1JKGB

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna nuclear export factor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
180
Chain Sequence
b'APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFISSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 54
structure length 180
sequence length 186
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
B PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jkgB00
3WMDA 2RFRA 4IIAA 4HM1B 3F8HA 4K1UA 3ROBA 2HMMB 2XRXB 5AIIA 5IERA 4WYKA 4LMIA 8CHOA 4J9AA 2GBWB 3BB9A 3EQQB 1Q40A 1WQLB 5IG0A 2PZVA 3G8ZA 3NHXA 1ASKA 5IENA 1HKXA 4L7KA 3ER7A 2F99A 3JUOA 1BUQA 1OGZA 1EA2A 5AI1A 2IMJA 3JUQA 3GZRA 3OXAA 4WP5A 3E99A 3T8NA 4HM8B 3FH1A 4HM4B 4K1VA 3FGYA 2B24B 4R9KA 2QIYA 2HMNB 4KVHA 3NBRA 5KP4A 2HMJB 5IEPA 3SOYA 3CU3A 2XR8B 4LEHA 4XBYA 1Q42A 1QJGA 3NM2A 1JB4A 3G16A 4X2OA 4XB5A 1EG9B 3EN1B 3GRDA 4STDA 3FKAA 4HM3B 6STDA 2Z76A 3VSYA 4HVNA 3DM8A 1TP6A 3UJMA 3RGAA 3LZAA 5AEWB 3EC9A 3K0ZA 1W01A 4HZBB 5AIHA 4HZ9B 5JPUA 4R9LA 3F7SA 4L8OA 3HX8A 3LYGA 4HM2B 5IG4A 5EVHA 1AR0A 3B8LA 4I4KA 4HKVB 5AIGA 4RZMA 3GZBA 3JUNA 1E97A 2I9WA 2YFLB 3DUKA 3Q90A 4ORLA 3OX9A 1O7GB 1UUWB 2Z77A 3H51A 3B4OA 3M8CA 1O7HB 4FCMA 2R4IA 3MKIA 1OF5A 2BNGA 3OWSA 1W02A 3SEDA 1OHPA 1GYBA 4CDLA 5AIFA 3CPOA 1NU3A 1IDPA 3EX9A 3OV4A 1GY5A 1OHSA 3T8UA 5JPPA 2UX0A 1ZO2A 3B7CA 3A76A 2CHCA 1JKGA 2RCDA 5D82A 2XSHB 4H3UA 4HM5B 5DRVA 4MJDA 2BMQB 3CNXA 5KP3A 3MYTA 3G0KA 3KZTA 5FW5A 1TUHA 1QMAA 3D9RA 4PEJA 3B4PA 1DMMA 3DMCA 2GBXB 2HMKB 1ISKA 5CLKA 3HZPA 4N3VA 2BMOB 5HGRA 4XDVA 3FF0A 3NV0B 4FCJA 3FLJA 3EBTA 4OVMA 4HM0B 3KE7A 3KSPA 1GS3A 1OF5B 2GXFA 4OUQA 5BVBA 3FSDA 2W2CA 3H3HA 3MG2A 1NDOB 2YFIB 1E3VA 1C7HA 5D81A 1UUVB 4WWUC 5STDA 3S5CA 3STDA 2B1XB 1CQSA 4XBTA 2GEXA 1K41A 1OPYA 2Z7AA 1JKGB 1OHOA 2F86B 2BMRB 2K54A 3GWRA 1STDA 2A15A 4XDWA 3UNLA 1A2KA 3NV0A 1JN5B 3EN8A 1ULIB 4HJLB 3JUMA 1DMNA 3MG3A 3EJVA 4J8TA 1Z1SA 1S5AA 3ECFA 2INXA 3JUPA 4XBXA 5BXQA 2JQ5A 1DMQA 1W00A 3SOAA 2GEYA 5AEUB 7STDA 3I0YA 1JB5A 1ZX2A 4R1KA 5IG3A 5TGNA 2QGUA 5CXOA 3MSOA 3NUVA 3F14A 1JN5A 2XSOB 3F40A 3DXOA 3MG1A 4HM6B 3MHEA 5DREA 1JB2A 4L8PA 2YFJB 3KKGA 5IEOA 5G2GA 2F98A 3CNMA 5IF6A 3EBYA 5KP1A 4GB5A 1W6YA 1O7MB 3K7CA 5IG5A 2CKFB 3NXJA 1VZZA 1O7PB 4HM7B 4LGQA 3IPTA 3RGRA 3HK4A 3GZYB 1GY7A 1E3RA 3OWUA 5CF2A 4Q53A 5D83A 4U13A 3EF8A 1OUNA 3EHCA 3OWYA 3FF2A 3DZLA 2RGQA 1O7WB 3BLZA 4WYKB 5CF1A 1O7NB 3F7XA 2STDA 1Q40B 4XM4A 1U5OA 1GY6A 3F8XA 3GZXB 3F9SA 1OCVA 1ULJB 1OGXA 5CK6A 2OWPA 1OH0A 4X2HA 1SJWA 1NWWA 2HMOB 2HMLB 3FZWA 3VGNA
chains in the Genus database with same CATH superfamily
2CW9A 2D1WA 3WMDA 6RNTA 2RFRA 1CYUA 3NX0A 3QRDA 4IIAA 1QVF2 4LSOA 4HM1B 2C11A 3F8HA 3IJEB 4K1UA 3ROBA 2F56A 2HMMB 1Y4KA 2OQEC 2XRXB 5AIIA 4GL6A 1VQQA 3NBBA 5IERA 2R41A 5EQLA 1W6CA 4WYKA 2W04A 4N6LA 4LMIA 8CHOA 2H0HA 1KSIA 1LOYA 2AADA 4J9AA 1IQXA 1STFI 1SARA 1UCKA 2GBWB 2H0IA 3BB9A 2ML5A 1RNTA 3EQQB 3CCU3 1Q40A 3EB8A 1WTHA 1RRLA 2CWVA 1TIJA 1WQLB 3GSPA 5IG0A 4AEQA 1JBSA 3URPA 1IT7A 1TFKA 1BNSA 1MWTA 1I2FA 1KWIA 1UI8A 2CFKA 1AY7A 1KD14 1VQM3 1M9GA 1QALA 2LYXA 2PZVA 1AV4A 3G8ZA 2XFTA 1ASKA 2D42A 3NHXA 5GSPA 3UB1A 5IENA 1B2SA 1HKXA 2E2UA 4FMBA 4L7KA 2P0MA 1M1K4 3CC73 2CIUA 3ER7A 2F99A 3JUOA 2SARA 4IPBA 1EKMA 1BUQA 4BU4A 1N5HA 1BRKA 3K63A 1LOXA 1EA2A 1OGZA 1MGRA 2IMJA 3KN4A 5AI1A 3JUQA 5M1AA 4EW5A 3J7Yd 3CCV3 1S723 1L5GB 2CX0A 3FCSB 1LNHA 2P09A 2F5MA 3WODG 3SYUA 3DGYA 3GZRA 2CWUA 3OXAA 1BNRA 2GU3A 4WP5A 1WMNA 2K3DA 3E99A 3T8NA 2L1SA 4HM8B 1G02A 2ZA4A 4N6MA 4CJNA 1YI23 3FH1A 4HM4B 1T2IA 4K1VA 1A2PA 3FGYA 2B24B 4R9KA 1V57A 2QIYA 2HMNB 3PXMA 1LVNA 4KVHA 3NBRA 1W5ZA 4EXRA 4HOHA 5KP4A 1YIJ3 2HMJB 1FW7A 3HIIA 3SXXA 5IEPA 3I563 1BAOA 3SOYA 1DETA 1RKYA 4MMXB 3CU3A 3CC23 1JZOA 2XR8B 4BTWA 4LEHA 4XBYA 1Q42A 1QJGA 4KFEA 3X40A 1YJW3 3L0RA 3BIRA 1PU4A 1W7CA 2BU4A 1MNLA 4BL2A 3NM2A 5RNTA 1I2EA 1YHQ3 4H61A 1JB4A 3G16A 4X2OA 4XB5A 1EG9B 1I0VA 3AGOA 3EN1B 1RMSA 1CH0A 2WOFA 3GRDA 3LTAA 3SVAA 3VF1A 3X42A 1A67A 2QA43 4EC6A 4AKZA 1VQ73 1UCJA 4STDA 3FKAA 4I5QA 1N8R4 2UUGC 1CYVA 1BVIA 2ZHXB 4GHOA 3TDGA 1RCKA 2O3OA 4HM3B 1K9M4 6STDA 2Z76A 5EEOA 3VSYA 2CH9A 4HVNA 1QAKA 3DM8A 3U97A 2P05A 1TP6A 5BU4A 3UJMA 3FG3A 3RGAA 2OTL3 3HIGA 3LZAA 5AEWB 1FGMA 3EC9A 4MEIA 6GSPA 3K0ZA 1B2MA 5FGOA 1W01A 4RNZA 2Q07A 2K0MA 1TRQA 1TTOA 4HZBB 3KCHA 5AIHA 2KF5A 3Q3FA 4HZ9B 3G6E3 1RGCA 5JPUA 1BSAA 4R9LA 1X1XA 5ELUA 3F7SA 1PYLA 3CCS3 4L8OA 3HX8A 3MWZA 3LYGA 1GOUA 4HM2B 3PGBA 1RJOA 1QAFA 5IG4A 5EVHA 1AR0A 1A90A 2OQEA 4R80A 3B8LA 4OK0A 4I4KA 1ZS7A 4HKVB 3WA3A 5AIGA 2MF7A 3BNBA 3PCSA 4RZMA 3GZBA 3ZG0A 1BNEA 4EV5A 3JUNA 4GSPA 1E97A 2I9WA 4EV2A 1IT8A 1IVXA 2WGQA 4JF8A 2YFLB 1X1WA 3DUKA 3Q90A 4ORLA 4RNYA 4J5KA 3OX9A 7RNTA 1O7GB 1FGRA 4QWTA 1UUWB 1RGAA 3MPHA 2Z77A 4HBRA 3H51A 1B21A 2W6JH 3WOEB 3KFQC 1I8VA 3AMOA 3B4OA 3M8CA 2WOHA 1MGWA 1AVLA 1N5PA 1O7HB 3LTBA 2ML6A 1GMPA 2R4IA 4FCMA 4K61A 4BTXA 1BSBA 5M19A 1D6YA 3MKIA 3WA2X 1W2B2 1UCLA 1OF5A 1ZGXA 2BNGA 3OWSA 2CK3H 3OW22 1I2GA 1W02A 3SEDA 2P0XA 1OHPA 1FGTA 1GYBA 3GAXA 2CWTA 4AKYA 4CDLA 5AIFA 1LRAA 4N6OB 3LMLA 4BL3A 1T3BA 3CPOA 1NU3A 2XEPA 1VQ63 1IDPA 2KAAA 3WDGB 3EX9A 3OV4A 1GY5A 4O3VA 1OHSA 3PCRA 2IUKA 4ZM8A 1IVWA 3T8UA 5JPPA 1Q7HA 1NB3I 3T0UA 1Q824 1B2XA 1RGKA 2RNTA 1I3IA 4FMDA 3JVCA 2UX0A 3D79A 1RRHA 1PY3A 2C10A 1ZO2A 2W56B 1BIRA 1W4NA 1YJ93 1V74A 1B27A 3EE1A 3UL6A 3B7CA 1F8NA 2OOVC 2JDIH 2MC8A 3A76A 1N9EA 1YNVX 1JKGA 2CHCA 2RCDA 2Y73A 4FR9A 5D82A 3SX1A 2XSHB 4H3UA 2WGOA 2GU1A 5ELJA 1JNQA 4HM5B 3LT8A 1R4CA 3PZWA 1LOWA 3LOYA 1Q7Y4 5DRVA 3DY5A 4MJDA 2BMQB 3LTCA 1IQ8A 1SPUA 3AHWA 3CNXA 4LZIA 5KP3A 3KIIA 3CCE3 4J5GA 5LC7A 3MYTA 3G0KA 3KZTA 2P38A 5FW5A 1K28A 1TUHA 2HOHA 3D3LA 3V98A 4FMCA 3G4S3 1VQL3 1BANA 2O9UX 3ALAA 1GOYA 1QMAA 3DH2A 4JRFA 4O8SA 3BNEA 1VQK3 3D9RA 1BOXA 1RN1A 4PEJA 3B4PA 2IA7A 2OCTA 1DMMA 3DGLA 2E2VA 3NQYA 1LOVA 3DMCA 2GBXB 3X3YA 2ZDJA 1BNGA 2L4VA 3S29A 1B2ZA 2XGLA 2HMKB 1ISKA 3A5EA 2W03A 1RHLA 5CLKA 2IY2A 1GMRA 3HZPA 3O8YA 4N3VA 3NM7A 1BRGA 1LQGC 2BMOB 5HGRA 5IW9A 1BSCA 1UCIA 2W9PA 1BRSA 3PYJA 3SLUA 3K5TA 2CFLA 4N6NB 4XDVA 3G713 3CPW2 2W56A 1Q814 2KXGA 3FF0A 3U1WA 1JV2B 5A0OB 1EQKA 1IVUA 3NV0B 1MWSA 3FG4A 4FCJA 3FLJA 3AMOB 3EBTA 4OVMA 1IV7A 2C4BA 4HYZA 1JJ22 4HM0B 3KE7A 3KSPA 4HAAA 1GS3A 4NHFA 4N6UA 1GD4A 1ROAA 1OF5B 1IU7A 1U8CB 2GXFA 5LC6A 1IVVA 1X1UA 3WR2A 4OUQA 5BVBA 1CEWI 1VQ83 1IQYA 1HZ1A 3N54B 3FSDA 1JBRA 2W2CA 1VQ43 3H3HA 3MG2A 1NDOB 1DVCA 2YFIB 1FUTA 1TRPA 1E3VA 4BTYA 2OTJ3 1KC84 1C7HA 5D81A 3X3ZA 1BU4A 1UUVB 1UGHI 3LT9A 4NPBA 2F5WA 4WWUC 5STDA 1Q864 3S5CA 3NBJA 3STDA 1YVBI 2B1XB 1CQSA 4KFDA 4XBTA 2GEXA 1K41A 1OPYA 3WHOA 1BRHA 2Z7AA 1JKGB 2BIRA 3I553 2XFSA 1OHOA 1V58A 2F86B 2BMRB 1BRJA 2FNQA 1NJI4 1UUGB 3CCM3 2K54A 3DGOA 1TFOA 1RGFA 3GWRA 1IV9A 3N8BA 3CME3 1IK3A 1A2VA 1STDA 1VQ53 2A15A 4EYCA 4XDWA 3UNLA 1A2KA 1UGIA 1N8QA 2IYJA 3NV0A 2KF4A 1BNFA 1JN5B 1FUSA 1JZDA 3EN8A 1ULIB 1BGSA 2M7OA 3UL5A 1B2UA 2XGNA 3Q1CA 4HJLB 3JUMA 1DMNA 1JRQA 1MOLA 3BU4A 1RGGA 2KF3A 3MG3A 4G1MB 3EJVA 3D5GA 5BIRA 4J8TA 1BSDA 2OOVA 1I0XA 1KQS2 1Z1SA 1W6GA 1S5AA 2KCDA 3ECFA 1LQMB 1TJDA 4TX4A 1DVDA 1MWRA 4WFOA 2INXA 2WO0A 3JUPA 3HOHA 3ZFZA 2CG0A 3S28A 4KZ1A 2UGIA 4XBXA 2J8XB 2RSXA 4WHAA 4RBNA 1YJN3 5BXQA 1TU5A 3CCR3 2JQ5A 1DMQA 1RGLA 4KFFA 1RN7A 4RNTA 4K90B 3LXUX 3WOFB 1MWUA 1LXEA 1W00A 1VQP3 1K734 1I70A 2BT3A 3SOAA 4DKIA 1FGOA 1B20A 2GEYA 1M904 3S27A 5AEUB 3BNCA 4MMZB 7STDA 1NB5I 3I0YA 1JB5A 1RSNA 1VQN3 2Z6BA 5AYSC 1ZX2A 1HU9A 1BRNL 4R1KA 5IG3A 4N6TA 1RDSA 5TGNA 1RLSA 2QGUA 2Y74A 2W0QA 5CXOA 3MSOA 4FMAA 1VQ93 1NNVA 3NUVA 3QK9A 5G1LA 1GSPA 1JN5A 3F14A 1N9JA 2XSOB 1I3FA 4CCVA 1FZUA 3DGNA 3F40A 3DXOA 3MG1A 3Q2PA 1T5YA 1T2HA 2YX9A 4HM6B 1BNIA 1GMQA 3MHEA 5DREA 2CFDA 2KF6A 2E2TA 1JB2A 1BUJA 4L8PA 1J2BA 1BRIA 3KSED 4FCZA 5M18A 2YFJB 3KKGA 3K9MC 3V99A 3CD63 3CC43 5IEOA 3N9HA 3LH4A 1R4YA 5G2GA 1DE3A 2F98A 3CNMA 5IF6A 1YVSA 3X41A 1YGWA 1UI7A 3EBYA 3DGMA 1DYUA 5KP1A 3FG1A 4GB5A 4O2HA 1W6YA 4CPKA 3RDEA 4IT7A 1O7MB 2FXTA 3K7CA 5IG5A 1B3SA 2CKFB 1G96A 1AVKA 1YGEA 2CFWA 3NXJA 5G1KA 1D6UA 4ILFA 1VZZA 1W2ZA 1O7PB 4HM7B 4LGQA 8RNTA 2H0GA 2PNCA 3IPTA 2LQVA 1LNIA 3RGRA 3AHSA 3RNTA 3HK4A 4MMYB 1SIIA 3GZYB 1HYFA 2CFGA 4N6V0 1QVG2 1GY7A 4R4KA 2SBLA 5I97A 4O02B 1BNJA 3CCL3 1E3RA 4BIRA 3HI7A 2W9QA 3CXC2 1FGQA 1GD3A 3OWUA 1EEJA 1SIHA 4Q53A 5CF2A 3CCQ3 5D83A 1UDII 3D4AA 2CG1A 4U13A 1RTUA 1IYYA 3EF8A 1OUNA 3EHCA 3OWYA 1AQZA 1UW1A 3FF2A 3BNDA 3DZLA 2XH9A 1JBTA 4EBGA 2RGQA 2ZL8A 1FYSA 1YIT3 1O7WB 3BLZA 1GOVA 2BO9B 3PS8A 2QEX3 4WYKB 1NO3A 1FUWA 1D6ZA 2GSPA 1RCLA 9RNTA 1RN4A 3CMA3 5CF1A 2CX1A 1G0TA 1O7NB 2STDA 3F7XA 1US1A 4LYLB 1PFPA 3V92A 1RNBA 5AYRB 1Q40B 1ROVA 4XM4A 1EUIC 1U5OA 3D5IA 2V1LA 1GY6A 1VQO3 3F8XA 3X3XA 3ZG5A 5HOHA 3NQZA 1WNHA 7GSPA 3IMAB 1WMPA 1WMOA 1SQWA 3GZXB 1K8A4 3F9SA 1OCVA 1ULJB 2KRTA 4KT3B 1X1YA 4NREA 1OGXA 1OACA 2CC3A 2RBIA 5CK6A 2IUJA 3S67A 3CCJ3 2OWPA 1FA3A 2XF3A 1M1XB 1OH0A 2AAEA 4X2HA 2BHMA 1BSEA 3AGNA 1C54A 5JBSA 3LTDA 2F4YA 1SJWA 1NWWA 2HMOB 1RGHA 2HMLB 1Q9EA 2FGTA 3FZWA 1RGEA 3VGNA
chains in the Genus database with same CATH topology
2CW9A 2D1WA 3WMDA 2RFRA 1CYUA 3NX0A 3QRDA 4IIAA 1QVF2 4LSOA 4HM1B 2C11A 3F8HA 3IJEB 4K1UA 3ROBA 2HMMB 1Y4KA 2OQEC 2XRXB 5AIIA 4GL6A 3NBBA 5IERA 5EQLA 1W6CA 4WYKA 2W04A 4N6LA 4LMIA 8CHOA 1KSIA 4J9AA 1IQXA 1STFI 2GBWB 3BB9A 2ML5A 3EQQB 3CCU3 1Q40A 3EB8A 1WTHA 1RRLA 2CWVA 1TIJA 1WQLB 5IG0A 4AEQA 1IT7A 1TFKA 1KD14 1KWIA 2CFKA 1UI8A 1VQM3 1M9GA 1QALA 2LYXA 2PZVA 1AV4A 3G8ZA 2XFTA 1ASKA 2D42A 3NHXA 3UB1A 5IENA 1HKXA 2E2UA 4FMBA 4L7KA 2P0MA 1M1K4 3CC73 2CIUA 3ER7A 2F99A 3JUOA 4IPBA 1BUQA 1EKMA 1N5HA 3K63A 1LOXA 1EA2A 1OGZA 5AI1A 2IMJA 3KN4A 3J7Yd 3JUQA 3CCV3 1S723 1L5GB 3FCSB 1LNHA 2P09A 3WODG 3GZRA 2CWUA 3OXAA 2GU3A 4WP5A 1WMNA 3E99A 3T8NA 4HM8B 4N6MA 1YI23 3FH1A 4HM4B 4K1VA 3FGYA 2B24B 4R9KA 2QIYA 2HMNB 3PXMA 1LVNA 4KVHA 3NBRA 1W5ZA 4EXRA 5KP4A 1YIJ3 2HMJB 3HIIA 3SXXA 5IEPA 3I563 3SOYA 1RKYA 4MMXB 3CU3A 3CC23 2XR8B 4BTWA 4LEHA 4XBYA 1Q42A 1QJGA 4KFEA 3X40A 1YJW3 3L0RA 1PU4A 1W7CA 1MNLA 3NM2A 1YHQ3 4H61A 1JB4A 3G16A 4X2OA 4XB5A 1EG9B 3LTAA 3EN1B 2WOFA 3SVAA 3GRDA 3X42A 3VF1A 1A67A 2QA43 4EC6A 4AKZA 1VQ73 4STDA 3FKAA 1N8R4 1CYVA 3TDGA 2O3OA 4HM3B 1K9M4 6STDA 2Z76A 5EEOA 3VSYA 2CH9A 4HVNA 1QAKA 3DM8A 3U97A 2P05A 1TP6A 3UJMA 3FG3A 3RGAA 2OTL3 3HIGA 3LZAA 5AEWB 1FGMA 3EC9A 4MEIA 3K0ZA 5FGOA 1W01A 4RNZA 2Q07A 2K0MA 4HZBB 5AIHA 4HZ9B 3G6E3 5JPUA 4R9LA 5ELUA 3F7SA 3CCS3 4L8OA 3HX8A 3MWZA 3LYGA 4HM2B 3PGBA 1RJOA 1QAFA 5IG4A 5EVHA 1AR0A 1A90A 2OQEA 4R80A 3B8LA 4OK0A 4I4KA 4HKVB 3WA3A 5AIGA 2MF7A 3BNBA 3PCSA 4RZMA 3GZBA 4EV5A 3JUNA 1E97A 2I9WA 4EV2A 1IT8A 1IVXA 2WGQA 4JF8A 2YFLB 3DUKA 3Q90A 4ORLA 4RNYA 3OX9A 1O7GB 1FGRA 4QWTA 1UUWB 3MPHA 2Z77A 4HBRA 3H51A 2W6JH 3WOEB 3KFQC 3AMOA 3B4OA 3M8CA 2WOHA 1AVLA 1N5PA 1O7HB 3LTBA 2ML6A 2R4IA 4FCMA 4K61A 4BTXA 1D6YA 3MKIA 3WA2X 1W2B2 1OF5A 2BNGA 3OWSA 2CK3H 3OW22 1W02A 3SEDA 2P0XA 1OHPA 1GYBA 1FGTA 3GAXA 2CWTA 4AKYA 4CDLA 5AIFA 4N6OB 3LMLA 3CPOA 1NU3A 2XEPA 1VQ63 1IDPA 3WDGB 3EX9A 3OV4A 1GY5A 4O3VA 1OHSA 3PCRA 2IUKA 4ZM8A 1IVWA 3T8UA 5JPPA 1NB3I 3T0UA 1Q824 4FMDA 3JVCA 2UX0A 1RRHA 2C10A 1ZO2A 2W56B 1W4NA 1YJ93 1V74A 3EE1A 3UL6A 3B7CA 1F8NA 2OOVC 2JDIH 2MC8A 3A76A 1N9EA 2CHCA 1JKGA 2RCDA 2Y73A 4FR9A 5D82A 3SX1A 2XSHB 4H3UA 2WGOA 2GU1A 5ELJA 1JNQA 4HM5B 3LT8A 1R4CA 3PZWA 3LOYA 1Q7Y4 5DRVA 3DY5A 4MJDA 2BMQB 3LTCA 1IQ8A 1SPUA 3CNXA 4LZIA 5KP3A 3KIIA 3CCE3 5LC7A 3MYTA 3G0KA 3KZTA 2P38A 5FW5A 1K28A 1TUHA 3D3LA 3V98A 4FMCA 3G4S3 1VQL3 3ALAA 2O9UX 1QMAA 4JRFA 4O8SA 3BNEA 1VQK3 3D9RA 4PEJA 3B4PA 2IA7A 2OCTA 1DMMA 3DGLA 2E2VA 3NQYA 3DMCA 2GBXB 3X3YA 2ZDJA 2L4VA 3S29A 2XGLA 2HMKB 1ISKA 2W03A 5CLKA 3HZPA 3O8YA 4N3VA 3NM7A 2BMOB 5HGRA 5IW9A 2W9PA 3PYJA 3SLUA 3K5TA 2CFLA 4N6NB 4XDVA 3G713 3CPW2 2W56A 1Q814 2KXGA 3FF0A 3U1WA 1JV2B 5A0OB 1EQKA 1IVUA 3NV0B 3FG4A 4FCJA 3FLJA 3AMOB 3EBTA 4OVMA 1IV7A 4HYZA 1JJ22 4HM0B 3KE7A 3KSPA 1GS3A 4NHFA 4N6UA 1GD4A 1ROAA 1OF5B 1IU7A 1U8CB 2GXFA 5LC6A 1IVVA 4OUQA 5BVBA 1CEWI 1VQ83 1IQYA 3N54B 3FSDA 2W2CA 1VQ43 3H3HA 3MG2A 1NDOB 1DVCA 2YFIB 1E3VA 4BTYA 2OTJ3 1KC84 1C7HA 5D81A 3X3ZA 1UUVB 3LT9A 4WWUC 5STDA 1Q864 3S5CA 3NBJA 3STDA 1YVBI 2B1XB 1CQSA 4KFDA 4XBTA 2GEXA 1K41A 1OPYA 2Z7AA 1JKGB 3I553 2XFSA 1OHOA 2F86B 2BMRB 2FNQA 1NJI4 3CCM3 2K54A 3DGOA 1TFOA 3GWRA 1IV9A 3N8BA 3CME3 1IK3A 1A2VA 1STDA 1VQ53 2A15A 4EYCA 4XDWA 3UNLA 1A2KA 1N8QA 3NV0A 1JN5B 3EN8A 1ULIB 2M7OA 3UL5A 2XGNA 3Q1CA 4HJLB 3JUMA 1DMNA 1JRQA 1MOLA 3MG3A 4G1MB 3EJVA 4J8TA 2OOVA 1KQS2 1Z1SA 1W6GA 1S5AA 2KCDA 3ECFA 4TX4A 1DVDA 4WFOA 2INXA 2WO0A 3JUPA 2CG0A 3S28A 4KZ1A 4XBXA 2RSXA 4WHAA 4RBNA 1YJN3 5BXQA 1TU5A 3CCR3 2JQ5A 1DMQA 4KFFA 1RN7A 4K90B 3LXUX 3WOFB 1LXEA 1W00A 1VQP3 1K734 2BT3A 3SOAA 1FGOA 2GEYA 1M904 3S27A 5AEUB 3BNCA 4MMZB 7STDA 1NB5I 3I0YA 1JB5A 1VQN3 2Z6BA 5AYSC 1ZX2A 1HU9A 4R1KA 5IG3A 4N6TA 5TGNA 2QGUA 2Y74A 2W0QA 5CXOA 3MSOA 4FMAA 1VQ93 3NUVA 3QK9A 3F14A 1JN5A 1N9JA 2XSOB 4CCVA 3DGNA 3F40A 3DXOA 3MG1A 3Q2PA 1T5YA 2YX9A 4HM6B 3MHEA 5DREA 2CFDA 2E2TA 1JB2A 4L8PA 1J2BA 4FCZA 3KSED 2YFJB 3KKGA 3K9MC 3V99A 3CD63 3CC43 5IEOA 3N9HA 3LH4A 5G2GA 2F98A 3CNMA 5IF6A 3X41A 1UI7A 3EBYA 3DGMA 1DYUA 5KP1A 3FG1A 4GB5A 4O2HA 1W6YA 3RDEA 4IT7A 1O7MB 2FXTA 3K7CA 5IG5A 2CKFB 1G96A 1AVKA 1YGEA 2CFWA 3NXJA 1D6UA 1VZZA 1O7PB 1W2ZA 4HM7B 4LGQA 3IPTA 2PNCA 2LQVA 3RGRA 3HK4A 4MMYB 1SIIA 3GZYB 2CFGA 4N6V0 1QVG2 1GY7A 4R4KA 2SBLA 5I97A 4O02B 3CCL3 1E3RA 3HI7A 2W9QA 3CXC2 1FGQA 1GD3A 3OWUA 5CF2A 1SIHA 4Q53A 3CCQ3 5D83A 2CG1A 4U13A 3EF8A 1OUNA 3EHCA 3OWYA 1UW1A 3FF2A 3BNDA 3DZLA 2XH9A 4EBGA 2RGQA 2ZL8A 1YIT3 1O7WB 3BLZA 2BO9B 2QEX3 3PS8A 4WYKB 1NO3A 1FUWA 1D6ZA 3CMA3 5CF1A 1O7NB 3F7XA 2STDA 3V92A 1US1A 1PFPA 5AYRB 1Q40B 1ROVA 4XM4A 1U5OA 2V1LA 1GY6A 1VQO3 3F8XA 3X3XA 3NQZA 1WNHA 3IMAB 1WMPA 1WMOA 1SQWA 3GZXB 1K8A4 3F9SA 1OCVA 1ULJB 2KRTA 4NREA 3S67A 1OGXA 1OACA 2CC3A 5CK6A 2IUJA 1FA3A 3CCJ3 2OWPA 2XF3A 1M1XB 1OH0A 4X2HA 2BHMA 5JBSA 3LTDA 1SJWA 1NWWA 2HMOB 2HMLB 2FGTA 3FZWA 3VGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WMD A;  2RFR A;  4IIA A;  4HM1 B;  3F8H A;  4K1U A;  3ROB A;  2HMM B;  2XRX B;  5AII A;  5IER A;  4WYK A;  4LMI A;  8CHO A;  4J9A A;  2GBW B;  3BB9 A;  3EQQ B;  1Q40 A;  1WQL B;  5IG0 A;  2PZV A;  3G8Z A;  3NHX A;  1ASK A;  5IEN A;  1HKX A;  4L7K A;  3ER7 A;  2F99 A;  3JUO A;  1BUQ A;  1OGZ A;  1EA2 A;  5AI1 A;  2IMJ A;  3JUQ A;  3GZR A;  3OXA A;  4WP5 A;  3E99 A;  3T8N A;  4HM8 B;  3FH1 A;  4HM4 B;  4K1V A;  3FGY A;  2B24 B;  4R9K A;  2QIY A;  2HMN B;  4KVH A;  3NBR A;  5KP4 A;  2HMJ B;  5IEP A;  3SOY A;  3CU3 A;  2XR8 B;  4LEH A;  4XBY A;  1Q42 A;  1QJG A;  3NM2 A;  1JB4 A;  3G16 A;  4X2O A;  4XB5 A;  1EG9 B;  3EN1 B;  3GRD A;  4STD A;  3FKA A;  4HM3 B;  6STD A;  2Z76 A;  3VSY A;  4HVN A;  3DM8 A;  1TP6 A;  3UJM A;  3RGA A;  3LZA A;  5AEW B;  3EC9 A;  3K0Z A;  1W01 A;  4HZB B;  5AIH A;  4HZ9 B;  5JPU A;  4R9L A;  3F7S A;  4L8O A;  3HX8 A;  3LYG A;  4HM2 B;  5IG4 A;  5EVH A;  1AR0 A;  3B8L A;  4I4K A;  4HKV B;  5AIG A;  4RZM A;  3GZB A;  3JUN A;  1E97 A;  2I9W A;  2YFL B;  3DUK A;  3Q90 A;  4ORL A;  3OX9 A;  1O7G B;  1UUW B;  2Z77 A;  3H51 A;  3B4O A;  3M8C A;  1O7H B;  4FCM A;  2R4I A;  3MKI A;  1OF5 A;  2BNG A;  3OWS A;  1W02 A;  3SED A;  1OHP A;  1GYB A;  4CDL A;  5AIF A;  3CPO A;  1NU3 A;  1IDP A;  3EX9 A;  3OV4 A;  1GY5 A;  1OHS A;  3T8U A;  5JPP A;  2UX0 A;  1ZO2 A;  3B7C A;  3A76 A;  2CHC A;  1JKG A;  2RCD A;  5D82 A;  2XSH B;  4H3U A;  4HM5 B;  5DRV A;  4MJD A;  2BMQ B;  3CNX A;  5KP3 A;  3MYT A;  3G0K A;  3KZT A;  5FW5 A;  1TUH A;  1QMA A;  3D9R A;  4PEJ A;  3B4P A;  1DMM A;  3DMC A;  2GBX B;  2HMK B;  1ISK A;  5CLK A;  3HZP A;  4N3V A;  2BMO B;  5HGR A;  4XDV A;  3FF0 A;  3NV0 B;  4FCJ A;  3FLJ A;  3EBT A;  4OVM A;  4HM0 B;  3KE7 A;  3KSP A;  1GS3 A;  1OF5 B;  2GXF A;  4OUQ A;  5BVB A;  3FSD A;  2W2C A;  3H3H A;  3MG2 A;  1NDO B;  2YFI B;  1E3V A;  1C7H A;  5D81 A;  1UUV B;  4WWU C;  5STD A;  3S5C A;  3STD A;  2B1X B;  1CQS A;  4XBT A;  2GEX A;  1K41 A;  1OPY A;  2Z7A A;  1JKG B;  1OHO A;  2F86 B;  2BMR B;  2K54 A;  3GWR A;  1STD A;  2A15 A;  4XDW A;  3UNL A;  1A2K A;  3NV0 A;  1JN5 B;  3EN8 A;  1ULI B;  4HJL B;  3JUM A;  1DMN A;  3MG3 A;  3EJV A;  4J8T A;  1Z1S A;  1S5A A;  3ECF A;  2INX A;  3JUP A;  4XBX A;  5BXQ A;  2JQ5 A;  1DMQ A;  1W00 A;  3SOA A;  2GEY A;  5AEU B;  7STD A;  3I0Y A;  1JB5 A;  1ZX2 A;  4R1K A;  5IG3 A;  5TGN A;  2QGU A;  5CXO A;  3MSO A;  3NUV A;  3F14 A;  1JN5 A;  2XSO B;  3F40 A;  3DXO A;  3MG1 A;  4HM6 B;  3MHE A;  5DRE A;  1JB2 A;  4L8P A;  2YFJ B;  3KKG A;  5IEO A;  5G2G A;  2F98 A;  3CNM A;  5IF6 A;  3EBY A;  5KP1 A;  4GB5 A;  1W6Y A;  1O7M B;  3K7C A;  5IG5 A;  2CKF B;  3NXJ A;  1VZZ A;  1O7P B;  4HM7 B;  4LGQ A;  3IPT A;  3RGR A;  3HK4 A;  3GZY B;  1GY7 A;  1E3R A;  3OWU A;  5CF2 A;  4Q53 A;  5D83 A;  4U13 A;  3EF8 A;  1OUN A;  3EHC A;  3OWY A;  3FF2 A;  3DZL A;  2RGQ A;  1O7W B;  3BLZ A;  4WYK B;  5CF1 A;  1O7N B;  3F7X A;  2STD A;  1Q40 B;  4XM4 A;  1U5O A;  1GY6 A;  3F8X A;  3GZX B;  3F9S A;  1OCV A;  1ULJ B;  1OGX A;  5CK6 A;  2OWP A;  1OH0 A;  4X2H A;  1SJW A;  1NWW A;  2HMO B;  2HML B;  3FZW A;  3VGN A; 
#chains in the Genus database with same CATH topology
 2CW9 A;  2D1W A;  3WMD A;  6RNT A;  2RFR A;  1CYU A;  3NX0 A;  3QRD A;  4IIA A;  1QVF 2;  4LSO A;  4HM1 B;  2C11 A;  3F8H A;  3IJE B;  4K1U A;  3ROB A;  2F56 A;  2HMM B;  1Y4K A;  2OQE C;  2XRX B;  5AII A;  4GL6 A;  1VQQ A;  3NBB A;  5IER A;  2R41 A;  5EQL A;  1W6C A;  4WYK A;  2W04 A;  4N6L A;  4LMI A;  8CHO A;  2H0H A;  1KSI A;  1LOY A;  2AAD A;  4J9A A;  1IQX A;  1STF I;  1SAR A;  1UCK A;  2GBW B;  2H0I A;  3BB9 A;  2ML5 A;  1RNT A;  3EQQ B;  3CCU 3;  1Q40 A;  3EB8 A;  1WTH A;  1RRL A;  2CWV A;  1TIJ A;  1WQL B;  3GSP A;  5IG0 A;  4AEQ A;  1JBS A;  3URP A;  1IT7 A;  1TFK A;  1BNS A;  1MWT A;  1I2F A;  1KWI A;  1UI8 A;  2CFK A;  1AY7 A;  1KD1 4;  1VQM 3;  1M9G A;  1QAL A;  2LYX A;  2PZV A;  1AV4 A;  3G8Z A;  2XFT A;  1ASK A;  2D42 A;  3NHX A;  5GSP A;  3UB1 A;  5IEN A;  1B2S A;  1HKX A;  2E2U A;  4FMB A;  4L7K A;  2P0M A;  1M1K 4;  3CC7 3;  2CIU A;  3ER7 A;  2F99 A;  3JUO A;  2SAR A;  4IPB A;  1EKM A;  1BUQ A;  4BU4 A;  1N5H A;  1BRK A;  3K63 A;  1LOX A;  1EA2 A;  1OGZ A;  1MGR A;  2IMJ A;  3KN4 A;  5AI1 A;  3JUQ A;  5M1A A;  4EW5 A;  3J7Y d;  3CCV 3;  1S72 3;  1L5G B;  2CX0 A;  3FCS B;  1LNH A;  2P09 A;  2F5M A;  3WOD G;  3SYU A;  3DGY A;  3GZR A;  2CWU A;  3OXA A;  1BNR A;  2GU3 A;  4WP5 A;  1WMN A;  2K3D A;  3E99 A;  3T8N A;  2L1S A;  4HM8 B;  1G02 A;  2ZA4 A;  4N6M A;  4CJN A;  1YI2 3;  3FH1 A;  4HM4 B;  1T2I A;  4K1V A;  1A2P A;  3FGY A;  2B24 B;  4R9K A;  1V57 A;  2QIY A;  2HMN B;  3PXM A;  1LVN A;  4KVH A;  3NBR A;  1W5Z A;  4EXR A;  4HOH A;  5KP4 A;  1YIJ 3;  2HMJ B;  1FW7 A;  3HII A;  3SXX A;  5IEP A;  3I56 3;  1BAO A;  3SOY A;  1DET A;  1RKY A;  4MMX B;  3CU3 A;  3CC2 3;  1JZO A;  2XR8 B;  4BTW A;  4LEH A;  4XBY A;  1Q42 A;  1QJG A;  4KFE A;  3X40 A;  1YJW 3;  3L0R A;  3BIR A;  1PU4 A;  1W7C A;  2BU4 A;  1MNL A;  4BL2 A;  3NM2 A;  5RNT A;  1I2E A;  1YHQ 3;  4H61 A;  1JB4 A;  3G16 A;  4X2O A;  4XB5 A;  1EG9 B;  1I0V A;  3AGO A;  3EN1 B;  1RMS A;  1CH0 A;  2WOF A;  3GRD A;  3LTA A;  3SVA A;  3VF1 A;  3X42 A;  1A67 A;  2QA4 3;  4EC6 A;  4AKZ A;  1VQ7 3;  1UCJ A;  4STD A;  3FKA A;  4I5Q A;  1N8R 4;  2UUG C;  1CYV A;  1BVI A;  2ZHX B;  4GHO A;  3TDG A;  1RCK A;  2O3O A;  4HM3 B;  1K9M 4;  6STD A;  2Z76 A;  5EEO A;  3VSY A;  2CH9 A;  4HVN A;  1QAK A;  3DM8 A;  3U97 A;  2P05 A;  1TP6 A;  5BU4 A;  3UJM A;  3FG3 A;  3RGA A;  2OTL 3;  3HIG A;  3LZA A;  5AEW B;  1FGM A;  3EC9 A;  4MEI A;  6GSP A;  3K0Z A;  1B2M A;  5FGO A;  1W01 A;  4RNZ A;  2Q07 A;  2K0M A;  1TRQ A;  1TTO A;  4HZB B;  3KCH A;  5AIH A;  2KF5 A;  3Q3F A;  4HZ9 B;  3G6E 3;  1RGC A;  5JPU A;  1BSA A;  4R9L A;  1X1X A;  5ELU A;  3F7S A;  1PYL A;  3CCS 3;  4L8O A;  3HX8 A;  3MWZ A;  3LYG A;  1GOU A;  4HM2 B;  3PGB A;  1RJO A;  1QAF A;  5IG4 A;  5EVH A;  1AR0 A;  1A90 A;  2OQE A;  4R80 A;  3B8L A;  4OK0 A;  4I4K A;  1ZS7 A;  4HKV B;  3WA3 A;  5AIG A;  2MF7 A;  3BNB A;  3PCS A;  4RZM A;  3GZB A;  3ZG0 A;  1BNE A;  4EV5 A;  3JUN A;  4GSP A;  1E97 A;  2I9W A;  4EV2 A;  1IT8 A;  1IVX A;  2WGQ A;  4JF8 A;  2YFL B;  1X1W A;  3DUK A;  3Q90 A;  4ORL A;  4RNY A;  4J5K A;  3OX9 A;  7RNT A;  1O7G B;  1FGR A;  4QWT A;  1UUW B;  1RGA A;  3MPH A;  2Z77 A;  4HBR A;  3H51 A;  1B21 A;  2W6J H;  3WOE B;  3KFQ C;  1I8V A;  3AMO A;  3B4O A;  3M8C A;  2WOH A;  1MGW A;  1AVL A;  1N5P A;  1O7H B;  3LTB A;  2ML6 A;  1GMP A;  2R4I A;  4FCM A;  4K61 A;  4BTX A;  1BSB A;  5M19 A;  1D6Y A;  3MKI A;  3WA2 X;  1W2B 2;  1UCL A;  1OF5 A;  1ZGX A;  2BNG A;  3OWS A;  2CK3 H;  3OW2 2;  1I2G A;  1W02 A;  3SED A;  2P0X A;  1OHP A;  1FGT A;  1GYB A;  3GAX A;  2CWT A;  4AKY A;  4CDL A;  5AIF A;  1LRA A;  4N6O B;  3LML A;  4BL3 A;  1T3B A;  3CPO A;  1NU3 A;  2XEP A;  1VQ6 3;  1IDP A;  2KAA A;  3WDG B;  3EX9 A;  3OV4 A;  1GY5 A;  4O3V A;  1OHS A;  3PCR A;  2IUK A;  4ZM8 A;  1IVW A;  3T8U A;  5JPP A;  1Q7H A;  1NB3 I;  3T0U A;  1Q82 4;  1B2X A;  1RGK A;  2RNT A;  1I3I A;  4FMD A;  3JVC A;  2UX0 A;  3D79 A;  1RRH A;  1PY3 A;  2C10 A;  1ZO2 A;  2W56 B;  1BIR A;  1W4N A;  1YJ9 3;  1V74 A;  1B27 A;  3EE1 A;  3UL6 A;  3B7C A;  1F8N A;  2OOV C;  2JDI H;  2MC8 A;  3A76 A;  1N9E A;  1YNV X;  1JKG A;  2CHC A;  2RCD A;  2Y73 A;  4FR9 A;  5D82 A;  3SX1 A;  2XSH B;  4H3U A;  2WGO A;  2GU1 A;  5ELJ A;  1JNQ A;  4HM5 B;  3LT8 A;  1R4C A;  3PZW A;  1LOW A;  3LOY A;  1Q7Y 4;  5DRV A;  3DY5 A;  4MJD A;  2BMQ B;  3LTC A;  1IQ8 A;  1SPU A;  3AHW A;  3CNX A;  4LZI A;  5KP3 A;  3KII A;  3CCE 3;  4J5G A;  5LC7 A;  3MYT A;  3G0K A;  3KZT A;  2P38 A;  5FW5 A;  1K28 A;  1TUH A;  2HOH A;  3D3L A;  3V98 A;  4FMC A;  3G4S 3;  1VQL 3;  1BAN A;  2O9U X;  3ALA A;  1GOY A;  1QMA A;  3DH2 A;  4JRF A;  4O8S A;  3BNE A;  1VQK 3;  3D9R A;  1BOX A;  1RN1 A;  4PEJ A;  3B4P A;  2IA7 A;  2OCT A;  1DMM A;  3DGL A;  2E2V A;  3NQY A;  1LOV A;  3DMC A;  2GBX B;  3X3Y A;  2ZDJ A;  1BNG A;  2L4V A;  3S29 A;  1B2Z A;  2XGL A;  2HMK B;  1ISK A;  3A5E A;  2W03 A;  1RHL A;  5CLK A;  2IY2 A;  1GMR A;  3HZP A;  3O8Y A;  4N3V A;  3NM7 A;  1BRG A;  1LQG C;  2BMO B;  5HGR A;  5IW9 A;  1BSC A;  1UCI A;  2W9P A;  1BRS A;  3PYJ A;  3SLU A;  3K5T A;  2CFL A;  4N6N B;  4XDV A;  3G71 3;  3CPW 2;  2W56 A;  1Q81 4;  2KXG A;  3FF0 A;  3U1W A;  1JV2 B;  5A0O B;  1EQK A;  1IVU A;  3NV0 B;  1MWS A;  3FG4 A;  4FCJ A;  3FLJ A;  3AMO B;  3EBT A;  4OVM A;  1IV7 A;  2C4B A;  4HYZ A;  1JJ2 2;  4HM0 B;  3KE7 A;  3KSP A;  4HAA A;  1GS3 A;  4NHF A;  4N6U A;  1GD4 A;  1ROA A;  1OF5 B;  1IU7 A;  1U8C B;  2GXF A;  5LC6 A;  1IVV A;  1X1U A;  3WR2 A;  4OUQ A;  5BVB A;  1CEW I;  1VQ8 3;  1IQY A;  1HZ1 A;  3N54 B;  3FSD A;  1JBR A;  2W2C A;  1VQ4 3;  3H3H A;  3MG2 A;  1NDO B;  1DVC A;  2YFI B;  1FUT A;  1TRP A;  1E3V A;  4BTY A;  2OTJ 3;  1KC8 4;  1C7H A;  5D81 A;  3X3Z A;  1BU4 A;  1UUV B;  1UGH I;  3LT9 A;  4NPB A;  2F5W A;  4WWU C;  5STD A;  1Q86 4;  3S5C A;  3NBJ A;  3STD A;  1YVB I;  2B1X B;  1CQS A;  4KFD A;  4XBT A;  2GEX A;  1K41 A;  1OPY A;  3WHO A;  1BRH A;  2Z7A A;  1JKG B;  2BIR A;  3I55 3;  2XFS A;  1OHO A;  1V58 A;  2F86 B;  2BMR B;  1BRJ A;  2FNQ A;  1NJI 4;  1UUG B;  3CCM 3;  2K54 A;  3DGO A;  1TFO A;  1RGF A;  3GWR A;  1IV9 A;  3N8B A;  3CME 3;  1IK3 A;  1A2V A;  1STD A;  1VQ5 3;  2A15 A;  4EYC A;  4XDW A;  3UNL A;  1A2K A;  1UGI A;  1N8Q A;  2IYJ A;  3NV0 A;  2KF4 A;  1BNF A;  1JN5 B;  1FUS A;  1JZD A;  3EN8 A;  1ULI B;  1BGS A;  2M7O A;  3UL5 A;  1B2U A;  2XGN A;  3Q1C A;  4HJL B;  3JUM A;  1DMN A;  1JRQ A;  1MOL A;  3BU4 A;  1RGG A;  2KF3 A;  3MG3 A;  4G1M B;  3EJV A;  3D5G A;  5BIR A;  4J8T A;  1BSD A;  2OOV A;  1I0X A;  1KQS 2;  1Z1S A;  1W6G A;  1S5A A;  2KCD A;  3ECF A;  1LQM B;  1TJD A;  4TX4 A;  1DVD A;  1MWR A;  4WFO A;  2INX A;  2WO0 A;  3JUP A;  3HOH A;  3ZFZ A;  2CG0 A;  3S28 A;  4KZ1 A;  2UGI A;  4XBX A;  2J8X B;  2RSX A;  4WHA A;  4RBN A;  1YJN 3;  5BXQ A;  1TU5 A;  3CCR 3;  2JQ5 A;  1DMQ A;  1RGL A;  4KFF A;  1RN7 A;  4RNT A;  4K90 B;  3LXU X;  3WOF B;  1MWU A;  1LXE A;  1W00 A;  1VQP 3;  1K73 4;  1I70 A;  2BT3 A;  3SOA A;  4DKI A;  1FGO A;  1B20 A;  2GEY A;  1M90 4;  3S27 A;  5AEU B;  3BNC A;  4MMZ B;  7STD A;  1NB5 I;  3I0Y A;  1JB5 A;  1RSN A;  1VQN 3;  2Z6B A;  5AYS C;  1ZX2 A;  1HU9 A;  1BRN L;  4R1K A;  5IG3 A;  4N6T A;  1RDS A;  5TGN A;  1RLS A;  2QGU A;  2Y74 A;  2W0Q A;  5CXO A;  3MSO A;  4FMA A;  1VQ9 3;  1NNV A;  3NUV A;  3QK9 A;  5G1L A;  1GSP A;  1JN5 A;  3F14 A;  1N9J A;  2XSO B;  1I3F A;  4CCV A;  1FZU A;  3DGN A;  3F40 A;  3DXO A;  3MG1 A;  3Q2P A;  1T5Y A;  1T2H A;  2YX9 A;  4HM6 B;  1BNI A;  1GMQ A;  3MHE A;  5DRE A;  2CFD A;  2KF6 A;  2E2T A;  1JB2 A;  1BUJ A;  4L8P A;  1J2B A;  1BRI A;  3KSE D;  4FCZ A;  5M18 A;  2YFJ B;  3KKG A;  3K9M C;  3V99 A;  3CD6 3;  3CC4 3;  5IEO A;  3N9H A;  3LH4 A;  1R4Y A;  5G2G A;  1DE3 A;  2F98 A;  3CNM A;  5IF6 A;  1YVS A;  3X41 A;  1YGW A;  1UI7 A;  3EBY A;  3DGM A;  1DYU A;  5KP1 A;  3FG1 A;  4GB5 A;  4O2H A;  1W6Y A;  4CPK A;  3RDE A;  4IT7 A;  1O7M B;  2FXT A;  3K7C A;  5IG5 A;  1B3S A;  2CKF B;  1G96 A;  1AVK A;  1YGE A;  2CFW A;  3NXJ A;  5G1K A;  1D6U A;  4ILF A;  1VZZ A;  1W2Z A;  1O7P B;  4HM7 B;  4LGQ A;  8RNT A;  2H0G A;  2PNC A;  3IPT A;  2LQV A;  1LNI A;  3RGR A;  3AHS A;  3RNT A;  3HK4 A;  4MMY B;  1SII A;  3GZY B;  1HYF A;  2CFG A;  4N6V 0;  1QVG 2;  1GY7 A;  4R4K A;  2SBL A;  5I97 A;  4O02 B;  1BNJ A;  3CCL 3;  1E3R A;  4BIR A;  3HI7 A;  2W9Q A;  3CXC 2;  1FGQ A;  1GD3 A;  3OWU A;  1EEJ A;  1SIH A;  4Q53 A;  5CF2 A;  3CCQ 3;  5D83 A;  1UDI I;  3D4A A;  2CG1 A;  4U13 A;  1RTU A;  1IYY A;  3EF8 A;  1OUN A;  3EHC A;  3OWY A;  1AQZ A;  1UW1 A;  3FF2 A;  3BND A;  3DZL A;  2XH9 A;  1JBT A;  4EBG A;  2RGQ A;  2ZL8 A;  1FYS A;  1YIT 3;  1O7W B;  3BLZ A;  1GOV A;  2BO9 B;  3PS8 A;  2QEX 3;  4WYK B;  1NO3 A;  1FUW A;  1D6Z A;  2GSP A;  1RCL A;  9RNT A;  1RN4 A;  3CMA 3;  5CF1 A;  2CX1 A;  1G0T A;  1O7N B;  2STD A;  3F7X A;  1US1 A;  4LYL B;  1PFP A;  3V92 A;  1RNB A;  5AYR B;  1Q40 B;  1ROV A;  4XM4 A;  1EUI C;  1U5O A;  3D5I A;  2V1L A;  1GY6 A;  1VQO 3;  3F8X A;  3X3X A;  3ZG5 A;  5HOH A;  3NQZ A;  1WNH A;  7GSP A;  3IMA B;  1WMP A;  1WMO A;  1SQW A;  3GZX B;  1K8A 4;  3F9S A;  1OCV A;  1ULJ B;  2KRT A;  4KT3 B;  1X1Y A;  4NRE A;  1OGX A;  1OAC A;  2CC3 A;  2RBI A;  5CK6 A;  2IUJ A;  3S67 A;  3CCJ 3;  2OWP A;  1FA3 A;  2XF3 A;  1M1X B;  1OH0 A;  2AAE A;  4X2H A;  2BHM A;  1BSE A;  3AGN A;  1C54 A;  5JBS A;  3LTD A;  2F4Y A;  1SJW A;  1NWW A;  2HMO B;  1RGH A;  2HML B;  1Q9E A;  2FGT A;  3FZW A;  1RGE A;  3VGN A; 
#chains in the Genus database with same CATH homology
 2CW9 A;  2D1W A;  3WMD A;  2RFR A;  1CYU A;  3NX0 A;  3QRD A;  4IIA A;  1QVF 2;  4LSO A;  4HM1 B;  2C11 A;  3F8H A;  3IJE B;  4K1U A;  3ROB A;  2HMM B;  1Y4K A;  2OQE C;  2XRX B;  5AII A;  4GL6 A;  3NBB A;  5IER A;  5EQL A;  1W6C A;  4WYK A;  2W04 A;  4N6L A;  4LMI A;  8CHO A;  1KSI A;  4J9A A;  1IQX A;  1STF I;  2GBW B;  3BB9 A;  2ML5 A;  3EQQ B;  3CCU 3;  1Q40 A;  3EB8 A;  1WTH A;  1RRL A;  2CWV A;  1TIJ A;  1WQL B;  5IG0 A;  4AEQ A;  1IT7 A;  1TFK A;  1KD1 4;  1KWI A;  2CFK A;  1UI8 A;  1VQM 3;  1M9G A;  1QAL A;  2LYX A;  2PZV A;  1AV4 A;  3G8Z A;  2XFT A;  1ASK A;  2D42 A;  3NHX A;  3UB1 A;  5IEN A;  1HKX A;  2E2U A;  4FMB A;  4L7K A;  2P0M A;  1M1K 4;  3CC7 3;  2CIU A;  3ER7 A;  2F99 A;  3JUO A;  4IPB A;  1BUQ A;  1EKM A;  1N5H A;  3K63 A;  1LOX A;  1EA2 A;  1OGZ A;  5AI1 A;  2IMJ A;  3KN4 A;  3J7Y d;  3JUQ A;  3CCV 3;  1S72 3;  1L5G B;  3FCS B;  1LNH A;  2P09 A;  3WOD G;  3GZR A;  2CWU A;  3OXA A;  2GU3 A;  4WP5 A;  1WMN A;  3E99 A;  3T8N A;  4HM8 B;  4N6M A;  1YI2 3;  3FH1 A;  4HM4 B;  4K1V A;  3FGY A;  2B24 B;  4R9K A;  2QIY A;  2HMN B;  3PXM A;  1LVN A;  4KVH A;  3NBR A;  1W5Z A;  4EXR A;  5KP4 A;  1YIJ 3;  2HMJ B;  3HII A;  3SXX A;  5IEP A;  3I56 3;  3SOY A;  1RKY A;  4MMX B;  3CU3 A;  3CC2 3;  2XR8 B;  4BTW A;  4LEH A;  4XBY A;  1Q42 A;  1QJG A;  4KFE A;  3X40 A;  1YJW 3;  3L0R A;  1PU4 A;  1W7C A;  1MNL A;  3NM2 A;  1YHQ 3;  4H61 A;  1JB4 A;  3G16 A;  4X2O A;  4XB5 A;  1EG9 B;  3LTA A;  3EN1 B;  2WOF A;  3SVA A;  3GRD A;  3X42 A;  3VF1 A;  1A67 A;  2QA4 3;  4EC6 A;  4AKZ A;  1VQ7 3;  4STD A;  3FKA A;  1N8R 4;  1CYV A;  3TDG A;  2O3O A;  4HM3 B;  1K9M 4;  6STD A;  2Z76 A;  5EEO A;  3VSY A;  2CH9 A;  4HVN A;  1QAK A;  3DM8 A;  3U97 A;  2P05 A;  1TP6 A;  3UJM A;  3FG3 A;  3RGA A;  2OTL 3;  3HIG A;  3LZA A;  5AEW B;  1FGM A;  3EC9 A;  4MEI A;  3K0Z A;  5FGO A;  1W01 A;  4RNZ A;  2Q07 A;  2K0M A;  4HZB B;  5AIH A;  4HZ9 B;  3G6E 3;  5JPU A;  4R9L A;  5ELU A;  3F7S A;  3CCS 3;  4L8O A;  3HX8 A;  3MWZ A;  3LYG A;  4HM2 B;  3PGB A;  1RJO A;  1QAF A;  5IG4 A;  5EVH A;  1AR0 A;  1A90 A;  2OQE A;  4R80 A;  3B8L A;  4OK0 A;  4I4K A;  4HKV B;  3WA3 A;  5AIG A;  2MF7 A;  3BNB A;  3PCS A;  4RZM A;  3GZB A;  4EV5 A;  3JUN A;  1E97 A;  2I9W A;  4EV2 A;  1IT8 A;  1IVX A;  2WGQ A;  4JF8 A;  2YFL B;  3DUK A;  3Q90 A;  4ORL A;  4RNY A;  3OX9 A;  1O7G B;  1FGR A;  4QWT A;  1UUW B;  3MPH A;  2Z77 A;  4HBR A;  3H51 A;  2W6J H;  3WOE B;  3KFQ C;  3AMO A;  3B4O A;  3M8C A;  2WOH A;  1AVL A;  1N5P A;  1O7H B;  3LTB A;  2ML6 A;  2R4I A;  4FCM A;  4K61 A;  4BTX A;  1D6Y A;  3MKI A;  3WA2 X;  1W2B 2;  1OF5 A;  2BNG A;  3OWS A;  2CK3 H;  3OW2 2;  1W02 A;  3SED A;  2P0X A;  1OHP A;  1GYB A;  1FGT A;  3GAX A;  2CWT A;  4AKY A;  4CDL A;  5AIF A;  4N6O B;  3LML A;  3CPO A;  1NU3 A;  2XEP A;  1VQ6 3;  1IDP A;  3WDG B;  3EX9 A;  3OV4 A;  1GY5 A;  4O3V A;  1OHS A;  3PCR A;  2IUK A;  4ZM8 A;  1IVW A;  3T8U A;  5JPP A;  1NB3 I;  3T0U A;  1Q82 4;  4FMD A;  3JVC A;  2UX0 A;  1RRH A;  2C10 A;  1ZO2 A;  2W56 B;  1W4N A;  1YJ9 3;  1V74 A;  3EE1 A;  3UL6 A;  3B7C A;  1F8N A;  2OOV C;  2JDI H;  2MC8 A;  3A76 A;  1N9E A;  2CHC A;  1JKG A;  2RCD A;  2Y73 A;  4FR9 A;  5D82 A;  3SX1 A;  2XSH B;  4H3U A;  2WGO A;  2GU1 A;  5ELJ A;  1JNQ A;  4HM5 B;  3LT8 A;  1R4C A;  3PZW A;  3LOY A;  1Q7Y 4;  5DRV A;  3DY5 A;  4MJD A;  2BMQ B;  3LTC A;  1IQ8 A;  1SPU A;  3CNX A;  4LZI A;  5KP3 A;  3KII A;  3CCE 3;  5LC7 A;  3MYT A;  3G0K A;  3KZT A;  2P38 A;  5FW5 A;  1K28 A;  1TUH A;  3D3L A;  3V98 A;  4FMC A;  3G4S 3;  1VQL 3;  3ALA A;  2O9U X;  1QMA A;  4JRF A;  4O8S A;  3BNE A;  1VQK 3;  3D9R A;  4PEJ A;  3B4P A;  2IA7 A;  2OCT A;  1DMM A;  3DGL A;  2E2V A;  3NQY A;  3DMC A;  2GBX B;  3X3Y A;  2ZDJ A;  2L4V A;  3S29 A;  2XGL A;  2HMK B;  1ISK A;  2W03 A;  5CLK A;  3HZP A;  3O8Y A;  4N3V A;  3NM7 A;  2BMO B;  5HGR A;  5IW9 A;  2W9P A;  3PYJ A;  3SLU A;  3K5T A;  2CFL A;  4N6N B;  4XDV A;  3G71 3;  3CPW 2;  2W56 A;  1Q81 4;  2KXG A;  3FF0 A;  3U1W A;  1JV2 B;  5A0O B;  1EQK A;  1IVU A;  3NV0 B;  3FG4 A;  4FCJ A;  3FLJ A;  3AMO B;  3EBT A;  4OVM A;  1IV7 A;  4HYZ A;  1JJ2 2;  4HM0 B;  3KE7 A;  3KSP A;  1GS3 A;  4NHF A;  4N6U A;  1GD4 A;  1ROA A;  1OF5 B;  1IU7 A;  1U8C B;  2GXF A;  5LC6 A;  1IVV A;  4OUQ A;  5BVB A;  1CEW I;  1VQ8 3;  1IQY A;  3N54 B;  3FSD A;  2W2C A;  1VQ4 3;  3H3H A;  3MG2 A;  1NDO B;  1DVC A;  2YFI B;  1E3V A;  4BTY A;  2OTJ 3;  1KC8 4;  1C7H A;  5D81 A;  3X3Z A;  1UUV B;  3LT9 A;  4WWU C;  5STD A;  1Q86 4;  3S5C A;  3NBJ A;  3STD A;  1YVB I;  2B1X B;  1CQS A;  4KFD A;  4XBT A;  2GEX A;  1K41 A;  1OPY A;  2Z7A A;  1JKG B;  3I55 3;  2XFS A;  1OHO A;  2F86 B;  2BMR B;  2FNQ A;  1NJI 4;  3CCM 3;  2K54 A;  3DGO A;  1TFO A;  3GWR A;  1IV9 A;  3N8B A;  3CME 3;  1IK3 A;  1A2V A;  1STD A;  1VQ5 3;  2A15 A;  4EYC A;  4XDW A;  3UNL A;  1A2K A;  1N8Q A;  3NV0 A;  1JN5 B;  3EN8 A;  1ULI B;  2M7O A;  3UL5 A;  2XGN A;  3Q1C A;  4HJL B;  3JUM A;  1DMN A;  1JRQ A;  1MOL A;  3MG3 A;  4G1M B;  3EJV A;  4J8T A;  2OOV A;  1KQS 2;  1Z1S A;  1W6G A;  1S5A A;  2KCD A;  3ECF A;  4TX4 A;  1DVD A;  4WFO A;  2INX A;  2WO0 A;  3JUP A;  2CG0 A;  3S28 A;  4KZ1 A;  4XBX A;  2RSX A;  4WHA A;  4RBN A;  1YJN 3;  5BXQ A;  1TU5 A;  3CCR 3;  2JQ5 A;  1DMQ A;  4KFF A;  1RN7 A;  4K90 B;  3LXU X;  3WOF B;  1LXE A;  1W00 A;  1VQP 3;  1K73 4;  2BT3 A;  3SOA A;  1FGO A;  2GEY A;  1M90 4;  3S27 A;  5AEU B;  3BNC A;  4MMZ B;  7STD A;  1NB5 I;  3I0Y A;  1JB5 A;  1VQN 3;  2Z6B A;  5AYS C;  1ZX2 A;  1HU9 A;  4R1K A;  5IG3 A;  4N6T A;  5TGN A;  2QGU A;  2Y74 A;  2W0Q A;  5CXO A;  3MSO A;  4FMA A;  1VQ9 3;  3NUV A;  3QK9 A;  3F14 A;  1JN5 A;  1N9J A;  2XSO B;  4CCV A;  3DGN A;  3F40 A;  3DXO A;  3MG1 A;  3Q2P A;  1T5Y A;  2YX9 A;  4HM6 B;  3MHE A;  5DRE A;  2CFD A;  2E2T A;  1JB2 A;  4L8P A;  1J2B A;  4FCZ A;  3KSE D;  2YFJ B;  3KKG A;  3K9M C;  3V99 A;  3CD6 3;  3CC4 3;  5IEO A;  3N9H A;  3LH4 A;  5G2G A;  2F98 A;  3CNM A;  5IF6 A;  3X41 A;  1UI7 A;  3EBY A;  3DGM A;  1DYU A;  5KP1 A;  3FG1 A;  4GB5 A;  4O2H A;  1W6Y A;  3RDE A;  4IT7 A;  1O7M B;  2FXT A;  3K7C A;  5IG5 A;  2CKF B;  1G96 A;  1AVK A;  1YGE A;  2CFW A;  3NXJ A;  1D6U A;  1VZZ A;  1O7P B;  1W2Z A;  4HM7 B;  4LGQ A;  3IPT A;  2PNC A;  2LQV A;  3RGR A;  3HK4 A;  4MMY B;  1SII A;  3GZY B;  2CFG A;  4N6V 0;  1QVG 2;  1GY7 A;  4R4K A;  2SBL A;  5I97 A;  4O02 B;  3CCL 3;  1E3R A;  3HI7 A;  2W9Q A;  3CXC 2;  1FGQ A;  1GD3 A;  3OWU A;  5CF2 A;  1SIH A;  4Q53 A;  3CCQ 3;  5D83 A;  2CG1 A;  4U13 A;  3EF8 A;  1OUN A;  3EHC A;  3OWY A;  1UW1 A;  3FF2 A;  3BND A;  3DZL A;  2XH9 A;  4EBG A;  2RGQ A;  2ZL8 A;  1YIT 3;  1O7W B;  3BLZ A;  2BO9 B;  2QEX 3;  3PS8 A;  4WYK B;  1NO3 A;  1FUW A;  1D6Z A;  3CMA 3;  5CF1 A;  1O7N B;  3F7X A;  2STD A;  3V92 A;  1US1 A;  1PFP A;  5AYR B;  1Q40 B;  1ROV A;  4XM4 A;  1U5O A;  2V1L A;  1GY6 A;  1VQO 3;  3F8X A;  3X3X A;  3NQZ A;  1WNH A;  3IMA B;  1WMP A;  1WMO A;  1SQW A;  3GZX B;  1K8A 4;  3F9S A;  1OCV A;  1ULJ B;  2KRT A;  4NRE A;  3S67 A;  1OGX A;  1OAC A;  2CC3 A;  5CK6 A;  2IUJ A;  1FA3 A;  3CCJ 3;  2OWP A;  2XF3 A;  1M1X B;  1OH0 A;  4X2H A;  2BHM A;  5JBS A;  3LTD A;  1SJW A;  1NWW A;  2HMO B;  2HML B;  2FGT A;  3FZW A;  3VGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...