A;  3DUK A;  1PU4 A;  1DMM A;  4EXR A;  1O7P B;  2W56 A;  1FYS A;  2QEX 3;  3MKI A;  1G02 A;  1SJW A;  1QAF A;  6RNT A;  4XDV A;  3F8X A;  1VQQ A;  1FUS A;  4LYL B;  3O8Y A;  1IVV A;  3CNX A;  1RGL A;  3F7X A;  2OWP A;  3K9M C;  2P09 A;  1K9M 4;  4HM3 B;  3OXA A;  2F99 A;  1UCL A;  2Q07 A;  3UNL A;  2E2V A;  2CG0 A;  1LRA A;  3N8B A;  1RLS A;  2JQ5 A;  4HOH A;  2A15 A;  2W9P A;  1SPU A;  3LH4 A;  4HAA A;  7GSP A;  1YIT 3;  1EKM A;  3FG4 A;  3RGR A;  1B20 A;  2QGU A;  3S5C A;  3FG3 A;  1O7G B;  2GBW B;  2HMK B;  3DMC A;  3F7S A;  4CJN A;  3FLJ A;  4N6U A;  5IER A;  3UB1 A;  1J2B A;  1W01 A;  3CU3 A;  4G1M B;  1UI8 A;  3KSE D;  1W6C A;  2CX1 A;  2CWT A;  1MGW A;  5BU4 A;  1JBT A;  1B3S A;  2E2T A;  3PZW A;  5DRV A;  2F86 B;  2M7O A;  1RCL A;  2W9Q A;  3EN1 B;  4K90 B;  4L8P A;  5JPU A;  1VQ9 3;  1LQM B;  4EBG A;  1TIJ A;  4OVM A;  3CCS 3;  1NB3 I;  3BU4 A;  1YJW 3;  3G71 3;  1UCI A;  5KP3 A;  5IG3 A;  2WOF A;  1YJ9 3;  1TRQ A;  2CX0 A;  1ZGX A;  3T8N A;  1RRH A;  1W5Z A;  2BHM A;  2RGQ A;  3IJE B;  3WMD A;  3FF2 A;  4HM4 B;  2OTL 3;  1O7N B;  1AVK A;  2XRX B;  1JB4 A;  1LNH A;  3SOA A;  2Y74 A;  1OF5 B;  4MMX B;  4MMY B;  2HOH A;  4NHF A;  3FH1 A;  1LVN A;  4KFE A;  1QMA A;  3D79 A;  4PEJ A;  4EV5 A;  5AI1 A;  3PS8 A;  1D6U A;  1FGO A;  1IDP A;  1JNQ A;  1MWU A;  1BSB A;  2D42 A;  1KWI A;  3GZX B;  3NM7 A;  2HML B;  3NBR A;  4RZM A;  4O8S A;  3S27 A;  1FGM A;  3SYU A;  3AMO B;  4X2O A;  3UJM A;  3WA3 A;  4WWU C;  1TFO A;  1QJG A;  1A2K A;  1N9E A;  2F98 A;  2XGN A;  3NV0 B;  1BRI A;  4HKV B;  4LGQ A;  1ZX2 A;  2P0M A;  3MHE A;  4WP5 A;  4EYC A;  1GSP A;  1LOY A;  1VQL 3;  1R4C A;  2PZV A;  3BNB A;  5A0O B;  3LZA A;  3CPO A;  3FSD A;  1PFP A;  2Z7A A;  2F4Y A;  1HU9 A;  5KP1 A;  4JF8 A;  3SLU A;  3D5I A;  3EHC A;  4ORL A;  3GWR A;  3B7C A;  1WNH A;  1N5P A;  1GOU A;  1VQM 3;  2RBI A;  2STD A;  1TTO A;  4BU4 A;  3N54 B;  3MG1 A;  2FXT A;  1BSE A;  1K28 A;  1Q40 B;  1KC8 4;  1IVU A;  3CCU 3;  1IK3 A;  1IV9 A;  1D6Y A;  5GSP A;  3CC2 3;  5LC6 A;  3NM2 A;  1VQP 3;  3WOD G;  3V99 A;  3MWZ A;  6GSP A;  1KD1 4;  1EA2 A;  2JDI H;  3M8C A;  3Q90 A;  2GEX A;  1JN5 A;  2GEY A;  3BIR A;  5LC7 A;  4EW5 A;  4GSP A;  2KF5 A;  1GY6 A;  2ZHX B;  3AHW A;  1BAN A;  2L1S A;  3GAX A;  2W6J H;  3KKG A;  3X3Z A;  1K8A 4;  1ISK A;  1STD A;  2RNT A;  1N8R 4;  1DYU A;  5EQL A;  5G1L A;  5HOH A;  1X1U A;  1SII A;  1IT7 A;  1CQS A;  2K3D A;  4HVN A;  4FMB A;  4OUQ A;  4HM1 B;  1GMQ A;  3VF1 A;  3V92 A;  1AQZ A;  3GRD A;  3CD6 3;  1OHS A;  2OCT A;  1MWR A;  1T2I A;  1TFK A;  3CCL 3;  5D83 A;  1MNL A;  3ZFZ A;  3CCJ 3;  3ECF A;  1ZO2 A;  3B4O A;  1RHL A;  1UCK A;  1RCK A;  4JRF A;  3ZG0 A;  3DXO A;  1RGC A;  1U5O A;  2UUG C;  2O9U X;  1UI7 A;  3WDG B;  1GMR A;  3BNE A;  3JVC A;  2BNG A;  1UGI A;  1W00 A;  2Y73 A;  3ALA A;  2KCD A;  2R4I A;  3EF8 A;  3FCS B;  1RNT A;  2GXF A;  5ELU A;  1EQK A;  2WO0 A;  4MEI A;  3KII A;  3AMO A;  1E3R A;  1YGE A;  3MSO A;  1F8N A;  1OCV A;  5D82 A;  5FW5 A;  5IG5 A;  3CCR 3;  1JKG B;  1I0V A;  5EVH A;  4FCZ A;  3EE1 A;  2BIR A;  4J9A A;  4O02 B;  8RNT A;  1WTH A;  2L4V A;  1RGH A;  2BMR B;  4LZI A;  2KRT A;  2CFK A;  1BSA A;  3DGY A;  1K73 4;  2YX9 A;  1EEJ A;  2J8X B;  2MF7 A;  2XSH B;  3D4A A;  3KN4 A;  1QAK A;  3DZL A;  1BNF A;  3JUO A;  4HM0 B;  1B2Z A;  3DGL A;  1EUI C;  4J5K A;  4KFF A;  3KCH A;  4KVH A;  1WMN A;  1BNJ A;  1UUG B;  1WMO A;  1D6Z A;  5G1K A;  4RNZ A;  1GMP A;  1W2B 2;  3V98 A;  3PCS A;  1RGE A;  1Y4K A;  1Q40 A;  4IIA A;  9RNT A;  4HM6 B;  3OW2 2;  1YVS A;  3NBB A;  2BMO B;  3J7Y d;  1NU3 A;  3SX1 A;  2KF6 A;  4IT7 A;  4KFD A;  1JN5 B;  2HMJ B;  1ROA A;  2OOV A;  1O7M B;  3LTD A;  4XBY A;  3JUM A;  1RRL A;  3HX8 A;  1MWS A;  1N5H A;  1W4N A;  3NBJ A;  3QRD A;  1NO3 A;  2CKF B;  5AYS C;  1Q81 4;  5IEP A;  1BRG A;  3HIG A;  4K1U A;  3S67 A;  4R80 A;  5CXO A;  5TGN A;  2W04 A;  1IQY A;  3MG3 A;  2CWU A;  1QVG 2;  3NUV A;  1VQ5 3;  5IEO A;  3U1W A;  5CF1 A;  1LQG C;  2XF3 A;  1O7W B;  1E3V A;  1HZ1 A;  3I0Y A;  1JZO A;  4BL2 A;  3CCQ 3;  1B2X A;  1NB5 I;  1VQ7 3;  2KXG A;  3EBT A;  8CHO A;  2C4B A;  3EBY A;  1GY7 A;  1NNV A;  1RGG A;  4FMD A;  1BNR A;  1B2S A;  3WOE B;  2HMM B;  2HMN B;  3UL5 A;  3CMA 3;  3ZG5 A;  4GL6 A;  2ZDJ A;  2W2C A;  2H0I A;  1MGR A;  1OHP A;  1GOV A;  1DVC A;  1Q7H A;  3WHO A;  3A5E A;  2BT3 A;  1O7H B;  2Z6B A;  3LXU X;  3G6E 3;  1TP6 A;  3CPW 2;  2LQV A;  3NXJ A;  1I8V A;  1M9G A;  1W02 A;  2UGI A;  5AII A;  1JKG A;  2XGL A;  3AGO A;  1CH0 A;  1YVB I;  3LTB A;  4HBR A;  5M1A A;  2F5W A;  1Q86 4;  1JB2 A;  3NX0 A;  3X3Y A;  1NJI 4;  2AAE A;  2W03 A;  1DE3 A;  2E2U A;  4RBN A;  2YFJ B;  3N9H A;  1YGW A;  1A2V A;  3CC4 3;  3I56 3;  3ER7 A;  3STD A;  1JRQ A;  1Q42 A;  3JUQ A;  5D81 A;  1UUV B;  2XSO B;  1RGA A;  2OOV C;  2WOH A;  3F9S A;  5KP4 A;  3HI7 A;  4ILF A;  2BU4 A;  1CYU A;  1IVX A;  1BSC A;  3RNT A;  4HM8 B;  2P05 A;  1A2P A;  3Q2P A;  4MMZ B;  2XFT A;  3X3X A;  3LOY A;  2AAD A;  3KFQ C;  4R1K A;  1JB5 A;  1DMN A;  3HK4 A;  3G8Z A;  2Z77 A;  1A90 A;  4K1V A;  2Z76 A;  4L7K A;  2CFW A;  3RDE A;  4EC6 A;  1BNS A;  1UCJ A;  2K0M A;  4RNY A;  3IPT A;  4FMC A;  3TDG A;  4N3V A;  3HZP A;  2O3O A;  4HJL B;  2KAA A;  3CCE 3;  1I0X A;  4N6L A;  1WQL B;  3SOY A;  3URP A;  1GY5 A;  3DH2 A;  3SED A;  2H0H A;  1RTU A;  3BB9 A;  1W2Z A;  3MYT A;  4I5Q A;  1OUN A;  1M1K 4;  2ZL8 A;  1B21 A;  1SAR A;  1ULJ B;  3PXM A;  4GHO A;  2V1L A;  5AIH A;  3CCV 3;  1BRS A;  1S5A A;  3SXX A;  1CYV A;  1L5G B;  7STD A;  3D5G A;  3EC9 A;  1IVW A;  4BL3 A;  3OWY A;  1DET A;  4N6M A;  1KQS 2;  3FG1 A;  1E97 A;  1Q7Y 4;  1OPY A;  1BRK A;  3JUP A;  1LOX A;  3LT9 A;  3NQZ A;  5DRE A;  5FGO A;  4HYZ A;  3Q3F A;  3PYJ A;  2QIY A;  4I4K A;  1IV7 A;  1FW7 A;  4X2H A;  1OH0 A;  3EQQ B;  3AGN A;  1W6Y A;  3OWU A;  4K61 A;  2GSP A;  4HM2 B;  2KF3 A;  3K0Z A;  2RFR A;  1UW1 A;  1K41 A;  1YNV X;  1YI2 3;  3LYG A;  3CME 3;  2I9W A;  4XBT A;  6STD A;  3BND A;  2CFG A;  2H0G A;  2IUK A;  4IPB A;  3DGO A;  1JJ2 2;  1EG9 B;  4WHA A;  5CLK A;  1I70 A;  1ULI B;  1GD3 A;  4BTX A;  3WR2 A;  1VQ6 3;  2CW9 A;  2D1W A;  3NQY A;  2CHC A;  5AIF A;  3GZR A;  3H3H A;  4ZM8 A;  3EB8 A;  1ASK A;  1RGK A;  5G2G A;  3T8U A;  1TUH A;  3G4S 3;  1BVI A;  4LSO A;  2W0Q A;  4O3V A;  2CC3 A;  5BVB A;  1FA3 A;  4DKI A;  1QVF 2;  2ML6 A;  1STF I;  2CH9 A;  3KZT A;  1FZU A;  1LOV A;  3CC7 3;  2WGO A;  1FGR A;  1RMS A;  3X42 A;  1RGF A;  4GB5 A;  5M18 A;  2UX0 A;  1RKY A;  3LML A; 
#chains in the Genus database with same CATH homology
 3GZY B;  3G16 A;  3BLZ A;  2OQE A;  4AEQ A;  3X41 A;  1TU5 A;  3MPH A;  1T5Y A;  1HKX A;  4HM7 B;  4R9L A;  1Z1S A;  4CCV A;  3F40 A;  1BUQ A;  3Q1C A;  3HII A;  3PGB A;  4LMI A;  2P0X A;  2QA4 3;  1OGZ A;  3F8H A;  4MJD A;  1YIJ 3;  1JV2 B;  2INX A;  2BMQ B;  3KE7 A;  4TX4 A;  2P38 A;  4J8T A;  3RGA A;  3DGN A;  1V74 A;  3A76 A;  1FUW A;  3FF0 A;  3D3L A;  3WOF B;  2WGQ A;  2YFL B;  3OX9 A;  3CNM A;  1CEW I;  3KSP A;  1U8C B;  1NWW A;  1NDO B;  3D9R A;  4AKY A;  3K5T A;  3VSY A;  4WYK A;  5AEU B;  3PCR A;  2IUJ A;  2C10 A;  2XR8 B;  1MOL A;  4N6N B;  3DY5 A;  2GU3 A;  5EEO A;  1AR0 A;  1ROV A;  2CWV A;  4QWT A;  1DVD A;  4HM5 B;  1W6G A;  3B4P A;  2K54 A;  3H51 A;  2XFS A;  4BTY A;  2B24 B;  2SBL A;  5IG0 A;  1RJO A;  3MG2 A;  2CG1 A;  1M1X B;  2IA7 A;  2ML5 A;  4N6O B;  5JBS A;  5HGR A;  2XH9 A;  3SVA A;  1VQO 3;  4NRE A;  1S72 3;  3L0R A;  1IQ8 A;  3EJV A;  4FCM A;  3EX9 A;  1SIH A;  4Q53 A;  3S29 A;  3I55 3;  1W7C A;  4XDW A;  1GYB A;  4BTW A;  3FGY A;  2HMO B;  5IG4 A;  1KSI A;  2RCD A;  1C7H A;  1US1 A;  2FNQ A;  4XM4 A;  1VQ8 3;  2OQE C;  3B8L A;  4L8O A;  5AIG A;  1VQ4 3;  2W56 B;  4FCJ A;  1OAC A;  4EV2 A;  3JUN A;  2B1X B;  3DM8 A;  4XB5 A;  5I97 A;  5AEW B;  1LXE A;  2FGT A;  3LTC A;  5IF6 A;  1RN7 A;  3G0K A;  2PNC A;  4N6V 0;  5IEN A;  2GU1 A;  3OWS A;  4N6T A;  4OK0 A;  1YHQ 3;  1N8Q A;  2C11 A;  3FZW A;  2CK3 H;  4H3U A;  5AYR B;  1GD4 A;  3UL6 A;  4KZ1 A;  3NHX A;  5CK6 A;  1YJN 3;  1FGT A;  3LT8 A;  1SQW A;  3T0U A;  4XBX A;  2LYX A;  3WA2 X;  1IQX A;  2CFD A;  4FMA A;  3BNC A;  3OV4 A;  5STD A;  4WYK B;  3CCM 3;  2IMJ A;  1VZZ A;  3LTA A;  2CFL A;  3X40 A;  1N9J A;  1FGQ A;  1IU7 A;  3GZB A;  2GBX B;  4LEH A;  3F14 A;  2YFI B;  1UUW B;  2XEP A;  3FKA A;  4WFO A;  1OHO A;  2RSX A;  3VGN A;  1VQN 3;  2OTJ 3;  4HZ9 B;  5BXQ A;  1AV4 A;  5IW9 A;  4R4K A;  3EN8 A;  3K7C A;  4O2H A;  1OGX A;  1M90 4;  5CF2 A;  1QAL A;  4R9K A;  3IMA B;  2BO9 B;  1AVL A;  4HZB B;  2CIU A;  3K63 A;  1OF5 A;  3DGM A;  4FR9 A;  1WMP A;  5ELJ A;  3ROB A;  2MC8 A;  3U97 A;  4CDL A;  1IT8 A;  3S28 A;  4STD A;  3QK9 A;  1GS3 A;  1DMQ A;  1Q82 4;  4H61 A;  3E99 A;  4U13 A;  1G96 A;  1VQK 3;  3NV0 A;  3DUK A;  1PU4 A;  1DMM A;  4EXR A;  1O7P B;  2W56 A;  2QEX 3;  3MKI A;  1SJW A;  1QAF A;  4XDV A;  3F8X A;  3O8Y A;  1IVV A;  3CNX A;  3F7X A;  2OWP A;  3K9M C;  2P09 A;  1K9M 4;  4HM3 B;  3OXA A;  2F99 A;  3UNL A;  2Q07 A;  2E2V A;  2CG0 A;  3N8B A;  2JQ5 A;  2A15 A;  2W9P A;  1SPU A;  3LH4 A;  1YIT 3;  1EKM A;  3FG4 A;  3RGR A;  2QGU A;  3S5C A;  3FG3 A;  1O7G B;  2GBW B;  2HMK B;  3DMC A;  3F7S A;  3FLJ A;  4N6U A;  5IER A;  3UB1 A;  1J2B A;  1W01 A;  3CU3 A;  4G1M B;  1UI8 A;  3KSE D;  1W6C A;  2CWT A;  2E2T A;  3PZW A;  5DRV A;  2F86 B;  2M7O A;  2W9Q A;  3EN1 B;  4K90 B;  4L8P A;  5JPU A;  1VQ9 3;  4EBG A;  1TIJ A;  4OVM A;  3CCS 3;  1NB3 I;  1YJW 3;  3G71 3;  5KP3 A;  5IG3 A;  2WOF A;  1YJ9 3;  3T8N A;  1RRH A;  1W5Z A;  2BHM A;  2RGQ A;  3IJE B;  3WMD A;  3FF2 A;  4HM4 B;  2OTL 3;  1O7N B;  1AVK A;  2XRX B;  1JB4 A;  1LNH A;  3SOA A;  2Y74 A;  1OF5 B;  4MMX B;  4MMY B;  4NHF A;  3FH1 A;  1LVN A;  4KFE A;  1QMA A;  4PEJ A;  4EV5 A;  5AI1 A;  3PS8 A;  1D6U A;  1FGO A;  1IDP A;  1JNQ A;  3GZX B;  4AKZ A;  2D42 A;  1KWI A;  4RZM A;  3NM7 A;  2HML B;  3NBR A;  3S27 A;  4O8S A;  3CXC 2;  1FGM A;  3AMO B;  4X2O A;  3UJM A;  3WA3 A;  4WWU C;  1TFO A;  1QJG A;  1A2K A;  1N9E A;  2F98 A;  2XGN A;  3NV0 B;  4HKV B;  4LGQ A;  4WP5 A;  1ZX2 A;  2P0M A;  3MHE A;  4EYC A;  1VQL 3;  1R4C A;  2PZV A;  3BNB A;  5A0O B;  3LZA A;  3CPO A;  3FSD A;  1PFP A;  2Z7A A;  5KP1 A;  1HU9 A;  4JF8 A;  3SLU A;  3EHC A;  4ORL A;  3GWR A;  3B7C A;  1WNH A;  1N5P A;  1VQM 3;  2STD A;  3N54 B;  3MG1 A;  2FXT A;  1K28 A;  1Q40 B;  1KC8 4;  1IVU A;  3CCU 3;  1IK3 A;  1IV9 A;  1D6Y A;  3CC2 3;  1VQP 3;  5LC6 A;  3NM2 A;  3WOD G;  3V99 A;  3MWZ A;  1KD1 4;  1EA2 A;  2JDI H;  3M8C A;  3Q90 A;  2GEX A;  1JN5 A;  2GEY A;  5LC7 A;  1GY6 A;  3GAX A;  3X3Z A;  2W6J H;  3KKG A;  1K8A 4;  1ISK A;  1STD A;  1N8R 4;  1DYU A;  5EQL A;  1SII A;  1IT7 A;  1CQS A;  4HVN A;  4FMB A;  4OUQ A;  4HM1 B;  3VF1 A;  3V92 A;  3CD6 3;  3GRD A;  1OHS A;  2OCT A;  1TFK A;  3CCL 3;  5D83 A;  1MNL A;  3CCJ 3;  3ECF A;  1ZO2 A;  3B4O A;  4JRF A;  3DXO A;  1U5O A;  2O9U X;  1UI7 A;  3WDG B;  3BNE A;  3JVC A;  2BNG A;  1W00 A;  3ALA A;  2Y73 A;  2KCD A;  2R4I A;  3EF8 A;  3FCS B;  2GXF A;  5ELU A;  1EQK A;  2WO0 A;  4MEI A;  3KII A;  3AMO A;  1E3R A;  1YGE A;  3MSO A;  1F8N A;  1OCV A;  5D82 A;  5FW5 A;  5IG5 A;  3CCR 3;  1JKG B;  5EVH A;  4FCZ A;  3EE1 A;  4J9A A;  4O02 B;  1WTH A;  2L4V A;  2BMR B;  4LZI A;  2KRT A;  2CFK A;  1K73 4;  2YX9 A;  2XSH B;  2MF7 A;  3KN4 A;  5JPP A;  1A67 A;  4HM0 B;  1QAK A;  3DZL A;  4KFF A;  3JUO A;  3DGL A;  4KVH A;  1WMN A;  1W2B 2;  1WMO A;  1D6Z A;  4RNZ A;  3V98 A;  3PCS A;  1Y4K A;  1Q40 A;  4IIA A;  4HM6 B;  3OW2 2;  3NBB A;  2BMO B;  3J7Y d;  1NU3 A;  3SX1 A;  4IT7 A;  4KFD A;  2OOV A;  1JN5 B;  2HMJ B;  1ROA A;  1O7M B;  3LTD A;  4XBY A;  3JUM A;  1RRL A;  3HX8 A;  3NBJ A;  1N5H A;  1W4N A;  3QRD A;  1NO3 A;  2CKF B;  5AYS C;  1Q81 4;  5IEP A;  3HIG A;  4K1U A;  3S67 A;  4R80 A;  5CXO A;  5TGN A;  2W04 A;  1IQY A;  3MG3 A;  2CWU A;  1QVG 2;  3NUV A;  1VQ5 3;  5IEO A;  3U1W A;  5CF1 A;  2XF3 A;  3I0Y A;  1O7W B;  1E3V A;  3CCQ 3;  1NB5 I;  1VQ7 3;  2KXG A;  3EBT A;  8CHO A;  3EBY A;  1GY7 A;  4FMD A;  3WOE B;  2HMM B;  2HMN B;  3UL5 A;  3CMA 3;  4GL6 A;  2ZDJ A;  2W2C A;  1OHP A;  1DVC A;  2BT3 A;  1O7H B;  2Z6B A;  3LXU X;  3G6E 3;  1TP6 A;  3CPW 2;  2LQV A;  3NXJ A;  1M9G A;  1W02 A;  5AII A;  1JKG A;  2XGL A;  3LTB A;  1YVB I;  4HBR A;  1Q86 4;  1JB2 A;  3NX0 A;  3X3Y A;  1NJI 4;  2W03 A;  2E2U A;  4RBN A;  2YFJ B;  3N9H A;  1A2V A;  3CC4 3;  3I56 3;  3ER7 A;  3STD A;  1JRQ A;  1Q42 A;  3JUQ A;  5D81 A;  1UUV B;  2XSO B;  2WOH A;  2OOV C;  3F9S A;  5KP4 A;  3HI7 A;  1CYU A;  1IVX A;  4HM8 B;  2P05 A;  3Q2P A;  4MMZ B;  3X3X A;  2XFT A;  3LOY A;  3KFQ C;  4R1K A;  1JB5 A;  1DMN A;  3HK4 A;  3G8Z A;  2Z77 A;  1A90 A;  4K1V A;  2Z76 A;  4L7K A;  2CFW A;  3RDE A;  4EC6 A;  2K0M A;  4RNY A;  3IPT A;  4FMC A;  3TDG A;  4N3V A;  3HZP A;  2O3O A;  4HJL B;  3CCE 3;  4N6L A;  1WQL B;  3SOY A;  1GY5 A;  3SED A;  3BB9 A;  1W2Z A;  3MYT A;  1OUN A;  1M1K 4;  2ZL8 A;  1ULJ B;  3PXM A;  5AIH A;  2V1L A;  3CCV 3;  1S5A A;  3SXX A;  1CYV A;  1L5G B;  7STD A;  3EC9 A;  1IVW A;  3OWY A;  4N6M A;  1KQS 2;  3FG1 A;  1E97 A;  1Q7Y 4;  1OPY A;  3JUP A;  3LT9 A;  1LOX A;  3NQZ A;  5DRE A;  5FGO A;  4HYZ A;  3PYJ A;  2QIY A;  4I4K A;  1IV7 A;  4X2H A;  1OH0 A;  3EQQ B;  1W6Y A;  3OWU A;  4K61 A;  4HM2 B;  3K0Z A;  2RFR A;  1UW1 A;  1K41 A;  1YI2 3;  3LYG A;  3CME 3;  2I9W A;  4XBT A;  6STD A;  3BND A;  2CFG A;  4IPB A;  2IUK A;  3DGO A;  1JJ2 2;  1EG9 B;  4WHA A;  5CLK A;  1ULI B;  1GD3 A;  4BTX A;  1VQ6 3;  2CW9 A;  2D1W A;  3NQY A;  2CHC A;  5AIF A;  3GZR A;  3H3H A;  4ZM8 A;  3EB8 A;  1ASK A;  3T8U A;  5G2G A;  1TUH A;  3G4S 3;  4LSO A;  2W0Q A;  4O3V A;  2CC3 A;  5BVB A;  1FA3 A;  1QVF 2;  2ML6 A;  1STF I;  2CH9 A;  3KZT A;  3CC7 3;  2WGO A;  1FGR A;  3X42 A;  4GB5 A;  2UX0 A;  1RKY A;  3LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...