1FYSA

Ribonuclease t1 v16c mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDCSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fysA00
1B2UA 2SARA 1LOVA 1RGKA 7GSPA 1I2GA 1YVSA 1BRGA 2F4YA 5BIRA 1FUTA 1LOYA 1RN4A 1B2SA 1BRIA 3Q3FA 1I3FA 1GSPA 1PY3A 2RNTA 4J5GA 4HOHA 1RTUA 1JBSA 1BNJA 2AAEA 1I0XA 1HZ1A 1GMRA 1RNTA 1GMQA 1BNGA 1BRKA 1RGHA 2KF4A 3RNTA 1B2XA 1C54A 1RGAA 3D5IA 1TRPA 1SARA 2ZA4A 1T2HA 1BRSA 1RHLA 1RN1A 1BSEA 1LNIA 1RGGA 3WHOA 1UCKA 2BU4A 3URPA 3DGYA 1UCIA 1TTOA 1X1XA 1BSCA 1I2EA 1BOXA 4J5KA 1FYSA 1BNIA 1RSNA 1PYLA 3AHWA 1RGFA 3BU4A 2AADA 2KF5A 4GHOA 1B3SA 1B2ZA 1MGWA 1RGCA 1RLSA 1I2FA 1JBTA 1BIRA 1Q9EA 3WR2A 3GSPA 1I8VA 1LRAA 1CH0A 3AHSA 1IYYA 1YNVX 1LOWA 1BSBA 2F5WA 1HYFA 5BU4A 1BRNL 1X1YA 5GSPA 3DH2A 1A2PA 1X1UA 3D5GA 3BIRA 9RNTA 1DE3A 1T2IA 3AGOA 1RDSA 1BNEA 1BNFA 1R4YA 1RCLA 4BU4A 1G02A 8RNTA 1BU4A 4HAAA 1RGEA 2KF3A 1BUJA 1RGLA 3D4AA 1BNSA 1GOVA 1TRQA 1BGSA 1RMSA 1B27A 1BSAA 1GMPA 1GOYA 1I0VA 2F56A 3A5EA 4RNTA 1I3IA 1DETA 1BRHA 1FZUA 1BRJA 2GSPA 2HOHA 2RBIA 7RNTA 1FUSA 1GOUA 1BNRA 1YGWA 1RCKA 1UCLA 1AY7A 1BANA 2KF6A 1BSDA 2F5MA 2C4BA 1X1WA 1BAOA 4BIRA 1RNBA 3HOHA 1I70A 1UCJA 1AQZA 1MGRA 3AGNA 1B21A 5HOHA 5RNTA 1JBRA 1ZGXA 6GSPA 2BIRA 1FW7A 6RNTA 1B20A 3SYUA 3KCHA 2KAAA 1B2MA 4GSPA 1BVIA
chains in the Genus database with same CATH superfamily
2LQVA 2L1SA 4H3UA 4FMDA 3I0YA 1EUIC 4O2HA 1YIT3 3OV4A 7GSPA 3NQYA 4L8OA 1YVSA 2YX9A 2F4YA 2P05A 1STDA 4NHFA 1UUVB 5STDA 5D83A 3BNDA 4EW5A 2XSOB 1ISKA 4J5GA 2RNTA 3SX1A 1OCVA 3VF1A 3EE1A 1RTUA 3EX9A 1OHPA 1OACA 1VQ53 1BNGA 1RGHA 3D3LA 2D1WA 1C54A 3F7SA 4IPBA 3D5IA 1K734 3UNLA 1NJI4 1VQ63 2H0GA 2CKFB 2XFSA 5IG4A 4FMAA 1RN1A 4LEHA 2STDA 4EYCA 1Q814 1RGGA 1ULIB 2BU4A 1RN7A 3LZAA 1ASKA 3URPA 1QJGA 1U8CB 4N6LA 3ALAA 1ZX2A 2GU1A 3KFQC 2W56A 3KN4A 3SOAA 3PXMA 3PCSA 3EBTA 2P38A 2O3OA 2OQEC 3ECFA 2Z6BA 1M9GA 1BNIA 3OWSA 1RSNA 4XBXA 3SEDA 3SLUA 3S28A 1O7HB 4MJDA 1WMNA 3F40A 3FG4A 1KD14 1E3RA 1ZO2A 3QK9A 1RLSA 4BL3A 4EV5A 2OWPA 1BIRA 1Q9EA 1NWWA 4FCZA 3SXXA 3WR2A 3GSPA 1GS3A 3T8UA 3U1WA 1MNLA 3AMOB 1SIHA 1YNVX 5I97A 1UI8A 4R1KA 1BSBA 3PCRA 1G0TA 1CYUA 1S5AA 1IQ8A 2QA43 3OWYA 1JB2A 5A0OB 1WMOA 1M1K4 3G8ZA 1VQ43 1W6CA 2WOFA 1IVUA 2WOHA 1W5ZA 3DH2A 2BT3A 1JB5A 1EA2A 3IMAB 9RNTA 3BIRA 2K3DA 1C7HA 4O3VA 1T5YA 1VQO3 1YJN3 3RDEA 2RFRA 5IG5A 1D6UA 1UGHI 2E2UA 2SBLA 4EXRA 2HMMB 1RCLA 4O8SA 1ROAA 4MMZB 2ZHXB 3DXOA 3FF2A 4HAAA 4WFOA 5D81A 5IERA 2ZDJA 1RGEA 3S27A 7STDA 4FMCA 5G2GA 1NNVA 2CWVA 3D4AA 3LH4A 3G6E3 1YI23 3GZRA 1Q7Y4 2W6JH 1JJ22 1W6GA 2IUKA 4R80A 1E97A 3X42A 1AR0A 1UDII 5FW5A 1GOVA 2XRXB 1RMSA 4CPKA 1B27A 1GY5A 3RGAA 1I0VA 3FG1A 1FGTA 3A5EA 4RNTA 3LTBA 2W9QA 2XF3A 3CCR3 4LZIA 3V98A 3IPTA 1AV4A 5AEWB 4N6OB 1GY6A 2H0HA 3D9RA 1OF5B 2W2CA 5IG3A 1NO3A 2J8XB 4PEJA 1D6YA 1LQMB 4KT3B 3I553 1RNBA 2R41A 1YJ93 4GB5A 2CFGA 4JRFA 3S5CA 5HOHA 4CDLA 1QALA 3GRDA 1ZGXA 4KVHA 6GSPA 1IQXA 1WMPA 3D79A 5AEUB 3PZWA 2ML5A 3CCS3 1QAKA 1B20A 3SYUA 3DZLA 3KCHA 3T8NA 2RCDA 1K9M4 3DGLA 2KCDA 2Z77A 3EB8A 5CLKA 4WYKB 1BVIA 2XFTA 1B2MA 2SARA 3LTAA 2FGTA 3CU3A 4FMBA 3B4PA 1L5GB 1JZDA 4EC6A 3N54B 1SIIA 2KXGA 5IF6A 4HZBB 4KFEA 1I2GA 3K9MC 2WGOA 5G1KA 3G713 1W2B2 3NBJA 3CCQ3 1LOYA 2F98A 2K0MA 5G1LA 3Q3FA 1I3FA 2CG1A 4EBGA 1JN5A 5DRVA 1JKGB 1BNJA 2GU3A 3U97A 2UUGC 1D6ZA 3B7CA 1FGQA 1LOXA 1GMRA 2HMKB 1K8A4 3X3ZA 3X41A 4MMXB 1O7MB 4RNZA 3CNXA 2FXTA 2E2TA 3X40A 4X2HA 1IT8A 2C10A 1AVKA 2CIUA 1QVF2 1E3VA 3NQZA 4TX4A 5BVBA 1RHLA 3DUKA 5TGNA 2YFJB 1LNIA 1F8NA 1UUGB 1V57A 3ZG5A 1FGRA 1IT7A 3FG3A 1N8QA 1UCIA 3Q1CA 1DMQA 1A67A 3LT9A 3BNEA 5AIHA 1BOXA 1JV2B 1LVNA 4CCVA 3S29A 2HMLB 1R4CA 2GEXA 4HM4B 5ELUA 3KIIA 2QEX3 2K54A 2UX0A 3OX9A 1JZOA 3K0ZA 1RGFA 3BU4A 2OCTA 3EF8A 3NHXA 2YFLB 3LMLA 2D42A 3NM7A 4GHOA 3CPW2 1B2ZA 1Q42A 1YGEA 5CXOA 1I8VA 4HM3B 4XB5A 3UL5A 5AI1A 1CH0A 1HU9A 3UL6A 4FCJA 3FLJA 3X3YA 4HM1B 1ULJB 3WODG 5BU4A 3WA3A 4HM8B 1A2KA 4ILFA 3F9SA 1NB5I 1O7GB 3NUVA 4K61A 1IV7A 3CD63 1IQYA 1DE3A 1CYVA 1T2IA 3BNBA 3KSED 1KC84 4R4KA 1EG9B 3AGOA 1RDSA 2R4IA 1TIJA 1ZS7A 2W9PA 5IG0A 5CF1A 3CC73 1G02A 5LC6A 2B24B 3MPHA 3CMA3 2INXA 1N9EA 2GBXB 2Z7AA 3TDGA 3AMOA 3EJVA 2GEYA 1BUJA 2C11A 1RGLA 2IA7A 3B4OA 3FGYA 1Y4KA 1CEWI 1UGIA 2O9UX 1W01A 2YFIB 1BNSA 1MWTA 4LMIA 4X2OA 4U13A 1IVVA 3CPOA 3K63A 3CNMA 1DVCA 4I4KA 3WA2X 1GOYA 4N6NB 1YVBI 1QVG2 1I3IA 1FZUA 2BO9B 1MWUA 1TFKA 4XM4A 2WGQA 1KSIA 4RNYA 5EQLA 5IEPA 1RRHA 2F99A 2W56B 3HK4A 2V1LA 1YGWA 3N9HA 3LOYA 2XGNA 1Q40A 3Q2PA 1UCLA 3JVCA 1W02A 4NPBA 3NV0A 5CK6A 1VQ83 2F86B 1TU5A 2BNGA 2GBWB 3Q90A 4BIRA 1BAOA 3LTCA 3HOHA 3DY5A 4HYZA 2XSHB 1TP6A 1I70A 1DMNA 1AQZA 1IV9A 1MGRA 3KE7A 1JBRA 4OVMA 3JUPA 3LT8A 1EQKA 6RNTA 2M7OA 3MWZA 3I563 2GXFA 1O7PB 1SQWA 1A90A 3G0KA 1YJW3 3E99A 4STDA 1WNHA 3G16A 1B2UA 5JPUA 3FSDA 3JUMA 3EC9A 2B1XB 1BRGA 4DKIA 3LXUX 1OPYA 5BIRA 1FUTA 2I9WA 1TJDA 1RN4A 1GY7A 1BRIA 2W0QA 2OOVA 3ROBA 3FH1A 2IUJA 1PY3A 4HM0B 3MG1A 4N6TA 1W4NA 1JBSA 2AAEA 2Q07A 1OGXA 3OWUA 4WWUC 3GWRA 4KFFA 1GMQA 3KKGA 4R9KA 3RNTA 2P0XA 1VQQA 1GD3A 1OHSA 3KSPA 2ZA4A 2OTJ3 1T2HA 1QMAA 2W03A 1GD4A 3WHOA 1UCKA 1ROVA 1GYBA 3DGMA 3FF0A 3ZFZA 4RZMA 1I2EA 1NDOB 4OUQA 3DMCA 4NREA 1WQLB 1W6YA 2IMJA 4L8PA 5KP3A 5IW9A 3M8CA 2H0IA 3MKIA 4HM6B 1JKGA 1DYUA 3V92A 1U5OA 3HIIA 4N6UA 4XDWA 2AADA 2KF5A 3L0RA 4N3VA 2Y73A 2UGIA 1I2FA 1OGZA 1FGOA 1JBTA 3HIGA 1T3BA 4ORLA 3WOFB 3AHSA 3HX8A 1IYYA 2CX0A 2Z76A 3FZWA 1HYFA 1BRNL 3F14A 1X1YA 4RBNA 3HZPA 1FUWA 1QAFA 1O7WB 4XDVA 5GSPA 3OW22 2HMOB 1UI7A 1TFOA 2CFLA 3V99A 4I5QA 1SJWA 4GL6A 3VSYA 2CC3A 1MWSA 2P09A 2MF7A 3F7XA 4BU4A 1BU4A 1JN5B 4Q53A 4BL2A 2MC8A 3EHCA 4WP5A 3ER7A 2CX1A 3PYJA 2PNCA 3CCE3 3CC43 1Q7HA 2CG0A 3O8YA 5DREA 1TUHA 1VQM3 4BTWA 1YIJ3 1MOLA 4FCMA 4XBYA 1VQN3 1GMPA 2XR8B 2RGQA 1CQSA 3CME3 1VQL3 4JF8A 1DETA 4G1MB 1O7NB 4HKVB 3K5TA 1PU4A 1BRJA 4LSOA 1MWRA 3PGBA 1M904 1VQ73 1FGMA 3DGOA 2IY2A 4IT7A 3LTDA 2CK3H 4HZ9B 2CWUA 1AY7A 1BSDA 4J9AA 1RRLA 4O02B 1Q824 1Z1SA 4BTYA 2C4BA 1X1WA 2E2VA 4AKYA 3OXAA 4N6V0 2XGLA 3UB1A 2RSXA 3CCL3 1UCJA 3AGNA 1B21A 1RKYA 5AYRB 3MSOA 5JPPA 1OHOA 2BIRA 2ZL8A 4QWTA 4MEIA 1FW7A 3H3HA 4HVNA 2QIYA 4BTXA 4K1UA 3GZYB 3RGRA 1IVXA 1IDPA 3WOEB 3G4S3 1LOVA 3NBRA 1RGKA 4KZ1A 4HM5B 5LC7A 1KQS2 1UW1A 3F8HA 1W00A 4WHAA 1LQGC 1UUWB 3QRDA 2OOVC 1B2SA 4EV2A 1J2BA 1GSPA 2CWTA 2CH9A 1V74A 1LNHA 4K90B 4HOHA 3WDGB 3CCJ3 2JDIH 1K28A 1I0XA 1HZ1A 3J7Yd 1DMMA 3MYTA 4FR9A 4IIAA 5CF2A 8CHOA 1RNTA 1N8R4 1A2VA 1BRKA 3DM8A 3NXJA 3CCU3 1EEJA 2KF4A 1B2XA 1N9JA 4KFDA 1RGAA 1TRPA 3SVAA 1SARA 1DVDA 2XEPA 3BLZA 3NX0A 3EBYA 1BRSA 5IEOA 2JQ5A 1BSEA 3EN8A 1SPUA 5AYSC 5AIIA 5JBSA 2W04A 3DGYA 1TTOA 1X1XA 3N8BA 2FNQA 1BSCA 2XH9A 3MG2A 5ELJA 1IK3A 1AVLA 4J5KA 5M18A 1WTHA 1LXEA 5D82A 3KZTA 1FYSA 2OQEA 5BXQA 3CCM3 3GZXB 1OF5A 2CHCA 3GAXA 1HKXA 1PYLA 3AHWA 3NBBA 3PS8A 4K1VA 1Q864 1Q40B 3IJEB 2P0MA 3NV0B 5AIFA 2KRTA 1NB3I 1B3SA 3ZG0A 1RGCA 1MGWA 1NU3A 2CFKA 2CW9A 1FA3A 2ML6A 1VQ93 1US1A 2IYJA 3NM2A 5FGOA 3DGNA 1JRQA 3B8LA 1LRAA 3HI7A 3JUNA 4XBTA 6STDA 2HMNB 2BMQB 1LOWA 2BMRB 2F5WA 2LYXA 4ZM8A 4WYKA 1VZZA 4HBRA 2PZVA 4HM7B 1A2PA 1X1UA 3D5GA 4L7KA 1K41A 2CFWA 3STDA 4N6MA 1VQK3 1BNEA 3EQQB 1S723 1BNFA 1M1XB 2HMJB 4AEQA 1R4YA 4R9LA 5EVHA 1VQP3 3A76A 2QGUA 1PFPA 2A15A 4HM2B 8RNTA 1W2ZA 1YHQ3 3GZBA 2OTL3 3WMDA 3X3XA 1IVWA 2BMOB 5HGRA 2KF3A 1V58A 3MHEA 4CJNA 2L4VA 3BB9A 4MMYB 5M19A 1TRQA 1BGSA 3EN1B 1N5HA 3JUOA 3K7CA 1BSAA 2F56A 1OUNA 2Y74A 1BRHA 1KWIA 1G96A 2WO0A 4HJLB 2RBIA 2GSPA 2HOHA 7RNTA 3LYGA 5KP1A 1STFI 3FKAA 1FUSA 3CXC2 1GOUA 3CCV3 4H61A 1BNRA 3T0UA 1RCKA 2BHMA 3S67A 3FCSB 1BANA 5M1AA 2KF6A 3CC23 1EKMA 4AKZA 2F5MA 3VGNA 4LGQA 1JB4A 1OH0A 1RJOA 3JUQA 1N5PA 5RNTA 3SOYA 3UJMA 1BUQA 5AIGA 4LYLB 2CFDA 1W7CA 5EEOA 5IENA 1JNQA 5KP4A 3H51A 2KAAA 1IU7A 4J8TA 3F8XA 4OK0A 3MG3A 3BNCA 4GSPA
chains in the Genus database with same CATH topology
1B2UA 2SARA 1LOVA 1RGKA 7GSPA 1I2GA 1YVSA 1BRGA 2F4YA 5BIRA 1FUTA 1LOYA 1RN4A 1B2SA 1BRIA 3Q3FA 1I3FA 1GSPA 1PY3A 2RNTA 4J5GA 4HOHA 1RTUA 1JBSA 1BNJA 2AAEA 1I0XA 1HZ1A 1GMRA 1RNTA 1GMQA 1BNGA 1BRKA 1RGHA 2KF4A 3RNTA 1B2XA 1C54A 1RGAA 3D5IA 1TRPA 1SARA 2ZA4A 1T2HA 1BRSA 1RHLA 1RN1A 1BSEA 1LNIA 1RGGA 3WHOA 1UCKA 2BU4A 3URPA 3DGYA 1UCIA 1TTOA 1X1XA 1BSCA 1I2EA 1BOXA 4J5KA 1FYSA 1BNIA 1RSNA 1PYLA 3AHWA 1RGFA 3BU4A 2AADA 2KF5A 4GHOA 1B3SA 1B2ZA 1MGWA 1RGCA 1RLSA 1I2FA 1JBTA 1BIRA 1Q9EA 3WR2A 3GSPA 1I8VA 1LRAA 1CH0A 3AHSA 1IYYA 1YNVX 1LOWA 1BSBA 2F5WA 1HYFA 5BU4A 1BRNL 1X1YA 5GSPA 3DH2A 1A2PA 1X1UA 3D5GA 3BIRA 9RNTA 1DE3A 1T2IA 3AGOA 1RDSA 1BNEA 1BNFA 1R4YA 1RCLA 4BU4A 1G02A 8RNTA 1BU4A 4HAAA 1RGEA 2KF3A 1BUJA 1RGLA 3D4AA 1BNSA 1GOVA 1TRQA 1BGSA 1RMSA 1B27A 1BSAA 1GMPA 1GOYA 1I0VA 2F56A 3A5EA 4RNTA 1I3IA 1DETA 1BRHA 1FZUA 1BRJA 2GSPA 2HOHA 2RBIA 7RNTA 1FUSA 1GOUA 1BNRA 1YGWA 1RCKA 1UCLA 1AY7A 1BANA 2KF6A 1BSDA 2F5MA 2C4BA 1X1WA 1BAOA 4BIRA 1RNBA 3HOHA 1I70A 1UCJA 1AQZA 1MGRA 3AGNA 1B21A 5HOHA 5RNTA 1JBRA 1ZGXA 6GSPA 2BIRA 1FW7A 6RNTA 1B20A 3SYUA 3KCHA 2KAAA 1B2MA 4GSPA 1BVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2U A;  2SAR A;  1LOV A;  1RGK A;  7GSP A;  1I2G A;  1YVS A;  1BRG A;  2F4Y A;  5BIR A;  1FUT A;  1LOY A;  1RN4 A;  1B2S A;  1BRI A;  3Q3F A;  1I3F A;  1GSP A;  1PY3 A;  2RNT A;  4J5G A;  4HOH A;  1RTU A;  1JBS A;  1BNJ A;  2AAE A;  1I0X A;  1HZ1 A;  1GMR A;  1RNT A;  1GMQ A;  1BNG A;  1BRK A;  1RGH A;  2KF4 A;  3RNT A;  1B2X A;  1C54 A;  1RGA A;  3D5I A;  1TRP A;  1SAR A;  2ZA4 A;  1T2H A;  1BRS A;  1RHL A;  1RN1 A;  1BSE A;  1LNI A;  1RGG A;  3WHO A;  1UCK A;  2BU4 A;  3URP A;  3DGY A;  1UCI A;  1TTO A;  1X1X A;  1BSC A;  1I2E A;  1BOX A;  4J5K A;  1FYS A;  1BNI A;  1RSN A;  1PYL A;  3AHW A;  1RGF A;  3BU4 A;  2AAD A;  2KF5 A;  4GHO A;  1B3S A;  1B2Z A;  1MGW A;  1RGC A;  1RLS A;  1I2F A;  1JBT A;  1BIR A;  1Q9E A;  3WR2 A;  3GSP A;  1I8V A;  1LRA A;  1CH0 A;  3AHS A;  1IYY A;  1YNV X;  1LOW A;  1BSB A;  2F5W A;  1HYF A;  5BU4 A;  1BRN L;  1X1Y A;  5GSP A;  3DH2 A;  1A2P A;  1X1U A;  3D5G A;  3BIR A;  9RNT A;  1DE3 A;  1T2I A;  3AGO A;  1RDS A;  1BNE A;  1BNF A;  1R4Y A;  1RCL A;  4BU4 A;  1G02 A;  8RNT A;  1BU4 A;  4HAA A;  1RGE A;  2KF3 A;  1BUJ A;  1RGL A;  3D4A A;  1BNS A;  1GOV A;  1TRQ A;  1BGS A;  1RMS A;  1B27 A;  1BSA A;  1GMP A;  1GOY A;  1I0V A;  2F56 A;  3A5E A;  4RNT A;  1I3I A;  1DET A;  1BRH A;  1FZU A;  1BRJ A;  2GSP A;  2HOH A;  2RBI A;  7RNT A;  1FUS A;  1GOU A;  1BNR A;  1YGW A;  1RCK A;  1UCL A;  1AY7 A;  1BAN A;  2KF6 A;  1BSD A;  2F5M A;  2C4B A;  1X1W A;  1BAO A;  4BIR A;  1RNB A;  3HOH A;  1I70 A;  1UCJ A;  1AQZ A;  1MGR A;  3AGN A;  1B21 A;  5HOH A;  5RNT A;  1JBR A;  1ZGX A;  6GSP A;  2BIR A;  1FW7 A;  6RNT A;  1B20 A;  3SYU A;  3KCH A;  2KAA A;  1B2M A;  4GSP A;  1BVI A; 
#chains in the Genus database with same CATH topology
 2LQV A;  2L1S A;  4H3U A;  4FMD A;  3I0Y A;  1EUI C;  4O2H A;  1YIT 3;  3OV4 A;  7GSP A;  3NQY A;  4L8O A;  1YVS A;  2YX9 A;  2F4Y A;  2P05 A;  1STD A;  4NHF A;  1UUV B;  5STD A;  5D83 A;  3BND A;  4EW5 A;  2XSO B;  1ISK A;  4J5G A;  2RNT A;  3SX1 A;  1OCV A;  3VF1 A;  3EE1 A;  1RTU A;  3EX9 A;  1OHP A;  1OAC A;  1VQ5 3;  1BNG A;  1RGH A;  3D3L A;  2D1W A;  1C54 A;  3F7S A;  4IPB A;  3D5I A;  1K73 4;  3UNL A;  1NJI 4;  1VQ6 3;  2H0G A;  2CKF B;  2XFS A;  5IG4 A;  4FMA A;  1RN1 A;  4LEH A;  2STD A;  4EYC A;  1Q81 4;  1RGG A;  1ULI B;  2BU4 A;  1RN7 A;  3LZA A;  1ASK A;  3URP A;  1QJG A;  1U8C B;  4N6L A;  3ALA A;  1ZX2 A;  2GU1 A;  3KFQ C;  2W56 A;  3KN4 A;  3SOA A;  3PXM A;  3PCS A;  3EBT A;  2P38 A;  2O3O A;  2OQE C;  3ECF A;  2Z6B A;  1M9G A;  1BNI A;  3OWS A;  1RSN A;  4XBX A;  3SED A;  3SLU A;  3S28 A;  1O7H B;  4MJD A;  1WMN A;  3F40 A;  3FG4 A;  1KD1 4;  1E3R A;  1ZO2 A;  3QK9 A;  1RLS A;  4BL3 A;  4EV5 A;  2OWP A;  1BIR A;  1Q9E A;  1NWW A;  4FCZ A;  3SXX A;  3WR2 A;  3GSP A;  1GS3 A;  3T8U A;  3U1W A;  1MNL A;  3AMO B;  1SIH A;  1YNV X;  5I97 A;  1UI8 A;  4R1K A;  1BSB A;  3PCR A;  1G0T A;  1CYU A;  1S5A A;  1IQ8 A;  2QA4 3;  3OWY A;  1JB2 A;  5A0O B;  1WMO A;  1M1K 4;  3G8Z A;  1VQ4 3;  1W6C A;  2WOF A;  1IVU A;  2WOH A;  1W5Z A;  3DH2 A;  2BT3 A;  1JB5 A;  1EA2 A;  3IMA B;  9RNT A;  3BIR A;  2K3D A;  1C7H A;  4O3V A;  1T5Y A;  1VQO 3;  1YJN 3;  3RDE A;  2RFR A;  5IG5 A;  1D6U A;  1UGH I;  2E2U A;  2SBL A;  4EXR A;  2HMM B;  1RCL A;  4O8S A;  1ROA A;  4MMZ B;  2ZHX B;  3DXO A;  3FF2 A;  4HAA A;  4WFO A;  5D81 A;  5IER A;  2ZDJ A;  1RGE A;  3S27 A;  7STD A;  4FMC A;  5G2G A;  1NNV A;  2CWV A;  3D4A A;  3LH4 A;  3G6E 3;  1YI2 3;  3GZR A;  1Q7Y 4;  2W6J H;  1JJ2 2;  1W6G A;  2IUK A;  4R80 A;  1E97 A;  3X42 A;  1AR0 A;  1UDI I;  5FW5 A;  1GOV A;  2XRX B;  1RMS A;  4CPK A;  1B27 A;  1GY5 A;  3RGA A;  1I0V A;  3FG1 A;  1FGT A;  3A5E A;  4RNT A;  3LTB A;  2W9Q A;  2XF3 A;  3CCR 3;  4LZI A;  3V98 A;  3IPT A;  1AV4 A;  5AEW B;  4N6O B;  1GY6 A;  2H0H A;  3D9R A;  1OF5 B;  2W2C A;  5IG3 A;  1NO3 A;  2J8X B;  4PEJ A;  1D6Y A;  1LQM B;  4KT3 B;  3I55 3;  1RNB A;  2R41 A;  1YJ9 3;  4GB5 A;  2CFG A;  4JRF A;  3S5C A;  5HOH A;  4CDL A;  1QAL A;  3GRD A;  1ZGX A;  4KVH A;  6GSP A;  1IQX A;  1WMP A;  3D79 A;  5AEU B;  3PZW A;  2ML5 A;  3CCS 3;  1QAK A;  1B20 A;  3SYU A;  3DZL A;  3KCH A;  3T8N A;  2RCD A;  1K9M 4;  3DGL A;  2KCD A;  2Z77 A;  3EB8 A;  5CLK A;  4WYK B;  1BVI A;  2XFT A;  1B2M A;  2SAR A;  3LTA A;  2FGT A;  3CU3 A;  4FMB A;  3B4P A;  1L5G B;  1JZD A;  4EC6 A;  3N54 B;  1SII A;  2KXG A;  5IF6 A;  4HZB B;  4KFE A;  1I2G A;  3K9M C;  2WGO A;  5G1K A;  3G71 3;  1W2B 2;  3NBJ A;  3CCQ 3;  1LOY A;  2F98 A;  2K0M A;  5G1L A;  3Q3F A;  1I3F A;  2CG1 A;  4EBG A;  1JN5 A;  5DRV A;  1JKG B;  1BNJ A;  2GU3 A;  3U97 A;  2UUG C;  1D6Z A;  3B7C A;  1FGQ A;  1LOX A;  1GMR A;  2HMK B;  1K8A 4;  3X3Z A;  3X41 A;  4MMX B;  1O7M B;  4RNZ A;  3CNX A;  2FXT A;  2E2T A;  3X40 A;  4X2H A;  1IT8 A;  2C10 A;  1AVK A;  2CIU A;  1QVF 2;  1E3V A;  3NQZ A;  4TX4 A;  5BVB A;  1RHL A;  3DUK A;  5TGN A;  2YFJ B;  1LNI A;  1F8N A;  1UUG B;  1V57 A;  3ZG5 A;  1FGR A;  1IT7 A;  3FG3 A;  1N8Q A;  1UCI A;  3Q1C A;  1DMQ A;  1A67 A;  3LT9 A;  3BNE A;  5AIH A;  1BOX A;  1JV2 B;  1LVN A;  4CCV A;  3S29 A;  2HML B;  1R4C A;  2GEX A;  4HM4 B;  5ELU A;  3KII A;  2QEX 3;  2K54 A;  2UX0 A;  3OX9 A;  1JZO A;  3K0Z A;  1RGF A;  3BU4 A;  2OCT A;  3EF8 A;  3NHX A;  2YFL B;  3LML A;  2D42 A;  3NM7 A;  4GHO A;  3CPW 2;  1B2Z A;  1Q42 A;  1YGE A;  5CXO A;  1I8V A;  4HM3 B;  4XB5 A;  3UL5 A;  5AI1 A;  1CH0 A;  1HU9 A;  3UL6 A;  4FCJ A;  3FLJ A;  3X3Y A;  4HM1 B;  1ULJ B;  3WOD G;  5BU4 A;  3WA3 A;  4HM8 B;  1A2K A;  4ILF A;  3F9S A;  1NB5 I;  1O7G B;  3NUV A;  4K61 A;  1IV7 A;  3CD6 3;  1IQY A;  1DE3 A;  1CYV A;  1T2I A;  3BNB A;  3KSE D;  1KC8 4;  4R4K A;  1EG9 B;  3AGO A;  1RDS A;  2R4I A;  1TIJ A;  1ZS7 A;  2W9P A;  5IG0 A;  5CF1 A;  3CC7 3;  1G02 A;  5LC6 A;  2B24 B;  3MPH A;  3CMA 3;  2INX A;  1N9E A;  2GBX B;  2Z7A A;  3TDG A;  3AMO A;  3EJV A;  2GEY A;  1BUJ A;  2C11 A;  1RGL A;  2IA7 A;  3B4O A;  3FGY A;  1Y4K A;  1CEW I;  1UGI A;  2O9U X;  1W01 A;  2YFI B;  1BNS A;  1MWT A;  4LMI A;  4X2O A;  4U13 A;  1IVV A;  3CPO A;  3K63 A;  3CNM A;  1DVC A;  4I4K A;  3WA2 X;  1GOY A;  4N6N B;  1YVB I;  1QVG 2;  1I3I A;  1FZU A;  2BO9 B;  1MWU A;  1TFK A;  4XM4 A;  2WGQ A;  1KSI A;  4RNY A;  5EQL A;  5IEP A;  1RRH A;  2F99 A;  2W56 B;  3HK4 A;  2V1L A;  1YGW A;  3N9H A;  3LOY A;  2XGN A;  1Q40 A;  3Q2P A;  1UCL A;  3JVC A;  1W02 A;  4NPB A;  3NV0 A;  5CK6 A;  1VQ8 3;  2F86 B;  1TU5 A;  2BNG A;  2GBW B;  3Q90 A;  4BIR A;  1BAO A;  3LTC A;  3HOH A;  3DY5 A;  4HYZ A;  2XSH B;  1TP6 A;  1I70 A;  1DMN A;  1AQZ A;  1IV9 A;  1MGR A;  3KE7 A;  1JBR A;  4OVM A;  3JUP A;  3LT8 A;  1EQK A;  6RNT A;  2M7O A;  3MWZ A;  3I56 3;  2GXF A;  1O7P B;  1SQW A;  1A90 A;  3G0K A;  1YJW 3;  3E99 A;  4STD A;  1WNH A;  3G16 A;  1B2U A;  5JPU A;  3FSD A;  3JUM A;  3EC9 A;  2B1X B;  1BRG A;  4DKI A;  3LXU X;  1OPY A;  5BIR A;  1FUT A;  2I9W A;  1TJD A;  1RN4 A;  1GY7 A;  1BRI A;  2W0Q A;  2OOV A;  3ROB A;  3FH1 A;  2IUJ A;  1PY3 A;  4HM0 B;  3MG1 A;  4N6T A;  1W4N A;  1JBS A;  2AAE A;  2Q07 A;  1OGX A;  3OWU A;  4WWU C;  3GWR A;  4KFF A;  1GMQ A;  3KKG A;  4R9K A;  3RNT A;  2P0X A;  1VQQ A;  1GD3 A;  1OHS A;  3KSP A;  2ZA4 A;  2OTJ 3;  1T2H A;  1QMA A;  2W03 A;  1GD4 A;  3WHO A;  1UCK A;  1ROV A;  1GYB A;  3DGM A;  3FF0 A;  3ZFZ A;  4RZM A;  1I2E A;  1NDO B;  4OUQ A;  3DMC A;  4NRE A;  1WQL B;  1W6Y A;  2IMJ A;  4L8P A;  5KP3 A;  5IW9 A;  3M8C A;  2H0I A;  3MKI A;  4HM6 B;  1JKG A;  1DYU A;  3V92 A;  1U5O A;  3HII A;  4N6U A;  4XDW A;  2AAD A;  2KF5 A;  3L0R A;  4N3V A;  2Y73 A;  2UGI A;  1I2F A;  1OGZ A;  1FGO A;  1JBT A;  3HIG A;  1T3B A;  4ORL A;  3WOF B;  3AHS A;  3HX8 A;  1IYY A;  2CX0 A;  2Z76 A;  3FZW A;  1HYF A;  1BRN L;  3F14 A;  1X1Y A;  4RBN A;  3HZP A;  1FUW A;  1QAF A;  1O7W B;  4XDV A;  5GSP A;  3OW2 2;  2HMO B;  1UI7 A;  1TFO A;  2CFL A;  3V99 A;  4I5Q A;  1SJW A;  4GL6 A;  3VSY A;  2CC3 A;  1MWS A;  2P09 A;  2MF7 A;  3F7X A;  4BU4 A;  1BU4 A;  1JN5 B;  4Q53 A;  4BL2 A;  2MC8 A;  3EHC A;  4WP5 A;  3ER7 A;  2CX1 A;  3PYJ A;  2PNC A;  3CCE 3;  3CC4 3;  1Q7H A;  2CG0 A;  3O8Y A;  5DRE A;  1TUH A;  1VQM 3;  4BTW A;  1YIJ 3;  1MOL A;  4FCM A;  4XBY A;  1VQN 3;  1GMP A;  2XR8 B;  2RGQ A;  1CQS A;  3CME 3;  1VQL 3;  4JF8 A;  1DET A;  4G1M B;  1O7N B;  4HKV B;  3K5T A;  1PU4 A;  1BRJ A;  4LSO A;  1MWR A;  3PGB A;  1M90 4;  1VQ7 3;  1FGM A;  3DGO A;  2IY2 A;  4IT7 A;  3LTD A;  2CK3 H;  4HZ9 B;  2CWU A;  1AY7 A;  1BSD A;  4J9A A;  1RRL A;  4O02 B;  1Q82 4;  1Z1S A;  4BTY A;  2C4B A;  1X1W A;  2E2V A;  4AKY A;  3OXA A;  4N6V 0;  2XGL A;  3UB1 A;  2RSX A;  3CCL 3;  1UCJ A;  3AGN A;  1B21 A;  1RKY A;  5AYR B;  3MSO A;  5JPP A;  1OHO A;  2BIR A;  2ZL8 A;  4QWT A;  4MEI A;  1FW7 A;  3H3H A;  4HVN A;  2QIY A;  4BTX A;  4K1U A;  3GZY B;  3RGR A;  1IVX A;  1IDP A;  3WOE B;  3G4S 3;  1LOV A;  3NBR A;  1RGK A;  4KZ1 A;  4HM5 B;  5LC7 A;  1KQS 2;  1UW1 A;  3F8H A;  1W00 A;  4WHA A;  1LQG C;  1UUW B;  3QRD A;  2OOV C;  1B2S A;  4EV2 A;  1J2B A;  1GSP A;  2CWT A;  2CH9 A;  1V74 A;  1LNH A;  4K90 B;  4HOH A;  3WDG B;  3CCJ 3;  2JDI H;  1K28 A;  1I0X A;  1HZ1 A;  3J7Y d;  1DMM A;  3MYT A;  4FR9 A;  4IIA A;  5CF2 A;  8CHO A;  1RNT A;  1N8R 4;  1A2V A;  1BRK A;  3DM8 A;  3NXJ A;  3CCU 3;  1EEJ A;  2KF4 A;  1B2X A;  1N9J A;  4KFD A;  1RGA A;  1TRP A;  3SVA A;  1SAR A;  1DVD A;  2XEP A;  3BLZ A;  3NX0 A;  3EBY A;  1BRS A;  5IEO A;  2JQ5 A;  1BSE A;  3EN8 A;  1SPU A;  5AYS C;  5AII A;  5JBS A;  2W04 A;  3DGY A;  1TTO A;  1X1X A;  3N8B A;  2FNQ A;  1BSC A;  2XH9 A;  3MG2 A;  5ELJ A;  1IK3 A;  1AVL A;  4J5K A;  5M18 A;  1WTH A;  1LXE A;  5D82 A;  3KZT A;  1FYS A;  2OQE A;  5BXQ A;  3CCM 3;  3GZX B;  1OF5 A;  2CHC A;  3GAX A;  1HKX A;  1PYL A;  3AHW A;  3NBB A;  3PS8 A;  4K1V A;  1Q86 4;  1Q40 B;  3IJE B;  2P0M A;  3NV0 B;  5AIF A;  2KRT A;  1NB3 I;  1B3S A;  3ZG0 A;  1RGC A;  1MGW A;  1NU3 A;  2CFK A;  2CW9 A;  1FA3 A;  2ML6 A;  1VQ9 3;  1US1 A;  2IYJ A;  3NM2 A;  5FGO A;  3DGN A;  1JRQ A;  3B8L A;  1LRA A;  3HI7 A;  3JUN A;  4XBT A;  6STD A;  2HMN B;  2BMQ B;  1LOW A;  2BMR B;  2F5W A;  2LYX A;  4ZM8 A;  4WYK A;  1VZZ A;  4HBR A;  2PZV A;  4HM7 B;  1A2P A;  1X1U A;  3D5G A;  4L7K A;  1K41 A;  2CFW A;  3STD A;  4N6M A;  1VQK 3;  1BNE A;  3EQQ B;  1S72 3;  1BNF A;  1M1X B;  2HMJ B;  4AEQ A;  1R4Y A;  4R9L A;  5EVH A;  1VQP 3;  3A76 A;  2QGU A;  1PFP A;  2A15 A;  4HM2 B;  8RNT A;  1W2Z A;  1YHQ 3;  3GZB A;  2OTL 3;  3WMD A;  3X3X A;  1IVW A;  2BMO B;  5HGR A;  2KF3 A;  1V58 A;  3MHE A;  4CJN A;  2L4V A;  3BB9 A;  4MMY B;  5M19 A;  1TRQ A;  1BGS A;  3EN1 B;  1N5H A;  3JUO A;  3K7C A;  1BSA A;  2F56 A;  1OUN A;  2Y74 A;  1BRH A;  1KWI A;  1G96 A;  2WO0 A;  4HJL B;  2RBI A;  2GSP A;  2HOH A;  7RNT A;  3LYG A;  5KP1 A;  1STF I;  3FKA A;  1FUS A;  3CXC 2;  1GOU A;  3CCV 3;  4H61 A;  1BNR A;  3T0U A;  1RCK A;  2BHM A;  3S67 A;  3FCS B;  1BAN A;  5M1A A;  2KF6 A;  3CC2 3;  1EKM A;  4AKZ A;  2F5M A;  3VGN A;  4LGQ A;  1JB4 A;  1OH0 A;  1RJO A;  3JUQ A;  1N5P A;  5RNT A;  3SOY A;  3UJM A;  1BUQ A;  5AIG A;  4LYL B;  2CFD A;  1W7C A;  5EEO A;  5IEN A;  1JNQ A;  5KP4 A;  3H51 A;  2KAA A;  1IU7 A;  4J8T A;  3F8X A;  4OK0 A;  3MG3 A;  3BNC A;  4GSP A; 
#chains in the Genus database with same CATH homology
 1B2U A;  2SAR A;  1LOV A;  1RGK A;  7GSP A;  1I2G A;  1YVS A;  1BRG A;  2F4Y A;  5BIR A;  1FUT A;  1LOY A;  1RN4 A;  1B2S A;  1BRI A;  3Q3F A;  1I3F A;  1GSP A;  1PY3 A;  2RNT A;  4J5G A;  4HOH A;  1RTU A;  1JBS A;  1BNJ A;  2AAE A;  1I0X A;  1HZ1 A;  1GMR A;  1RNT A;  1GMQ A;  1BNG A;  1BRK A;  1RGH A;  2KF4 A;  3RNT A;  1B2X A;  1C54 A;  1RGA A;  3D5I A;  1TRP A;  1SAR A;  2ZA4 A;  1T2H A;  1BRS A;  1RHL A;  1RN1 A;  1BSE A;  1LNI A;  1RGG A;  3WHO A;  1UCK A;  2BU4 A;  3URP A;  3DGY A;  1UCI A;  1TTO A;  1X1X A;  1BSC A;  1I2E A;  1BOX A;  4J5K A;  1FYS A;  1BNI A;  1RSN A;  1PYL A;  3AHW A;  1RGF A;  3BU4 A;  2AAD A;  2KF5 A;  4GHO A;  1B3S A;  1B2Z A;  1MGW A;  1RGC A;  1RLS A;  1I2F A;  1JBT A;  1BIR A;  1Q9E A;  3WR2 A;  3GSP A;  1I8V A;  1LRA A;  1CH0 A;  3AHS A;  1IYY A;  1YNV X;  1LOW A;  1BSB A;  2F5W A;  1HYF A;  5BU4 A;  1BRN L;  1X1Y A;  5GSP A;  3DH2 A;  1A2P A;  1X1U A;  3D5G A;  3BIR A;  9RNT A;  1DE3 A;  1T2I A;  3AGO A;  1RDS A;  1BNE A;  1BNF A;  1R4Y A;  1RCL A;  4BU4 A;  1G02 A;  8RNT A;  1BU4 A;  4HAA A;  1RGE A;  2KF3 A;  1BUJ A;  1RGL A;  3D4A A;  1BNS A;  1GOV A;  1TRQ A;  1BGS A;  1RMS A;  1B27 A;  1BSA A;  1GMP A;  1GOY A;  1I0V A;  2F56 A;  3A5E A;  4RNT A;  1I3I A;  1DET A;  1BRH A;  1FZU A;  1BRJ A;  2GSP A;  2HOH A;  2RBI A;  7RNT A;  1FUS A;  1GOU A;  1BNR A;  1YGW A;  1RCK A;  1UCL A;  1AY7 A;  1BAN A;  2KF6 A;  1BSD A;  2F5M A;  2C4B A;  1X1W A;  1BAO A;  4BIR A;  1RNB A;  3HOH A;  1I70 A;  1UCJ A;  1AQZ A;  1MGR A;  3AGN A;  1B21 A;  5HOH A;  5RNT A;  1JBR A;  1ZGX A;  6GSP A;  2BIR A;  1FW7 A;  6RNT A;  1B20 A;  3SYU A;  3KCH A;  2KAA A;  1B2M A;  4GSP A;  1BVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...