1FYSA

Ribonuclease t1 v16c mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDCSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fysA00
1BNIA 1JBSA 1BSBA 1BOXA 1BNSA 1GOVA 1RN4A 1RNTA 1RGGA 3GSPA 5RNTA 1BNJA 1X1WA 2F56A 1FYSA 1BNFA 1HZ1A 1X1XA 3AGOA 3DH2A 1BNEA 1TTOA 3AHWA 1BAOA 4GSPA 4HOHA 1I2FA 2GSPA 2HOHA 1RGFA 2SARA 1ZGXA 1BVIA 3A5EA 7GSPA 1RGKA 2BU4A 3SYUA 1I2EA 1CH0A 1AQZA 1Q9EA 3RNTA 5HOHA 1I0VA 2C4BA 4J5GA 1T2IA 5BU4A 4RNTA 3WR2A 5BIRA 1B21A 1UCJA 3KCHA 3AGNA 3DGYA 3Q3FA 3AHSA 1BRHA 1B2XA 5GSPA 3D5GA 1YVSA 1RHLA 9RNTA 2KF5A 2ZA4A 1BRNL 2F5WA 1BSDA 1GMPA 8RNTA 1BSEA 1FUTA 1JBTA 1BGSA 1BNGA 1BIRA 1BRIA 1PY3A 2BIRA 4HAAA 1I2GA 4BIRA 1B2MA 1JBRA 1BSCA 1RGAA 1BANA 2RNTA 1B3SA 3D4AA 1FZUA 2KF4A 1BRSA 2KF6A 1RNBA 1IYYA 1LOYA 3BIRA 1HYFA 3D5IA 1B2SA 2KAAA 1BUJA 1SARA 3WHOA 1X1UA 1UCLA 2RBIA 1MGWA 1DE3A 1DETA 7RNTA 1X1YA 1B20A 1R4YA 1G02A 1BNRA 1GOYA 2AADA 1MGRA 1YGWA 2KF3A 1FUSA 3HOHA 1BRKA 1PYLA 1FW7A 1RLSA 1TRPA 1LOVA 1RDSA 1GMQA 1I0XA 1I3FA 1YNVX 1I8VA 6GSPA 1BRJA 1UCIA 1RN1A 1T2HA 1RCLA 1B27A 1RCKA 1B2UA 3URPA 1BU4A 2F5MA 1C54A 1RGEA 1RGCA 1RGHA 4J5KA 1LRAA 1GSPA 1BRGA 2F4YA 4BU4A 1RSNA 1GMRA 1LOWA 6RNTA 1I3IA 1BSAA 1B2ZA 2AAEA 1I70A 4GHOA 1RGLA 1RTUA 3BU4A 1RMSA 1AY7A 1A2PA 1GOUA 1UCKA 1TRQA 1LNIA
chains in the Genus database with same CATH superfamily
3KKGA 1CYVA 1BSBA 1RNTA 1S5AA 1HKXA 3UNLA 1IVUA 1W00A 2OOVA 4N6UA 3LTAA 5D83A 3SVAA 1JV2B 1N8R4 3LOYA 3JUOA 2HMNB 2CW9A 3BLZA 4HKVB 2RCDA 1U5OA 3UB1A 2OWPA 1FUWA 4HOHA 4XDWA 1RKYA 1JB4A 5DRVA 2RFRA 1WMNA 3G0KA 1Q9EA 2BT3A 3KZTA 1YIT3 1YJ93 3X3ZA 3K0ZA 3LMLA 2CIUA 2H0GA 5KP1A 1I0VA 3CME3 5EQLA 4LYLB 3HK4A 1T2IA 4BTXA 5BU4A 4EBGA 1VQL3 2QIYA 2D1WA 4L8PA 4RNTA 4CCVA 1UI7A 2IY2A 5KP3A 4IT7A 3HIIA 2H0IA 1QVG2 3LH4A 3AGNA 3GRDA 3Q3FA 4XB5A 3AHSA 5GSPA 1AR0A 3T8UA 2CX0A 3F8XA 3OWYA 1BSDA 2GBXB 1Z1SA 1BGSA 3GAXA 4BIRA 1PY3A 1B2MA 1W02A 1FGOA 3ER7A 1E97A 3PCSA 2SBLA 2IA7A 1FZUA 1L5GB 2KF4A 2F86B 3F7SA 4H3UA 3FG1A 1VQM3 3G16A 1KQS2 1LOYA 4O8SA 5IF6A 3BIRA 4HM1B 3ROBA 3ZG5A 1JRQA 4HJLB 1E3RA 1BUJA 1PFPA 1X1UA 3SOYA 1SJWA 3VSYA 1W2B2 3ZFZA 1FGQA 3CCM3 1ZO2A 1IU7A 1DETA 3PCRA 1G02A 1BNRA 1N8QA 1UUWB 3LT8A 1RRLA 4N6MA 3ECFA 2XSHB 2PZVA 3H3HA 4NPBA 4XBTA 1JB2A 3V92A 3X3YA 2GEXA 3EJVA 1JZDA 1GMQA 1I0XA 4TX4A 6STDA 1STDA 4EV2A 3BNDA 2Z6BA 4HM6B 2XSOB 4N6V0 3CPOA 1RN7A 2UUGC 1MOLA 1BRJA 1UCIA 3K9MC 1W6YA 2E2TA 2MF7A 1UI8A 4H61A 1O7PB 2CWUA 3DGNA 1QALA 4KT3B 3FG4A 2K54A 3OX9A 5FGOA 4EXRA 3LT9A 4GL6A 3X40A 3CCL3 1GY6A 3EE1A 2OOVC 1LRAA 1GSPA 1BRGA 1GD3A 2WO0A 5CXOA 4AKZA 1YJN3 2F4YA 1O7NB 3DM8A 5IG4A 1AV4A 1NNVA 1RSNA 3BB9A 2P38A 3PGBA 1GS3A 1Y4KA 1DMQA 6RNTA 1K9M4 1Q40A 1EG9B 4EYCA 1MWTA 1SIHA 5LC7A 1SPUA 1YJW3 4HZBB 3CCR3 4GHOA 3RGRA 1RTUA 3MG2A 1RMSA 3PXMA 2JQ5A 3F40A 3KIIA 3LTBA 2Q07A 2W2CA 3EN1B 3JUNA 1VQ53 4MMXB 1TRQA 1LNIA 1K41A 1A2KA 3MPHA 3OV4A 1OHSA 1BOXA 1BNSA 3K5TA 4JRFA 1M1K4 1QAKA 2FNQA 2YFLB 1JKGB 1G96A 1ZX2A 1QVF2 1J2BA 1OF5B 4FMBA 3GSPA 1KWIA 3AMOA 3IPTA 1ROAA 1X1WA 3NBBA 1YVBI 4WWUC 2YFJB 1HZ1A 2IUKA 1X1XA 3MKIA 3G4S3 2LQVA 1EUIC 1I2FA 2HMOB 4KFFA 4R1KA 3WA2X 2CFLA 5IERA 3FG3A 1YGEA 3CCU3 4MMZB 1I2EA 1IVWA 3F8HA 1OACA 1ASKA 4EW5A 4FMDA 2CK3H 4NREA 2C4BA 2YX9A 2K3DA 4J5GA 3VF1A 1GYBA 1NJI4 7STDA 3WR2A 1W2ZA 1B21A 1DYUA 4U13A 2KRTA 3NUVA 5ELJA 2Y74A 4FMAA 4R9KA 3V98A 1ULIB 1BRHA 1US1A 4RBNA 2CFDA 1B2XA 1W01A 2W56B 5IG5A 1VQ83 1RHLA 4EC6A 3NBJA 4FMCA 2F5WA 3SOAA 3FZWA 1LOXA 1MNLA 1SIIA 2IMJA 3JVCA 1BNGA 1BIRA 1PU4A 2OTL3 1I2GA 3CCE3 1RGAA 1UUVB 3D4AA 3SEDA 1D6UA 1W4NA 3KFQC 4ILFA 1IT7A 4HM0B 3CD63 2P0MA 4AEQA 4R4KA 1CEWI 3UJMA 5JBSA 1SARA 3GZBA 1O7GB 1TJDA 2XFSA 4FCMA 2RBIA 3Q1CA 5G1KA 7RNTA 3NV0A 3CCV3 2BNGA 2A15A 3GWRA 4I4KA 2CFWA 2WGOA 5IEOA 1V58A 3UL5A 1OH0A 2I9WA 1FUSA 2KF3A 4WYKA 3STDA 1OPYA 4WFOA 4N6OB 1RLSA 4O02B 1EA2A 4HM3B 4N6TA 1JB5A 2W04A 2CWVA 2W0QA 1KC84 1YNVX 3GZRA 3CCJ3 2CX1A 3FLJA 4BL2A 2HMMB 2OQEC 3NM2A 4KVHA 2CKFB 2XGLA 1TUHA 1T2HA 1B27A 3URPA 2WOHA 4K90B 4FCZA 1Q864 3DZLA 1Q814 1RGEA 3NHXA 3CC73 3HZPA 1RGCA 1JN5B 3EBTA 4N6LA 5AIHA 3T8NA 2BMRB 1ZS7A 4J5KA 2QGUA 1EEJA 3VGNA 3X42A 3FH1A 1JJ22 3J7Yd 4BU4A 1UW1A 3ZG0A 2XH9A 3MSOA 3V99A 1LOWA 2GXFA 3EHCA 1BSAA 3X3XA 4OVMA 1WMPA 2F98A 4XBXA 1I70A 3S5CA 3CCQ3 5D81A 3K7CA 2RGQA 4LGQA 3CC23 1VQP3 5AYSC 1IQYA 1NO3A 1A2PA 3E99A 3U97A 1VQ73 1K734 3RGAA 1VQ93 1UCKA 1RJOA 2M7OA 3GZYB 1T3BA 3EBYA 1QAFA 1BNIA 3WHOA 1JBSA 2XFTA 1NB5I 2WOFA 2E2UA 1RN4A 3BNBA 1MWRA 3B8LA 1RGGA 1F8NA 2XRXB 1BNJA 4XDVA 2BHMA 3OWSA 3DH2A 3AGOA 1O7WB 3NQZA 2D42A 1BNEA 2CG0A 2GEYA 3EN8A 1OGZA 3FF2A 3OWUA 3FCSB 4GSPA 4CPKA 1RGFA 2HMLB 2SARA 5G1LA 4EV5A 5BVBA 1BVIA 1SQWA 2WGQA 3AMOB 3S27A 1QJGA 2BU4A 2ML6A 3GZXB 5CLKA 1D6YA 1CH0A 1S723 3RNTA 5HOHA 4RNZA 3S29A 3B4OA 3LZAA 4HBRA 3UL6A 1IDPA 3CCS3 1W7CA 3D9RA 4K1UA 1WMOA 4X2HA 5BIRA 1UCJA 1HU9A 3KCHA 3MYTA 3MHEA 2CHCA 4K61A 1Q824 2KCDA 2HMKB 5M19A 3MWZA 1ISKA 2XF3A 1OGXA 2OCTA 3KE7A 1G0TA 1ROVA 1YVSA 2YFIB 5M18A 1BRNL 2CFGA 1FGMA 1DMMA 3G8ZA 5EEOA 1GMPA 5M1AA 2O3OA 1FUTA 1BRIA 4HAAA 1JBRA 3SLUA 2P05A 1BUQA 1BSCA 3I0YA 2RNTA 2INXA 3LTDA 3NM7A 2IUJA 2LYXA 1M9GA 5KP4A 1BRSA 4QWTA 1W6CA 3G713 2QEX3 3KSPA 1ULJB 3N9HA 1V57A 5BXQA 1UGHI 1IVXA 3QK9A 1UUGB 3WA3A 1UCLA 3MG1A 1NB3I 4O3VA 2OTJ3 2BMOB 4FCJA 4N3VA 3WMDA 1X1YA 1R4YA 4X2OA 3B7CA 5AIGA 4FR9A 1WQLB 1QMAA 2Z77A 1A2VA 1GOYA 1M1XB 5CF1A 2AADA 1MGRA 1YGWA 4R80A 2L1SA 1BRKA 1OHOA 1TRPA 2UX0A 1TFKA 3IMAB 3LTCA 3N8BA 3NV0B 2BMQB 3PYJA 4HM5B 1I8VA 2L4VA 4I5QA 1LNHA 3WOFB 8CHOA 5IW9A 3SX1A 3JUQA 3I563 1O7HB 3OW22 3N54B 6GSPA 5CF2A 3JUPA 4WYKB 1MWSA 1OF5A 3DGOA 4R9LA 1CQSA 3S67A 1BU4A 3Q90A 1GY5A 5STDA 1C54A 1N9EA 1TFOA 1UDII 3EF8A 1RGHA 4MEIA 4BL3A 2C11A 2XGNA 4KFEA 4RNYA 3PS8A 4HM8B 2XR8B 1GMRA 2CWTA 2GU1A 1K28A 4K1VA 5TGNA 2B24B 3OXAA 3KSED 4ORLA 3BNCA 1I3IA 1OCVA 3L0RA 1STFI 4L7KA 1UGIA 1V74A 2AAEA 3EX9A 1WTHA 3Q2PA 4BTYA 1LXEA 1VQ43 1VQN3 1A90A 1Q7HA 1RGLA 3H51A 1O7MB 4GB5A 3BU4A 3T0UA 1AY7A 2W56A 4LSOA 3I553 3LYGA 1DVCA 1GOUA 1IT8A 5JPUA 3DGMA 1YHQ3 1VQQA 2ZDJA 1C7HA 4MMYB 2CFKA 1GOVA 1W6GA 2FGTA 3M8CA 2J8XB 3EC9A 2XEPA 1GY7A 3DY5A 4HVNA 4HYZA 5RNTA 2F56A 2QA43 4STDA 1FYSA 4HZ9B 1BNFA 2ZL8A 4BTWA 2P0XA 2R41A 1T5YA 4J8TA 5JPPA 4KZ1A 1TTOA 3AHWA 1BAOA 2JDIH 4WHAA 1FA3A 1EKMA 3PZWA 2GSPA 1RRHA 2HOHA 4XM4A 1W5ZA 1KD14 5G2GA 3NXJA 1ZGXA 4IIAA 3A5EA 7GSPA 1CYUA 4CJNA 1RGKA 3D3LA 3K63A 3KN4A 3SYUA 4L8OA 3DGLA 1AQZA 1NU3A 3FKAA 4HM4B 4MJDA 3SXXA 3DUKA 5IENA 1IQ8A 3NBRA 4J9AA 1Q40B 4HM2B 4RZMA 1TIJA 2ZHXB 3CU3A 1MWUA 3QRDA 3DGYA 1FGTA 1D6ZA 2FXTA 1LVNA 2STDA 4XBYA 2Y73A 1A67A 1TU5A 4KFDA 4LMIA 1N9JA 3D5GA 9RNTA 2KF5A 2ZA4A 1AVKA 1IV7A 5A0OB 8RNTA 1JBTA 1BSEA 1Q7Y4 1FGRA 2C10A 3B4PA 3BNEA 2BIRA 5IG3A 1DVDA 3FGYA 3JUMA 5IG0A 1GD4A 1YI23 2R4IA 1BANA 5D82A 1IQXA 5I97A 1B3SA 1JN5A 3D79A 3NX0A 4WP5A 5EVHA 3WOEB 5IEPA 3CXC2 1VQO3 2V1LA 2PNCA 2IYJA 3X41A 2KF6A 1M904 1RNBA 1IYYA 1EQKA 1OUNA 1VZZA 2CC3A 2O9UX 4OK0A 5LC6A 5AEUB 5AEWB 1HYFA 2CH9A 4HM7B 3D5IA 1B2SA 2KAAA 4PEJA 4OUQA 1VQK3 1N5HA 3CC43 2RSXA 3G6E3 1K8A4 3DXOA 2P09A 1JNQA 3IJEB 3O8YA 2E2VA 4DKIA 1MGWA 4LEHA 5HGRA 1DE3A 5AIIA 4JF8A 3NQYA 1B20A 1E3VA 1JZOA 2GBWB 3HI7A 3MG3A 3CMA3 1LQMB 1NWWA 2W9PA 1U8CB 4G1MB 3HIGA 3HOHA 3LXUX 3CNXA 3A76A 4ZM8A 1PYLA 1AVLA 3DMCA 3FSDA 3WODG 1FW7A 1TP6A 1LQGC 1LOVA 2UGIA 3RDEA 1RDSA 1IVVA 2HMJB 1I3FA 3WDGB 3F7XA 1R4CA 2W9QA 2CG1A 2OQEA 1Q42A 3CNMA 3S28A 1VQ63 5AI1A 2H0HA 4N6NB 1RN1A 3ALAA 1RCLA 1B2UA 1RCKA 1WNHA 2KXGA 2F5MA 2GU3A 3EQQB 1YIJ3 4IPBA 5DREA 3TDGA 1KSIA 4NHFA 3F9SA 5AIFA 2B1XB 4CDLA 2W6JH 4O2HA 2W03A 2Z7AA 2BO9B 2F99A 3F14A 5FW5A 4LZIA 1DMNA 5ELUA 1NDOB 3EB8A 3CPW2 1B2ZA 5CK6A 1IK3A 2ML5A 3HX8A 4AKYA 4Q53A 1IV9A 1JKGA 2K0MA 2Z76A 3U1WA 2MC8A 5AYRB 1N5PA 1OHPA 3FF0A
chains in the Genus database with same CATH topology
1BNIA 1JBSA 1BSBA 1BOXA 1BNSA 1GOVA 1RN4A 1RNTA 1RGGA 3GSPA 5RNTA 1BNJA 1X1WA 2F56A 1FYSA 1BNFA 1HZ1A 1X1XA 3AGOA 3DH2A 1BNEA 1TTOA 3AHWA 1BAOA 4GSPA 4HOHA 1I2FA 2GSPA 2HOHA 1RGFA 2SARA 1ZGXA 1BVIA 3A5EA 7GSPA 1RGKA 2BU4A 3SYUA 1I2EA 1CH0A 1AQZA 1Q9EA 3RNTA 5HOHA 1I0VA 2C4BA 4J5GA 1T2IA 5BU4A 4RNTA 3WR2A 5BIRA 1B21A 1UCJA 3KCHA 3AGNA 3DGYA 3Q3FA 3AHSA 1BRHA 1B2XA 5GSPA 3D5GA 1YVSA 1RHLA 9RNTA 2KF5A 2ZA4A 1BRNL 2F5WA 1BSDA 1GMPA 8RNTA 1BSEA 1FUTA 1JBTA 1BGSA 1BNGA 1BIRA 1BRIA 1PY3A 2BIRA 4HAAA 1I2GA 4BIRA 1B2MA 1JBRA 1BSCA 1RGAA 1BANA 2RNTA 1B3SA 3D4AA 1FZUA 2KF4A 1BRSA 2KF6A 1RNBA 1IYYA 1LOYA 3BIRA 1HYFA 3D5IA 1B2SA 2KAAA 1BUJA 1SARA 3WHOA 1X1UA 1UCLA 2RBIA 1MGWA 1DE3A 1DETA 7RNTA 1X1YA 1B20A 1R4YA 1G02A 1BNRA 1GOYA 2AADA 1MGRA 1YGWA 2KF3A 1FUSA 3HOHA 1BRKA 1PYLA 1FW7A 1RLSA 1TRPA 1LOVA 1RDSA 1GMQA 1I0XA 1I3FA 1YNVX 1I8VA 6GSPA 1BRJA 1UCIA 1RN1A 1T2HA 1RCLA 1B27A 1RCKA 1B2UA 3URPA 1BU4A 2F5MA 1C54A 1RGEA 1RGCA 1RGHA 4J5KA 1LRAA 1GSPA 1BRGA 2F4YA 4BU4A 1RSNA 1GMRA 1LOWA 6RNTA 1I3IA 1BSAA 1B2ZA 2AAEA 1I70A 4GHOA 1RGLA 1RTUA 3BU4A 1RMSA 1AY7A 1A2PA 1GOUA 1UCKA 1TRQA 1LNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1JBS A;  1BSB A;  1BOX A;  1BNS A;  1GOV A;  1RN4 A;  1RNT A;  1RGG A;  3GSP A;  5RNT A;  1BNJ A;  1X1W A;  2F56 A;  1FYS A;  1BNF A;  1HZ1 A;  1X1X A;  3AGO A;  3DH2 A;  1BNE A;  1TTO A;  3AHW A;  1BAO A;  4GSP A;  4HOH A;  1I2F A;  2GSP A;  2HOH A;  1RGF A;  2SAR A;  1ZGX A;  1BVI A;  3A5E A;  7GSP A;  1RGK A;  2BU4 A;  3SYU A;  1I2E A;  1CH0 A;  1AQZ A;  1Q9E A;  3RNT A;  5HOH A;  1I0V A;  2C4B A;  4J5G A;  1T2I A;  5BU4 A;  4RNT A;  3WR2 A;  5BIR A;  1B21 A;  1UCJ A;  3KCH A;  3AGN A;  3DGY A;  3Q3F A;  3AHS A;  1BRH A;  1B2X A;  5GSP A;  3D5G A;  1YVS A;  1RHL A;  9RNT A;  2KF5 A;  2ZA4 A;  1BRN L;  2F5W A;  1BSD A;  1GMP A;  8RNT A;  1BSE A;  1FUT A;  1JBT A;  1BGS A;  1BNG A;  1BIR A;  1BRI A;  1PY3 A;  2BIR A;  4HAA A;  1I2G A;  4BIR A;  1B2M A;  1JBR A;  1BSC A;  1RGA A;  1BAN A;  2RNT A;  1B3S A;  3D4A A;  1FZU A;  2KF4 A;  1BRS A;  2KF6 A;  1RNB A;  1IYY A;  1LOY A;  3BIR A;  1HYF A;  3D5I A;  1B2S A;  2KAA A;  1BUJ A;  1SAR A;  3WHO A;  1X1U A;  1UCL A;  2RBI A;  1MGW A;  1DE3 A;  1DET A;  7RNT A;  1X1Y A;  1B20 A;  1R4Y A;  1G02 A;  1BNR A;  1GOY A;  2AAD A;  1MGR A;  1YGW A;  2KF3 A;  1FUS A;  3HOH A;  1BRK A;  1PYL A;  1FW7 A;  1RLS A;  1TRP A;  1LOV A;  1RDS A;  1GMQ A;  1I0X A;  1I3F A;  1YNV X;  1I8V A;  6GSP A;  1BRJ A;  1UCI A;  1RN1 A;  1T2H A;  1RCL A;  1B27 A;  1RCK A;  1B2U A;  3URP A;  1BU4 A;  2F5M A;  1C54 A;  1RGE A;  1RGC A;  1RGH A;  4J5K A;  1LRA A;  1GSP A;  1BRG A;  2F4Y A;  4BU4 A;  1RSN A;  1GMR A;  1LOW A;  6RNT A;  1I3I A;  1BSA A;  1B2Z A;  2AAE A;  1I70 A;  4GHO A;  1RGL A;  1RTU A;  3BU4 A;  1RMS A;  1AY7 A;  1A2P A;  1GOU A;  1UCK A;  1TRQ A;  1LNI A; 
#chains in the Genus database with same CATH topology
 3KKG A;  1CYV A;  1BSB A;  1RNT A;  1S5A A;  1HKX A;  3UNL A;  1IVU A;  1W00 A;  2OOV A;  4N6U A;  3LTA A;  5D83 A;  3SVA A;  1JV2 B;  1N8R 4;  3LOY A;  3JUO A;  2HMN B;  2CW9 A;  3BLZ A;  4HKV B;  2RCD A;  1U5O A;  3UB1 A;  2OWP A;  1FUW A;  4HOH A;  4XDW A;  1RKY A;  1JB4 A;  5DRV A;  2RFR A;  1WMN A;  3G0K A;  1Q9E A;  2BT3 A;  3KZT A;  1YIT 3;  1YJ9 3;  3X3Z A;  3K0Z A;  3LML A;  2CIU A;  2H0G A;  5KP1 A;  1I0V A;  3CME 3;  5EQL A;  4LYL B;  3HK4 A;  1T2I A;  4BTX A;  5BU4 A;  4EBG A;  1VQL 3;  2QIY A;  2D1W A;  4L8P A;  4RNT A;  4CCV A;  1UI7 A;  2IY2 A;  5KP3 A;  4IT7 A;  3HII A;  2H0I A;  1QVG 2;  3LH4 A;  3AGN A;  3GRD A;  3Q3F A;  4XB5 A;  3AHS A;  5GSP A;  1AR0 A;  3T8U A;  2CX0 A;  3F8X A;  3OWY A;  1BSD A;  2GBX B;  1Z1S A;  1BGS A;  3GAX A;  4BIR A;  1PY3 A;  1B2M A;  1W02 A;  1FGO A;  3ER7 A;  1E97 A;  3PCS A;  2SBL A;  2IA7 A;  1FZU A;  1L5G B;  2KF4 A;  2F86 B;  3F7S A;  4H3U A;  3FG1 A;  1VQM 3;  3G16 A;  1KQS 2;  1LOY A;  4O8S A;  5IF6 A;  3BIR A;  4HM1 B;  3ROB A;  3ZG5 A;  1JRQ A;  4HJL B;  1E3R A;  1BUJ A;  1PFP A;  1X1U A;  3SOY A;  1SJW A;  3VSY A;  1W2B 2;  3ZFZ A;  1FGQ A;  3CCM 3;  1ZO2 A;  1IU7 A;  1DET A;  3PCR A;  1G02 A;  1BNR A;  1N8Q A;  1UUW B;  3LT8 A;  1RRL A;  4N6M A;  3ECF A;  2XSH B;  2PZV A;  3H3H A;  4NPB A;  4XBT A;  1JB2 A;  3V92 A;  3X3Y A;  2GEX A;  3EJV A;  1JZD A;  1GMQ A;  1I0X A;  4TX4 A;  6STD A;  1STD A;  4EV2 A;  3BND A;  2Z6B A;  4HM6 B;  2XSO B;  4N6V 0;  3CPO A;  1RN7 A;  2UUG C;  1MOL A;  1BRJ A;  1UCI A;  3K9M C;  1W6Y A;  2E2T A;  2MF7 A;  1UI8 A;  4H61 A;  1O7P B;  2CWU A;  3DGN A;  1QAL A;  4KT3 B;  3FG4 A;  2K54 A;  3OX9 A;  5FGO A;  4EXR A;  3LT9 A;  4GL6 A;  3X40 A;  3CCL 3;  1GY6 A;  3EE1 A;  2OOV C;  1LRA A;  1GSP A;  1BRG A;  1GD3 A;  2WO0 A;  5CXO A;  4AKZ A;  1YJN 3;  2F4Y A;  1O7N B;  3DM8 A;  5IG4 A;  1AV4 A;  1NNV A;  1RSN A;  3BB9 A;  2P38 A;  3PGB A;  1GS3 A;  1Y4K A;  1DMQ A;  6RNT A;  1K9M 4;  1Q40 A;  1EG9 B;  4EYC A;  1MWT A;  1SIH A;  5LC7 A;  1SPU A;  1YJW 3;  4HZB B;  3CCR 3;  4GHO A;  3RGR A;  1RTU A;  3MG2 A;  1RMS A;  3PXM A;  2JQ5 A;  3F40 A;  3KII A;  3LTB A;  2Q07 A;  2W2C A;  3EN1 B;  3JUN A;  1VQ5 3;  4MMX B;  1TRQ A;  1LNI A;  1K41 A;  1A2K A;  3MPH A;  3OV4 A;  1OHS A;  1BOX A;  1BNS A;  3K5T A;  4JRF A;  1M1K 4;  1QAK A;  2FNQ A;  2YFL B;  1JKG B;  1G96 A;  1ZX2 A;  1QVF 2;  1J2B A;  1OF5 B;  4FMB A;  3GSP A;  1KWI A;  3AMO A;  3IPT A;  1ROA A;  1X1W A;  3NBB A;  1YVB I;  4WWU C;  2YFJ B;  1HZ1 A;  2IUK A;  1X1X A;  3MKI A;  3G4S 3;  2LQV A;  1EUI C;  1I2F A;  2HMO B;  4KFF A;  4R1K A;  3WA2 X;  2CFL A;  5IER A;  3FG3 A;  1YGE A;  3CCU 3;  4MMZ B;  1I2E A;  1IVW A;  3F8H A;  1OAC A;  1ASK A;  4EW5 A;  4FMD A;  2CK3 H;  4NRE A;  2C4B A;  2YX9 A;  2K3D A;  4J5G A;  3VF1 A;  1GYB A;  1NJI 4;  7STD A;  3WR2 A;  1W2Z A;  1B21 A;  1DYU A;  4U13 A;  2KRT A;  3NUV A;  5ELJ A;  2Y74 A;  4FMA A;  4R9K A;  3V98 A;  1ULI B;  1BRH A;  1US1 A;  4RBN A;  2CFD A;  1B2X A;  1W01 A;  2W56 B;  5IG5 A;  1VQ8 3;  1RHL A;  4EC6 A;  3NBJ A;  4FMC A;  2F5W A;  3SOA A;  3FZW A;  1LOX A;  1MNL A;  1SII A;  2IMJ A;  3JVC A;  1BNG A;  1BIR A;  1PU4 A;  2OTL 3;  1I2G A;  3CCE 3;  1RGA A;  1UUV B;  3D4A A;  3SED A;  1D6U A;  1W4N A;  3KFQ C;  4ILF A;  1IT7 A;  4HM0 B;  3CD6 3;  2P0M A;  4AEQ A;  4R4K A;  1CEW I;  3UJM A;  5JBS A;  1SAR A;  3GZB A;  1O7G B;  1TJD A;  2XFS A;  4FCM A;  2RBI A;  3Q1C A;  5G1K A;  7RNT A;  3NV0 A;  3CCV 3;  2BNG A;  2A15 A;  3GWR A;  4I4K A;  2CFW A;  2WGO A;  5IEO A;  1V58 A;  3UL5 A;  1OH0 A;  2I9W A;  1FUS A;  2KF3 A;  4WYK A;  3STD A;  1OPY A;  4WFO A;  4N6O B;  1RLS A;  4O02 B;  1EA2 A;  4HM3 B;  4N6T A;  1JB5 A;  2W04 A;  2CWV A;  2W0Q A;  1KC8 4;  1YNV X;  3GZR A;  3CCJ 3;  2CX1 A;  3FLJ A;  4BL2 A;  2HMM B;  2OQE C;  3NM2 A;  4KVH A;  2CKF B;  2XGL A;  1TUH A;  1T2H A;  1B27 A;  3URP A;  2WOH A;  4K90 B;  4FCZ A;  1Q86 4;  3DZL A;  1Q81 4;  1RGE A;  3NHX A;  3CC7 3;  3HZP A;  1RGC A;  1JN5 B;  3EBT A;  4N6L A;  5AIH A;  3T8N A;  2BMR B;  1ZS7 A;  4J5K A;  2QGU A;  1EEJ A;  3VGN A;  3X42 A;  3FH1 A;  1JJ2 2;  3J7Y d;  4BU4 A;  1UW1 A;  3ZG0 A;  2XH9 A;  3MSO A;  3V99 A;  1LOW A;  2GXF A;  3EHC A;  1BSA A;  3X3X A;  4OVM A;  1WMP A;  2F98 A;  4XBX A;  1I70 A;  3S5C A;  3CCQ 3;  5D81 A;  3K7C A;  2RGQ A;  4LGQ A;  3CC2 3;  1VQP 3;  5AYS C;  1IQY A;  1NO3 A;  1A2P A;  3E99 A;  3U97 A;  1VQ7 3;  1K73 4;  3RGA A;  1VQ9 3;  1UCK A;  1RJO A;  2M7O A;  3GZY B;  1T3B A;  3EBY A;  1QAF A;  1BNI A;  3WHO A;  1JBS A;  2XFT A;  1NB5 I;  2WOF A;  2E2U A;  1RN4 A;  3BNB A;  1MWR A;  3B8L A;  1RGG A;  1F8N A;  2XRX B;  1BNJ A;  4XDV A;  2BHM A;  3OWS A;  3DH2 A;  3AGO A;  1O7W B;  3NQZ A;  2D42 A;  1BNE A;  2CG0 A;  2GEY A;  3EN8 A;  1OGZ A;  3FF2 A;  3OWU A;  3FCS B;  4GSP A;  4CPK A;  1RGF A;  2HML B;  2SAR A;  5G1L A;  4EV5 A;  5BVB A;  1BVI A;  1SQW A;  2WGQ A;  3AMO B;  3S27 A;  1QJG A;  2BU4 A;  2ML6 A;  3GZX B;  5CLK A;  1D6Y A;  1CH0 A;  1S72 3;  3RNT A;  5HOH A;  4RNZ A;  3S29 A;  3B4O A;  3LZA A;  4HBR A;  3UL6 A;  1IDP A;  3CCS 3;  1W7C A;  3D9R A;  4K1U A;  1WMO A;  4X2H A;  5BIR A;  1UCJ A;  1HU9 A;  3KCH A;  3MYT A;  3MHE A;  2CHC A;  4K61 A;  1Q82 4;  2KCD A;  2HMK B;  5M19 A;  3MWZ A;  1ISK A;  2XF3 A;  1OGX A;  2OCT A;  3KE7 A;  1G0T A;  1ROV A;  1YVS A;  2YFI B;  5M18 A;  1BRN L;  2CFG A;  1FGM A;  1DMM A;  3G8Z A;  5EEO A;  1GMP A;  5M1A A;  2O3O A;  1FUT A;  1BRI A;  4HAA A;  1JBR A;  3SLU A;  2P05 A;  1BUQ A;  1BSC A;  3I0Y A;  2RNT A;  2INX A;  3LTD A;  3NM7 A;  2IUJ A;  2LYX A;  1M9G A;  5KP4 A;  1BRS A;  4QWT A;  1W6C A;  3G71 3;  2QEX 3;  3KSP A;  1ULJ B;  3N9H A;  1V57 A;  5BXQ A;  1UGH I;  1IVX A;  3QK9 A;  1UUG B;  3WA3 A;  1UCL A;  3MG1 A;  1NB3 I;  4O3V A;  2OTJ 3;  2BMO B;  4FCJ A;  4N3V A;  3WMD A;  1X1Y A;  1R4Y A;  4X2O A;  3B7C A;  5AIG A;  4FR9 A;  1WQL B;  1QMA A;  2Z77 A;  1A2V A;  1GOY A;  1M1X B;  5CF1 A;  2AAD A;  1MGR A;  1YGW A;  4R80 A;  2L1S A;  1BRK A;  1OHO A;  1TRP A;  2UX0 A;  1TFK A;  3IMA B;  3LTC A;  3N8B A;  3NV0 B;  2BMQ B;  3PYJ A;  4HM5 B;  1I8V A;  2L4V A;  4I5Q A;  1LNH A;  3WOF B;  8CHO A;  5IW9 A;  3SX1 A;  3JUQ A;  3I56 3;  1O7H B;  3OW2 2;  3N54 B;  6GSP A;  5CF2 A;  3JUP A;  4WYK B;  1MWS A;  1OF5 A;  3DGO A;  4R9L A;  1CQS A;  3S67 A;  1BU4 A;  3Q90 A;  1GY5 A;  5STD A;  1C54 A;  1N9E A;  1TFO A;  1UDI I;  3EF8 A;  1RGH A;  4MEI A;  4BL3 A;  2C11 A;  2XGN A;  4KFE A;  4RNY A;  3PS8 A;  4HM8 B;  2XR8 B;  1GMR A;  2CWT A;  2GU1 A;  1K28 A;  4K1V A;  5TGN A;  2B24 B;  3OXA A;  3KSE D;  4ORL A;  3BNC A;  1I3I A;  1OCV A;  3L0R A;  1STF I;  4L7K A;  1UGI A;  1V74 A;  2AAE A;  3EX9 A;  1WTH A;  3Q2P A;  4BTY A;  1LXE A;  1VQ4 3;  1VQN 3;  1A90 A;  1Q7H A;  1RGL A;  3H51 A;  1O7M B;  4GB5 A;  3BU4 A;  3T0U A;  1AY7 A;  2W56 A;  4LSO A;  3I55 3;  3LYG A;  1DVC A;  1GOU A;  1IT8 A;  5JPU A;  3DGM A;  1YHQ 3;  1VQQ A;  2ZDJ A;  1C7H A;  4MMY B;  2CFK A;  1GOV A;  1W6G A;  2FGT A;  3M8C A;  2J8X B;  3EC9 A;  2XEP A;  1GY7 A;  3DY5 A;  4HVN A;  4HYZ A;  5RNT A;  2F56 A;  2QA4 3;  4STD A;  1FYS A;  4HZ9 B;  1BNF A;  2ZL8 A;  4BTW A;  2P0X A;  2R41 A;  1T5Y A;  4J8T A;  5JPP A;  4KZ1 A;  1TTO A;  3AHW A;  1BAO A;  2JDI H;  4WHA A;  1FA3 A;  1EKM A;  3PZW A;  2GSP A;  1RRH A;  2HOH A;  4XM4 A;  1W5Z A;  1KD1 4;  5G2G A;  3NXJ A;  1ZGX A;  4IIA A;  3A5E A;  7GSP A;  1CYU A;  4CJN A;  1RGK A;  3D3L A;  3K63 A;  3KN4 A;  3SYU A;  4L8O A;  3DGL A;  1AQZ A;  1NU3 A;  3FKA A;  4HM4 B;  4MJD A;  3SXX A;  3DUK A;  5IEN A;  1IQ8 A;  3NBR A;  4J9A A;  1Q40 B;  4HM2 B;  4RZM A;  1TIJ A;  2ZHX B;  3CU3 A;  1MWU A;  3QRD A;  3DGY A;  1FGT A;  1D6Z A;  2FXT A;  1LVN A;  2STD A;  4XBY A;  2Y73 A;  1A67 A;  1TU5 A;  4KFD A;  4LMI A;  1N9J A;  3D5G A;  9RNT A;  2KF5 A;  2ZA4 A;  1AVK A;  1IV7 A;  5A0O B;  8RNT A;  1JBT A;  1BSE A;  1Q7Y 4;  1FGR A;  2C10 A;  3B4P A;  3BNE A;  2BIR A;  5IG3 A;  1DVD A;  3FGY A;  3JUM A;  5IG0 A;  1GD4 A;  1YI2 3;  2R4I A;  1BAN A;  5D82 A;  1IQX A;  5I97 A;  1B3S A;  1JN5 A;  3D79 A;  3NX0 A;  4WP5 A;  5EVH A;  3WOE B;  5IEP A;  3CXC 2;  1VQO 3;  2V1L A;  2PNC A;  2IYJ A;  3X41 A;  2KF6 A;  1M90 4;  1RNB A;  1IYY A;  1EQK A;  1OUN A;  1VZZ A;  2CC3 A;  2O9U X;  4OK0 A;  5LC6 A;  5AEU B;  5AEW B;  1HYF A;  2CH9 A;  4HM7 B;  3D5I A;  1B2S A;  2KAA A;  4PEJ A;  4OUQ A;  1VQK 3;  1N5H A;  3CC4 3;  2RSX A;  3G6E 3;  1K8A 4;  3DXO A;  2P09 A;  1JNQ A;  3IJE B;  3O8Y A;  2E2V A;  4DKI A;  1MGW A;  4LEH A;  5HGR A;  1DE3 A;  5AII A;  4JF8 A;  3NQY A;  1B20 A;  1E3V A;  1JZO A;  2GBW B;  3HI7 A;  3MG3 A;  3CMA 3;  1LQM B;  1NWW A;  2W9P A;  1U8C B;  4G1M B;  3HIG A;  3HOH A;  3LXU X;  3CNX A;  3A76 A;  4ZM8 A;  1PYL A;  1AVL A;  3DMC A;  3FSD A;  3WOD G;  1FW7 A;  1TP6 A;  1LQG C;  1LOV A;  2UGI A;  3RDE A;  1RDS A;  1IVV A;  2HMJ B;  1I3F A;  3WDG B;  3F7X A;  1R4C A;  2W9Q A;  2CG1 A;  2OQE A;  1Q42 A;  3CNM A;  3S28 A;  1VQ6 3;  5AI1 A;  2H0H A;  4N6N B;  1RN1 A;  3ALA A;  1RCL A;  1B2U A;  1RCK A;  1WNH A;  2KXG A;  2F5M A;  2GU3 A;  3EQQ B;  1YIJ 3;  4IPB A;  5DRE A;  3TDG A;  1KSI A;  4NHF A;  3F9S A;  5AIF A;  2B1X B;  4CDL A;  2W6J H;  4O2H A;  2W03 A;  2Z7A A;  2BO9 B;  2F99 A;  3F14 A;  5FW5 A;  4LZI A;  1DMN A;  5ELU A;  1NDO B;  3EB8 A;  3CPW 2;  1B2Z A;  5CK6 A;  1IK3 A;  2ML5 A;  3HX8 A;  4AKY A;  4Q53 A;  1IV9 A;  1JKG A;  2K0M A;  2Z76 A;  3U1W A;  2MC8 A;  5AYR B;  1N5P A;  1OHP A;  3FF0 A; 
#chains in the Genus database with same CATH homology
 1BNI A;  1JBS A;  1BSB A;  1BOX A;  1BNS A;  1GOV A;  1RN4 A;  1RNT A;  1RGG A;  3GSP A;  5RNT A;  1BNJ A;  1X1W A;  2F56 A;  1FYS A;  1BNF A;  1HZ1 A;  1X1X A;  3AGO A;  3DH2 A;  1BNE A;  1TTO A;  3AHW A;  1BAO A;  4GSP A;  4HOH A;  1I2F A;  2GSP A;  2HOH A;  1RGF A;  2SAR A;  1ZGX A;  1BVI A;  3A5E A;  7GSP A;  1RGK A;  2BU4 A;  3SYU A;  1I2E A;  1CH0 A;  1AQZ A;  1Q9E A;  3RNT A;  5HOH A;  1I0V A;  2C4B A;  4J5G A;  1T2I A;  5BU4 A;  4RNT A;  3WR2 A;  5BIR A;  1B21 A;  1UCJ A;  3KCH A;  3AGN A;  3DGY A;  3Q3F A;  3AHS A;  1BRH A;  1B2X A;  5GSP A;  3D5G A;  1YVS A;  1RHL A;  9RNT A;  2KF5 A;  2ZA4 A;  1BRN L;  2F5W A;  1BSD A;  1GMP A;  8RNT A;  1BSE A;  1FUT A;  1JBT A;  1BGS A;  1BNG A;  1BIR A;  1BRI A;  1PY3 A;  2BIR A;  4HAA A;  1I2G A;  4BIR A;  1B2M A;  1JBR A;  1BSC A;  1RGA A;  1BAN A;  2RNT A;  1B3S A;  3D4A A;  1FZU A;  2KF4 A;  1BRS A;  2KF6 A;  1RNB A;  1IYY A;  1LOY A;  3BIR A;  1HYF A;  3D5I A;  1B2S A;  2KAA A;  1BUJ A;  1SAR A;  3WHO A;  1X1U A;  1UCL A;  2RBI A;  1MGW A;  1DE3 A;  1DET A;  7RNT A;  1X1Y A;  1B20 A;  1R4Y A;  1G02 A;  1BNR A;  1GOY A;  2AAD A;  1MGR A;  1YGW A;  2KF3 A;  1FUS A;  3HOH A;  1BRK A;  1PYL A;  1FW7 A;  1RLS A;  1TRP A;  1LOV A;  1RDS A;  1GMQ A;  1I0X A;  1I3F A;  1YNV X;  1I8V A;  6GSP A;  1BRJ A;  1UCI A;  1RN1 A;  1T2H A;  1RCL A;  1B27 A;  1RCK A;  1B2U A;  3URP A;  1BU4 A;  2F5M A;  1C54 A;  1RGE A;  1RGC A;  1RGH A;  4J5K A;  1LRA A;  1GSP A;  1BRG A;  2F4Y A;  4BU4 A;  1RSN A;  1GMR A;  1LOW A;  6RNT A;  1I3I A;  1BSA A;  1B2Z A;  2AAE A;  1I70 A;  4GHO A;  1RGL A;  1RTU A;  3BU4 A;  1RMS A;  1AY7 A;  1A2P A;  1GOU A;  1UCK A;  1TRQ A;  1LNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...