1JKGB

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna nuclear export factor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
180
Chain Sequence
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFISSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 180
sequence length 186
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
B PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jkgB00
4CDLA 3IPTA 4R9LA 3SEDA 4L8OA 4XB5A 1U5OA 3KE7A 2B24B 3UJMA 4H3UA 3M8CA 1O7MB 3RGAA 1GS3A 1O7GB 2HMNB 1NWWA 1E97A 3EN8A 5CLKA 4STDA 2QIYA 3GZRA 1DMQA 1Q40B 3E99A 3MG2A 3MSOA 3GZXB 3EN1B 2GEXA 4HM0B 3NV0A 4HZ9B 1GYBA 3NM2A 2R4IA 4WYKB 2YFJB 5IEPA 3OWYA 1HKXA 3EHCA 3OXAA 5IG5A 4L7KA 3LYGA 1JB5A 1EA2A 1OGXA 5D81A 3VSYA 2RCDA 3KKGA 3CNXA 1STDA 3EC9A 2XR8B 1ASKA 1UUWB 3FKAA 3JUNA 5JPUA 2RGQA 2K54A 1W00A 2GBWB 3BLZA 4XDVA 5AIFA 4IIAA 4U13A 3CPOA 3ER7A 2UX0A 1JKGA 1O7NB 4L8PA 6STDA 3FZWA 4HM8B 5IG4A 5TGNA 4K1UA 1SJWA 2Z76A 1W6YA 3VGNA 5CF1A 3I0YA 2BMRB 3KSPA 4HM3B 2BMQB 2B1XB 1JB2A 3OWUA 3FSDA 4HZBB 3DM8A 3GWRA 3UNLA 3G8ZA 1W02A 2HMKB 1O7PB 2PZVA 1OF5A 3S5CA 3G0KA 1BUQA 4ORLA 3T8NA 3MHEA 7STDA 2INXA 2CHCA 3EX9A 2IMJA 3NXJA 3FH1A 1IDPA 1NU3A 1OGZA 5IF6A 1OPYA 1OCVA 3F8XA 5CK6A 5KP1A 3HX8A 5IG3A 4HM5B 1QJGA 1ULJB 5D82A 1O7WB 3CNMA 4RZMA 4FCJA 4HM7B 1O7HB 3STDA 1TP6A 3GZBA 3H51A 5KP4A 2BNGA 1WQLB 2HMOB 2XSHB 3NV0B 3OWSA 5AIGA 2GEYA 4R1KA 4X2HA 4XBTA 1EG9B 1C7HA 3B8LA 5AIIA 3A76A 3EQQB 8CHOA 4N3VA 1OH0A 1AR0A 1JN5A 4K1VA 3T8UA 1GY6A 1VZZA 3K7CA 5STDA 4HM6B 3CU3A 3F9SA 3GRDA 5DRVA 3EJVA 1OHSA 2YFIB 3H3HA 5IERA 1K41A 4HM2B 3FLJA 3HZPA 5BXQA 5FW5A 3SOYA 2STDA 4LGQA 2XRXB 3ROBA 3JUMA 4HM1B 3FF0A 4OVMA 3EF8A 1TUHA 5HGRA 3F7XA 3DUKA 3KZTA 4J9AA 3OX9A 1JKGB 1DMNA 2BMOB 2CKFB 5CXOA 2Z77A 2W2CA 3JUPA 1NDOB 1ULIB 5G2GA 3D9RA 3GZYB 1QMAA 3LZAA 1OF5B 4FCMA 5D83A 1CQSA 3B4OA 3MG3A 1OUNA 3WMDA 3FF2A 2HMLB 3RGRA 4WWUC 1Q40A 4HKVB 4XBXA 3BB9A 1GY7A 1ZO2A 2RFRA 5JPPA 3ECFA 4XM4A 3F40A 4WP5A 3EBTA 3MKIA 1DMMA 4WYKA 5IG0A 2XSOB 4X2OA 3SOAA 2QGUA 3MG1A 1OHPA 4OUQA 3EBYA 5AEUB 3B7CA 1S5AA 4XDWA 2YFLB 2JQ5A 4LEHA 4MJDA 5AIHA 3F8HA 3JUQA 5EVHA 1JB4A 1E3RA 3F14A 2HMMB 3NBRA 3OV4A 4Q53A 4HVNA 2Z7AA 4J8TA 2F99A 5IENA 1W01A 2GXFA 1JN5B 3DZLA 4LMIA 3HK4A 5AI1A 3JUOA 2A15A 3G16A 1Z1SA 4GB5A 5IEOA 2F98A 3FGYA 4XBYA 2HMJB 1OHOA 5AEWB 1UUVB 5KP3A 4PEJA 1ZX2A 3B4PA 5DREA 3NHXA 3DMCA 3F7SA 3MYTA 1A2KA 5CF2A 2GBXB 2I9WA 1GY5A 3K0ZA 1Q42A 4HM4B 3DXOA 4KVHA 4I4KA 4R9KA 5BVBA 3Q90A 1ISKA 3NUVA 2OWPA 1E3VA 4HJLB 2F86B
chains in the Genus database with same CATH superfamily
4FMBA 1JZDA 3IPTA 1I2FA 1BIRA 4CDLA 2ML5A 4R9LA 2R41A 3SEDA 4L8OA 2E2VA 3LT8A 1GD4A 2CG1A 4XB5A 3DGYA 1IV7A 1U5OA 1W4NA 3KE7A 1RGLA 1B3SA 1V74A 3V92A 1Q7HA 5ELUA 4FMDA 1WMNA 3D5GA 4G1MB 4N6V0 2BIRA 2B24B 3UJMA 3O8YA 1N8R4 2O3OA 3LTCA 4H3UA 3M8CA 1O7MB 3RGAA 1GS3A 1EUIC 3AGNA 4BL3A 1AQZA 3D3LA 3ZG5A 1OACA 3X42A 1EQKA 1GMRA 1O7GB 1X1UA 3SYUA 1W6GA 2HMNB 1Q814 1AV4A 1I3FA 1TFOA 3UL6A 1NWWA 1GD3A 1E97A 1RNTA 3WOEB 1BUJA 2W9PA 2KAAA 4J5KA 1IQ8A 3NBJA 1PFPA 1I2GA 3EN8A 4BL2A 4HOHA 3SX1A 2V1LA 5CLKA 1GOUA 4STDA 3CCM3 2QIYA 3GZRA 5G1LA 1DMQA 1Q40B 1IYYA 2M7OA 1DE3A 4N6UA 3E99A 1IU7A 3MG2A 5GSPA 3MSOA 1IVVA 3GZXB 3EN1B 1V58A 3X3ZA 2W56A 1X1YA 1WMPA 2IYJA 2GEXA 4HM0B 3CC73 1MWRA 1DYUA 1HZ1A 3NV0A 4K61A 4HZ9B 1GYBA 3NM2A 2CK3H 3WR2A 3CCS3 2OQEA 2R4IA 1LQMB 1RGAA 1VQ53 4WYKB 1UI7A 4K90B 1FGRA 4ZM8A 1IV9A 2YFJB 6RNTA 4QWTA 4FMCA 5IEPA 3OWYA 1YJW3 1HKXA 1UCJA 3EHCA 2WOFA 1YGEA 2JDIH 1BRHA 3OXAA 4HAAA 4OK0A 5LC6A 5IG5A 1K9M4 3I563 1UGIA 4L7KA 3LYGA 1JB5A 1IQXA 1WNHA 3LH4A 2CFLA 1LOVA 1J2BA 2P38A 1EA2A 1B2MA 4RNYA 3WOFB 2QEX3 1OGXA 4NHFA 2KCDA 1BSDA 1CYUA 2H0HA 2D42A 1JV2B 2CW9A 5D81A 2CFWA 3VSYA 1BSCA 4KFDA 2RCDA 3KKGA 2PNCA 2WGOA 1CYVA 3AHSA 3CNXA 3UL5A 3D5IA 1QAKA 1STDA 3EC9A 1EKMA 1SIHA 2XR8B 1ASKA 1UUWB 3FG3A 4FCZA 1BRIA 3CC43 1YJN3 5LC7A 1RNBA 2KF3A 3FKAA 1VQN3 5BIRA 1BNRA 3JUNA 3URPA 5ELJA 5JPUA 3CCJ3 1FUWA 2RGQA 1SARA 1LRAA 1SQWA 3CC23 2K54A 3CMA3 1W00A 1QAFA 2KRTA 4RNZA 3FG1A 2GBWB 3Q3FA 3BLZA 4XDVA 4I5QA 1VQ93 5AIFA 1LOWA 2Y73A 3BIRA 3NQYA 1RGKA 4IIAA 1UW1A 4U13A 3CPOA 3ER7A 1YIJ3 1WMOA 1BSAA 1US1A 2OQEC 1Y4KA 3CCE3 2UX0A 1QVG2 3K9MC 2IA7A 1YGWA 1BVIA 3ZFZA 1JKGA 1O7NB 4L8PA 1YJ93 6STDA 3FZWA 2C4BA 1YVSA 2XGLA 1I3IA 1MGWA 4HM8B 5IG4A 1YI23 2KXGA 1AY7A 3N54B 4FR9A 2CH9A 4K1UA 5TGNA 1SJWA 3PCRA 4BTYA 2Z76A 1W6YA 3VGNA 5CF1A 3I0YA 1GOVA 4EC6A 1QVF2 1M904 2BMRB 3KSPA 1DETA 4HM3B 3MPHA 2BMQB 2B1XB 1JB2A 1HYFA 2F5WA 1UUGB 3OWUA 1UI8A 2CIUA 3FSDA 4HZBB 4BU4A 4MMYB 3DM8A 3GWRA 3UNLA 2ZL8A 3G8ZA 1W02A 2HMKB 4BIRA 1O7PB 2KF4A 4AKZA 3AGOA 1UCLA 2PZVA 2F4YA 1OF5A 3S5CA 1RRLA 4EW5A 3G0KA 1RN4A 1BUQA 2XH9A 4EYCA 1A2VA 4ORLA 4EBGA 2YX9A 4ILFA 1NNVA 4N6OB 3GSPA 2CC3A 3T8NA 3MHEA 1TTOA 2INXA 7STDA 1IT7A 3AMOA 2CG0A 4O8SA 4KT3B 4O3VA 1G02A 2CHCA 1BSEA 3EX9A 3X3YA 3WA2X 2OOVA 1RMSA 1RCKA 2IMJA 1LXEA 2FNQA 5I97A 1VQ63 4N6NB 1IT8A 3NXJA 4O2HA 3DH2A 3FH1A 1IVUA 1IDPA 1JRQA 1UGHI 3TDGA 1NU3A 3SLUA 2LQVA 1OGZA 5IF6A 1B20A 1OCVA 1OPYA 2IY2A 3F8XA 1FGQA 1M9GA 5CK6A 2W9QA 4N6MA 1LQGC 1JBSA 1IVXA 5KP1A 3WDGB 3HX8A 4O02B 1B2UA 5IG3A 3CCL3 1BRKA 3KIIA 4HM5B 1RGCA 1QJGA 1RHLA 1Q7Y4 1I0XA 1I0VA 2GU1A 1ULJB 5D82A 1O7WB 1BANA 3CNMA 3FG4A 1ZS7A 3L0RA 4FCJA 4RZMA 1R4YA 1VQL3 2FGTA 2CFDA 2XEPA 4JF8A 2CX0A 4LSOA 1PU4A 4HM7B 1FYSA 1CEWI 2K3DA 2L1SA 1O7HB 3STDA 3IJEB 1TP6A 2W56B 1YHQ3 3GZBA 3H51A 4KFEA 5KP4A 2BNGA 4MMXB 1BNFA 1FGOA 1WQLB 2HMOB 3CCV3 1A67A 1TRPA 1U8CB 2XSHB 3NV0B 3OWSA 5AIGA 3WA3A 2RNTA 1GMPA 2GEYA 4R1KA 3U1WA 4X2HA 1VQ73 1BNGA 4HBRA 1IK3A 1KD14 3S67A 4XBTA 5JBSA 1EG9B 5M18A 1C7HA 1JJ22 3B8LA 3J7Yd 3HIGA 3NX0A 1KQS2 5AIIA 2KF5A 1HU9A 1UDII 1X1XA 3A76A 2OOVC 3EQQB 4FMAA 4N3VA 5EEOA 8CHOA 5HOHA 1NB5I 1BSBA 3PXMA 2CWTA 2Y74A 1LOXA 2W0QA 1OH0A 3PS8A 1AR0A 2MF7A 1VQ43 1RKYA 2K0MA 1JN5A 1Q9EA 3NQZA 3DGOA 1T2IA 4K1VA 3T8UA 1GY6A 4EXRA 1RGFA 1BAOA 1BNEA 1FUSA 3PGBA 1M1XB 1VZZA 3DGNA 3K7CA 5STDA 4HM6B 4IPBA 4BTXA 5RNTA 3CU3A 2ZDJA 3F9SA 3GRDA 2W6JH 1PY3A 4GSPA 2XFTA 3EJVA 5DRVA 3CPW2 1OHSA 3HOHA 3CCR3 2YFIB 4H61A 2RSXA 1UCIA 3H3HA 5M1AA 1NO3A 1G0TA 1ROVA 5IERA 3JVCA 4AKYA 5EQLA 1K41A 1TRQA 4HM2B 7GSPA 3PYJA 3UB1A 1FA3A 1N9EA 1RLSA 1JBRA 3BNBA 3QK9A 3FLJA 3HZPA 5BXQA 9RNTA 5FW5A 2QA43 4RBNA 1BNSA 3PCSA 3SOYA 3CXC2 2STDA 4LGQA 5FGOA 4GHOA 2XRXB 1RGEA 3K5TA 3JUMA 4LYLB 3ROBA 1RGHA 3X40A 4CPKA 5BU4A 4HM1B 3FF0A 4R4KA 5AYSC 1RN1A 4GL6A 3QRDA 1FZUA 2OTL3 1FGMA 1C54A 4OVMA 3V99A 1W2ZA 3EF8A 1TUHA 5HGRA 3N8BA 3F7XA 3DUKA 3EE1A 3KZTA 3S27A 1FW7A 4J9AA 5M19A 3G6E3 3OX9A 1JKGB 3KSED 1DMNA 2BMOB 1B2ZA 2CKFB 1L5GB 4EV5A 3RNTA 5CXOA 1EEJA 2UGIA 2Z77A 3SXXA 1D6UA 4DKIA 2E2TA 2W2CA 3JUPA 1NDOB 1RRHA 5A0OB 1M1K4 3N9HA 1RN7A 3BU4A 2H0GA 2E2UA 2AADA 2AAEA 1KC84 3X3XA 4EV2A 1ZGXA 3AHWA 1ULIB 1N5PA 3T0UA 5G2GA 7RNTA 2OTJ3 3DGMA 1TJDA 3D9RA 2IUJA 3GZYB 3ALAA 1QMAA 2ZA4A 3LZAA 1Q864 2XGNA 1OF5B 2XFSA 4FCMA 5D83A 5AYRB 4NPBA 2F56A 3BNEA 3Q2PA 1CQSA 3SVAA 3BNCA 1NJI4 1DVDA 1AVKA 1VQP3 3HIIA 1KWIA 1W6CA 3B4OA 3MG3A 4JRFA 4R80A 1W5ZA 1Q824 1OUNA 3HI7A 1VQ83 3WMDA 3D79A 2UUGC 3FF2A 2GU3A 2HMLB 3AMOB 1QALA 2CFGA 2OCTA 2CWVA 2O9UX 1AVLA 1JNQA 2Z6BA 2CX1A 3DGLA 1CH0A 4AEQA 3RGRA 1T5YA 2P0MA 4WWUC 3CD63 2SBLA 1Q40A 4HKVB 3GAXA 3DY5A 4XBXA 3BB9A 3NBBA 1BNIA 1DVCA 1A2PA 1W7CA 2Q07A 3EB8A 2WGQA 1RCLA 3Q1CA 1RGGA 1GY7A 1RDSA 1ZO2A 2RFRA 2BU4A 5JPPA 1T3BA 3ECFA 3KFQC 4IT7A 4MMZB 5G1KA 2WOHA 3LTAA 1R4CA 1RJOA 3PZWA 1LNIA 1YIT3 1LNHA 3F40A 4MEIA 4KZ1A 4WP5A 4XM4A 3S28A 1UCKA 4HYZA 2RBIA 3EBTA 4RNTA 1K734 1BNJA 1G96A 1GOYA 1GMQA 1DMMA 1B2SA 2BO9B 2FXTA 3MKIA 1LVNA 1KSIA 4WYKA 2XSOB 5IG0A 4CCVA 3KCHA 3LXUX 4X2OA 4J5GA 1PYLA 2H0IA 3MWZA 4KFFA 1YVBI 1D6YA 3SOAA 1SIIA 1BGSA 2QGUA 2ZHXB 1IVWA 3MG1A 1MOLA 1BU4A 1TFKA 1BRSA 1MNLA 1OHPA 4OUQA 1VQK3 3EBYA 3LT9A 5AEUB 3B7CA 1S5AA 4XDWA 1FGTA 1VQQA 3U97A 3RDEA 2YFLB 2SARA 1B21A 1JBTA 4NREA 3CCQ3 2JQ5A 1D6ZA 1S723 4LEHA 4MJDA 5AIHA 3F8HA 1B2XA 3LTBA 3JUQA 3NM7A 5EVHA 3V98A 3KN4A 2IUKA 1B27A 1F8NA 1JB4A 1E3RA 3F14A 3BNDA 2CWUA 2HMMB 3NBRA 3OV4A 4Q53A 4LZIA 3VF1A 2P05A 3WODG 3A5EA 3OW22 1A90A 3CCU3 1T2HA 4HVNA 2HOHA 2Z7AA 4J8TA 3G4S3 2KF6A 1K8A4 2F99A 1FUTA 5IENA 3IMAB 1GSPA 1W01A 1JZOA 1JN5B 1V57A 1BRGA 2GXFA 2XF3A 3DZLA 3K63A 4CJNA 3S29A 1SPUA 2D1WA 1TIJA 2CFKA 4LMIA 3HK4A 5AI1A 4BTWA 2L4VA 3JUOA 2W03A 2A15A 3G16A 1BOXA 1Z1SA 2GSPA 2WO0A 4N6LA 6GSPA 4GB5A 1N5HA 1BRJA 2F5MA 5IEOA 1LOYA 1STFI 2F98A 1RTUA 3FGYA 2J8XB 4XBYA 2HMJB 2ML6A 1BRNL 2C10A 3I553 1OHOA 3G713 8RNTA 5AEWB 1UUVB 2LYXA 3LTDA 5KP3A 3FCSB 3WHOA 1TU5A 1VQO3 1IQYA 1I2EA 4PEJA 1YNVX 1ZX2A 3B4PA 1NB3I 5DREA 3X41A 3NHXA 2W04A 3DMCA 3F7SA 1VQM3 3MYTA 1MGRA 1ROAA 4WHAA 1MWUA 3D4AA 1A2KA 5CF2A 3ZG0A 5IW9A 2P0XA 1N8QA 4TX4A 2BT3A 1W2B2 2GBXB 2I9WA 1N9JA 1WTHA 1RSNA 1GY5A 2C11A 3K0ZA 1X1WA 1MWSA 1Q42A 4HM4B 1MWTA 2P09A 1I8VA 3DXOA 2BHMA 4N6TA 4KVHA 1I70A 4WFOA 2MC8A 4I4KA 3LOYA 4R9KA 1K28A 5BVBA 3Q90A 1ISKA 3CME3 3NUVA 2OWPA 1E3VA 4HJLB 2F86B 3LMLA
chains in the Genus database with same CATH topology
4FMBA 4CDLA 3IPTA 2ML5A 4R9LA 3SEDA 4L8OA 2E2VA 3LT8A 1GD4A 2CG1A 4XB5A 1IV7A 1U5OA 1W4NA 3KE7A 3V92A 1V74A 5ELUA 4FMDA 1WMNA 4N6V0 4G1MB 2B24B 3UJMA 3O8YA 1N8R4 2O3OA 3LTCA 4H3UA 3M8CA 1O7MB 3RGAA 1GS3A 3D3LA 1OACA 3X42A 1EQKA 1O7GB 1W6GA 2HMNB 1Q814 1AV4A 1TFOA 3UL6A 1NWWA 1GD3A 1E97A 3WOEB 2W9PA 1IQ8A 3NBJA 1PFPA 3EN8A 3SX1A 2V1LA 5CLKA 4STDA 3CCM3 2QIYA 3GZRA 1DMQA 1Q40B 2M7OA 4N6UA 3E99A 1IU7A 3MG2A 3MSOA 1IVVA 3GZXB 3EN1B 3X3ZA 2W56A 1WMPA 2GEXA 4HM0B 3CC73 1DYUA 3NV0A 4K61A 4HZ9B 1GYBA 3NM2A 2CK3H 3CCS3 2OQEA 2R4IA 1VQ53 4WYKB 1UI7A 4K90B 1FGRA 4ZM8A 1IV9A 2YFJB 4QWTA 4FMCA 5IEPA 3OWYA 1YJW3 1HKXA 3EHCA 5LC6A 2WOFA 1YGEA 2JDIH 3OXAA 4OK0A 5IG5A 1K9M4 3I563 4L7KA 3LYGA 1JB5A 1IQXA 1WNHA 3LH4A 2CFLA 1J2BA 2P38A 1EA2A 4RNYA 3WOFB 2QEX3 1OGXA 4NHFA 2KCDA 1CYUA 2D42A 1JV2B 2CW9A 5D81A 2CFWA 3VSYA 4KFDA 2RCDA 3KKGA 2PNCA 2WGOA 1CYVA 3CNXA 3UL5A 1QAKA 1STDA 3EC9A 1EKMA 1SIHA 2XR8B 1ASKA 1UUWB 3FG3A 4FCZA 3CC43 1YJN3 5LC7A 3FKAA 1VQN3 3JUNA 5ELJA 5JPUA 3CCJ3 1FUWA 2RGQA 1SQWA 3CC23 2K54A 3CMA3 1W00A 1QAFA 2KRTA 4RNZA 3FG1A 2GBWB 3BLZA 4XDVA 1VQ93 5AIFA 2Y73A 3NQYA 4IIAA 4U13A 1UW1A 3CPOA 3ER7A 1YIJ3 1WMOA 1US1A 2OQEC 1Y4KA 3CCE3 2UX0A 1QVG2 3K9MC 2IA7A 1JKGA 1O7NB 4L8PA 1YJ93 6STDA 3FZWA 2XGLA 4HM8B 5IG4A 1YI23 2KXGA 3N54B 4FR9A 2CH9A 4K1UA 5TGNA 1SJWA 3PCRA 4BTYA 2Z76A 1W6YA 3VGNA 5CF1A 3I0YA 4EC6A 1QVF2 1M904 2BMRB 3KSPA 4HM3B 3MPHA 2BMQB 2B1XB 1JB2A 3OWUA 1UI8A 2CIUA 3FSDA 4HZBB 4MMYB 3DM8A 3GWRA 3UNLA 2ZL8A 3G8ZA 1W02A 2HMKB 1O7PB 4AKZA 2PZVA 1OF5A 3S5CA 1RRLA 3G0KA 1BUQA 2XH9A 4EYCA 1A2VA 4ORLA 4EBGA 2YX9A 4N6OB 2CC3A 3T8NA 3MHEA 7STDA 2INXA 1IT7A 3AMOA 2CG0A 4O8SA 4O3VA 2CHCA 3EX9A 3X3YA 3WA2X 2OOVA 2IMJA 1LXEA 2FNQA 5I97A 1VQ63 4N6NB 1IT8A 3NXJA 4O2HA 3FH1A 1IVUA 1IDPA 1JRQA 3TDGA 1NU3A 3SLUA 2LQVA 1OGZA 5IF6A 1OPYA 1OCVA 3F8XA 1FGQA 1M9GA 5CK6A 2W9QA 4N6MA 1IVXA 5KP1A 3WDGB 3HX8A 4O02B 5IG3A 3CCL3 3KIIA 4HM5B 1QJGA 1Q7Y4 2GU1A 1ULJB 5D82A 1O7WB 3CNMA 3FG4A 3L0RA 4FCJA 4RZMA 2FGTA 2CFDA 2XEPA 4JF8A 4LSOA 1PU4A 4HM7B 1CEWI 1O7HB 3STDA 3IJEB 1TP6A 2W56B 1YHQ3 3GZBA 3H51A 4KFEA 5KP4A 2BNGA 4MMXB 1FGOA 1WQLB 2HMOB 3CCV3 1A67A 1U8CB 2XSHB 3NV0B 3OWSA 5AIGA 3WA3A 2GEYA 4R1KA 3U1WA 4X2HA 1VQ73 1KD14 4HBRA 1IK3A 3S67A 4XBTA 5JBSA 1EG9B 1C7HA 1JJ22 3B8LA 3J7Yd 3HIGA 3NX0A 1KQS2 5AIIA 1HU9A 3A76A 3EQQB 5EEOA 2OOVC 4FMAA 4N3VA 8CHOA 1NB5I 3PXMA 2CWTA 2Y74A 1LOXA 2W0QA 1OH0A 3PS8A 1AR0A 2MF7A 1VQ43 1RKYA 2K0MA 1JN5A 3NQZA 3DGOA 4K1VA 3T8UA 1GY6A 4EXRA 3PGBA 1M1XB 1VZZA 3DGNA 3K7CA 5STDA 4HM6B 4IPBA 4BTXA 3CU3A 2ZDJA 3F9SA 3GRDA 2W6JH 3CPW2 5DRVA 2XFTA 3EJVA 1OHSA 3CCR3 2YFIB 4H61A 2RSXA 3H3HA 1NO3A 1ROVA 5IERA 3JVCA 4AKYA 5EQLA 1K41A 4HM2B 3PYJA 3UB1A 1FA3A 1N9EA 3BNBA 3QK9A 3FLJA 3HZPA 5BXQA 5FW5A 2QA43 4RBNA 3PCSA 3SOYA 3CXC2 2STDA 4LGQA 5FGOA 2XRXB 3K5TA 3ROBA 3JUMA 3X40A 4HM1B 3FF0A 4R4KA 5AYSC 4GL6A 3QRDA 2OTL3 1FGMA 4OVMA 3V99A 1W2ZA 3EF8A 1TUHA 5HGRA 3N8BA 3F7XA 3DUKA 3EE1A 3KZTA 3S27A 4J9AA 3G6E3 3OX9A 1JKGB 3KSED 1DMNA 2BMOB 1L5GB 2CKFB 4EV5A 5CXOA 2Z77A 3SXXA 1D6UA 2E2TA 2W2CA 3JUPA 1NDOB 1RRHA 5A0OB 1M1K4 3N9HA 1RN7A 2E2UA 1KC84 3X3XA 4EV2A 1ULIB 1N5PA 3T0UA 5G2GA 2OTJ3 3DGMA 3D9RA 2IUJA 3GZYB 3ALAA 1QMAA 3LZAA 1Q864 2XGNA 1OF5B 2XFSA 4FCMA 5D83A 5AYRB 3BNEA 3Q2PA 1CQSA 3SVAA 3BNCA 1NJI4 1DVDA 1AVKA 1VQP3 3HIIA 1KWIA 1W6CA 3B4OA 3MG3A 4JRFA 4R80A 1W5ZA 1Q824 1OUNA 3HI7A 1VQ83 3WMDA 3FF2A 2GU3A 2HMLB 3AMOB 1QALA 2CFGA 2OCTA 2CWVA 2O9UX 1AVLA 1JNQA 2Z6BA 3DGLA 4AEQA 3RGRA 1T5YA 2P0MA 4WWUC 3CD63 2SBLA 1Q40A 4HKVB 3GAXA 3DY5A 4XBXA 3BB9A 3NBBA 1DVCA 1W7CA 2Q07A 3EB8A 2WGQA 3Q1CA 1GY7A 1ZO2A 2RFRA 5JPPA 3ECFA 3KFQC 4IT7A 4MMZB 2WOHA 3LTAA 1R4CA 1RJOA 3PZWA 1YIT3 1LNHA 3F40A 4MEIA 4KZ1A 4WP5A 4XM4A 3S28A 4HYZA 3EBTA 1K734 1G96A 2BO9B 2FXTA 1DMMA 3MKIA 4WYKA 5IG0A 1LVNA 1KSIA 2XSOB 4CCVA 3LXUX 4X2OA 3MWZA 4KFFA 1YVBI 1D6YA 3SOAA 1SIIA 2QGUA 3MG1A 1IVWA 1MOLA 1TFKA 1MNLA 1OHPA 1VQK3 4OUQA 3EBYA 3LT9A 5AEUB 3B7CA 1S5AA 4XDWA 1FGTA 3U97A 3RDEA 2YFLB 4NREA 3CCQ3 2JQ5A 1D6ZA 1S723 4LEHA 4MJDA 5AIHA 3F8HA 3LTBA 3JUQA 3NM7A 5EVHA 3V98A 3KN4A 2IUKA 1F8NA 1JB4A 1E3RA 3F14A 3BNDA 2CWUA 2HMMB 3NBRA 3OV4A 4Q53A 4LZIA 3VF1A 2P05A 3WODG 3OW22 1A90A 3CCU3 4HVNA 2Z7AA 4J8TA 3G4S3 1K8A4 2F99A 5IENA 3IMAB 1W01A 2GXFA 1JN5B 2XF3A 3DZLA 3K63A 3S29A 1SPUA 2D1WA 1TIJA 2CFKA 4LMIA 3HK4A 5AI1A 4BTWA 2L4VA 3JUOA 2W03A 2A15A 3G16A 1Z1SA 2WO0A 4N6LA 4GB5A 1N5HA 5IEOA 1STFI 2F98A 3FGYA 4XBYA 2HMJB 2ML6A 2C10A 3I553 1OHOA 3G713 5AEWB 1UUVB 2LYXA 3LTDA 5KP3A 3FCSB 1TU5A 1VQO3 1VQL3 1IQYA 4PEJA 3X41A 1ZX2A 3B4PA 1NB3I 5DREA 3NHXA 2W04A 3DMCA 3F7SA 1VQM3 3MYTA 1ROAA 4WHAA 1A2KA 5CF2A 5IW9A 2P0XA 1N8QA 4TX4A 2BT3A 1W2B2 2GBXB 2I9WA 1N9JA 1WTHA 1GY5A 2C11A 3K0ZA 1Q42A 4HM4B 2P09A 2MC8A 3DXOA 2BHMA 4N6TA 4KVHA 4WFOA 4I4KA 3LOYA 4R9KA 1K28A 5BVBA 3Q90A 1ISKA 3CME3 3NUVA 2OWPA 1E3VA 4HJLB 2F86B 3LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDL A;  3IPT A;  4R9L A;  3SED A;  4L8O A;  4XB5 A;  1U5O A;  3KE7 A;  2B24 B;  3UJM A;  4H3U A;  3M8C A;  1O7M B;  3RGA A;  1GS3 A;  1O7G B;  2HMN B;  1NWW A;  1E97 A;  3EN8 A;  5CLK A;  4STD A;  2QIY A;  3GZR A;  1DMQ A;  1Q40 B;  3E99 A;  3MG2 A;  3MSO A;  3GZX B;  3EN1 B;  2GEX A;  4HM0 B;  3NV0 A;  4HZ9 B;  1GYB A;  3NM2 A;  2R4I A;  4WYK B;  2YFJ B;  5IEP A;  3OWY A;  1HKX A;  3EHC A;  3OXA A;  5IG5 A;  4L7K A;  3LYG A;  1JB5 A;  1EA2 A;  1OGX A;  5D81 A;  3VSY A;  2RCD A;  3KKG A;  3CNX A;  1STD A;  3EC9 A;  2XR8 B;  1ASK A;  1UUW B;  3FKA A;  3JUN A;  5JPU A;  2RGQ A;  2K54 A;  1W00 A;  2GBW B;  3BLZ A;  4XDV A;  5AIF A;  4IIA A;  4U13 A;  3CPO A;  3ER7 A;  2UX0 A;  1JKG A;  1O7N B;  4L8P A;  6STD A;  3FZW A;  4HM8 B;  5IG4 A;  5TGN A;  4K1U A;  1SJW A;  2Z76 A;  1W6Y A;  3VGN A;  5CF1 A;  3I0Y A;  2BMR B;  3KSP A;  4HM3 B;  2BMQ B;  2B1X B;  1JB2 A;  3OWU A;  3FSD A;  4HZB B;  3DM8 A;  3GWR A;  3UNL A;  3G8Z A;  1W02 A;  2HMK B;  1O7P B;  2PZV A;  1OF5 A;  3S5C A;  3G0K A;  1BUQ A;  4ORL A;  3T8N A;  3MHE A;  7STD A;  2INX A;  2CHC A;  3EX9 A;  2IMJ A;  3NXJ A;  3FH1 A;  1IDP A;  1NU3 A;  1OGZ A;  5IF6 A;  1OPY A;  1OCV A;  3F8X A;  5CK6 A;  5KP1 A;  3HX8 A;  5IG3 A;  4HM5 B;  1QJG A;  1ULJ B;  5D82 A;  1O7W B;  3CNM A;  4RZM A;  4FCJ A;  4HM7 B;  1O7H B;  3STD A;  1TP6 A;  3GZB A;  3H51 A;  5KP4 A;  2BNG A;  1WQL B;  2HMO B;  2XSH B;  3NV0 B;  3OWS A;  5AIG A;  2GEY A;  4R1K A;  4X2H A;  4XBT A;  1EG9 B;  1C7H A;  3B8L A;  5AII A;  3A76 A;  3EQQ B;  8CHO A;  4N3V A;  1OH0 A;  1AR0 A;  1JN5 A;  4K1V A;  3T8U A;  1GY6 A;  1VZZ A;  3K7C A;  5STD A;  4HM6 B;  3CU3 A;  3F9S A;  3GRD A;  5DRV A;  3EJV A;  1OHS A;  2YFI B;  3H3H A;  5IER A;  1K41 A;  4HM2 B;  3FLJ A;  3HZP A;  5BXQ A;  5FW5 A;  3SOY A;  2STD A;  4LGQ A;  2XRX B;  3ROB A;  3JUM A;  4HM1 B;  3FF0 A;  4OVM A;  3EF8 A;  1TUH A;  5HGR A;  3F7X A;  3DUK A;  3KZT A;  4J9A A;  3OX9 A;  1JKG B;  1DMN A;  2BMO B;  2CKF B;  5CXO A;  2Z77 A;  2W2C A;  3JUP A;  1NDO B;  1ULI B;  5G2G A;  3D9R A;  3GZY B;  1QMA A;  3LZA A;  1OF5 B;  4FCM A;  5D83 A;  1CQS A;  3B4O A;  3MG3 A;  1OUN A;  3WMD A;  3FF2 A;  2HML B;  3RGR A;  4WWU C;  1Q40 A;  4HKV B;  4XBX A;  3BB9 A;  1GY7 A;  1ZO2 A;  2RFR A;  5JPP A;  3ECF A;  4XM4 A;  3F40 A;  4WP5 A;  3EBT A;  3MKI A;  1DMM A;  4WYK A;  5IG0 A;  2XSO B;  4X2O A;  3SOA A;  2QGU A;  3MG1 A;  1OHP A;  4OUQ A;  3EBY A;  5AEU B;  3B7C A;  1S5A A;  4XDW A;  2YFL B;  2JQ5 A;  4LEH A;  4MJD A;  5AIH A;  3F8H A;  3JUQ A;  5EVH A;  1JB4 A;  1E3R A;  3F14 A;  2HMM B;  3NBR A;  3OV4 A;  4Q53 A;  4HVN A;  2Z7A A;  4J8T A;  2F99 A;  5IEN A;  1W01 A;  2GXF A;  1JN5 B;  3DZL A;  4LMI A;  3HK4 A;  5AI1 A;  3JUO A;  2A15 A;  3G16 A;  1Z1S A;  4GB5 A;  5IEO A;  2F98 A;  3FGY A;  4XBY A;  2HMJ B;  1OHO A;  5AEW B;  1UUV B;  5KP3 A;  4PEJ A;  1ZX2 A;  3B4P A;  5DRE A;  3NHX A;  3DMC A;  3F7S A;  3MYT A;  1A2K A;  5CF2 A;  2GBX B;  2I9W A;  1GY5 A;  3K0Z A;  1Q42 A;  4HM4 B;  3DXO A;  4KVH A;  4I4K A;  4R9K A;  5BVB A;  3Q90 A;  1ISK A;  3NUV A;  2OWP A;  1E3V A;  4HJL B;  2F86 B; 
#chains in the Genus database with same CATH topology
 4FMB A;  1JZD A;  3IPT A;  1I2F A;  1BIR A;  4CDL A;  2ML5 A;  4R9L A;  2R41 A;  3SED A;  4L8O A;  2E2V A;  3LT8 A;  1GD4 A;  2CG1 A;  4XB5 A;  3DGY A;  1IV7 A;  1U5O A;  1W4N A;  3KE7 A;  1RGL A;  1B3S A;  1V74 A;  3V92 A;  1Q7H A;  5ELU A;  4FMD A;  1WMN A;  3D5G A;  4G1M B;  4N6V 0;  2BIR A;  2B24 B;  3UJM A;  3O8Y A;  1N8R 4;  2O3O A;  3LTC A;  4H3U A;  3M8C A;  1O7M B;  3RGA A;  1GS3 A;  1EUI C;  3AGN A;  4BL3 A;  1AQZ A;  3D3L A;  3ZG5 A;  1OAC A;  3X42 A;  1EQK A;  1GMR A;  1O7G B;  1X1U A;  3SYU A;  1W6G A;  2HMN B;  1Q81 4;  1AV4 A;  1I3F A;  1TFO A;  3UL6 A;  1NWW A;  1GD3 A;  1E97 A;  1RNT A;  3WOE B;  1BUJ A;  2W9P A;  2KAA A;  4J5K A;  1IQ8 A;  3NBJ A;  1PFP A;  1I2G A;  3EN8 A;  4BL2 A;  4HOH A;  3SX1 A;  2V1L A;  5CLK A;  1GOU A;  4STD A;  3CCM 3;  2QIY A;  3GZR A;  5G1L A;  1DMQ A;  1Q40 B;  1IYY A;  2M7O A;  1DE3 A;  4N6U A;  3E99 A;  1IU7 A;  3MG2 A;  5GSP A;  3MSO A;  1IVV A;  3GZX B;  3EN1 B;  1V58 A;  3X3Z A;  2W56 A;  1X1Y A;  1WMP A;  2IYJ A;  2GEX A;  4HM0 B;  3CC7 3;  1MWR A;  1DYU A;  1HZ1 A;  3NV0 A;  4K61 A;  4HZ9 B;  1GYB A;  3NM2 A;  2CK3 H;  3WR2 A;  3CCS 3;  2OQE A;  2R4I A;  1LQM B;  1RGA A;  1VQ5 3;  4WYK B;  1UI7 A;  4K90 B;  1FGR A;  4ZM8 A;  1IV9 A;  2YFJ B;  6RNT A;  4QWT A;  4FMC A;  5IEP A;  3OWY A;  1YJW 3;  1HKX A;  1UCJ A;  3EHC A;  2WOF A;  1YGE A;  2JDI H;  1BRH A;  3OXA A;  4HAA A;  4OK0 A;  5LC6 A;  5IG5 A;  1K9M 4;  3I56 3;  1UGI A;  4L7K A;  3LYG A;  1JB5 A;  1IQX A;  1WNH A;  3LH4 A;  2CFL A;  1LOV A;  1J2B A;  2P38 A;  1EA2 A;  1B2M A;  4RNY A;  3WOF B;  2QEX 3;  1OGX A;  4NHF A;  2KCD A;  1BSD A;  1CYU A;  2H0H A;  2D42 A;  1JV2 B;  2CW9 A;  5D81 A;  2CFW A;  3VSY A;  1BSC A;  4KFD A;  2RCD A;  3KKG A;  2PNC A;  2WGO A;  1CYV A;  3AHS A;  3CNX A;  3UL5 A;  3D5I A;  1QAK A;  1STD A;  3EC9 A;  1EKM A;  1SIH A;  2XR8 B;  1ASK A;  1UUW B;  3FG3 A;  4FCZ A;  1BRI A;  3CC4 3;  1YJN 3;  5LC7 A;  1RNB A;  2KF3 A;  3FKA A;  1VQN 3;  5BIR A;  1BNR A;  3JUN A;  3URP A;  5ELJ A;  5JPU A;  3CCJ 3;  1FUW A;  2RGQ A;  1SAR A;  1LRA A;  1SQW A;  3CC2 3;  2K54 A;  3CMA 3;  1W00 A;  1QAF A;  2KRT A;  4RNZ A;  3FG1 A;  2GBW B;  3Q3F A;  3BLZ A;  4XDV A;  4I5Q A;  1VQ9 3;  5AIF A;  1LOW A;  2Y73 A;  3BIR A;  3NQY A;  1RGK A;  4IIA A;  1UW1 A;  4U13 A;  3CPO A;  3ER7 A;  1YIJ 3;  1WMO A;  1BSA A;  1US1 A;  2OQE C;  1Y4K A;  3CCE 3;  2UX0 A;  1QVG 2;  3K9M C;  2IA7 A;  1YGW A;  1BVI A;  3ZFZ A;  1JKG A;  1O7N B;  4L8P A;  1YJ9 3;  6STD A;  3FZW A;  2C4B A;  1YVS A;  2XGL A;  1I3I A;  1MGW A;  4HM8 B;  5IG4 A;  1YI2 3;  2KXG A;  1AY7 A;  3N54 B;  4FR9 A;  2CH9 A;  4K1U A;  5TGN A;  1SJW A;  3PCR A;  4BTY A;  2Z76 A;  1W6Y A;  3VGN A;  5CF1 A;  3I0Y A;  1GOV A;  4EC6 A;  1QVF 2;  1M90 4;  2BMR B;  3KSP A;  1DET A;  4HM3 B;  3MPH A;  2BMQ B;  2B1X B;  1JB2 A;  1HYF A;  2F5W A;  1UUG B;  3OWU A;  1UI8 A;  2CIU A;  3FSD A;  4HZB B;  4BU4 A;  4MMY B;  3DM8 A;  3GWR A;  3UNL A;  2ZL8 A;  3G8Z A;  1W02 A;  2HMK B;  4BIR A;  1O7P B;  2KF4 A;  4AKZ A;  3AGO A;  1UCL A;  2PZV A;  2F4Y A;  1OF5 A;  3S5C A;  1RRL A;  4EW5 A;  3G0K A;  1RN4 A;  1BUQ A;  2XH9 A;  4EYC A;  1A2V A;  4ORL A;  4EBG A;  2YX9 A;  4ILF A;  1NNV A;  4N6O B;  3GSP A;  2CC3 A;  3T8N A;  3MHE A;  1TTO A;  2INX A;  7STD A;  1IT7 A;  3AMO A;  2CG0 A;  4O8S A;  4KT3 B;  4O3V A;  1G02 A;  2CHC A;  1BSE A;  3EX9 A;  3X3Y A;  3WA2 X;  2OOV A;  1RMS A;  1RCK A;  2IMJ A;  1LXE A;  2FNQ A;  5I97 A;  1VQ6 3;  4N6N B;  1IT8 A;  3NXJ A;  4O2H A;  3DH2 A;  3FH1 A;  1IVU A;  1IDP A;  1JRQ A;  1UGH I;  3TDG A;  1NU3 A;  3SLU A;  2LQV A;  1OGZ A;  5IF6 A;  1B20 A;  1OCV A;  1OPY A;  2IY2 A;  3F8X A;  1FGQ A;  1M9G A;  5CK6 A;  2W9Q A;  4N6M A;  1LQG C;  1JBS A;  1IVX A;  5KP1 A;  3WDG B;  3HX8 A;  4O02 B;  1B2U A;  5IG3 A;  3CCL 3;  1BRK A;  3KII A;  4HM5 B;  1RGC A;  1QJG A;  1RHL A;  1Q7Y 4;  1I0X A;  1I0V A;  2GU1 A;  1ULJ B;  5D82 A;  1O7W B;  1BAN A;  3CNM A;  3FG4 A;  1ZS7 A;  3L0R A;  4FCJ A;  4RZM A;  1R4Y A;  1VQL 3;  2FGT A;  2CFD A;  2XEP A;  4JF8 A;  2CX0 A;  4LSO A;  1PU4 A;  4HM7 B;  1FYS A;  1CEW I;  2K3D A;  2L1S A;  1O7H B;  3STD A;  3IJE B;  1TP6 A;  2W56 B;  1YHQ 3;  3GZB A;  3H51 A;  4KFE A;  5KP4 A;  2BNG A;  4MMX B;  1BNF A;  1FGO A;  1WQL B;  2HMO B;  3CCV 3;  1A67 A;  1TRP A;  1U8C B;  2XSH B;  3NV0 B;  3OWS A;  5AIG A;  3WA3 A;  2RNT A;  1GMP A;  2GEY A;  4R1K A;  3U1W A;  4X2H A;  1VQ7 3;  1BNG A;  4HBR A;  1IK3 A;  1KD1 4;  3S67 A;  4XBT A;  5JBS A;  1EG9 B;  5M18 A;  1C7H A;  1JJ2 2;  3B8L A;  3J7Y d;  3HIG A;  3NX0 A;  1KQS 2;  5AII A;  2KF5 A;  1HU9 A;  1UDI I;  1X1X A;  3A76 A;  2OOV C;  3EQQ B;  4FMA A;  4N3V A;  5EEO A;  8CHO A;  5HOH A;  1NB5 I;  1BSB A;  3PXM A;  2CWT A;  2Y74 A;  1LOX A;  2W0Q A;  1OH0 A;  3PS8 A;  1AR0 A;  2MF7 A;  1VQ4 3;  1RKY A;  2K0M A;  1JN5 A;  1Q9E A;  3NQZ A;  3DGO A;  1T2I A;  4K1V A;  3T8U A;  1GY6 A;  4EXR A;  1RGF A;  1BAO A;  1BNE A;  1FUS A;  3PGB A;  1M1X B;  1VZZ A;  3DGN A;  3K7C A;  5STD A;  4HM6 B;  4IPB A;  4BTX A;  5RNT A;  3CU3 A;  2ZDJ A;  3F9S A;  3GRD A;  2W6J H;  1PY3 A;  4GSP A;  2XFT A;  3EJV A;  5DRV A;  3CPW 2;  1OHS A;  3HOH A;  3CCR 3;  2YFI B;  4H61 A;  2RSX A;  1UCI A;  3H3H A;  5M1A A;  1NO3 A;  1G0T A;  1ROV A;  5IER A;  3JVC A;  4AKY A;  5EQL A;  1K41 A;  1TRQ A;  4HM2 B;  7GSP A;  3PYJ A;  3UB1 A;  1FA3 A;  1N9E A;  1RLS A;  1JBR A;  3BNB A;  3QK9 A;  3FLJ A;  3HZP A;  5BXQ A;  9RNT A;  5FW5 A;  2QA4 3;  4RBN A;  1BNS A;  3PCS A;  3SOY A;  3CXC 2;  2STD A;  4LGQ A;  5FGO A;  4GHO A;  2XRX B;  1RGE A;  3K5T A;  3JUM A;  4LYL B;  3ROB A;  1RGH A;  3X40 A;  4CPK A;  5BU4 A;  4HM1 B;  3FF0 A;  4R4K A;  5AYS C;  1RN1 A;  4GL6 A;  3QRD A;  1FZU A;  2OTL 3;  1FGM A;  1C54 A;  4OVM A;  3V99 A;  1W2Z A;  3EF8 A;  1TUH A;  5HGR A;  3N8B A;  3F7X A;  3DUK A;  3EE1 A;  3KZT A;  3S27 A;  1FW7 A;  4J9A A;  5M19 A;  3G6E 3;  3OX9 A;  1JKG B;  3KSE D;  1DMN A;  2BMO B;  1B2Z A;  2CKF B;  1L5G B;  4EV5 A;  3RNT A;  5CXO A;  1EEJ A;  2UGI A;  2Z77 A;  3SXX A;  1D6U A;  4DKI A;  2E2T A;  2W2C A;  3JUP A;  1NDO B;  1RRH A;  5A0O B;  1M1K 4;  3N9H A;  1RN7 A;  3BU4 A;  2H0G A;  2E2U A;  2AAD A;  2AAE A;  1KC8 4;  3X3X A;  4EV2 A;  1ZGX A;  3AHW A;  1ULI B;  1N5P A;  3T0U A;  5G2G A;  7RNT A;  2OTJ 3;  3DGM A;  1TJD A;  3D9R A;  2IUJ A;  3GZY B;  3ALA A;  1QMA A;  2ZA4 A;  3LZA A;  1Q86 4;  2XGN A;  1OF5 B;  2XFS A;  4FCM A;  5D83 A;  5AYR B;  4NPB A;  2F56 A;  3BNE A;  3Q2P A;  1CQS A;  3SVA A;  3BNC A;  1NJI 4;  1DVD A;  1AVK A;  1VQP 3;  3HII A;  1KWI A;  1W6C A;  3B4O A;  3MG3 A;  4JRF A;  4R80 A;  1W5Z A;  1Q82 4;  1OUN A;  3HI7 A;  1VQ8 3;  3WMD A;  3D79 A;  2UUG C;  3FF2 A;  2GU3 A;  2HML B;  3AMO B;  1QAL A;  2CFG A;  2OCT A;  2CWV A;  2O9U X;  1AVL A;  1JNQ A;  2Z6B A;  2CX1 A;  3DGL A;  1CH0 A;  4AEQ A;  3RGR A;  1T5Y A;  2P0M A;  4WWU C;  3CD6 3;  2SBL A;  1Q40 A;  4HKV B;  3GAX A;  3DY5 A;  4XBX A;  3BB9 A;  3NBB A;  1BNI A;  1DVC A;  1A2P A;  1W7C A;  2Q07 A;  3EB8 A;  2WGQ A;  1RCL A;  3Q1C A;  1RGG A;  1GY7 A;  1RDS A;  1ZO2 A;  2RFR A;  2BU4 A;  5JPP A;  1T3B A;  3ECF A;  3KFQ C;  4IT7 A;  4MMZ B;  5G1K A;  2WOH A;  3LTA A;  1R4C A;  1RJO A;  3PZW A;  1LNI A;  1YIT 3;  1LNH A;  3F40 A;  4MEI A;  4KZ1 A;  4WP5 A;  4XM4 A;  3S28 A;  1UCK A;  4HYZ A;  2RBI A;  3EBT A;  4RNT A;  1K73 4;  1BNJ A;  1G96 A;  1GOY A;  1GMQ A;  1DMM A;  1B2S A;  2BO9 B;  2FXT A;  3MKI A;  1LVN A;  1KSI A;  4WYK A;  2XSO B;  5IG0 A;  4CCV A;  3KCH A;  3LXU X;  4X2O A;  4J5G A;  1PYL A;  2H0I A;  3MWZ A;  4KFF A;  1YVB I;  1D6Y A;  3SOA A;  1SII A;  1BGS A;  2QGU A;  2ZHX B;  1IVW A;  3MG1 A;  1MOL A;  1BU4 A;  1TFK A;  1BRS A;  1MNL A;  1OHP A;  4OUQ A;  1VQK 3;  3EBY A;  3LT9 A;  5AEU B;  3B7C A;  1S5A A;  4XDW A;  1FGT A;  1VQQ A;  3U97 A;  3RDE A;  2YFL B;  2SAR A;  1B21 A;  1JBT A;  4NRE A;  3CCQ 3;  2JQ5 A;  1D6Z A;  1S72 3;  4LEH A;  4MJD A;  5AIH A;  3F8H A;  1B2X A;  3LTB A;  3JUQ A;  3NM7 A;  5EVH A;  3V98 A;  3KN4 A;  2IUK A;  1B27 A;  1F8N A;  1JB4 A;  1E3R A;  3F14 A;  3BND A;  2CWU A;  2HMM B;  3NBR A;  3OV4 A;  4Q53 A;  4LZI A;  3VF1 A;  2P05 A;  3WOD G;  3A5E A;  3OW2 2;  1A90 A;  3CCU 3;  1T2H A;  4HVN A;  2HOH A;  2Z7A A;  4J8T A;  3G4S 3;  2KF6 A;  1K8A 4;  2F99 A;  1FUT A;  5IEN A;  3IMA B;  1GSP A;  1W01 A;  1JZO A;  1JN5 B;  1V57 A;  1BRG A;  2GXF A;  2XF3 A;  3DZL A;  3K63 A;  4CJN A;  3S29 A;  1SPU A;  2D1W A;  1TIJ A;  2CFK A;  4LMI A;  3HK4 A;  5AI1 A;  4BTW A;  2L4V A;  3JUO A;  2W03 A;  2A15 A;  3G16 A;  1BOX A;  1Z1S A;  2GSP A;  2WO0 A;  4N6L A;  6GSP A;  4GB5 A;  1N5H A;  1BRJ A;  2F5M A;  5IEO A;  1LOY A;  1STF I;  2F98 A;  1RTU A;  3FGY A;  2J8X B;  4XBY A;  2HMJ B;  2ML6 A;  1BRN L;  2C10 A;  3I55 3;  1OHO A;  3G71 3;  8RNT A;  5AEW B;  1UUV B;  2LYX A;  3LTD A;  5KP3 A;  3FCS B;  3WHO A;  1TU5 A;  1VQO 3;  1IQY A;  1I2E A;  4PEJ A;  1YNV X;  1ZX2 A;  3B4P A;  1NB3 I;  5DRE A;  3X41 A;  3NHX A;  2W04 A;  3DMC A;  3F7S A;  1VQM 3;  3MYT A;  1MGR A;  1ROA A;  4WHA A;  1MWU A;  3D4A A;  1A2K A;  5CF2 A;  3ZG0 A;  5IW9 A;  2P0X A;  1N8Q A;  4TX4 A;  2BT3 A;  1W2B 2;  2GBX B;  2I9W A;  1N9J A;  1WTH A;  1RSN A;  1GY5 A;  2C11 A;  3K0Z A;  1X1W A;  1MWS A;  1Q42 A;  4HM4 B;  1MWT A;  2P09 A;  1I8V A;  3DXO A;  2BHM A;  4N6T A;  4KVH A;  1I70 A;  4WFO A;  2MC8 A;  4I4K A;  3LOY A;  4R9K A;  1K28 A;  5BVB A;  3Q90 A;  1ISK A;  3CME 3;  3NUV A;  2OWP A;  1E3V A;  4HJL B;  2F86 B;  3LML A; 
#chains in the Genus database with same CATH homology
 4FMB A;  4CDL A;  3IPT A;  2ML5 A;  4R9L A;  3SED A;  4L8O A;  2E2V A;  3LT8 A;  1GD4 A;  2CG1 A;  4XB5 A;  1IV7 A;  1U5O A;  1W4N A;  3KE7 A;  3V92 A;  1V74 A;  5ELU A;  4FMD A;  1WMN A;  4N6V 0;  4G1M B;  2B24 B;  3UJM A;  3O8Y A;  1N8R 4;  2O3O A;  3LTC A;  4H3U A;  3M8C A;  1O7M B;  3RGA A;  1GS3 A;  3D3L A;  1OAC A;  3X42 A;  1EQK A;  1O7G B;  1W6G A;  2HMN B;  1Q81 4;  1AV4 A;  1TFO A;  3UL6 A;  1NWW A;  1GD3 A;  1E97 A;  3WOE B;  2W9P A;  1IQ8 A;  3NBJ A;  1PFP A;  3EN8 A;  3SX1 A;  2V1L A;  5CLK A;  4STD A;  3CCM 3;  2QIY A;  3GZR A;  1DMQ A;  1Q40 B;  2M7O A;  4N6U A;  3E99 A;  1IU7 A;  3MG2 A;  3MSO A;  1IVV A;  3GZX B;  3EN1 B;  3X3Z A;  2W56 A;  1WMP A;  2GEX A;  4HM0 B;  3CC7 3;  1DYU A;  3NV0 A;  4K61 A;  4HZ9 B;  1GYB A;  3NM2 A;  2CK3 H;  3CCS 3;  2OQE A;  2R4I A;  1VQ5 3;  4WYK B;  1UI7 A;  4K90 B;  1FGR A;  4ZM8 A;  1IV9 A;  2YFJ B;  4QWT A;  4FMC A;  5IEP A;  3OWY A;  1YJW 3;  1HKX A;  3EHC A;  5LC6 A;  2WOF A;  1YGE A;  2JDI H;  3OXA A;  4OK0 A;  5IG5 A;  1K9M 4;  3I56 3;  4L7K A;  3LYG A;  1JB5 A;  1IQX A;  1WNH A;  3LH4 A;  2CFL A;  1J2B A;  2P38 A;  1EA2 A;  4RNY A;  3WOF B;  2QEX 3;  1OGX A;  4NHF A;  2KCD A;  1CYU A;  2D42 A;  1JV2 B;  2CW9 A;  5D81 A;  2CFW A;  3VSY A;  4KFD A;  2RCD A;  3KKG A;  2PNC A;  2WGO A;  1CYV A;  3CNX A;  3UL5 A;  1QAK A;  1STD A;  3EC9 A;  1EKM A;  1SIH A;  2XR8 B;  1ASK A;  1UUW B;  3FG3 A;  4FCZ A;  3CC4 3;  1YJN 3;  5LC7 A;  3FKA A;  1VQN 3;  3JUN A;  5ELJ A;  5JPU A;  3CCJ 3;  1FUW A;  2RGQ A;  1SQW A;  3CC2 3;  2K54 A;  3CMA 3;  1W00 A;  1QAF A;  2KRT A;  4RNZ A;  3FG1 A;  2GBW B;  3BLZ A;  4XDV A;  1VQ9 3;  5AIF A;  2Y73 A;  3NQY A;  4IIA A;  4U13 A;  1UW1 A;  3CPO A;  3ER7 A;  1YIJ 3;  1WMO A;  1US1 A;  2OQE C;  1Y4K A;  3CCE 3;  2UX0 A;  1QVG 2;  3K9M C;  2IA7 A;  1JKG A;  1O7N B;  4L8P A;  1YJ9 3;  6STD A;  3FZW A;  2XGL A;  4HM8 B;  5IG4 A;  1YI2 3;  2KXG A;  3N54 B;  4FR9 A;  2CH9 A;  4K1U A;  5TGN A;  1SJW A;  3PCR A;  4BTY A;  2Z76 A;  1W6Y A;  3VGN A;  5CF1 A;  3I0Y A;  4EC6 A;  1QVF 2;  1M90 4;  2BMR B;  3KSP A;  4HM3 B;  3MPH A;  2BMQ B;  2B1X B;  1JB2 A;  3OWU A;  1UI8 A;  2CIU A;  3FSD A;  4HZB B;  4MMY B;  3DM8 A;  3GWR A;  3UNL A;  2ZL8 A;  3G8Z A;  1W02 A;  2HMK B;  1O7P B;  4AKZ A;  2PZV A;  1OF5 A;  3S5C A;  1RRL A;  3G0K A;  1BUQ A;  2XH9 A;  4EYC A;  1A2V A;  4ORL A;  4EBG A;  2YX9 A;  4N6O B;  2CC3 A;  3T8N A;  3MHE A;  7STD A;  2INX A;  1IT7 A;  3AMO A;  2CG0 A;  4O8S A;  4O3V A;  2CHC A;  3EX9 A;  3X3Y A;  3WA2 X;  2OOV A;  2IMJ A;  1LXE A;  2FNQ A;  5I97 A;  1VQ6 3;  4N6N B;  1IT8 A;  3NXJ A;  4O2H A;  3FH1 A;  1IVU A;  1IDP A;  1JRQ A;  3TDG A;  1NU3 A;  3SLU A;  2LQV A;  1OGZ A;  5IF6 A;  1OPY A;  1OCV A;  3F8X A;  1FGQ A;  1M9G A;  5CK6 A;  2W9Q A;  4N6M A;  1IVX A;  5KP1 A;  3WDG B;  3HX8 A;  4O02 B;  5IG3 A;  3CCL 3;  3KII A;  4HM5 B;  1QJG A;  1Q7Y 4;  2GU1 A;  1ULJ B;  5D82 A;  1O7W B;  3CNM A;  3FG4 A;  3L0R A;  4FCJ A;  4RZM A;  2FGT A;  2CFD A;  2XEP A;  4JF8 A;  4LSO A;  1PU4 A;  4HM7 B;  1CEW I;  1O7H B;  3STD A;  3IJE B;  1TP6 A;  2W56 B;  1YHQ 3;  3GZB A;  3H51 A;  4KFE A;  5KP4 A;  2BNG A;  4MMX B;  1FGO A;  1WQL B;  2HMO B;  3CCV 3;  1A67 A;  1U8C B;  2XSH B;  3NV0 B;  3OWS A;  5AIG A;  3WA3 A;  2GEY A;  4R1K A;  3U1W A;  4X2H A;  1VQ7 3;  1KD1 4;  4HBR A;  1IK3 A;  3S67 A;  4XBT A;  5JBS A;  1EG9 B;  1C7H A;  1JJ2 2;  3B8L A;  3J7Y d;  3HIG A;  3NX0 A;  1KQS 2;  5AII A;  1HU9 A;  3A76 A;  3EQQ B;  5EEO A;  2OOV C;  4FMA A;  4N3V A;  8CHO A;  1NB5 I;  3PXM A;  2CWT A;  2Y74 A;  1LOX A;  2W0Q A;  1OH0 A;  3PS8 A;  1AR0 A;  2MF7 A;  1VQ4 3;  1RKY A;  2K0M A;  1JN5 A;  3NQZ A;  3DGO A;  4K1V A;  3T8U A;  1GY6 A;  4EXR A;  3PGB A;  1M1X B;  1VZZ A;  3DGN A;  3K7C A;  5STD A;  4HM6 B;  4IPB A;  4BTX A;  3CU3 A;  2ZDJ A;  3F9S A;  3GRD A;  2W6J H;  3CPW 2;  5DRV A;  2XFT A;  3EJV A;  1OHS A;  3CCR 3;  2YFI B;  4H61 A;  2RSX A;  3H3H A;  1NO3 A;  1ROV A;  5IER A;  3JVC A;  4AKY A;  5EQL A;  1K41 A;  4HM2 B;  3PYJ A;  3UB1 A;  1FA3 A;  1N9E A;  3BNB A;  3QK9 A;  3FLJ A;  3HZP A;  5BXQ A;  5FW5 A;  2QA4 3;  4RBN A;  3PCS A;  3SOY A;  3CXC 2;  2STD A;  4LGQ A;  5FGO A;  2XRX B;  3K5T A;  3ROB A;  3JUM A;  3X40 A;  4HM1 B;  3FF0 A;  4R4K A;  5AYS C;  4GL6 A;  3QRD A;  2OTL 3;  1FGM A;  4OVM A;  3V99 A;  1W2Z A;  3EF8 A;  1TUH A;  5HGR A;  3N8B A;  3F7X A;  3DUK A;  3EE1 A;  3KZT A;  3S27 A;  4J9A A;  3G6E 3;  3OX9 A;  1JKG B;  3KSE D;  1DMN A;  2BMO B;  1L5G B;  2CKF B;  4EV5 A;  5CXO A;  2Z77 A;  3SXX A;  1D6U A;  2E2T A;  2W2C A;  3JUP A;  1NDO B;  1RRH A;  5A0O B;  1M1K 4;  3N9H A;  1RN7 A;  2E2U A;  1KC8 4;  3X3X A;  4EV2 A;  1ULI B;  1N5P A;  3T0U A;  5G2G A;  2OTJ 3;  3DGM A;  3D9R A;  2IUJ A;  3GZY B;  3ALA A;  1QMA A;  3LZA A;  1Q86 4;  2XGN A;  1OF5 B;  2XFS A;  4FCM A;  5D83 A;  5AYR B;  3BNE A;  3Q2P A;  1CQS A;  3SVA A;  3BNC A;  1NJI 4;  1DVD A;  1AVK A;  1VQP 3;  3HII A;  1KWI A;  1W6C A;  3B4O A;  3MG3 A;  4JRF A;  4R80 A;  1W5Z A;  1Q82 4;  1OUN A;  3HI7 A;  1VQ8 3;  3WMD A;  3FF2 A;  2GU3 A;  2HML B;  3AMO B;  1QAL A;  2CFG A;  2OCT A;  2CWV A;  2O9U X;  1AVL A;  1JNQ A;  2Z6B A;  3DGL A;  4AEQ A;  3RGR A;  1T5Y A;  2P0M A;  4WWU C;  3CD6 3;  2SBL A;  1Q40 A;  4HKV B;  3GAX A;  3DY5 A;  4XBX A;  3BB9 A;  3NBB A;  1DVC A;  1W7C A;  2Q07 A;  3EB8 A;  2WGQ A;  3Q1C A;  1GY7 A;  1ZO2 A;  2RFR A;  5JPP A;  3ECF A;  3KFQ C;  4IT7 A;  4MMZ B;  2WOH A;  3LTA A;  1R4C A;  1RJO A;  3PZW A;  1YIT 3;  1LNH A;  3F40 A;  4MEI A;  4KZ1 A;  4WP5 A;  4XM4 A;  3S28 A;  4HYZ A;  3EBT A;  1K73 4;  1G96 A;  2BO9 B;  2FXT A;  1DMM A;  3MKI A;  4WYK A;  5IG0 A;  1LVN A;  1KSI A;  2XSO B;  4CCV A;  3LXU X;  4X2O A;  3MWZ A;  4KFF A;  1YVB I;  1D6Y A;  3SOA A;  1SII A;  2QGU A;  3MG1 A;  1IVW A;  1MOL A;  1TFK A;  1MNL A;  1OHP A;  1VQK 3;  4OUQ A;  3EBY A;  3LT9 A;  5AEU B;  3B7C A;  1S5A A;  4XDW A;  1FGT A;  3U97 A;  3RDE A;  2YFL B;  4NRE A;  3CCQ 3;  2JQ5 A;  1D6Z A;  1S72 3;  4LEH A;  4MJD A;  5AIH A;  3F8H A;  3LTB A;  3JUQ A;  3NM7 A;  5EVH A;  3V98 A;  3KN4 A;  2IUK A;  1F8N A;  1JB4 A;  1E3R A;  3F14 A;  3BND A;  2CWU A;  2HMM B;  3NBR A;  3OV4 A;  4Q53 A;  4LZI A;  3VF1 A;  2P05 A;  3WOD G;  3OW2 2;  1A90 A;  3CCU 3;  4HVN A;  2Z7A A;  4J8T A;  3G4S 3;  1K8A 4;  2F99 A;  5IEN A;  3IMA B;  1W01 A;  2GXF A;  1JN5 B;  2XF3 A;  3DZL A;  3K63 A;  3S29 A;  1SPU A;  2D1W A;  1TIJ A;  2CFK A;  4LMI A;  3HK4 A;  5AI1 A;  4BTW A;  2L4V A;  3JUO A;  2W03 A;  2A15 A;  3G16 A;  1Z1S A;  2WO0 A;  4N6L A;  4GB5 A;  1N5H A;  5IEO A;  1STF I;  2F98 A;  3FGY A;  4XBY A;  2HMJ B;  2ML6 A;  2C10 A;  3I55 3;  1OHO A;  3G71 3;  5AEW B;  1UUV B;  2LYX A;  3LTD A;  5KP3 A;  3FCS B;  1TU5 A;  1VQO 3;  1VQL 3;  1IQY A;  4PEJ A;  3X41 A;  1ZX2 A;  3B4P A;  1NB3 I;  5DRE A;  3NHX A;  2W04 A;  3DMC A;  3F7S A;  1VQM 3;  3MYT A;  1ROA A;  4WHA A;  1A2K A;  5CF2 A;  5IW9 A;  2P0X A;  1N8Q A;  4TX4 A;  2BT3 A;  1W2B 2;  2GBX B;  2I9W A;  1N9J A;  1WTH A;  1GY5 A;  2C11 A;  3K0Z A;  1Q42 A;  4HM4 B;  2P09 A;  2MC8 A;  3DXO A;  2BHM A;  4N6T A;  4KVH A;  4WFO A;  4I4K A;  3LOY A;  4R9K A;  1K28 A;  5BVB A;  3Q90 A;  1ISK A;  3CME 3;  3NUV A;  2OWP A;  1E3V A;  4HJL B;  2F86 B;  3LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...