1JKGB

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna nuclear export factor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
180
Chain Sequence
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFISSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords p15
total genus 54
structure length 180
sequence length 186
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
B PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jkgB00
4H3UA 1DMMA 1OH0A 2K54A 1JKGA 5CLKA 4HKVB 3MYTA 1OGXA 1DMQA 3S5CA 1NDOB 2YFIB 2Z76A 4K1UA 5CXOA 2Z7AA 1OUNA 1Q42A 4HZBB 1OHPA 1E3RA 3KKGA 3BLZA 1OHSA 2HMKB 3JUMA 1W02A 3FLJA 3LYGA 4OUQA 1ULIB 3MHEA 2CKFB 1JN5A 4HM3B 2HMOB 4HM7B 2QIYA 3STDA 3MKIA 3RGRA 1JB5A 3OWUA 3SOYA 1JB4A 1Q40B 3T8UA 5IG3A 3OWSA 4LMIA 3GZBA 3JUOA 5BXQA 1SJWA 4Q53A 3KZTA 3H3HA 4LEHA 3JUPA 4U13A 4LGQA 3KSPA 4HM0B 3F7SA 4HM2B 4MJDA 4HM4B 1EA2A 3CU3A 3FH1A 3GRDA 3MSOA 2GXFA 1NWWA 3EJVA 3NV0B 4XDVA 3ECFA 5JPPA 1GY5A 1DMNA 1C7HA 1ULJB 2GBWB 3KE7A 4WP5A 3OV4A 3EX9A 2YFLB 3FF2A 2GEXA 3GWRA 3OX9A 4GB5A 1GY7A 4HZ9B 3FZWA 4KVHA 5CF1A 1ZO2A 5STDA 3LZAA 2BNGA 1GS3A 1HKXA 4X2OA 4R1KA 4L8PA 3EF8A 3B8LA 2UX0A 2IMJA 2HMMB 3GZRA 3HZPA 4I4KA 4WYKB 3F8XA 1A2KA 1VZZA 3VGNA 1U5OA 3M8CA 5AIGA 3G0KA 2JQ5A 1QJGA 4HJLB 2A15A 2BMQB 3DZLA 1UUWB 3JUQA 4K1VA 4L8OA 2QGUA 3EBTA 1OF5B 3F9SA 1OCVA 3EN1B 4RZMA 5AI1A 3DUKA 1TUHA 2CHCA 3A76A 3E99A 2XSHB 3FF0A 3IPTA 4X2HA 5IEOA 3UJMA 5D81A 5TGNA 2B24B 2RCDA 3HX8A 3OWYA 5G2GA 1AR0A 3RGAA 5IG4A 4J9AA 5IEPA 2W2CA 3FKAA 3UNLA 3BB9A 1JN5B 2RFRA 3EN8A 4ORLA 5FW5A 5IF6A 3B4OA 3DM8A 5CK6A 3G16A 5AIHA 3NBRA 3SOAA 8CHOA 4R9KA 3GZXB 1ZX2A 2F99A 1E97A 3GZYB 2HMNB 1S5AA 1NU3A 1W01A 3K7CA 3NM2A 2YFJB 3D9RA 4XM4A 1JKGB 3F14A 6STDA 3NHXA 1W00A 2F98A 3FSDA 5AIFA 5AEUB 2B1XB 1GY6A 1O7GB 3B7CA 5CF2A 2BMRB 1TP6A 4R9LA 1O7MB 4XDWA 3NUVA 3NV0A 2OWPA 5AEWB 3F8HA 2HMJB 5KP3A 1ISKA 3I0YA 2XRXB 4L7KA 1QMAA 3F40A 1EG9B 5EVHA 1E3VA 3MG2A 2XR8B 4FCMA 4HM1B 4XBTA 3ROBA 1GYBA 1OHOA 1Q40A 2INXA 1JB2A 2I9WA 3F7XA 3CNMA 3HK4A 3MG1A 1K41A 3MG3A 5BVBA 3EQQB 2BMOB 1OPYA 5IERA 5IG5A 3CPOA 3FGYA 2GBXB 2GEYA 2Z77A 3JUNA 4HM6B 5HGRA 1O7HB 4HM5B 1STDA 5IG0A 3CNXA 3SEDA 1ASKA 4J8TA 5DRVA 3ER7A 1IDPA 1OF5A 2R4IA 3EBYA 3EHCA 4WWUC 2PZVA 4CDLA 2F86B 4FCJA 3VSYA 4OVMA 3B4PA 3EC9A 4PEJA 4HVNA 4STDA 3Q90A 5D83A 3WMDA 2RGQA 1BUQA 3G8ZA 2STDA 2XSOB 3OXAA 5DREA 1W6YA 1O7NB 5KP4A 1CQSA 1WQLB 2HMLB 3DMCA 4XBYA 3T8NA 4IIAA 4XBXA 3H51A 5KP1A 3K0ZA 4WYKA 1Z1SA 3DXOA 4XB5A 3NXJA 5JPUA 4HM8B 1UUVB 1O7PB 7STDA 5D82A 1OGZA 5IENA 4N3VA 1O7WB 5AIIA
chains in the Genus database with same CATH superfamily
2WGOA 1DMMA 5CLKA 3MYTA 1OGXA 1DMQA 1IVVA 3S5CA 1TRPA 5AYRB 2WGQA 2YFIB 8RNTA 2OCTA 3LMLA 4HZBB 1IV7A 3PZWA 2IY2A 2HMKB 2ZA4A 4H61A 3ZFZA 4N6NB 1WNHA 5ELJA 1IK3A 1TFOA 3GSPA 4FCZA 1RMSA 2HMOB 1BNRA 2QIYA 1TJDA 1JB5A 1G02A 2E2UA 5IG3A 4J5KA 1RSNA 3KSED 4BTWA 1BRHA 4DKIA 1RGKA 1IT8A 2W56A 4AKZA 1BANA 1ZS7A 4Q53A 5M1AA 1M1K4 4U13A 3KSPA 4HM4B 1VQL3 3CU3A 3KCHA 3LT8A 1NWWA 4XDVA 1VQ53 1JZOA 2GBWB 4WP5A 3D5GA 4KVHA 2GEXA 1STFI 3OX9A 4GB5A 4HZ9B 5CF1A 1A90A 3X40A 3WA3A 1HKXA 1RGEA 3RNTA 4R1KA 1YNVX 1PU4A 1VQM3 2W03A 1D6ZA 3F8XA 1VZZA 1U5OA 2CFLA 3M8CA 4I5QA 1JBRA 1UGIA 1AVLA 3NBBA 1RGLA 1FGOA 2O3OA 2QGUA 3V99A 1OCVA 4RZMA 2GSPA 1NJI4 1TUHA 3FF0A 2XSHB 4X2HA 4FMAA 2C11A 3UL5A 2RCDA 3K63A 3OWYA 1LOWA 3S28A 1BRJA 7RNTA 1N8R4 1JBSA 4J9AA 3AHSA 2W2CA 3FKAA 4NHFA 1IVWA 4LSOA 1RN7A 3EN8A 1UI7A 1SIIA 3G16A 1Q7HA 3LOYA 5AIHA 3SVAA 2IA7A 1CH0A 1I2FA 1YJ93 1RLSA 2CH9A 1T3BA 2W56B 3CCU3 1S5AA 3NM2A 1W01A 1KD14 3TDGA 6STDA 1FUWA 1JKGB 2OQEC 3N54B 3NHXA 1W00A 2F98A 5BIRA 1GY6A 1JV2B 1O7GB 3V98A 1TP6A 1FUTA 1O7MB 2BHMA 2WOFA 3LXUX 2XGNA 1UCLA 4AEQA 1HYFA 1VQ73 3S67A 1K8A4 2W6JH 3O8YA 1YGEA 2H0HA 5EVHA 3SLUA 1W6GA 2J8XB 2RSXA 3NBJA 3MG3A 1JB2A 2W9PA 2D1WA 3F7XA 5BU4A 1QVF2 1IVXA 2R41A 1VQN3 4KFFA 3NM7A 3FGYA 3JUNA 2Z77A 3PYJA 4WHAA 1MWUA 1EEJA 2BU4A 2CFGA 3CNXA 3ZG5A 4J8TA 1BNJA 2R4IA 2F86B 3VSYA 4OVMA 2E2VA 4ZM8A 4PEJA 3Q90A 3D5IA 1VQ63 4JF8A 1YI23 5DREA 1W6YA 4G1MB 1BIRA 1BSDA 3DMCA 4MEIA 3K0ZA 4BIRA 1AY7A 3FCSB 1QALA 1GOYA 4RNZA 1O7PB 7STDA 5D82A 1DVCA 4HM0B 1F8NA 4J5GA 2M7OA 1O7WB 1IVUA 4K61A 4H3UA 1M9GA 1OH0A 1IQXA 1JKGA 6GSPA 2RNTA 1ROAA 1Q824 1JNQA 5LC6A 4GSPA 1YHQ3 1OUNA 4FMCA 1AQZA 1E3RA 3KKGA 1OHSA 4LYLB 3JUMA 3FLJA 3FG1A 3SYUA 3DH2A 3MHEA 1T2HA 1BNIA 1LXEA 1K9M4 2LQVA 4HM7B 1I3IA 3T8UA 1R4CA 1BU4A 2Y74A 1BVIA 5BXQA 4TX4A 3KZTA 4LEHA 4RNYA 1VQQA 1UW1A 4HM2B 1MWRA 3CPW2 3URPA 3FH1A 3CCL3 4EC6A 2GXFA 4NPBA 2BT3A 1WMOA 1RDSA 1DMNA 1GOVA 3EX9A 2YFLB 1NNVA 4JRFA 3NQZA 1BSAA 1U8CB 1HU9A 1RHLA 1B21A 3DGLA 4EBGA 2P0MA 4L8PA 3EF8A 3G6E3 2IMJA 5G1LA 4BTYA 3Q3FA 3LTDA 3I553 3VGNA 1YJN3 1W4NA 5AIGA 3L0RA 4HJLB 2P38A 3G713 2CFKA 1IYYA 4O8SA 3MWZA 3AHWA 4CDLA 3DGYA 1OF5B 1RGHA 4O02B 5AI1A 2Z6BA 1Q7Y4 2YX9A 2CHCA 3E99A 1HZ1A 2IUKA 3HOHA 5ELUA 1V58A 1GSPA 5D81A 4QWTA 2CG0A 1RKYA 3RGAA 2KRTA 1R4YA 1YVBI 1LQMB 1W2ZA 1V57A 1MOLA 4ORLA 5FW5A 5IF6A 4LZIA 1FA3A 3WA2X 1SIHA 5G1KA 4K90B 8CHOA 1FUSA 2PNCA 1E97A 3X3YA 1NU3A 3K7CA 3FSDA 5JBSA 5AEUB 1I70A 2WOHA 1A67A 3B7CA 3CC23 2BMRB 2CWTA 4R9LA 1FYSA 2F5WA 3AGNA 2ZL8A 5AEWB 1SARA 3AMOA 3X42A 1MGRA 2CFDA 2K0MA 1GMPA 1QMAA 1EG9B 1QAFA 2KF3A 1E3VA 1RGCA 2XR8B 2CX1A 1BRIA 4FCMA 1W7CA 2INXA 2ML6A 4XBTA 1K734 5BVBA 2SARA 5IG5A 6RNTA 3HIIA 1EUIC 4FMDA 2GBXB 2K3DA 1WMPA 2GEYA 2XFTA 3V92A 4NREA 2F5MA 1STDA 5IG0A 1ASKA 5DRVA 4EXRA 1BRNL 4WWUC 3EHCA 2GU3A 2OTL3 5GSPA 1NB5I 1BSBA 1FGQA 4FCJA 1JJ22 1BNGA 2L1SA 3B4PA 3EC9A 2W9QA 4BTXA 2RGQA 5M18A 1L5GB 3FG3A 2STDA 1RRHA 1US1A 2XSOB 3OXAA 1GD3A 1O7NB 5KP4A 1RNTA 1WQLB 4IIAA 1UCJA 5KP1A 1SQWA 4WYKA 2H0IA 5A0OB 3CCV3 3NXJA 2XEPA 1LNIA 3U97A 4CJNA 5JPUA 2QA43 3WR2A 1TFKA 4N3VA 2HMLB 3MPHA 5AIIA 1GMQA 2K54A 1TTOA 3OW22 1YJW3 2D42A 4WFOA 1NDOB 1D6UA 3CCR3 5CXOA 5M19A 1GOUA 2KCDA 1TU5A 1OHPA 3AMOB 1RGFA 3LYGA 1W02A 3S27A 2IYJA 4OK0A 2C4BA 1IT7A 1LOXA 2CWUA 3MKIA 3RGRA 1GMRA 2Q07A 1VQ43 3OWUA 1AVKA 2BO9B 2O9UX 2XGLA 3LTAA 3SOYA 3K5TA 1JZDA 2KXGA 3OWSA 4LMIA 3WOFB 1RNBA 1FGMA 1N8QA 3LTBA 4O2HA 4KFEA 2F56A 3IMAB 4LGQA 1Q9EA 4MJDA 4HAAA 3GRDA 4CCVA 1RN1A 1UGHI 3EJVA 3NV0B 3IJEB 1LNHA 1Q814 4IPBA 5JPPA 4N6LA 3KE7A 3QRDA 3PGBA 3FF2A 4BL3A 1G0TA 3NQYA 3PXMA 1DYUA 1ZO2A 5STDA 2FNQA 3BNBA 1GS3A 4X2OA 3CC73 2F4YA 3PCSA 3DY5A 4HBRA 3B8LA 2UX0A 3GZRA 2HMMB 4I4KA 2AADA 3HIGA 3T0UA 1B2SA 2CX0A 1RTUA 2C10A 3CCM3 1LRAA 2RBIA 5IG4A 1IV9A 3G0KA 1QJGA 3WHOA 4KT3B 2A15A 1UCKA 3DZLA 1UUWB 1NB3I 4K1VA 3EBTA 4KZ1A 1CEWI 1BNFA 2CIUA 3N9HA 1SPUA 1W2B2 1BUQA 5IEOA 5TGNA 1RN4A 3BNEA 1YIJ3 1AR0A 3J7Yd 1B2ZA 2MF7A 5IEPA 1K28A 3UNLA 1I0VA 1VQK3 1UUGB 1KSIA 3S29A 1JRQA 2W04A 3AGOA 3GAXA 2OOVC 3B4OA 3DM8A 4MMZB 1FZUA 4R4KA 5CK6A 1YVSA 4N6OB 4R9KA 1A2PA 1ZX2A 3GZYB 1UCIA 1GD4A 2HMNB 4BL2A 1J2BA 1CYVA 1B20A 1MGWA 2YFJB 4XM4A 3F14A 3CCE3 2KF6A 1UI8A 2OQEA 5CF2A 5LC7A 1MNLA 1RCLA 3QK9A 2SBLA 4XDWA 1WTHA 5EQLA 2OWPA 2LYXA 2HMJB 3VF1A 4KFDA 1BAOA 2W0QA 1DVDA 1MWTA 4L7KA 3JVCA 3DGNA 1LOYA 3CCS3 3ROBA 4EV2A 1OHOA 4FMBA 1Q40A 5IENA 2I9WA 1G96A 1NO3A 3CNMA 1IQYA 1K41A 9RNTA 1B2MA 3EQQB 3N8BA 1OPYA 1BUJA 3G4S3 3CC43 3SX1A 1A2VA 1RGGA 3Q1CA 4HM6B 1O7HB 1BOXA 3DGOA 3CCQ3 1AV4A 4O3VA 5EEOA 1OF5A 1RCKA 2AAEA 1W5ZA 1PFPA 5RNTA 3CCJ3 3D79A 5D83A 4HVNA 1WMNA 1UDII 1VQ83 4IT7A 3G8ZA 3UL6A 4EW5A 1FW7A 3PS8A 3LT9A 3BNCA 3T8NA 4N6TA 3D4AA 2FXTA 1TRQA 3EE1A 3LTCA 1VQO3 1Z1SA 3DXOA 4GHOA 1CYUA 3CMA3 3BIRA 3A5EA 1W6CA 1I3FA 1N9EA 2E2TA 2L4VA 4HKVB 3ALAA 1X1UA 2Z76A 3CXC2 1QVG2 4K1UA 2Z7AA 1VQ93 1Q42A 1B2XA 1Q864 3BLZA 4OUQA 1IU7A 1X1XA 1ULIB 4HM3B 2CKFB 1BGSA 1JN5A 1DE3A 2HOHA 1QAKA 3STDA 1BRKA 3WODG 1M904 5IW9A 4MMXB 1JB4A 1Q40B 1BNEA 1TIJA 3GZBA 2CFWA 3NX0A 1I0XA 1LVNA 3JUOA 3WOEB 1SJWA 3BNDA 4AKYA 3H3HA 3JUPA 2XH9A 1N5PA 1BSCA 2ZHXB 3F7SA 1T5YA 2P09A 1EA2A 2CC3A 1D6YA 3MSOA 1PYLA 4R80A 2H0GA 3X3ZA 5I97A 3ECFA 1GY5A 1C7HA 1ULJB 2BIRA 3OV4A 3GWRA 4CPKA 1GY7A 3Q2PA 3FZWA 3LZAA 1BSEA 2BNGA 1BRGA 1X1WA 1LQGC 2V1LA 3HZPA 4WYKB 2XFSA 4EYCA 7GSPA 1BNSA 1FGRA 1LOVA 1A2KA 2MC8A 4HYZA 1YIT3 2JQ5A 4ILFA 2BMQB 1B2UA 3JUQA 2GU1A 2XF3A 4L8OA 3KN4A 3UB1A 3F9SA 3EN1B 1OACA 2Y73A 3X41A 3DUKA 1I8VA 2KF5A 1ZGXA 2KAAA 2OTJ3 3A76A 3UJMA 3HI7A 3IPTA 2B24B 1M1XB 3HX8A 2CW9A 2UGIA 2CK3H 1KWIA 3PCRA 5G2GA 4MMYB 5FGOA 3SXXA 3CME3 1C54A 1I2GA 2P05A 1JN5B 2RFRA 3BB9A 1B27A 3DGMA 3NBRA 3SOAA 4FR9A 2QEX3 3GZXB 1JBTA 2F99A 2KF4A 1T2IA 3D9RA 3KFQC 1X1YA 3EB8A 5AIFA 1YGWA 1B3SA 1DETA 2B1XB 1KC84 1Y4KA 1RRLA 3NUVA 3NV0A 3K9MC 4EV5A 2ML5A 3F8HA 5KP3A 1PY3A 1ISKA 4HOHA 3I0YA 2XRXB 2JDIH 2WO0A 3F40A 1BRSA 3MG2A 4N6MA 4HM1B 1V74A 1GYBA 2ZDJA 3HK4A 3ZG0A 5HOHA 3MG1A 5IERA 1EQKA 2BMOB 4RNTA 4N6V0 1RJOA 1EKMA 3CPOA 2P0XA 5HGRA 1RGAA 3LH4A 1N9JA 4HM5B 3KIIA 3SEDA 1N5HA 5AYSC 1VQP3 1I2EA 2CG1A 3ER7A 1IDPA 3EBYA 1IQ8A 2PZVA 4BU4A 2FGTA 1FGTA 3FG4A 3X3XA 3WMDA 2CWVA 3D3LA 4STDA 3RDEA 2UUGC 1CQSA 1KQS2 4XBYA 3I563 4XBXA 1MWSA 3H51A 4N6UA 2IUJA 2OOVA 4XB5A 3WDGB 4HM8B 3BU4A 1UUVB 3CD63 1ROVA 3U1WA 4RBNA 1OGZA 4GL6A 1S723
chains in the Genus database with same CATH topology
2WGOA 1DMMA 5CLKA 3MYTA 1OGXA 1DMQA 1IVVA 3S5CA 5AYRB 2WGQA 2YFIB 2OCTA 3LMLA 4HZBB 1IV7A 3PZWA 2HMKB 4H61A 4N6NB 1WNHA 5ELJA 1IK3A 1TFOA 4FCZA 2HMOB 2QIYA 1JB5A 2E2UA 5IG3A 3KSED 4BTWA 1IT8A 2W56A 4AKZA 4Q53A 1M1K4 4U13A 3KSPA 4HM4B 1VQL3 3CU3A 3LT8A 1NWWA 4XDVA 1VQ53 2GBWB 4WP5A 4KVHA 2GEXA 1STFI 3OX9A 4GB5A 4HZ9B 5CF1A 1A90A 3X40A 3WA3A 1HKXA 4R1KA 1PU4A 1VQM3 2W03A 1D6ZA 3F8XA 1VZZA 1U5OA 2CFLA 3M8CA 1AVLA 3NBBA 1FGOA 2O3OA 2QGUA 3V99A 1OCVA 4RZMA 1NJI4 1TUHA 3FF0A 2XSHB 4X2HA 4FMAA 2C11A 3UL5A 2RCDA 3K63A 3OWYA 3S28A 1N8R4 4J9AA 2W2CA 3FKAA 4NHFA 1IVWA 4LSOA 1RN7A 3EN8A 1UI7A 1SIIA 3G16A 3LOYA 5AIHA 3SVAA 2IA7A 1YJ93 2CH9A 2W56B 3CCU3 1S5AA 3NM2A 1W01A 1KD14 3TDGA 6STDA 1FUWA 1JKGB 2OQEC 3N54B 3NHXA 1W00A 2F98A 1GY6A 1JV2B 1O7GB 3V98A 1TP6A 2BHMA 1O7MB 2WOFA 3LXUX 4AEQA 2XGNA 1VQ73 3S67A 1K8A4 2W6JH 3O8YA 1YGEA 5EVHA 3SLUA 1W6GA 2RSXA 3NBJA 3MG3A 1JB2A 2W9PA 2D1WA 3F7XA 1QVF2 1VQN3 1IVXA 4KFFA 3NM7A 3FGYA 3JUNA 2Z77A 3PYJA 4WHAA 2CFGA 3CNXA 4J8TA 2R4IA 2F86B 3VSYA 4OVMA 2E2VA 4ZM8A 4PEJA 3Q90A 1VQ63 4JF8A 1YI23 5DREA 1W6YA 4G1MB 3DMCA 4MEIA 3K0ZA 3FCSB 1QALA 4RNZA 1O7PB 7STDA 5D82A 1DVCA 4HM0B 1F8NA 4K61A 2M7OA 1O7WB 1IVUA 4H3UA 1M9GA 1OH0A 1IQXA 1JKGA 1ROAA 1Q824 1JNQA 5LC6A 1YHQ3 1OUNA 4FMCA 1E3RA 3KKGA 1OHSA 3JUMA 3FLJA 3FG1A 3MHEA 1LXEA 1K9M4 2LQVA 4HM7B 3T8UA 1R4CA 2Y74A 5BXQA 4TX4A 3KZTA 4LEHA 4RNYA 1UW1A 4HM2B 3CPW2 3FH1A 3CCL3 4EC6A 2GXFA 2BT3A 1WMOA 1DMNA 3EX9A 2YFLB 4JRFA 3NQZA 1U8CB 1HU9A 3DGLA 4EBGA 2P0MA 4L8PA 3EF8A 3G6E3 2IMJA 4BTYA 3LTDA 3I553 3VGNA 1YJN3 1W4NA 5AIGA 3L0RA 4HJLB 2P38A 3G713 2CFKA 4O8SA 3MWZA 4CDLA 1OF5B 4O02B 5AI1A 2Z6BA 1Q7Y4 2YX9A 2CHCA 3E99A 2IUKA 5ELUA 5D81A 4QWTA 2CG0A 1RKYA 3RGAA 2KRTA 1YVBI 1W2ZA 1MOLA 4ORLA 5FW5A 5IF6A 4LZIA 1FA3A 3WA2X 1SIHA 4K90B 8CHOA 2PNCA 1E97A 3X3YA 1NU3A 3K7CA 3FSDA 5JBSA 5AEUB 2WOHA 1A67A 3B7CA 3CC23 2BMRB 2CWTA 4R9LA 2ZL8A 5AEWB 3AMOA 3X42A 2CFDA 2K0MA 1QMAA 1EG9B 1QAFA 1E3VA 4XBTA 2XR8B 4FCMA 1K734 1W7CA 2INXA 2ML6A 5BVBA 5IG5A 3HIIA 4FMDA 2GBXB 1WMPA 2GEYA 2XFTA 3V92A 4NREA 1STDA 5IG0A 1ASKA 5DRVA 4EXRA 4WWUC 3EHCA 2GU3A 2OTL3 1NB5I 1FGQA 4FCJA 1JJ22 3B4PA 3EC9A 2W9QA 4BTXA 2RGQA 1L5GB 3FG3A 2STDA 1RRHA 1US1A 2XSOB 3OXAA 1GD3A 1O7NB 5KP4A 1WQLB 4IIAA 5KP1A 1SQWA 4WYKA 5A0OB 3CCV3 3NXJA 2XEPA 3U97A 5JPUA 2QA43 1TFKA 4N3VA 2HMLB 3MPHA 5AIIA 2K54A 3OW22 1YJW3 2D42A 4WFOA 1NDOB 1D6UA 3CCR3 5CXOA 2KCDA 1TU5A 1OHPA 3AMOB 3LYGA 1W02A 3S27A 4OK0A 1IT7A 1LOXA 2CWUA 3MKIA 3RGRA 2Q07A 1VQ43 3OWUA 1AVKA 2BO9B 2O9UX 2XGLA 3LTAA 3SOYA 3K5TA 3OWSA 2KXGA 4LMIA 3WOFB 1FGMA 1N8QA 3LTBA 4O2HA 4KFEA 3IMAB 4LGQA 4MJDA 3GRDA 4CCVA 3EJVA 3NV0B 3IJEB 1LNHA 1Q814 4IPBA 5JPPA 4N6LA 3KE7A 3QRDA 3PGBA 3FF2A 3NQYA 3PXMA 1DYUA 1ZO2A 5STDA 2FNQA 3BNBA 1GS3A 4X2OA 3CC73 3PCSA 3DY5A 4HBRA 3B8LA 2UX0A 3GZRA 2HMMB 4I4KA 3HIGA 3T0UA 2C10A 3CCM3 1IV9A 3G0KA 1QJGA 2A15A 4K1VA 3DZLA 1UUWB 1NB3I 3EBTA 4KZ1A 1CEWI 2CIUA 3N9HA 1SPUA 1W2B2 1BUQA 5IEOA 5TGNA 3BNEA 1YIJ3 1AR0A 3J7Yd 5IEPA 2MF7A 1K28A 3UNLA 1VQK3 1KSIA 3S29A 1JRQA 2W04A 4R4KA 3GAXA 2OOVC 3B4OA 3DM8A 4MMZB 5CK6A 4N6OB 4R9KA 1ZX2A 3GZYB 1J2BA 1GD4A 2HMNB 1CYVA 2YFJB 4XM4A 3F14A 3CCE3 1UI8A 2OQEA 5CF2A 5LC7A 1MNLA 4XDWA 3QK9A 2SBLA 1WTHA 5EQLA 2OWPA 2LYXA 2HMJB 3VF1A 4KFDA 2W0QA 1DVDA 4L7KA 3JVCA 3DGNA 3CCS3 3ROBA 4EV2A 1OHOA 4FMBA 1Q40A 5IENA 2I9WA 1G96A 1NO3A 3CNMA 1IQYA 1K41A 3EQQB 3N8BA 1OPYA 3G4S3 3CC43 3SX1A 1A2VA 3Q1CA 4HM6B 1O7HB 3DGOA 3CCQ3 1AV4A 4O3VA 5EEOA 1OF5A 1W5ZA 1PFPA 3CCJ3 5D83A 4HVNA 1WMNA 1VQ83 4IT7A 3G8ZA 3UL6A 3PS8A 3LT9A 3BNCA 3T8NA 4N6TA 2FXTA 3EE1A 3LTCA 1VQO3 1Z1SA 3DXOA 1CYUA 3CMA3 1W6CA 4HKVB 1N9EA 2E2TA 2L4VA 3ALAA 2Z76A 3CXC2 1QVG2 4K1UA 2Z7AA 1VQ93 1Q42A 1Q864 3BLZA 4OUQA 1IU7A 1ULIB 4HM3B 2CKFB 1JN5A 3WODG 1QAKA 3STDA 1M904 5IW9A 4MMXB 1JB4A 1Q40B 1TIJA 3GZBA 2CFWA 3NX0A 3JUOA 1LVNA 3WOEB 1SJWA 3BNDA 4AKYA 3H3HA 3JUPA 2XH9A 1N5PA 3F7SA 1T5YA 2P09A 1EA2A 2CC3A 1D6YA 3MSOA 4R80A 5I97A 3X3ZA 3ECFA 1GY5A 1C7HA 1ULJB 3OV4A 3GWRA 1GY7A 3Q2PA 3FZWA 3LZAA 2BNGA 2V1LA 3HZPA 4WYKB 2XFSA 4EYCA 1FGRA 1A2KA 2MC8A 4HYZA 1YIT3 2JQ5A 2BMQB 3JUQA 3UB1A 2GU1A 2XF3A 4L8OA 3KN4A 3F9SA 3EN1B 1OACA 2Y73A 3X41A 3DUKA 2OTJ3 3A76A 3UJMA 3HI7A 3IPTA 2B24B 1M1XB 3HX8A 2CW9A 3PCRA 2CK3H 1KWIA 5G2GA 3SXXA 4MMYB 5FGOA 5IG4A 3CME3 3BB9A 2P05A 1JN5B 2RFRA 3DGMA 3NBRA 3SOAA 4FR9A 2QEX3 3GZXB 2F99A 3D9RA 3KFQC 3EB8A 5AIFA 2B1XB 1KC84 1Y4KA 1RRLA 3NUVA 3NV0A 3K9MC 4EV5A 2ML5A 3F8HA 5KP3A 1ISKA 3I0YA 2XRXB 2JDIH 2WO0A 3F40A 4N6MA 3MG2A 4HM1B 1V74A 1GYBA 2ZDJA 3HK4A 3MG1A 5IERA 1EQKA 2BMOB 4N6V0 1RJOA 1EKMA 3CPOA 2P0XA 5HGRA 3LH4A 1N9JA 4HM5B 3KIIA 3SEDA 1N5HA 5AYSC 1VQP3 2CG1A 3ER7A 1IDPA 3EBYA 1IQ8A 2PZVA 2FGTA 1FGTA 3FG4A 3X3XA 3WMDA 2CWVA 3D3LA 4STDA 3RDEA 1CQSA 1KQS2 4XBYA 3I563 4XBXA 3H51A 4N6UA 2IUJA 2OOVA 4XB5A 3WDGB 4HM8B 3CD63 1UUVB 1ROVA 3U1WA 4RBNA 1OGZA 4GL6A 1S723
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  1DMM A;  1OH0 A;  2K54 A;  1JKG A;  5CLK A;  4HKV B;  3MYT A;  1OGX A;  1DMQ A;  3S5C A;  1NDO B;  2YFI B;  2Z76 A;  4K1U A;  5CXO A;  2Z7A A;  1OUN A;  1Q42 A;  4HZB B;  1OHP A;  1E3R A;  3KKG A;  3BLZ A;  1OHS A;  2HMK B;  3JUM A;  1W02 A;  3FLJ A;  3LYG A;  4OUQ A;  1ULI B;  3MHE A;  2CKF B;  1JN5 A;  4HM3 B;  2HMO B;  4HM7 B;  2QIY A;  3STD A;  3MKI A;  3RGR A;  1JB5 A;  3OWU A;  3SOY A;  1JB4 A;  1Q40 B;  3T8U A;  5IG3 A;  3OWS A;  4LMI A;  3GZB A;  3JUO A;  5BXQ A;  1SJW A;  4Q53 A;  3KZT A;  3H3H A;  4LEH A;  3JUP A;  4U13 A;  4LGQ A;  3KSP A;  4HM0 B;  3F7S A;  4HM2 B;  4MJD A;  4HM4 B;  1EA2 A;  3CU3 A;  3FH1 A;  3GRD A;  3MSO A;  2GXF A;  1NWW A;  3EJV A;  3NV0 B;  4XDV A;  3ECF A;  5JPP A;  1GY5 A;  1DMN A;  1C7H A;  1ULJ B;  2GBW B;  3KE7 A;  4WP5 A;  3OV4 A;  3EX9 A;  2YFL B;  3FF2 A;  2GEX A;  3GWR A;  3OX9 A;  4GB5 A;  1GY7 A;  4HZ9 B;  3FZW A;  4KVH A;  5CF1 A;  1ZO2 A;  5STD A;  3LZA A;  2BNG A;  1GS3 A;  1HKX A;  4X2O A;  4R1K A;  4L8P A;  3EF8 A;  3B8L A;  2UX0 A;  2IMJ A;  2HMM B;  3GZR A;  3HZP A;  4I4K A;  4WYK B;  3F8X A;  1A2K A;  1VZZ A;  3VGN A;  1U5O A;  3M8C A;  5AIG A;  3G0K A;  2JQ5 A;  1QJG A;  4HJL B;  2A15 A;  2BMQ B;  3DZL A;  1UUW B;  3JUQ A;  4K1V A;  4L8O A;  2QGU A;  3EBT A;  1OF5 B;  3F9S A;  1OCV A;  3EN1 B;  4RZM A;  5AI1 A;  3DUK A;  1TUH A;  2CHC A;  3A76 A;  3E99 A;  2XSH B;  3FF0 A;  3IPT A;  4X2H A;  5IEO A;  3UJM A;  5D81 A;  5TGN A;  2B24 B;  2RCD A;  3HX8 A;  3OWY A;  5G2G A;  1AR0 A;  3RGA A;  5IG4 A;  4J9A A;  5IEP A;  2W2C A;  3FKA A;  3UNL A;  3BB9 A;  1JN5 B;  2RFR A;  3EN8 A;  4ORL A;  5FW5 A;  5IF6 A;  3B4O A;  3DM8 A;  5CK6 A;  3G16 A;  5AIH A;  3NBR A;  3SOA A;  8CHO A;  4R9K A;  3GZX B;  1ZX2 A;  2F99 A;  1E97 A;  3GZY B;  2HMN B;  1S5A A;  1NU3 A;  1W01 A;  3K7C A;  3NM2 A;  2YFJ B;  3D9R A;  4XM4 A;  1JKG B;  3F14 A;  6STD A;  3NHX A;  1W00 A;  2F98 A;  3FSD A;  5AIF A;  5AEU B;  2B1X B;  1GY6 A;  1O7G B;  3B7C A;  5CF2 A;  2BMR B;  1TP6 A;  4R9L A;  1O7M B;  4XDW A;  3NUV A;  3NV0 A;  2OWP A;  5AEW B;  3F8H A;  2HMJ B;  5KP3 A;  1ISK A;  3I0Y A;  2XRX B;  4L7K A;  1QMA A;  3F40 A;  1EG9 B;  5EVH A;  1E3V A;  3MG2 A;  2XR8 B;  4FCM A;  4HM1 B;  4XBT A;  3ROB A;  1GYB A;  1OHO A;  1Q40 A;  2INX A;  1JB2 A;  2I9W A;  3F7X A;  3CNM A;  3HK4 A;  3MG1 A;  1K41 A;  3MG3 A;  5BVB A;  3EQQ B;  2BMO B;  1OPY A;  5IER A;  5IG5 A;  3CPO A;  3FGY A;  2GBX B;  2GEY A;  2Z77 A;  3JUN A;  4HM6 B;  5HGR A;  1O7H B;  4HM5 B;  1STD A;  5IG0 A;  3CNX A;  3SED A;  1ASK A;  4J8T A;  5DRV A;  3ER7 A;  1IDP A;  1OF5 A;  2R4I A;  3EBY A;  3EHC A;  4WWU C;  2PZV A;  4CDL A;  2F86 B;  4FCJ A;  3VSY A;  4OVM A;  3B4P A;  3EC9 A;  4PEJ A;  4HVN A;  4STD A;  3Q90 A;  5D83 A;  3WMD A;  2RGQ A;  1BUQ A;  3G8Z A;  2STD A;  2XSO B;  3OXA A;  5DRE A;  1W6Y A;  1O7N B;  5KP4 A;  1CQS A;  1WQL B;  2HML B;  3DMC A;  4XBY A;  3T8N A;  4IIA A;  4XBX A;  3H51 A;  5KP1 A;  3K0Z A;  4WYK A;  1Z1S A;  3DXO A;  4XB5 A;  3NXJ A;  5JPU A;  4HM8 B;  1UUV B;  1O7P B;  7STD A;  5D82 A;  1OGZ A;  5IEN A;  4N3V A;  1O7W B;  5AII A; 
#chains in the Genus database with same CATH topology
 2WGO A;  1DMM A;  5CLK A;  3MYT A;  1OGX A;  1DMQ A;  1IVV A;  3S5C A;  1TRP A;  5AYR B;  2WGQ A;  2YFI B;  8RNT A;  2OCT A;  3LML A;  4HZB B;  1IV7 A;  3PZW A;  2IY2 A;  2HMK B;  2ZA4 A;  4H61 A;  3ZFZ A;  4N6N B;  1WNH A;  5ELJ A;  1IK3 A;  1TFO A;  3GSP A;  4FCZ A;  1RMS A;  2HMO B;  1BNR A;  2QIY A;  1TJD A;  1JB5 A;  1G02 A;  2E2U A;  5IG3 A;  4J5K A;  1RSN A;  3KSE D;  4BTW A;  1BRH A;  4DKI A;  1RGK A;  1IT8 A;  2W56 A;  4AKZ A;  1BAN A;  1ZS7 A;  4Q53 A;  5M1A A;  1M1K 4;  4U13 A;  3KSP A;  4HM4 B;  1VQL 3;  3CU3 A;  3KCH A;  3LT8 A;  1NWW A;  4XDV A;  1VQ5 3;  1JZO A;  2GBW B;  4WP5 A;  3D5G A;  4KVH A;  2GEX A;  1STF I;  3OX9 A;  4GB5 A;  4HZ9 B;  5CF1 A;  1A90 A;  3X40 A;  3WA3 A;  1HKX A;  1RGE A;  3RNT A;  4R1K A;  1YNV X;  1PU4 A;  1VQM 3;  2W03 A;  1D6Z A;  3F8X A;  1VZZ A;  1U5O A;  2CFL A;  3M8C A;  4I5Q A;  1JBR A;  1UGI A;  1AVL A;  3NBB A;  1RGL A;  1FGO A;  2O3O A;  2QGU A;  3V99 A;  1OCV A;  4RZM A;  2GSP A;  1NJI 4;  1TUH A;  3FF0 A;  2XSH B;  4X2H A;  4FMA A;  2C11 A;  3UL5 A;  2RCD A;  3K63 A;  3OWY A;  1LOW A;  3S28 A;  1BRJ A;  7RNT A;  1N8R 4;  1JBS A;  4J9A A;  3AHS A;  2W2C A;  3FKA A;  4NHF A;  1IVW A;  4LSO A;  1RN7 A;  3EN8 A;  1UI7 A;  1SII A;  3G16 A;  1Q7H A;  3LOY A;  5AIH A;  3SVA A;  2IA7 A;  1CH0 A;  1I2F A;  1YJ9 3;  1RLS A;  2CH9 A;  1T3B A;  2W56 B;  3CCU 3;  1S5A A;  3NM2 A;  1W01 A;  1KD1 4;  3TDG A;  6STD A;  1FUW A;  1JKG B;  2OQE C;  3N54 B;  3NHX A;  1W00 A;  2F98 A;  5BIR A;  1GY6 A;  1JV2 B;  1O7G B;  3V98 A;  1TP6 A;  1FUT A;  1O7M B;  2BHM A;  2WOF A;  3LXU X;  2XGN A;  1UCL A;  4AEQ A;  1HYF A;  1VQ7 3;  3S67 A;  1K8A 4;  2W6J H;  3O8Y A;  1YGE A;  2H0H A;  5EVH A;  3SLU A;  1W6G A;  2J8X B;  2RSX A;  3NBJ A;  3MG3 A;  1JB2 A;  2W9P A;  2D1W A;  3F7X A;  5BU4 A;  1QVF 2;  1IVX A;  2R41 A;  1VQN 3;  4KFF A;  3NM7 A;  3FGY A;  3JUN A;  2Z77 A;  3PYJ A;  4WHA A;  1MWU A;  1EEJ A;  2BU4 A;  2CFG A;  3CNX A;  3ZG5 A;  4J8T A;  1BNJ A;  2R4I A;  2F86 B;  3VSY A;  4OVM A;  2E2V A;  4ZM8 A;  4PEJ A;  3Q90 A;  3D5I A;  1VQ6 3;  4JF8 A;  1YI2 3;  5DRE A;  1W6Y A;  4G1M B;  1BIR A;  1BSD A;  3DMC A;  4MEI A;  3K0Z A;  4BIR A;  1AY7 A;  3FCS B;  1QAL A;  1GOY A;  4RNZ A;  1O7P B;  7STD A;  5D82 A;  1DVC A;  4HM0 B;  1F8N A;  4J5G A;  2M7O A;  1O7W B;  1IVU A;  4K61 A;  4H3U A;  1M9G A;  1OH0 A;  1IQX A;  1JKG A;  6GSP A;  2RNT A;  1ROA A;  1Q82 4;  1JNQ A;  5LC6 A;  4GSP A;  1YHQ 3;  1OUN A;  4FMC A;  1AQZ A;  1E3R A;  3KKG A;  1OHS A;  4LYL B;  3JUM A;  3FLJ A;  3FG1 A;  3SYU A;  3DH2 A;  3MHE A;  1T2H A;  1BNI A;  1LXE A;  1K9M 4;  2LQV A;  4HM7 B;  1I3I A;  3T8U A;  1R4C A;  1BU4 A;  2Y74 A;  1BVI A;  5BXQ A;  4TX4 A;  3KZT A;  4LEH A;  4RNY A;  1VQQ A;  1UW1 A;  4HM2 B;  1MWR A;  3CPW 2;  3URP A;  3FH1 A;  3CCL 3;  4EC6 A;  2GXF A;  4NPB A;  2BT3 A;  1WMO A;  1RDS A;  1DMN A;  1GOV A;  3EX9 A;  2YFL B;  1NNV A;  4JRF A;  3NQZ A;  1BSA A;  1U8C B;  1HU9 A;  1RHL A;  1B21 A;  3DGL A;  4EBG A;  2P0M A;  4L8P A;  3EF8 A;  3G6E 3;  2IMJ A;  5G1L A;  4BTY A;  3Q3F A;  3LTD A;  3I55 3;  3VGN A;  1YJN 3;  1W4N A;  5AIG A;  3L0R A;  4HJL B;  2P38 A;  3G71 3;  2CFK A;  1IYY A;  4O8S A;  3MWZ A;  3AHW A;  4CDL A;  3DGY A;  1OF5 B;  1RGH A;  4O02 B;  5AI1 A;  2Z6B A;  1Q7Y 4;  2YX9 A;  2CHC A;  3E99 A;  1HZ1 A;  2IUK A;  3HOH A;  5ELU A;  1V58 A;  1GSP A;  5D81 A;  4QWT A;  2CG0 A;  1RKY A;  3RGA A;  2KRT A;  1R4Y A;  1YVB I;  1LQM B;  1W2Z A;  1V57 A;  1MOL A;  4ORL A;  5FW5 A;  5IF6 A;  4LZI A;  1FA3 A;  3WA2 X;  1SIH A;  5G1K A;  4K90 B;  8CHO A;  1FUS A;  2PNC A;  1E97 A;  3X3Y A;  1NU3 A;  3K7C A;  3FSD A;  5JBS A;  5AEU B;  1I70 A;  2WOH A;  1A67 A;  3B7C A;  3CC2 3;  2BMR B;  2CWT A;  4R9L A;  1FYS A;  2F5W A;  3AGN A;  2ZL8 A;  5AEW B;  1SAR A;  3AMO A;  3X42 A;  1MGR A;  2CFD A;  2K0M A;  1GMP A;  1QMA A;  1EG9 B;  1QAF A;  2KF3 A;  1E3V A;  1RGC A;  2XR8 B;  2CX1 A;  1BRI A;  4FCM A;  1W7C A;  2INX A;  2ML6 A;  4XBT A;  1K73 4;  5BVB A;  2SAR A;  5IG5 A;  6RNT A;  3HII A;  1EUI C;  4FMD A;  2GBX B;  2K3D A;  1WMP A;  2GEY A;  2XFT A;  3V92 A;  4NRE A;  2F5M A;  1STD A;  5IG0 A;  1ASK A;  5DRV A;  4EXR A;  1BRN L;  4WWU C;  3EHC A;  2GU3 A;  2OTL 3;  5GSP A;  1NB5 I;  1BSB A;  1FGQ A;  4FCJ A;  1JJ2 2;  1BNG A;  2L1S A;  3B4P A;  3EC9 A;  2W9Q A;  4BTX A;  2RGQ A;  5M18 A;  1L5G B;  3FG3 A;  2STD A;  1RRH A;  1US1 A;  2XSO B;  3OXA A;  1GD3 A;  1O7N B;  5KP4 A;  1RNT A;  1WQL B;  4IIA A;  1UCJ A;  5KP1 A;  1SQW A;  4WYK A;  2H0I A;  5A0O B;  3CCV 3;  3NXJ A;  2XEP A;  1LNI A;  3U97 A;  4CJN A;  5JPU A;  2QA4 3;  3WR2 A;  1TFK A;  4N3V A;  2HML B;  3MPH A;  5AII A;  1GMQ A;  2K54 A;  1TTO A;  3OW2 2;  1YJW 3;  2D42 A;  4WFO A;  1NDO B;  1D6U A;  3CCR 3;  5CXO A;  5M19 A;  1GOU A;  2KCD A;  1TU5 A;  1OHP A;  3AMO B;  1RGF A;  3LYG A;  1W02 A;  3S27 A;  2IYJ A;  4OK0 A;  2C4B A;  1IT7 A;  1LOX A;  2CWU A;  3MKI A;  3RGR A;  1GMR A;  2Q07 A;  1VQ4 3;  3OWU A;  1AVK A;  2BO9 B;  2O9U X;  2XGL A;  3LTA A;  3SOY A;  3K5T A;  1JZD A;  2KXG A;  3OWS A;  4LMI A;  3WOF B;  1RNB A;  1FGM A;  1N8Q A;  3LTB A;  4O2H A;  4KFE A;  2F56 A;  3IMA B;  4LGQ A;  1Q9E A;  4MJD A;  4HAA A;  3GRD A;  4CCV A;  1RN1 A;  1UGH I;  3EJV A;  3NV0 B;  3IJE B;  1LNH A;  1Q81 4;  4IPB A;  5JPP A;  4N6L A;  3KE7 A;  3QRD A;  3PGB A;  3FF2 A;  4BL3 A;  1G0T A;  3NQY A;  3PXM A;  1DYU A;  1ZO2 A;  5STD A;  2FNQ A;  3BNB A;  1GS3 A;  4X2O A;  3CC7 3;  2F4Y A;  3PCS A;  3DY5 A;  4HBR A;  3B8L A;  2UX0 A;  3GZR A;  2HMM B;  4I4K A;  2AAD A;  3HIG A;  3T0U A;  1B2S A;  2CX0 A;  1RTU A;  2C10 A;  3CCM 3;  1LRA A;  2RBI A;  5IG4 A;  1IV9 A;  3G0K A;  1QJG A;  3WHO A;  4KT3 B;  2A15 A;  1UCK A;  3DZL A;  1UUW B;  1NB3 I;  4K1V A;  3EBT A;  4KZ1 A;  1CEW I;  1BNF A;  2CIU A;  3N9H A;  1SPU A;  1W2B 2;  1BUQ A;  5IEO A;  5TGN A;  1RN4 A;  3BNE A;  1YIJ 3;  1AR0 A;  3J7Y d;  1B2Z A;  2MF7 A;  5IEP A;  1K28 A;  3UNL A;  1I0V A;  1VQK 3;  1UUG B;  1KSI A;  3S29 A;  1JRQ A;  2W04 A;  3AGO A;  3GAX A;  2OOV C;  3B4O A;  3DM8 A;  4MMZ B;  1FZU A;  4R4K A;  5CK6 A;  1YVS A;  4N6O B;  4R9K A;  1A2P A;  1ZX2 A;  3GZY B;  1UCI A;  1GD4 A;  2HMN B;  4BL2 A;  1J2B A;  1CYV A;  1B20 A;  1MGW A;  2YFJ B;  4XM4 A;  3F14 A;  3CCE 3;  2KF6 A;  1UI8 A;  2OQE A;  5CF2 A;  5LC7 A;  1MNL A;  1RCL A;  3QK9 A;  2SBL A;  4XDW A;  1WTH A;  5EQL A;  2OWP A;  2LYX A;  2HMJ B;  3VF1 A;  4KFD A;  1BAO A;  2W0Q A;  1DVD A;  1MWT A;  4L7K A;  3JVC A;  3DGN A;  1LOY A;  3CCS 3;  3ROB A;  4EV2 A;  1OHO A;  4FMB A;  1Q40 A;  5IEN A;  2I9W A;  1G96 A;  1NO3 A;  3CNM A;  1IQY A;  1K41 A;  9RNT A;  1B2M A;  3EQQ B;  3N8B A;  1OPY A;  1BUJ A;  3G4S 3;  3CC4 3;  3SX1 A;  1A2V A;  1RGG A;  3Q1C A;  4HM6 B;  1O7H B;  1BOX A;  3DGO A;  3CCQ 3;  1AV4 A;  4O3V A;  5EEO A;  1OF5 A;  1RCK A;  2AAE A;  1W5Z A;  1PFP A;  5RNT A;  3CCJ 3;  3D79 A;  5D83 A;  4HVN A;  1WMN A;  1UDI I;  1VQ8 3;  4IT7 A;  3G8Z A;  3UL6 A;  4EW5 A;  1FW7 A;  3PS8 A;  3LT9 A;  3BNC A;  3T8N A;  4N6T A;  3D4A A;  2FXT A;  1TRQ A;  3EE1 A;  3LTC A;  1VQO 3;  1Z1S A;  3DXO A;  4GHO A;  1CYU A;  3CMA 3;  3BIR A;  3A5E A;  1W6C A;  1I3F A;  1N9E A;  2E2T A;  2L4V A;  4HKV B;  3ALA A;  1X1U A;  2Z76 A;  3CXC 2;  1QVG 2;  4K1U A;  2Z7A A;  1VQ9 3;  1Q42 A;  1B2X A;  1Q86 4;  3BLZ A;  4OUQ A;  1IU7 A;  1X1X A;  1ULI B;  4HM3 B;  2CKF B;  1BGS A;  1JN5 A;  1DE3 A;  2HOH A;  1QAK A;  3STD A;  1BRK A;  3WOD G;  1M90 4;  5IW9 A;  4MMX B;  1JB4 A;  1Q40 B;  1BNE A;  1TIJ A;  3GZB A;  2CFW A;  3NX0 A;  1I0X A;  1LVN A;  3JUO A;  3WOE B;  1SJW A;  3BND A;  4AKY A;  3H3H A;  3JUP A;  2XH9 A;  1N5P A;  1BSC A;  2ZHX B;  3F7S A;  1T5Y A;  2P09 A;  1EA2 A;  2CC3 A;  1D6Y A;  3MSO A;  1PYL A;  4R80 A;  2H0G A;  3X3Z A;  5I97 A;  3ECF A;  1GY5 A;  1C7H A;  1ULJ B;  2BIR A;  3OV4 A;  3GWR A;  4CPK A;  1GY7 A;  3Q2P A;  3FZW A;  3LZA A;  1BSE A;  2BNG A;  1BRG A;  1X1W A;  1LQG C;  2V1L A;  3HZP A;  4WYK B;  2XFS A;  4EYC A;  7GSP A;  1BNS A;  1FGR A;  1LOV A;  1A2K A;  2MC8 A;  4HYZ A;  1YIT 3;  2JQ5 A;  4ILF A;  2BMQ B;  1B2U A;  3JUQ A;  2GU1 A;  2XF3 A;  4L8O A;  3KN4 A;  3UB1 A;  3F9S A;  3EN1 B;  1OAC A;  2Y73 A;  3X41 A;  3DUK A;  1I8V A;  2KF5 A;  1ZGX A;  2KAA A;  2OTJ 3;  3A76 A;  3UJM A;  3HI7 A;  3IPT A;  2B24 B;  1M1X B;  3HX8 A;  2CW9 A;  2UGI A;  2CK3 H;  1KWI A;  3PCR A;  5G2G A;  4MMY B;  5FGO A;  3SXX A;  3CME 3;  1C54 A;  1I2G A;  2P05 A;  1JN5 B;  2RFR A;  3BB9 A;  1B27 A;  3DGM A;  3NBR A;  3SOA A;  4FR9 A;  2QEX 3;  3GZX B;  1JBT A;  2F99 A;  2KF4 A;  1T2I A;  3D9R A;  3KFQ C;  1X1Y A;  3EB8 A;  5AIF A;  1YGW A;  1B3S A;  1DET A;  2B1X B;  1KC8 4;  1Y4K A;  1RRL A;  3NUV A;  3NV0 A;  3K9M C;  4EV5 A;  2ML5 A;  3F8H A;  5KP3 A;  1PY3 A;  1ISK A;  4HOH A;  3I0Y A;  2XRX B;  2JDI H;  2WO0 A;  3F40 A;  1BRS A;  3MG2 A;  4N6M A;  4HM1 B;  1V74 A;  1GYB A;  2ZDJ A;  3HK4 A;  3ZG0 A;  5HOH A;  3MG1 A;  5IER A;  1EQK A;  2BMO B;  4RNT A;  4N6V 0;  1RJO A;  1EKM A;  3CPO A;  2P0X A;  5HGR A;  1RGA A;  3LH4 A;  1N9J A;  4HM5 B;  3KII A;  3SED A;  1N5H A;  5AYS C;  1VQP 3;  1I2E A;  2CG1 A;  3ER7 A;  1IDP A;  3EBY A;  1IQ8 A;  2PZV A;  4BU4 A;  2FGT A;  1FGT A;  3FG4 A;  3X3X A;  3WMD A;  2CWV A;  3D3L A;  4STD A;  3RDE A;  2UUG C;  1CQS A;  1KQS 2;  4XBY A;  3I56 3;  4XBX A;  1MWS A;  3H51 A;  4N6U A;  2IUJ A;  2OOV A;  4XB5 A;  3WDG B;  4HM8 B;  3BU4 A;  1UUV B;  3CD6 3;  1ROV A;  3U1W A;  4RBN A;  1OGZ A;  4GL6 A;  1S72 3; 
#chains in the Genus database with same CATH homology
 2WGO A;  1DMM A;  5CLK A;  3MYT A;  1OGX A;  1DMQ A;  1IVV A;  3S5C A;  5AYR B;  2WGQ A;  2YFI B;  2OCT A;  3LML A;  4HZB B;  1IV7 A;  3PZW A;  2HMK B;  4H61 A;  4N6N B;  1WNH A;  5ELJ A;  1IK3 A;  1TFO A;  4FCZ A;  2HMO B;  2QIY A;  1JB5 A;  2E2U A;  5IG3 A;  3KSE D;  4BTW A;  1IT8 A;  2W56 A;  4AKZ A;  4Q53 A;  1M1K 4;  4U13 A;  3KSP A;  4HM4 B;  1VQL 3;  3CU3 A;  3LT8 A;  1NWW A;  4XDV A;  1VQ5 3;  2GBW B;  4WP5 A;  4KVH A;  2GEX A;  1STF I;  3OX9 A;  4GB5 A;  4HZ9 B;  5CF1 A;  1A90 A;  3X40 A;  3WA3 A;  1HKX A;  4R1K A;  1PU4 A;  1VQM 3;  2W03 A;  1D6Z A;  3F8X A;  1VZZ A;  1U5O A;  2CFL A;  3M8C A;  1AVL A;  3NBB A;  1FGO A;  2O3O A;  2QGU A;  3V99 A;  1OCV A;  4RZM A;  1NJI 4;  1TUH A;  3FF0 A;  2XSH B;  4X2H A;  4FMA A;  2C11 A;  3UL5 A;  2RCD A;  3K63 A;  3OWY A;  3S28 A;  1N8R 4;  4J9A A;  2W2C A;  3FKA A;  4NHF A;  1IVW A;  4LSO A;  1RN7 A;  3EN8 A;  1UI7 A;  1SII A;  3G16 A;  3LOY A;  5AIH A;  3SVA A;  2IA7 A;  1YJ9 3;  2CH9 A;  2W56 B;  3CCU 3;  1S5A A;  3NM2 A;  1W01 A;  1KD1 4;  3TDG A;  6STD A;  1FUW A;  1JKG B;  2OQE C;  3N54 B;  3NHX A;  1W00 A;  2F98 A;  1GY6 A;  1JV2 B;  1O7G B;  3V98 A;  1TP6 A;  2BHM A;  1O7M B;  2WOF A;  3LXU X;  4AEQ A;  2XGN A;  1VQ7 3;  3S67 A;  1K8A 4;  2W6J H;  3O8Y A;  1YGE A;  5EVH A;  3SLU A;  1W6G A;  2RSX A;  3NBJ A;  3MG3 A;  1JB2 A;  2W9P A;  2D1W A;  3F7X A;  1QVF 2;  1VQN 3;  1IVX A;  4KFF A;  3NM7 A;  3FGY A;  3JUN A;  2Z77 A;  3PYJ A;  4WHA A;  2CFG A;  3CNX A;  4J8T A;  2R4I A;  2F86 B;  3VSY A;  4OVM A;  2E2V A;  4ZM8 A;  4PEJ A;  3Q90 A;  1VQ6 3;  4JF8 A;  1YI2 3;  5DRE A;  1W6Y A;  4G1M B;  3DMC A;  4MEI A;  3K0Z A;  3FCS B;  1QAL A;  4RNZ A;  1O7P B;  7STD A;  5D82 A;  1DVC A;  4HM0 B;  1F8N A;  4K61 A;  2M7O A;  1O7W B;  1IVU A;  4H3U A;  1M9G A;  1OH0 A;  1IQX A;  1JKG A;  1ROA A;  1Q82 4;  1JNQ A;  5LC6 A;  1YHQ 3;  1OUN A;  4FMC A;  1E3R A;  3KKG A;  1OHS A;  3JUM A;  3FLJ A;  3FG1 A;  3MHE A;  1LXE A;  1K9M 4;  2LQV A;  4HM7 B;  3T8U A;  1R4C A;  2Y74 A;  5BXQ A;  4TX4 A;  3KZT A;  4LEH A;  4RNY A;  1UW1 A;  4HM2 B;  3CPW 2;  3FH1 A;  3CCL 3;  4EC6 A;  2GXF A;  2BT3 A;  1WMO A;  1DMN A;  3EX9 A;  2YFL B;  4JRF A;  3NQZ A;  1U8C B;  1HU9 A;  3DGL A;  4EBG A;  2P0M A;  4L8P A;  3EF8 A;  3G6E 3;  2IMJ A;  4BTY A;  3LTD A;  3I55 3;  3VGN A;  1YJN 3;  1W4N A;  5AIG A;  3L0R A;  4HJL B;  2P38 A;  3G71 3;  2CFK A;  4O8S A;  3MWZ A;  4CDL A;  1OF5 B;  4O02 B;  5AI1 A;  2Z6B A;  1Q7Y 4;  2YX9 A;  2CHC A;  3E99 A;  2IUK A;  5ELU A;  5D81 A;  4QWT A;  2CG0 A;  1RKY A;  3RGA A;  2KRT A;  1YVB I;  1W2Z A;  1MOL A;  4ORL A;  5FW5 A;  5IF6 A;  4LZI A;  1FA3 A;  3WA2 X;  1SIH A;  4K90 B;  8CHO A;  2PNC A;  1E97 A;  3X3Y A;  1NU3 A;  3K7C A;  3FSD A;  5JBS A;  5AEU B;  2WOH A;  1A67 A;  3B7C A;  3CC2 3;  2BMR B;  2CWT A;  4R9L A;  2ZL8 A;  5AEW B;  3AMO A;  3X42 A;  2CFD A;  2K0M A;  1QMA A;  1EG9 B;  1QAF A;  1E3V A;  4XBT A;  2XR8 B;  4FCM A;  1K73 4;  1W7C A;  2INX A;  2ML6 A;  5BVB A;  5IG5 A;  3HII A;  4FMD A;  2GBX B;  1WMP A;  2GEY A;  2XFT A;  3V92 A;  4NRE A;  1STD A;  5IG0 A;  1ASK A;  5DRV A;  4EXR A;  4WWU C;  3EHC A;  2GU3 A;  2OTL 3;  1NB5 I;  1FGQ A;  4FCJ A;  1JJ2 2;  3B4P A;  3EC9 A;  2W9Q A;  4BTX A;  2RGQ A;  1L5G B;  3FG3 A;  2STD A;  1RRH A;  1US1 A;  2XSO B;  3OXA A;  1GD3 A;  1O7N B;  5KP4 A;  1WQL B;  4IIA A;  5KP1 A;  1SQW A;  4WYK A;  5A0O B;  3CCV 3;  3NXJ A;  2XEP A;  3U97 A;  5JPU A;  2QA4 3;  1TFK A;  4N3V A;  2HML B;  3MPH A;  5AII A;  2K54 A;  3OW2 2;  1YJW 3;  2D42 A;  4WFO A;  1NDO B;  1D6U A;  3CCR 3;  5CXO A;  2KCD A;  1TU5 A;  1OHP A;  3AMO B;  3LYG A;  1W02 A;  3S27 A;  4OK0 A;  1IT7 A;  1LOX A;  2CWU A;  3MKI A;  3RGR A;  2Q07 A;  1VQ4 3;  3OWU A;  1AVK A;  2BO9 B;  2O9U X;  2XGL A;  3LTA A;  3SOY A;  3K5T A;  3OWS A;  2KXG A;  4LMI A;  3WOF B;  1FGM A;  1N8Q A;  3LTB A;  4O2H A;  4KFE A;  3IMA B;  4LGQ A;  4MJD A;  3GRD A;  4CCV A;  3EJV A;  3NV0 B;  3IJE B;  1LNH A;  1Q81 4;  4IPB A;  5JPP A;  4N6L A;  3KE7 A;  3QRD A;  3PGB A;  3FF2 A;  3NQY A;  3PXM A;  1DYU A;  1ZO2 A;  5STD A;  2FNQ A;  3BNB A;  1GS3 A;  4X2O A;  3CC7 3;  3PCS A;  3DY5 A;  4HBR A;  3B8L A;  2UX0 A;  3GZR A;  2HMM B;  4I4K A;  3HIG A;  3T0U A;  2C10 A;  3CCM 3;  1IV9 A;  3G0K A;  1QJG A;  2A15 A;  4K1V A;  3DZL A;  1UUW B;  1NB3 I;  3EBT A;  4KZ1 A;  1CEW I;  2CIU A;  3N9H A;  1SPU A;  1W2B 2;  1BUQ A;  5IEO A;  5TGN A;  3BNE A;  1YIJ 3;  1AR0 A;  3J7Y d;  5IEP A;  2MF7 A;  1K28 A;  3UNL A;  1VQK 3;  1KSI A;  3S29 A;  1JRQ A;  2W04 A;  4R4K A;  3GAX A;  2OOV C;  3B4O A;  3DM8 A;  4MMZ B;  5CK6 A;  4N6O B;  4R9K A;  1ZX2 A;  3GZY B;  1J2B A;  1GD4 A;  2HMN B;  1CYV A;  2YFJ B;  4XM4 A;  3F14 A;  3CCE 3;  1UI8 A;  2OQE A;  5CF2 A;  5LC7 A;  1MNL A;  4XDW A;  3QK9 A;  2SBL A;  1WTH A;  5EQL A;  2OWP A;  2LYX A;  2HMJ B;  3VF1 A;  4KFD A;  2W0Q A;  1DVD A;  4L7K A;  3JVC A;  3DGN A;  3CCS 3;  3ROB A;  4EV2 A;  1OHO A;  4FMB A;  1Q40 A;  5IEN A;  2I9W A;  1G96 A;  1NO3 A;  3CNM A;  1IQY A;  1K41 A;  3EQQ B;  3N8B A;  1OPY A;  3G4S 3;  3CC4 3;  3SX1 A;  1A2V A;  3Q1C A;  4HM6 B;  1O7H B;  3DGO A;  3CCQ 3;  1AV4 A;  4O3V A;  5EEO A;  1OF5 A;  1W5Z A;  1PFP A;  3CCJ 3;  5D83 A;  4HVN A;  1WMN A;  1VQ8 3;  4IT7 A;  3G8Z A;  3UL6 A;  3PS8 A;  3LT9 A;  3BNC A;  3T8N A;  4N6T A;  2FXT A;  3EE1 A;  3LTC A;  1VQO 3;  1Z1S A;  3DXO A;  1CYU A;  3CMA 3;  1W6C A;  4HKV B;  1N9E A;  2E2T A;  2L4V A;  3ALA A;  2Z76 A;  3CXC 2;  1QVG 2;  4K1U A;  2Z7A A;  1VQ9 3;  1Q42 A;  1Q86 4;  3BLZ A;  4OUQ A;  1IU7 A;  1ULI B;  4HM3 B;  2CKF B;  1JN5 A;  3WOD G;  1QAK A;  3STD A;  1M90 4;  5IW9 A;  4MMX B;  1JB4 A;  1Q40 B;  1TIJ A;  3GZB A;  2CFW A;  3NX0 A;  3JUO A;  1LVN A;  3WOE B;  1SJW A;  3BND A;  4AKY A;  3H3H A;  3JUP A;  2XH9 A;  1N5P A;  3F7S A;  1T5Y A;  2P09 A;  1EA2 A;  2CC3 A;  1D6Y A;  3MSO A;  4R80 A;  5I97 A;  3X3Z A;  3ECF A;  1GY5 A;  1C7H A;  1ULJ B;  3OV4 A;  3GWR A;  1GY7 A;  3Q2P A;  3FZW A;  3LZA A;  2BNG A;  2V1L A;  3HZP A;  4WYK B;  2XFS A;  4EYC A;  1FGR A;  1A2K A;  2MC8 A;  4HYZ A;  1YIT 3;  2JQ5 A;  2BMQ B;  3JUQ A;  3UB1 A;  2GU1 A;  2XF3 A;  4L8O A;  3KN4 A;  3F9S A;  3EN1 B;  1OAC A;  2Y73 A;  3X41 A;  3DUK A;  2OTJ 3;  3A76 A;  3UJM A;  3HI7 A;  3IPT A;  2B24 B;  1M1X B;  3HX8 A;  2CW9 A;  3PCR A;  2CK3 H;  1KWI A;  5G2G A;  3SXX A;  4MMY B;  5FGO A;  5IG4 A;  3CME 3;  3BB9 A;  2P05 A;  1JN5 B;  2RFR A;  3DGM A;  3NBR A;  3SOA A;  4FR9 A;  2QEX 3;  3GZX B;  2F99 A;  3D9R A;  3KFQ C;  3EB8 A;  5AIF A;  2B1X B;  1KC8 4;  1Y4K A;  1RRL A;  3NUV A;  3NV0 A;  3K9M C;  4EV5 A;  2ML5 A;  3F8H A;  5KP3 A;  1ISK A;  3I0Y A;  2XRX B;  2JDI H;  2WO0 A;  3F40 A;  4N6M A;  3MG2 A;  4HM1 B;  1V74 A;  1GYB A;  2ZDJ A;  3HK4 A;  3MG1 A;  5IER A;  1EQK A;  2BMO B;  4N6V 0;  1RJO A;  1EKM A;  3CPO A;  2P0X A;  5HGR A;  3LH4 A;  1N9J A;  4HM5 B;  3KII A;  3SED A;  1N5H A;  5AYS C;  1VQP 3;  2CG1 A;  3ER7 A;  1IDP A;  3EBY A;  1IQ8 A;  2PZV A;  2FGT A;  1FGT A;  3FG4 A;  3X3X A;  3WMD A;  2CWV A;  3D3L A;  4STD A;  3RDE A;  1CQS A;  1KQS 2;  4XBY A;  3I56 3;  4XBX A;  3H51 A;  4N6U A;  2IUJ A;  2OOV A;  4XB5 A;  3WDG B;  4HM8 B;  3CD6 3;  1UUV B;  1ROV A;  3U1W A;  4RBN A;  1OGZ A;  4GL6 A;  1S72 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...