1B2SA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
AQVINTFDGVADYLQTYHKLPDNYITASEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2sA00
4J5KA 1RGKA 1BSAA 2F5MA 1RGGA 1RHLA 1BANA 3WR2A 3D4AA 1BNFA 1PYLA 3KCHA 3AGNA 1RGHA 2KF3A 1BIRA 4J5GA 3RNTA 1RTUA 1B3SA 1I0XA 3DGYA 9RNTA 1UCLA 1A2PA 1BNEA 1BVIA 1R4YA 1GMQA 1I3IA 1RCKA 1RN4A 1TTOA 3AGOA 1LOYA 2AADA 1GOUA 3Q3FA 1RNBA 1TRPA 1BAOA 3AHSA 1RGAA 3SYUA 1RDSA 2KF4A 6GSPA 6RNTA 1DE3A 2RNTA 3GSPA 1FUSA 1I3FA 5HOHA 1RSNA 1FYSA 5BIRA 4HAAA 8RNTA 1UCIA 2KF6A 1RNTA 1LOVA 1BRKA 1BSEA 1I0VA 1X1XA 4GSPA 5GSPA 1BRJA 1BGSA 1BNJA 2ZA4A 1B2XA 1CH0A 1B2ZA 1RCLA 1IYYA 1LOWA 1FW7A 1ZGXA 1JBRA 3BU4A 1GMRA 1AQZA 1MGWA 3AHWA 1BNIA 1BRSA 1B21A 1UCJA 2BIRA 1BUJA 2C4BA 1FUTA 5BU4A 1B27A 1BNSA 1LNIA 1BRGA 1HZ1A 1I8VA 1T2IA 1TRQA 1PY3A 1B20A 1RLSA 1RGLA 4RNTA 7GSPA 1B2UA 3BIRA 2F5WA 2RBIA 4BIRA 1BNRA 1UCKA 1BNGA 1I2FA 1Q9EA 1B2MA 1C54A 1RGEA 1JBSA 3URPA 1BU4A 1GMPA 1I2EA 1GSPA 1YVSA 4BU4A 5RNTA 1JBTA 4HOHA 1RGFA 3WHOA 1G02A 2AAEA 2KAAA 1GOYA 1X1WA 1BSCA 1I2GA 2BU4A 7RNTA 1FZUA 1AY7A 1X1YA 2SARA 3A5EA 1I70A 1BSDA 2GSPA 1GOVA 1LRAA 1BRIA 3HOHA 2F4YA 1RMSA 1SARA 4GHOA 1BOXA 3D5GA 1YGWA 3D5IA 1DETA 1T2HA 1X1UA 1BSBA 2HOHA 2F56A 1BRNL 1BRHA 1MGRA 1HYFA 1RGCA 1RN1A 1B2SA 3DH2A 2KF5A 1YNVX
chains in the Genus database with same CATH superfamily
3WOFB 3H51A 1JZOA 4OUQA 3CC43 2CX0A 5IERA 2XEPA 4HM4B 4KVHA 4EYCA 1BANA 1E3VA 1ASKA 2J8XB 4WYKB 2GU3A 4X2HA 3G0KA 2P09A 4U13A 3AGNA 2HMNB 1Q40A 1KC84 4XBXA 1IQ8A 1FGRA 3B4PA 1C7HA 5BXQA 4K1VA 1V57A 3J7Yd 2C11A 3CCL3 4RNZA 3RNTA 1EEJA 2W03A 4KFEA 3CCJ3 3PYJA 1ROVA 3JVCA 2E2UA 2RFRA 5CLKA 3F8XA 3FG3A 1UCLA 1BVIA 4LMIA 1I3IA 1RN4A 1TTOA 2XSOB 3Q3FA 6STDA 1VQM3 3GAXA 5IW9A 2H0IA 2D1WA 4LZIA 2CK3H 1K8A4 4LYLB 5EQLA 4ILFA 3F40A 3LT9A 3RGAA 2HMLB 4FMCA 1FYSA 2ZHXB 3BNEA 2BO9B 2CWUA 1V74A 3Q90A 2CG1A 4O8SA 4FR9A 1LOVA 1BRKA 1CYUA 5IG4A 1N8QA 1U5OA 3NBBA 5AEUB 1LXEA 4HJLB 2XRXB 3AMOA 1OACA 1UUWB 5D82A 1LOWA 3PS8A 4MMYB 2XGLA 1LVNA 1ZGXA 1NB3I 2PZVA 4TX4A 4HM7B 3OWUA 3S5CA 3BU4A 3Q1CA 3DM8A 1JBRA 4XBTA 3LH4A 4KZ1A 3RDEA 1DMMA 3FSDA 2PNCA 3EX9A 3S27A 3NX0A 1UCJA 3X3ZA 1BUJA 1ULIB 4BL3A 3NBRA 3O8YA 4AKYA 4CPKA 3WOEB 2OQEC 1D6YA 3ZFZA 1W2B2 3NQZA 5BU4A 1B27A 1NJI4 1BNSA 1NU3A 3EJVA 4FCJA 1HZ1A 3WA3A 3CMA3 4R9LA 5AIIA 1RLSA 2STDA 2Z7AA 3K0ZA 2CHCA 1TFKA 2CW9A 7GSPA 1MWSA 5CK6A 3NBJA 2WGQA 2HMOB 2LYXA 1IVXA 1N5PA 3KSPA 2GBWB 4RNYA 3MG3A 1UCKA 2JQ5A 2SBLA 1G96A 1BNGA 1I2FA 1Q9EA 1STDA 1C54A 3CNXA 1GY5A 1OF5B 1ROAA 3X42A 2BNGA 2E2VA 2RSXA 1BU4A 1I2EA 2O3OA 3PXMA 4GL6A 4L7KA 1GSPA 1YVSA 2Y74A 3GZRA 3LXUX 3N9HA 5G1LA 5KP1A 1YI23 2CIUA 3B8LA 3X3XA 1RGFA 3F8HA 1G02A 1QMAA 3GZXB 3EE1A 2KAAA 1IT8A 2CG0A 4NREA 4HBRA 1JB4A 1OCVA 3A76A 4HKVB 4HM3B 3CCU3 3HIIA 1M1K4 1R4CA 2O9UX 2XSHB 1D6ZA 5DRVA 4R9KA 2SARA 1MWTA 1VQN3 2L1SA 1S723 5ELUA 1F8NA 1GOVA 1RRLA 1TFOA 3MPHA 3CME3 1E3RA 2BMRB 4HM0B 1BOXA 1T2HA 1UGHI 3JUOA 5TGNA 3UNLA 2GEYA 2M7OA 1W6CA 3DXOA 1RN1A 1PU4A 3ZG0A 2KCDA 4RBNA 3WDGB 1GD3A 1DMQA 1BUQA 1UW1A 1BSAA 4HZBB 1J2BA 1JNQA 1KSIA 4BTXA 3PCSA 3WR2A 3V92A 3D4AA 1NWWA 1BNFA 3B4OA 1T5YA 3KCHA 3RGRA 2OOVC 1JKGB 7STDA 3G4S3 2W9PA 3JUMA 4N6NB 2CFLA 3EB8A 3D9RA 5KP4A 1O7WB 4IPBA 2WOFA 4LEHA 4X2OA 2Y73A 3G6E3 4J5GA 1RTUA 2QEX3 1EA2A 3WODG 3DY5A 1CQSA 3OW22 1M9GA 3Q2PA 1A2PA 1BNEA 4MMXB 1QJGA 1R4YA 5KP3A 1RCKA 3DZLA 2XR8B 4OVMA 1M1XB 5ELJA 3EN8A 3TDGA 4LSOA 5G2GA 1JRQA 2CKFB 3SLUA 2ML6A 2K0MA 1RDSA 3MKIA 2KF4A 3EBYA 4HYZA 4XB5A 6RNTA 1GY6A 2W04A 4O02B 3SVAA 1TIJA 2RNTA 1FUSA 4KFDA 3VSYA 4EV5A 5HOHA 2W6JH 1AVLA 1UCIA 2KF6A 1V58A 1I0VA 4FMBA 1X1XA 3CPW2 1NO3A 3VGNA 2IUJA 1Q824 3OXAA 3U97A 1RRHA 4WP5A 1BGSA 2ZA4A 1SPUA 3B7CA 2QGUA 1RCLA 4FCMA 3SOYA 2C10A 3N8BA 3NQYA 1O7PB 4EC6A 3EHCA 2R4IA 5AYRB 3V98A 3BNDA 3FCSB 1GMRA 1KQS2 3MG2A 2F86B 5JBSA 2Q07A 1BNIA 3EN1B 4WYKA 1B21A 1STFI 1G0TA 2YX9A 1CEWI 1Q7HA 1MOLA 3OX9A 1JB2A 2C4BA 3GWRA 1DVCA 4N6MA 1FUTA 3K63A 1YGEA 1GD4A 1LNIA 4MMZB 1T2IA 2UGIA 1AR0A 1IQYA 1HKXA 3MYTA 1IU7A 1PY3A 3UJMA 5IG5A 1B20A 1IT7A 2BT3A 1Q7Y4 4IIAA 5HGRA 4NHFA 1E97A 4GB5A 4N6UA 4FCZA 1Q864 1DMNA 2F5WA 2RBIA 1BNRA 4J9AA 1IV7A 1WNHA 4K90B 1JN5B 3I553 1VQ53 4KFFA 5AI1A 1VQ93 5FW5A 4IT7A 1JZDA 1QALA 4NPBA 4RZMA 2P38A 1Z1SA 5EVHA 3CXC2 2QIYA 3H3HA 2GBXB 3LTCA 2MC8A 3WHOA 1WMNA 1YJW3 1W5ZA 1GOYA 1X1WA 2QA43 2B1XB 1D6UA 3CCM3 5M1AA 1FZUA 1SIHA 1KD14 4ZM8A 1BSDA 2GSPA 4AKZA 3WMDA 4KT3B 4N6TA 3IMAB 5IG3A 5D83A 5CXOA 3CCE3 2IYJA 3CCS3 1TUHA 1SARA 3NV0B 4GHOA 1A2KA 1YGWA 1ULJB 3D5IA 4WWUC 4BTYA 3KSED 1QVG2 1BSBA 5AIFA 1W6YA 3OWYA 1MGRA 3G16A 3K9MC 2OTL3 1RGCA 1B2SA 3NM7A 3DH2A 3OV4A 1VQ63 1IQXA 1AVKA 3LTAA 3HK4A 4O2HA 1YIT3 1RGKA 4FMAA 3F9SA 2F5MA 1PFPA 1UUGB 2F98A 3DGLA 3D79A 3MWZA 1RHLA 3CPOA 3LT8A 2W0QA 1PYLA 4FMDA 1IK3A 1OUNA 3KIIA 2P0MA 3NM2A 2Z77A 2RGQA 3FG4A 2GU1A 1OF5A 1GY7A 3DGMA 5FGOA 1BIRA 1LOXA 1EKMA 4PEJA 1NNVA 3GZYB 3G8ZA 1YJ93 1I0XA 4N6OB 3DGYA 4HM6B 9RNTA 1A2VA 4EXRA 1YIJ3 2K3DA 1N9EA 3FKAA 1L5GB 4HM8B 4J8TA 3AGOA 1IV9A 1UI7A 1W2ZA 2AADA 2CFGA 3ECFA 1IVWA 2FNQA 1S5AA 2W56B 3F7XA 1TRPA 1BAOA 1RGAA 3SYUA 2D42A 3JUPA 5AIGA 6GSPA 3NHXA 1GS3A 1DE3A 5STDA 1VQQA 2IMJA 4H61A 1WMPA 1FGMA 2BMQB 1QAFA 4HM1B 1MNLA 1Q42A 5BIRA 5AEWB 1FGQA 1N8R4 1OPYA 1RNTA 1BSEA 4I5QA 3QK9A 3LTBA 1UDII 2UX0A 4K1UA 3EQQB 1TU5A 3FG1A 1O7HB 1SQWA 3CCQ3 1B2XA 4N3VA 1B2ZA 4DKIA 3MG1A 1UGIA 3KE7A 4JF8A 1FW7A 2P05A 3FLJA 2A15A 1AQZA 1MGWA 1OHPA 3LZAA 1MWUA 3DMCA 2BMOB 3QRDA 2BIRA 1O7NB 4LGQA 2OWPA 1JKGA 4WHAA 1EUIC 4L8PA 2OQEA 1K28A 5EEOA 1OHSA 1VQP3 3F14A 1N9JA 1RJOA 3SOAA 1BRGA 1LQGC 2CX1A 1O7GB 3X40A 3S29A 1RGLA 2WO0A 3X3YA 3F7SA 1B2UA 8CHOA 4HZ9B 3PCRA 1DYUA 5JPPA 3U1WA 5CF1A 4CJNA 2LQVA 1U8CB 1WQLB 1Q40B 4N6LA 1B2MA 1GYBA 4BL2A 1RGEA 1JBSA 4XDVA 3LTDA 3E99A 3JUNA 2YFJB 3UB1A 4EW5A 4XDWA 2OCTA 1GMPA 1W00A 3JUQA 5IEOA 2XFSA 2FGTA 4HOHA 2BHMA 4O3VA 3WA2X 1YHQ3 1LNHA 5IG0A 2INXA 3K7CA 3HZPA 2CFDA 1ZX2A 4N6V0 3KKGA 2IY2A 4MEIA 5AYSC 1I70A 2H0HA 4K61A 3T8NA 2YFIB 3N54B 1BRIA 3VF1A 3HOHA 3S28A 2JDIH 2W2CA 1RKYA 3D5GA 4R4KA 2KXGA 3MHEA 1DETA 1X1UA 2HOHA 3UL6A 1SIIA 5A0OB 4H3UA 1ISKA 2XH9A 3I0YA 1EQKA 3ZG5A 2CC3A 1HYFA 3KN4A 2B24B 3DGNA 1FA3A 1A90A 2KF5A 3AMOB 1K41A 1YNVX 2IUKA 3M8CA 4J5KA 5DREA 2XF3A 3STDA 2I9WA 3EF8A 3CCR3 3CC23 2CWVA 3DGOA 2HMMB 3BB9A 1RGGA 2ML5A 2ZL8A 1JB5A 4XM4A 3EC9A 4MJDA 2OOVA 4EV2A 3G713 3S67A 1AV4A 1RGHA 1JN5A 1ZS7A 3FF2A 3FF0A 2FXTA 1TJDA 4ORLA 2KF3A 1VZZA 1K734 5IF6A 1B3SA 1YVBI 1Y4KA 2WOHA 3BNBA 4OK0A 4XBYA 2KRTA 4HM5B 2XFTA 2CWTA 4QWTA 1GMQA 2F99A 3D3LA 1LOYA 1OGXA 1GOUA 1Q814 3HI7A 2UUGC 1RN7A 2CFKA 1T3BA 1RNBA 3T8UA 1WTHA 3AHSA 3GRDA 5AIHA 1FGOA 2YFLB 2V1LA 5D81A 3GSPA 1JJ22 1MWRA 3BNCA 1I3FA 1UUVB 3CC73 1RSNA 3KZTA 4HAAA 8RNTA 3NV0A 2XGNA 1VQ43 1LQMB 5BVBA 4CDLA 1OGZA 1W6GA 1NB5I 4GSPA 3CD63 1FGTA 5IENA 1VQ73 5GSPA 1BRJA 4R1KA 3FGYA 1BNJA 1JV2B 1CH0A 3SEDA 1IYYA 3IPTA 2CH9A 4EBGA 4JRFA 1EG9B 2MF7A 3FZWA 4CCVA 3AHWA 3LOYA 3PZWA 1BRSA 1W4NA 5G1KA 3SXXA 5I97A 2W9QA 1M904 3CCV3 2R41A 1ZO2A 4I4KA 1OH0A 1VQL3 1IVUA 4AEQA 3ALAA 1QAKA 5IEPA 3ER7A 1I8VA 1TRQA 4STDA 3NUVA 3NXJA 5LC6A 3HIGA 3T0UA 2Z6BA 4RNTA 3CNMA 2Z76A 3BIRA 1KWIA 1A67A 3FH1A 2IA7A 2CFWA 4BIRA 1DVDA 5M19A 1UI8A 4HM2B 2HMKB 3ROBA 2OTJ3 2W56A 2ZDJA 1W7CA 5JPUA 1W01A 1SJWA 3URPA 1WMOA 1VQK3 4BU4A 5RNTA 1CYVA 2H0GA 1JBTA 2K54A 1K9M4 3LMLA 5M18A 2AAEA 1HU9A 3X41A 1IDPA 3IJEB 3I563 2WGOA 3UL5A 1BSCA 1IVVA 1I2GA 2BU4A 4HVNA 1TP6A 7RNTA 3KFQC 1YJN3 1W02A 2L4VA 1QVF2 3OWSA 1US1A 1AY7A 1X1YA 3BLZA 3A5EA 3EBTA 3K5TA 4L8OA 3HX8A 4BTWA 1LRAA 2P0XA 3DUKA 3LYGA 1O7MB 1VQO3 3L0RA 2HMJB 1NDOB 2F4YA 4R80A 1RMSA 2E2TA 3MSOA 5LC7A 2GXFA 4G1MB 3V99A 4WFOA 2F56A 3GZBA 3SX1A 1BRNL 1BRHA 1N5HA 2RCDA 3CU3A 2GEXA 3PGBA 1VQ83 1FUWA 5CF2A 4Q53A 1OHOA
chains in the Genus database with same CATH topology
4J5KA 1RGKA 1BSAA 2F5MA 1RGGA 1RHLA 1BANA 3WR2A 3D4AA 1BNFA 1PYLA 3KCHA 3AGNA 1RGHA 2KF3A 1BIRA 4J5GA 3RNTA 1RTUA 1B3SA 1I0XA 3DGYA 9RNTA 1UCLA 1A2PA 1BNEA 1BVIA 1R4YA 1GMQA 1I3IA 1RCKA 1RN4A 1TTOA 3AGOA 1LOYA 2AADA 1GOUA 3Q3FA 1RNBA 1TRPA 1BAOA 3AHSA 1RGAA 3SYUA 1RDSA 2KF4A 6GSPA 6RNTA 1DE3A 2RNTA 3GSPA 1FUSA 1I3FA 5HOHA 1RSNA 1FYSA 5BIRA 4HAAA 8RNTA 1UCIA 2KF6A 1RNTA 1LOVA 1BRKA 1BSEA 1I0VA 1X1XA 4GSPA 5GSPA 1BRJA 1BGSA 1BNJA 2ZA4A 1B2XA 1CH0A 1B2ZA 1RCLA 1IYYA 1LOWA 1FW7A 1ZGXA 1JBRA 3BU4A 1GMRA 1AQZA 1MGWA 3AHWA 1BNIA 1BRSA 1B21A 1UCJA 2BIRA 1BUJA 2C4BA 1FUTA 5BU4A 1B27A 1BNSA 1LNIA 1BRGA 1HZ1A 1I8VA 1T2IA 1TRQA 1PY3A 1B20A 1RLSA 1RGLA 4RNTA 7GSPA 1B2UA 3BIRA 2F5WA 2RBIA 4BIRA 1BNRA 1UCKA 1BNGA 1I2FA 1Q9EA 1B2MA 1C54A 1RGEA 1JBSA 3URPA 1BU4A 1GMPA 1I2EA 1GSPA 1YVSA 4BU4A 5RNTA 1JBTA 4HOHA 1RGFA 3WHOA 1G02A 2AAEA 2KAAA 1GOYA 1X1WA 1BSCA 1I2GA 2BU4A 7RNTA 1FZUA 1AY7A 1X1YA 2SARA 3A5EA 1I70A 1BSDA 2GSPA 1GOVA 1LRAA 1BRIA 3HOHA 2F4YA 1RMSA 1SARA 4GHOA 1BOXA 3D5GA 1YGWA 3D5IA 1DETA 1T2HA 1X1UA 1BSBA 2HOHA 2F56A 1BRNL 1BRHA 1MGRA 1HYFA 1RGCA 1RN1A 1B2SA 3DH2A 2KF5A 1YNVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5K A;  1RGK A;  1BSA A;  2F5M A;  1RGG A;  1RHL A;  1BAN A;  3WR2 A;  3D4A A;  1BNF A;  1PYL A;  3KCH A;  3AGN A;  1RGH A;  2KF3 A;  1BIR A;  4J5G A;  3RNT A;  1RTU A;  1B3S A;  1I0X A;  3DGY A;  9RNT A;  1UCL A;  1A2P A;  1BNE A;  1BVI A;  1R4Y A;  1GMQ A;  1I3I A;  1RCK A;  1RN4 A;  1TTO A;  3AGO A;  1LOY A;  2AAD A;  1GOU A;  3Q3F A;  1RNB A;  1TRP A;  1BAO A;  3AHS A;  1RGA A;  3SYU A;  1RDS A;  2KF4 A;  6GSP A;  6RNT A;  1DE3 A;  2RNT A;  3GSP A;  1FUS A;  1I3F A;  5HOH A;  1RSN A;  1FYS A;  5BIR A;  4HAA A;  8RNT A;  1UCI A;  2KF6 A;  1RNT A;  1LOV A;  1BRK A;  1BSE A;  1I0V A;  1X1X A;  4GSP A;  5GSP A;  1BRJ A;  1BGS A;  1BNJ A;  2ZA4 A;  1B2X A;  1CH0 A;  1B2Z A;  1RCL A;  1IYY A;  1LOW A;  1FW7 A;  1ZGX A;  1JBR A;  3BU4 A;  1GMR A;  1AQZ A;  1MGW A;  3AHW A;  1BNI A;  1BRS A;  1B21 A;  1UCJ A;  2BIR A;  1BUJ A;  2C4B A;  1FUT A;  5BU4 A;  1B27 A;  1BNS A;  1LNI A;  1BRG A;  1HZ1 A;  1I8V A;  1T2I A;  1TRQ A;  1PY3 A;  1B20 A;  1RLS A;  1RGL A;  4RNT A;  7GSP A;  1B2U A;  3BIR A;  2F5W A;  2RBI A;  4BIR A;  1BNR A;  1UCK A;  1BNG A;  1I2F A;  1Q9E A;  1B2M A;  1C54 A;  1RGE A;  1JBS A;  3URP A;  1BU4 A;  1GMP A;  1I2E A;  1GSP A;  1YVS A;  4BU4 A;  5RNT A;  1JBT A;  4HOH A;  1RGF A;  3WHO A;  1G02 A;  2AAE A;  2KAA A;  1GOY A;  1X1W A;  1BSC A;  1I2G A;  2BU4 A;  7RNT A;  1FZU A;  1AY7 A;  1X1Y A;  2SAR A;  3A5E A;  1I70 A;  1BSD A;  2GSP A;  1GOV A;  1LRA A;  1BRI A;  3HOH A;  2F4Y A;  1RMS A;  1SAR A;  4GHO A;  1BOX A;  3D5G A;  1YGW A;  3D5I A;  1DET A;  1T2H A;  1X1U A;  1BSB A;  2HOH A;  2F56 A;  1BRN L;  1BRH A;  1MGR A;  1HYF A;  1RGC A;  1RN1 A;  1B2S A;  3DH2 A;  2KF5 A;  1YNV X; 
#chains in the Genus database with same CATH topology
 3WOF B;  3H51 A;  1JZO A;  4OUQ A;  3CC4 3;  2CX0 A;  5IER A;  2XEP A;  4HM4 B;  4KVH A;  4EYC A;  1BAN A;  1E3V A;  1ASK A;  2J8X B;  4WYK B;  2GU3 A;  4X2H A;  3G0K A;  2P09 A;  4U13 A;  3AGN A;  2HMN B;  1Q40 A;  1KC8 4;  4XBX A;  1IQ8 A;  1FGR A;  3B4P A;  1C7H A;  5BXQ A;  4K1V A;  1V57 A;  3J7Y d;  2C11 A;  3CCL 3;  4RNZ A;  3RNT A;  1EEJ A;  2W03 A;  4KFE A;  3CCJ 3;  3PYJ A;  1ROV A;  3JVC A;  2E2U A;  2RFR A;  5CLK A;  3F8X A;  3FG3 A;  1UCL A;  1BVI A;  4LMI A;  1I3I A;  1RN4 A;  1TTO A;  2XSO B;  3Q3F A;  6STD A;  1VQM 3;  3GAX A;  5IW9 A;  2H0I A;  2D1W A;  4LZI A;  2CK3 H;  1K8A 4;  4LYL B;  5EQL A;  4ILF A;  3F40 A;  3LT9 A;  3RGA A;  2HML B;  4FMC A;  1FYS A;  2ZHX B;  3BNE A;  2BO9 B;  2CWU A;  1V74 A;  3Q90 A;  2CG1 A;  4O8S A;  4FR9 A;  1LOV A;  1BRK A;  1CYU A;  5IG4 A;  1N8Q A;  1U5O A;  3NBB A;  5AEU B;  1LXE A;  4HJL B;  2XRX B;  3AMO A;  1OAC A;  1UUW B;  5D82 A;  1LOW A;  3PS8 A;  4MMY B;  2XGL A;  1LVN A;  1ZGX A;  1NB3 I;  2PZV A;  4TX4 A;  4HM7 B;  3OWU A;  3S5C A;  3BU4 A;  3Q1C A;  3DM8 A;  1JBR A;  4XBT A;  3LH4 A;  4KZ1 A;  3RDE A;  1DMM A;  3FSD A;  2PNC A;  3EX9 A;  3S27 A;  3NX0 A;  1UCJ A;  3X3Z A;  1BUJ A;  1ULI B;  4BL3 A;  3NBR A;  3O8Y A;  4AKY A;  4CPK A;  3WOE B;  2OQE C;  1D6Y A;  3ZFZ A;  1W2B 2;  3NQZ A;  5BU4 A;  1B27 A;  1NJI 4;  1BNS A;  1NU3 A;  3EJV A;  4FCJ A;  1HZ1 A;  3WA3 A;  3CMA 3;  4R9L A;  5AII A;  1RLS A;  2STD A;  2Z7A A;  3K0Z A;  2CHC A;  1TFK A;  2CW9 A;  7GSP A;  1MWS A;  5CK6 A;  3NBJ A;  2WGQ A;  2HMO B;  2LYX A;  1IVX A;  1N5P A;  3KSP A;  2GBW B;  4RNY A;  3MG3 A;  1UCK A;  2JQ5 A;  2SBL A;  1G96 A;  1BNG A;  1I2F A;  1Q9E A;  1STD A;  1C54 A;  3CNX A;  1GY5 A;  1OF5 B;  1ROA A;  3X42 A;  2BNG A;  2E2V A;  2RSX A;  1BU4 A;  1I2E A;  2O3O A;  3PXM A;  4GL6 A;  4L7K A;  1GSP A;  1YVS A;  2Y74 A;  3GZR A;  3LXU X;  3N9H A;  5G1L A;  5KP1 A;  1YI2 3;  2CIU A;  3B8L A;  3X3X A;  1RGF A;  3F8H A;  1G02 A;  1QMA A;  3GZX B;  3EE1 A;  2KAA A;  1IT8 A;  2CG0 A;  4NRE A;  4HBR A;  1JB4 A;  1OCV A;  3A76 A;  4HKV B;  4HM3 B;  3CCU 3;  3HII A;  1M1K 4;  1R4C A;  2O9U X;  2XSH B;  1D6Z A;  5DRV A;  4R9K A;  2SAR A;  1MWT A;  1VQN 3;  2L1S A;  1S72 3;  5ELU A;  1F8N A;  1GOV A;  1RRL A;  1TFO A;  3MPH A;  3CME 3;  1E3R A;  2BMR B;  4HM0 B;  1BOX A;  1T2H A;  1UGH I;  3JUO A;  5TGN A;  3UNL A;  2GEY A;  2M7O A;  1W6C A;  3DXO A;  1RN1 A;  1PU4 A;  3ZG0 A;  2KCD A;  4RBN A;  3WDG B;  1GD3 A;  1DMQ A;  1BUQ A;  1UW1 A;  1BSA A;  4HZB B;  1J2B A;  1JNQ A;  1KSI A;  4BTX A;  3PCS A;  3WR2 A;  3V92 A;  3D4A A;  1NWW A;  1BNF A;  3B4O A;  1T5Y A;  3KCH A;  3RGR A;  2OOV C;  1JKG B;  7STD A;  3G4S 3;  2W9P A;  3JUM A;  4N6N B;  2CFL A;  3EB8 A;  3D9R A;  5KP4 A;  1O7W B;  4IPB A;  2WOF A;  4LEH A;  4X2O A;  2Y73 A;  3G6E 3;  4J5G A;  1RTU A;  2QEX 3;  1EA2 A;  3WOD G;  3DY5 A;  1CQS A;  3OW2 2;  1M9G A;  3Q2P A;  1A2P A;  1BNE A;  4MMX B;  1QJG A;  1R4Y A;  5KP3 A;  1RCK A;  3DZL A;  2XR8 B;  4OVM A;  1M1X B;  5ELJ A;  3EN8 A;  3TDG A;  4LSO A;  5G2G A;  1JRQ A;  2CKF B;  3SLU A;  2ML6 A;  2K0M A;  1RDS A;  3MKI A;  2KF4 A;  3EBY A;  4HYZ A;  4XB5 A;  6RNT A;  1GY6 A;  2W04 A;  4O02 B;  3SVA A;  1TIJ A;  2RNT A;  1FUS A;  4KFD A;  3VSY A;  4EV5 A;  5HOH A;  2W6J H;  1AVL A;  1UCI A;  2KF6 A;  1V58 A;  1I0V A;  4FMB A;  1X1X A;  3CPW 2;  1NO3 A;  3VGN A;  2IUJ A;  1Q82 4;  3OXA A;  3U97 A;  1RRH A;  4WP5 A;  1BGS A;  2ZA4 A;  1SPU A;  3B7C A;  2QGU A;  1RCL A;  4FCM A;  3SOY A;  2C10 A;  3N8B A;  3NQY A;  1O7P B;  4EC6 A;  3EHC A;  2R4I A;  5AYR B;  3V98 A;  3BND A;  3FCS B;  1GMR A;  1KQS 2;  3MG2 A;  2F86 B;  5JBS A;  2Q07 A;  1BNI A;  3EN1 B;  4WYK A;  1B21 A;  1STF I;  1G0T A;  2YX9 A;  1CEW I;  1Q7H A;  1MOL A;  3OX9 A;  1JB2 A;  2C4B A;  3GWR A;  1DVC A;  4N6M A;  1FUT A;  3K63 A;  1YGE A;  1GD4 A;  1LNI A;  4MMZ B;  1T2I A;  2UGI A;  1AR0 A;  1IQY A;  1HKX A;  3MYT A;  1IU7 A;  1PY3 A;  3UJM A;  5IG5 A;  1B20 A;  1IT7 A;  2BT3 A;  1Q7Y 4;  4IIA A;  5HGR A;  4NHF A;  1E97 A;  4GB5 A;  4N6U A;  4FCZ A;  1Q86 4;  1DMN A;  2F5W A;  2RBI A;  1BNR A;  4J9A A;  1IV7 A;  1WNH A;  4K90 B;  1JN5 B;  3I55 3;  1VQ5 3;  4KFF A;  5AI1 A;  1VQ9 3;  5FW5 A;  4IT7 A;  1JZD A;  1QAL A;  4NPB A;  4RZM A;  2P38 A;  1Z1S A;  5EVH A;  3CXC 2;  2QIY A;  3H3H A;  2GBX B;  3LTC A;  2MC8 A;  3WHO A;  1WMN A;  1YJW 3;  1W5Z A;  1GOY A;  1X1W A;  2QA4 3;  2B1X B;  1D6U A;  3CCM 3;  5M1A A;  1FZU A;  1SIH A;  1KD1 4;  4ZM8 A;  1BSD A;  2GSP A;  4AKZ A;  3WMD A;  4KT3 B;  4N6T A;  3IMA B;  5IG3 A;  5D83 A;  5CXO A;  3CCE 3;  2IYJ A;  3CCS 3;  1TUH A;  1SAR A;  3NV0 B;  4GHO A;  1A2K A;  1YGW A;  1ULJ B;  3D5I A;  4WWU C;  4BTY A;  3KSE D;  1QVG 2;  1BSB A;  5AIF A;  1W6Y A;  3OWY A;  1MGR A;  3G16 A;  3K9M C;  2OTL 3;  1RGC A;  1B2S A;  3NM7 A;  3DH2 A;  3OV4 A;  1VQ6 3;  1IQX A;  1AVK A;  3LTA A;  3HK4 A;  4O2H A;  1YIT 3;  1RGK A;  4FMA A;  3F9S A;  2F5M A;  1PFP A;  1UUG B;  2F98 A;  3DGL A;  3D79 A;  3MWZ A;  1RHL A;  3CPO A;  3LT8 A;  2W0Q A;  1PYL A;  4FMD A;  1IK3 A;  1OUN A;  3KII A;  2P0M A;  3NM2 A;  2Z77 A;  2RGQ A;  3FG4 A;  2GU1 A;  1OF5 A;  1GY7 A;  3DGM A;  5FGO A;  1BIR A;  1LOX A;  1EKM A;  4PEJ A;  1NNV A;  3GZY B;  3G8Z A;  1YJ9 3;  1I0X A;  4N6O B;  3DGY A;  4HM6 B;  9RNT A;  1A2V A;  4EXR A;  1YIJ 3;  2K3D A;  1N9E A;  3FKA A;  1L5G B;  4HM8 B;  4J8T A;  3AGO A;  1IV9 A;  1UI7 A;  1W2Z A;  2AAD A;  2CFG A;  3ECF A;  1IVW A;  2FNQ A;  1S5A A;  2W56 B;  3F7X A;  1TRP A;  1BAO A;  1RGA A;  3SYU A;  2D42 A;  3JUP A;  5AIG A;  6GSP A;  3NHX A;  1GS3 A;  1DE3 A;  5STD A;  1VQQ A;  2IMJ A;  4H61 A;  1WMP A;  1FGM A;  2BMQ B;  1QAF A;  4HM1 B;  1MNL A;  1Q42 A;  5BIR A;  5AEW B;  1FGQ A;  1N8R 4;  1OPY A;  1RNT A;  1BSE A;  4I5Q A;  3QK9 A;  3LTB A;  1UDI I;  2UX0 A;  4K1U A;  3EQQ B;  1TU5 A;  3FG1 A;  1O7H B;  1SQW A;  3CCQ 3;  1B2X A;  4N3V A;  1B2Z A;  4DKI A;  3MG1 A;  1UGI A;  3KE7 A;  4JF8 A;  1FW7 A;  2P05 A;  3FLJ A;  2A15 A;  1AQZ A;  1MGW A;  1OHP A;  3LZA A;  1MWU A;  3DMC A;  2BMO B;  3QRD A;  2BIR A;  1O7N B;  4LGQ A;  2OWP A;  1JKG A;  4WHA A;  1EUI C;  4L8P A;  2OQE A;  1K28 A;  5EEO A;  1OHS A;  1VQP 3;  3F14 A;  1N9J A;  1RJO A;  3SOA A;  1BRG A;  1LQG C;  2CX1 A;  1O7G B;  3X40 A;  3S29 A;  1RGL A;  2WO0 A;  3X3Y A;  3F7S A;  1B2U A;  8CHO A;  4HZ9 B;  3PCR A;  1DYU A;  5JPP A;  3U1W A;  5CF1 A;  4CJN A;  2LQV A;  1U8C B;  1WQL B;  1Q40 B;  4N6L A;  1B2M A;  1GYB A;  4BL2 A;  1RGE A;  1JBS A;  4XDV A;  3LTD A;  3E99 A;  3JUN A;  2YFJ B;  3UB1 A;  4EW5 A;  4XDW A;  2OCT A;  1GMP A;  1W00 A;  3JUQ A;  5IEO A;  2XFS A;  2FGT A;  4HOH A;  2BHM A;  4O3V A;  3WA2 X;  1YHQ 3;  1LNH A;  5IG0 A;  2INX A;  3K7C A;  3HZP A;  2CFD A;  1ZX2 A;  4N6V 0;  3KKG A;  2IY2 A;  4MEI A;  5AYS C;  1I70 A;  2H0H A;  4K61 A;  3T8N A;  2YFI B;  3N54 B;  1BRI A;  3VF1 A;  3HOH A;  3S28 A;  2JDI H;  2W2C A;  1RKY A;  3D5G A;  4R4K A;  2KXG A;  3MHE A;  1DET A;  1X1U A;  2HOH A;  3UL6 A;  1SII A;  5A0O B;  4H3U A;  1ISK A;  2XH9 A;  3I0Y A;  1EQK A;  3ZG5 A;  2CC3 A;  1HYF A;  3KN4 A;  2B24 B;  3DGN A;  1FA3 A;  1A90 A;  2KF5 A;  3AMO B;  1K41 A;  1YNV X;  2IUK A;  3M8C A;  4J5K A;  5DRE A;  2XF3 A;  3STD A;  2I9W A;  3EF8 A;  3CCR 3;  3CC2 3;  2CWV A;  3DGO A;  2HMM B;  3BB9 A;  1RGG A;  2ML5 A;  2ZL8 A;  1JB5 A;  4XM4 A;  3EC9 A;  4MJD A;  2OOV A;  4EV2 A;  3G71 3;  3S67 A;  1AV4 A;  1RGH A;  1JN5 A;  1ZS7 A;  3FF2 A;  3FF0 A;  2FXT A;  1TJD A;  4ORL A;  2KF3 A;  1VZZ A;  1K73 4;  5IF6 A;  1B3S A;  1YVB I;  1Y4K A;  2WOH A;  3BNB A;  4OK0 A;  4XBY A;  2KRT A;  4HM5 B;  2XFT A;  2CWT A;  4QWT A;  1GMQ A;  2F99 A;  3D3L A;  1LOY A;  1OGX A;  1GOU A;  1Q81 4;  3HI7 A;  2UUG C;  1RN7 A;  2CFK A;  1T3B A;  1RNB A;  3T8U A;  1WTH A;  3AHS A;  3GRD A;  5AIH A;  1FGO A;  2YFL B;  2V1L A;  5D81 A;  3GSP A;  1JJ2 2;  1MWR A;  3BNC A;  1I3F A;  1UUV B;  3CC7 3;  1RSN A;  3KZT A;  4HAA A;  8RNT A;  3NV0 A;  2XGN A;  1VQ4 3;  1LQM B;  5BVB A;  4CDL A;  1OGZ A;  1W6G A;  1NB5 I;  4GSP A;  3CD6 3;  1FGT A;  5IEN A;  1VQ7 3;  5GSP A;  1BRJ A;  4R1K A;  3FGY A;  1BNJ A;  1JV2 B;  1CH0 A;  3SED A;  1IYY A;  3IPT A;  2CH9 A;  4EBG A;  4JRF A;  1EG9 B;  2MF7 A;  3FZW A;  4CCV A;  3AHW A;  3LOY A;  3PZW A;  1BRS A;  1W4N A;  5G1K A;  3SXX A;  5I97 A;  2W9Q A;  1M90 4;  3CCV 3;  2R41 A;  1ZO2 A;  4I4K A;  1OH0 A;  1VQL 3;  1IVU A;  4AEQ A;  3ALA A;  1QAK A;  5IEP A;  3ER7 A;  1I8V A;  1TRQ A;  4STD A;  3NUV A;  3NXJ A;  5LC6 A;  3HIG A;  3T0U A;  2Z6B A;  4RNT A;  3CNM A;  2Z76 A;  3BIR A;  1KWI A;  1A67 A;  3FH1 A;  2IA7 A;  2CFW A;  4BIR A;  1DVD A;  5M19 A;  1UI8 A;  4HM2 B;  2HMK B;  3ROB A;  2OTJ 3;  2W56 A;  2ZDJ A;  1W7C A;  5JPU A;  1W01 A;  1SJW A;  3URP A;  1WMO A;  1VQK 3;  4BU4 A;  5RNT A;  1CYV A;  2H0G A;  1JBT A;  2K54 A;  1K9M 4;  3LML A;  5M18 A;  2AAE A;  1HU9 A;  3X41 A;  1IDP A;  3IJE B;  3I56 3;  2WGO A;  3UL5 A;  1BSC A;  1IVV A;  1I2G A;  2BU4 A;  4HVN A;  1TP6 A;  7RNT A;  3KFQ C;  1YJN 3;  1W02 A;  2L4V A;  1QVF 2;  3OWS A;  1US1 A;  1AY7 A;  1X1Y A;  3BLZ A;  3A5E A;  3EBT A;  3K5T A;  4L8O A;  3HX8 A;  4BTW A;  1LRA A;  2P0X A;  3DUK A;  3LYG A;  1O7M B;  1VQO 3;  3L0R A;  2HMJ B;  1NDO B;  2F4Y A;  4R80 A;  1RMS A;  2E2T A;  3MSO A;  5LC7 A;  2GXF A;  4G1M B;  3V99 A;  4WFO A;  2F56 A;  3GZB A;  3SX1 A;  1BRN L;  1BRH A;  1N5H A;  2RCD A;  3CU3 A;  2GEX A;  3PGB A;  1VQ8 3;  1FUW A;  5CF2 A;  4Q53 A;  1OHO A; 
#chains in the Genus database with same CATH homology
 4J5K A;  1RGK A;  1BSA A;  2F5M A;  1RGG A;  1RHL A;  1BAN A;  3WR2 A;  3D4A A;  1BNF A;  1PYL A;  3KCH A;  3AGN A;  1RGH A;  2KF3 A;  1BIR A;  4J5G A;  3RNT A;  1RTU A;  1B3S A;  1I0X A;  3DGY A;  9RNT A;  1UCL A;  1A2P A;  1BNE A;  1BVI A;  1R4Y A;  1GMQ A;  1I3I A;  1RCK A;  1RN4 A;  1TTO A;  3AGO A;  1LOY A;  2AAD A;  1GOU A;  3Q3F A;  1RNB A;  1TRP A;  1BAO A;  3AHS A;  1RGA A;  3SYU A;  1RDS A;  2KF4 A;  6GSP A;  6RNT A;  1DE3 A;  2RNT A;  3GSP A;  1FUS A;  1I3F A;  5HOH A;  1RSN A;  1FYS A;  5BIR A;  4HAA A;  8RNT A;  1UCI A;  2KF6 A;  1RNT A;  1LOV A;  1BRK A;  1BSE A;  1I0V A;  1X1X A;  4GSP A;  5GSP A;  1BRJ A;  1BGS A;  1BNJ A;  2ZA4 A;  1B2X A;  1CH0 A;  1B2Z A;  1RCL A;  1IYY A;  1LOW A;  1FW7 A;  1ZGX A;  1JBR A;  3BU4 A;  1GMR A;  1AQZ A;  1MGW A;  3AHW A;  1BNI A;  1BRS A;  1B21 A;  1UCJ A;  2BIR A;  1BUJ A;  2C4B A;  1FUT A;  5BU4 A;  1B27 A;  1BNS A;  1LNI A;  1BRG A;  1HZ1 A;  1I8V A;  1T2I A;  1TRQ A;  1PY3 A;  1B20 A;  1RLS A;  1RGL A;  4RNT A;  7GSP A;  1B2U A;  3BIR A;  2F5W A;  2RBI A;  4BIR A;  1BNR A;  1UCK A;  1BNG A;  1I2F A;  1Q9E A;  1B2M A;  1C54 A;  1RGE A;  1JBS A;  3URP A;  1BU4 A;  1GMP A;  1I2E A;  1GSP A;  1YVS A;  4BU4 A;  5RNT A;  1JBT A;  4HOH A;  1RGF A;  3WHO A;  1G02 A;  2AAE A;  2KAA A;  1GOY A;  1X1W A;  1BSC A;  1I2G A;  2BU4 A;  7RNT A;  1FZU A;  1AY7 A;  1X1Y A;  2SAR A;  3A5E A;  1I70 A;  1BSD A;  2GSP A;  1GOV A;  1LRA A;  1BRI A;  3HOH A;  2F4Y A;  1RMS A;  1SAR A;  4GHO A;  1BOX A;  3D5G A;  1YGW A;  3D5I A;  1DET A;  1T2H A;  1X1U A;  1BSB A;  2HOH A;  2F56 A;  1BRN L;  1BRH A;  1MGR A;  1HYF A;  1RGC A;  1RN1 A;  1B2S A;  3DH2 A;  2KF5 A;  1YNV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...