1B2SA

Structural response to mutation at a protein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
AQVINTFDGVADYLQTYHKLPDNYITASEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (BARNASE)
publication title Structural response to mutation at a protein-protein interface.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2sA00
1BSBA 3URPA 7RNTA 1RGGA 1GSPA 2RNTA 2HOHA 3D4AA 1BNGA 1PY3A 1UCJA 1GMQA 8RNTA 2AAEA 1BNIA 1YGWA 2KAAA 1BNFA 2AADA 1BANA 5HOHA 1GOVA 2F4YA 1B3SA 1B2XA 1YNVX 1RGAA 2BIRA 4J5KA 1FYSA 1BRGA 1I3FA 1B27A 1RTUA 1FUSA 5BIRA 4BU4A 1GOUA 1MGWA 1T2HA 1BNEA 4HOHA 1FZUA 1TTOA 3AHSA 3D5GA 4GSPA 4BIRA 1DE3A 3SYUA 2SARA 3KCHA 1YVSA 3AGNA 1I0VA 1BSCA 2KF5A 1RCLA 2KF3A 7GSPA 1X1YA 1B20A 3WR2A 1B2ZA 1HYFA 1BRJA 1FUTA 6GSPA 1C54A 1GOYA 1DETA 3BIRA 3A5EA 1RN4A 3AHWA 1BRKA 1BSDA 1RMSA 5RNTA 4GHOA 1UCKA 1B2UA 1RHLA 4RNTA 1AY7A 1BIRA 1HZ1A 3BU4A 1RGFA 1MGRA 1RDSA 1SARA 3Q3FA 2RBIA 1I70A 1A2PA 1RGHA 1BRSA 1LOVA 3D5IA 3HOHA 1BRHA 1JBRA 2F5WA 1CH0A 1ZGXA 1BAOA 1RNTA 1B2SA 3WHOA 1RSNA 4HAAA 1BNJA 1I3IA 1I2GA 1I0XA 2F56A 1BGSA 2F5MA 1X1WA 2KF4A 4J5GA 2ZA4A 3DH2A 3DGYA 1RGCA 1RLSA 1LOYA 1LNIA 1AQZA 1BSEA 1I2EA 1UCIA 5BU4A 2BU4A 1T2IA 1GMPA 1LOWA 1X1UA 1BVIA 1BNSA 1RGEA 5GSPA 1BRNL 1BUJA 1Q9EA 9RNTA 1LRAA 1TRPA 1G02A 1BRIA 1RN1A 1RCKA 3GSPA 6RNTA 1B21A 1BOXA 2GSPA 1UCLA 1JBTA 3AGOA 1BSAA 1R4YA 1RGKA 1JBSA 1IYYA 1FW7A 1I2FA 1BU4A 2C4BA 1X1XA 2KF6A 1GMRA 1RNBA 1RGLA 1I8VA 1BNRA 1TRQA 3RNTA 1PYLA 1B2MA
chains in the Genus database with same CATH superfamily
1JKGB 3PCSA 3URPA 3DGLA 1GSPA 2CIUA 2RNTA 2HOHA 3FG4A 1KWIA 4LYLB 2STDA 1JB4A 1UCJA 3LXUX 1GMQA 3JUPA 1O7NB 4N6TA 2ML6A 2LYXA 5DRVA 2KAAA 4EYCA 1BNFA 2CG0A 4AKZA 5HOHA 1GOVA 2XGNA 3NUVA 1KSIA 2JQ5A 2GBXB 1IVUA 1JZDA 2H0HA 2H0IA 2KCDA 2CFWA 3CPW2 4HZ9B 2LQVA 1YNVX 1QVF2 4J5KA 1GY5A 2W04A 1TU5A 3KSED 3MHEA 3DUKA 1ISKA 3KIIA 2IUJA 2XH9A 2BT3A 3N54B 5I97A 3O8YA 3SOYA 1MGWA 5D82A 2GEXA 4FCJA 4HOHA 2PZVA 1N8R4 2HMMB 1FZUA 3D5GA 4HJLB 1EQKA 2OQEA 1WMOA 4RNYA 3NXJA 1DMQA 3FG1A 1DE3A 3AGNA 3ER7A 3GZXB 1S723 4L8OA 5CLKA 4EC6A 3WR2A 4FMBA 1FUTA 1YJN3 6GSPA 1IVXA 1D6YA 2L1SA 1C54A 1GOYA 3K0ZA 4BTWA 1U8CB 4N6UA 3NQZA 3MG1A 3CCE3 4HM8B 3T0UA 4HM1B 3Q1CA 3G0KA 4LEHA 2WOFA 1RHLA 1R4CA 2XEPA 3CU3A 3I0YA 1OF5A 2W9PA 4N6V0 4O8SA 5FW5A 1HZ1A 1STDA 3LH4A 4MMXB 5AYRB 1VQ53 1UI8A 1FGMA 3DGMA 4N6MA 1K9M4 1Q7HA 2Z77A 1RGHA 3OWYA 3NM2A 1S5AA 3BB9A 2C11A 3MG3A 1BUQA 1Q40A 1NU3A 1QJGA 2F5WA 1JN5B 4O02B 5KP3A 1W7CA 3GZBA 1BAOA 1K41A 3FZWA 1RNTA 2W56B 3LMLA 4OVMA 3KKGA 1HKXA 5IG3A 3FSDA 3WHOA 2OCTA 3FF0A 1OUNA 1I2GA 1DVDA 1SIHA 3WA3A 1FGQA 2FGTA 5G1LA 2F56A 1BGSA 2F5MA 2KF4A 3G8ZA 3M8CA 1ASKA 1MNLA 1NB3I 3B7CA 3DH2A 1DYUA 3DGYA 3RDEA 4XBXA 1Q814 1UGIA 1IQYA 1LNIA 1AQZA 2INXA 1E3RA 4WFOA 4HM5B 2W03A 3PZWA 2BU4A 1LXEA 1YHQ3 1GMPA 5KP4A 3ZG5A 1LOWA 1W2ZA 3JUMA 3N9HA 2SBLA 4N6NB 5FGOA 1BVIA 1BNSA 3HX8A 1BRNL 3N8BA 1TUHA 3PCRA 5GSPA 2XR8B 2K0MA 1AR0A 1BRIA 2P0XA 1RN7A 4KT3B 2F86B 1ULIB 4EXRA 1N5PA 3EBTA 4NPBA 3WMDA 4H3UA 1VQP3 5AEWB 2UGIA 4HVNA 1FW7A 3OWUA 2CFKA 5G2GA 3EX9A 2QGUA 2W9QA 2KF6A 2MC8A 1RNBA 2Y73A 1I8VA 4EV2A 1O7HB 1PYLA 1CQSA 3X3XA 2B24B 1OHSA 3IMAB 5ELUA 1E97A 1MOLA 3UB1A 3DGOA 1U5OA 3K7CA 7RNTA 1WNHA 4J9AA 3EQQB 3CCU3 1BNGA 4MJDA 4J8TA 3KZTA 1VQL3 8RNTA 3CPOA 4K61A 3CNMA 3CD63 4R80A 1LQMB 2W0QA 1BNIA 1YGWA 2BMRB 3U97A 5BVBA 1FA3A 3CC23 2OOVC 4RZMA 1IVVA 3EN8A 3NM7A 2F4YA 5EEOA 1B2XA 1Z1SA 1RGAA 4WHAA 3IJEB 3Q90A 1QMAA 1FYSA 4HM2B 4OK0A 2IY2A 2CH9A 3EF8A 1BRGA 3EE1A 2W6JH 2QA43 1I3FA 1OPYA 1B27A 1RTUA 2WOHA 3GAXA 1WTHA 5BIRA 1GOUA 4KFEA 4X2HA 1Q824 3V98A 4R9LA 5D83A 3SLUA 1OHPA 3DZLA 1L5GB 4HZBB 5AEUB 4KVHA 1SIIA 1LQGC 2IA7A 1NNVA 3S5CA 2CW9A 1US1A 4I5QA 4N6LA 1TIJA 4BIRA 5IEOA 3SYUA 2SARA 3X40A 3I553 1YVSA 2KF5A 2KF3A 4L8PA 2B1XB 5AYSC 4O2HA 2E2VA 2BNGA 1YI23 4NREA 2GXFA 4U13A 3X3ZA 2BO9B 1QALA 1JNQA 3OX9A 1K28A 5IF6A 4XBTA 1BRKA 1BSDA 1GY6A 4BL3A 4K1VA 1IV9A 3DGNA 4GHOA 3NHXA 1IV7A 4BL2A 1V58A 4RNTA 2Q07A 1UI7A 4EW5A 3X42A 1OACA 3OW22 1BIRA 3BU4A 1WQLB 1RGFA 1SARA 5M1AA 4G1MB 1CEWI 4XDVA 1I70A 1A2PA 1RJOA 4BTYA 2IYJA 4MMZB 4LZIA 4AEQA 1BRSA 1K8A4 1W5ZA 1LOVA 2QIYA 3DY5A 3D5IA 3HOHA 1BRHA 1VQK3 1VQO3 2HMNB 1QAFA 1ZGXA 1Q864 1UDII 1MWRA 3JUQA 2GU1A 1OF5B 2K3DA 3MYTA 5CXOA 2J8XB 3EJVA 1I3IA 2HMJB 2XF3A 1V57A 5KP1A 1UGHI 5D81A 3CXC2 3H51A 2D1WA 4J5GA 1N8QA 1RGCA 1IT8A 2D42A 1O7WB 3GRDA 1Q40B 1YGEA 3MKIA 1TP6A 2CWTA 4R4KA 3BNCA 1I2EA 4HM7B 2OOVA 3PYJA 1M1XB 1X1UA 3LYGA 3BLZA 1BUJA 3CCV3 1MWTA 3ALAA 2O9UX 3UL6A 1RN1A 1RCKA 3HI7A 1JB5A 6RNTA 3CCR3 4FMAA 3JUOA 1UCLA 1IU7A 1JBTA 2IUKA 3Q2PA 2YFIB 4ORLA 1JBSA 1IYYA 2BMOB 1QAKA 1I2FA 1M9GA 3F7XA 4XDWA 4ZM8A 3K63A 1A2KA 1GMRA 1PFPA 4HBRA 3BNDA 1RGLA 5CK6A 3ZG0A 1TFKA 3CC73 1BNRA 1TRQA 4HKVB 4H61A 3RGRA 4K1UA 2MF7A 3NV0A 3FH1A 3V92A 1PY3A 1FUWA 1IQ8A 2PNCA 3NQYA 5AIGA 4GB5A 1GYBA 2AAEA 1NWWA 3F14A 4PEJA 2F98A 2WGOA 1BANA 3SX1A 1W6CA 3G16A 1ZO2A 3EB8A 1KQS2 1UW1A 1VQ93 1M904 1N5HA 2FXTA 3ECFA 1TFOA 4MEIA 1FGOA 5LC7A 1JN5A 1Y4KA 1G0TA 4MMYB 2CKFB 1FUSA 4L7KA 3E99A 1N9JA 4BU4A 1ZX2A 4N3VA 4IPBA 2OTL3 1T2HA 4HM3B 3SEDA 1Q42A 1O7MB 3MSOA 1TTOA 2GEYA 4NHFA 4GSPA 2BHMA 4X2OA 3KCHA 2JDIH 3HIGA 3WODG 2WO0A 8CHOA 1I0VA 3F8XA 1RCLA 3S28A 1ZS7A 1KC84 1X1YA 1VQN3 3D3LA 2Z76A 3DM8A 1B2ZA 3VSYA 4RNZA 7STDA 1HYFA 2Z7AA 1EEJA 2FNQA 1YJ93 2I9WA 5LC6A 1NJI4 3DXOA 1OH0A 1VQM3 3DMCA 1DETA 4KZ1A 1AV4A 4R9KA 3CCJ3 1RN4A 3PGBA 4WYKA 2ZHXB 3AHWA 1O7GB 5RNTA 4RBNA 1OGXA 4HM4B 4EBGA 2HMOB 5AIIA 2CG1A 1W6GA 3PXMA 4CCVA 1AY7A 3X3YA 5DREA 1RDSA 2RBIA 3SXXA 2YFLB 2CK3H 3UJMA 3WOEB 1EUIC 3MG2A 4O3VA 3EN1B 1LVNA 2W2CA 4KFDA 1PU4A 2KRTA 3AMOA 3HZPA 2QEX3 2CX0A 1IT7A 1NO3A 1JBRA 3V99A 2ZL8A 2R4IA 3FCSB 1T3BA 3UNLA 1CH0A 5JPUA 1E3VA 1CYUA 1D6ZA 3QRDA 2XFSA 5IW9A 3LTBA 2YFJB 3JUNA 2RGQA 5EVHA 3G4S3 1B2SA 1FGTA 1ROVA 3WOFB 1BNJA 2CFDA 1I0XA 2XGLA 3B4PA 1FGRA 5CF1A 3HK4A 1X1WA 2ZA4A 1UUGB 3CCQ3 1JJ22 3CCM3 4XB5A 4Q53A 4KFFA 3CNXA 1UCIA 2CWVA 1K734 1SJWA 2E2UA 4GL6A 3B8LA 3KN4A 3F9SA 3EHCA 5G1KA 1OCVA 3G6E3 2UUGC 3SOAA 4LMIA 4DKIA 1JKGA 1Q9EA 9RNTA 5JBSA 1LRAA 1TRPA 1F8NA 2CC3A 2P09A 3OV4A 1M1K4 1DMNA 3H3HA 4I4KA 1CYVA 2XSHB 2K54A 3GSPA 1T5YA 4FCZA 4CDLA 2E2TA 2CX1A 2O3OA 1UUWB 2RCDA 4BTXA 1BOXA 2GSPA 3BNEA 3VF1A 6STDA 5IENA 3CCL3 4FR9A 1BSAA 1R4YA 2L4VA 1HU9A 1TJDA 5ELJA 5IEPA 2R41A 5AI1A 2CFGA 3X41A 1B2MA 1BSBA 1LOXA 1RGGA 3NX0A 2H0GA 1QVG2 3D4AA 5IG4A 1EG9B 3KFQC 5JPPA 1J2BA 2WGQA 3D9RA 1NB5I 3T8UA 3CC43 2HMKB 2Y74A 4QWTA 1JB2A 1AVLA 5CF2A 2AADA 1OGZA 2M7OA 1STFI 1RRHA 3D79A 1B3SA 1KD14 3BNBA 2BIRA 2A15A 3F40A 4HM6B 3LTCA 5BXQA 1YJW3 1W6YA 1IDPA 3MPHA 1OHOA 1IK3A 4LSOA 4LGQA 1VQ43 3NV0B 1NDOB 3ZFZA 1SQWA 3IPTA 5AIHA 3FLJA 3NBJA 1Q7Y4 1A67A 1W02A 2OWPA 1BNEA 1MWSA 1EA2A 1EKMA 3K9MC 3PS8A 3I563 1D6UA 5TGNA 1IQXA 3AHSA 1RRLA 2GBWB 1JZOA 1VZZA 1G96A 3S29A 7GSPA 1BSCA 3L0RA 5M19A 1O7PB 3KSPA 4FMCA 5STDA 1B20A 1BRJA 5IG0A 2KXGA 3A76A 4WP5A 1WMPA 2C10A 3BIRA 3A5EA 3LTDA 4XM4A 1ULJB 3ROBA 3T8NA 3K5TA 2IMJA 3FKAA 1YVBI 1RMSA 3SVAA 1W2B2 1UCKA 1B2UA 2W56A 4FMDA 3GWRA 3CME3 2RFRA 2GU3A 2XRXB 4N6OB 4WWUC 4FCMA 1MGRA 3Q3FA 4HM0B 2V1LA 4OUQA 4AKYA 2YX9A 1VQ63 3WA2X 1DMMA 1VQ83 1GD4A 1UUVB 4IIAA 2OTJ3 1A2VA 2P38A 3OWSA 4EV5A 1IVWA 3GZRA 4WYKB 5AIFA 3KE7A 1N9EA 2HMLB 1W01A 2OQEC 2P05A 3QK9A 4XBYA 2Z6BA 1JRQA 3EC9A 3NBRA 5HGRA 1RKYA 3EBYA 1RSNA 4ILFA 2XFTA 4CJNA 3LT9A 4HAAA 3UL5A 2CFLA 2RSXA 1A90A 1SPUA 1V74A 2BMQB 4JRFA 3MWZA 5IERA 3CMA3 3J7Yd 3B4OA 1C7HA 1W00A 1VQ73 1RLSA 3AMOB 4CPKA 1LOYA 3NBBA 3LOYA 3F8HA 1BSEA 5BU4A 1T2IA 1GD3A 3U1WA 3FGYA 5A0OB 2F99A 3G713 3OXAA 4JF8A 1YIJ3 1RGEA 1LNHA 4IT7A 2ML5A 1G02A 4K90B 2CWUA 3RGAA 3S27A 5IG5A 4TX4A 3CCS3 1AVKA 3FF2A 4R1KA 4STDA 1B21A 2ZDJA 1W4NA 1MWUA 4HYZA 3AGOA 1ROAA 1GS3A 3LT8A 1RGKA 3S67A 3F7SA 2P0MA 3GZYB 1YIT3 3FG3A 3HIIA 1DVCA 1WMNA 3WDGB 1BU4A 2C4BA 2CHCA 5EQLA 3STDA 1X1XA 2XSOB 3VGNA 3JVCA 3TDGA 3LZAA 3LTAA 1JV2B 2UX0A 5M18A 1GY7A 3RNTA 1VQQA
chains in the Genus database with same CATH topology
1BSBA 3URPA 7RNTA 1RGGA 1GSPA 2RNTA 2HOHA 3D4AA 1BNGA 1PY3A 1UCJA 1GMQA 8RNTA 2AAEA 1BNIA 1YGWA 2KAAA 1BNFA 2AADA 1BANA 5HOHA 1GOVA 2F4YA 1B3SA 1B2XA 1YNVX 1RGAA 2BIRA 4J5KA 1FYSA 1BRGA 1I3FA 1B27A 1RTUA 1FUSA 5BIRA 4BU4A 1GOUA 1MGWA 1T2HA 1BNEA 4HOHA 1FZUA 1TTOA 3AHSA 3D5GA 4GSPA 4BIRA 1DE3A 3SYUA 2SARA 3KCHA 1YVSA 3AGNA 1I0VA 1BSCA 2KF5A 1RCLA 2KF3A 7GSPA 1X1YA 1B20A 3WR2A 1B2ZA 1HYFA 1BRJA 1FUTA 6GSPA 1C54A 1GOYA 1DETA 3BIRA 3A5EA 1RN4A 3AHWA 1BRKA 1BSDA 1RMSA 5RNTA 4GHOA 1UCKA 1B2UA 1RHLA 4RNTA 1AY7A 1BIRA 1HZ1A 3BU4A 1RGFA 1MGRA 1RDSA 1SARA 3Q3FA 2RBIA 1I70A 1A2PA 1RGHA 1BRSA 1LOVA 3D5IA 3HOHA 1BRHA 1JBRA 2F5WA 1CH0A 1ZGXA 1BAOA 1RNTA 1B2SA 3WHOA 1RSNA 4HAAA 1BNJA 1I3IA 1I2GA 1I0XA 2F56A 1BGSA 2F5MA 1X1WA 2KF4A 4J5GA 2ZA4A 3DH2A 3DGYA 1RGCA 1RLSA 1LOYA 1LNIA 1AQZA 1BSEA 1I2EA 1UCIA 5BU4A 2BU4A 1T2IA 1GMPA 1LOWA 1X1UA 1BVIA 1BNSA 1RGEA 5GSPA 1BRNL 1BUJA 1Q9EA 9RNTA 1LRAA 1TRPA 1G02A 1BRIA 1RN1A 1RCKA 3GSPA 6RNTA 1B21A 1BOXA 2GSPA 1UCLA 1JBTA 3AGOA 1BSAA 1R4YA 1RGKA 1JBSA 1IYYA 1FW7A 1I2FA 1BU4A 2C4BA 1X1XA 2KF6A 1GMRA 1RNBA 1RGLA 1I8VA 1BNRA 1TRQA 3RNTA 1PYLA 1B2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSB A;  3URP A;  7RNT A;  1RGG A;  1GSP A;  2RNT A;  2HOH A;  3D4A A;  1BNG A;  1PY3 A;  1UCJ A;  1GMQ A;  8RNT A;  2AAE A;  1BNI A;  1YGW A;  2KAA A;  1BNF A;  2AAD A;  1BAN A;  5HOH A;  1GOV A;  2F4Y A;  1B3S A;  1B2X A;  1YNV X;  1RGA A;  2BIR A;  4J5K A;  1FYS A;  1BRG A;  1I3F A;  1B27 A;  1RTU A;  1FUS A;  5BIR A;  4BU4 A;  1GOU A;  1MGW A;  1T2H A;  1BNE A;  4HOH A;  1FZU A;  1TTO A;  3AHS A;  3D5G A;  4GSP A;  4BIR A;  1DE3 A;  3SYU A;  2SAR A;  3KCH A;  1YVS A;  3AGN A;  1I0V A;  1BSC A;  2KF5 A;  1RCL A;  2KF3 A;  7GSP A;  1X1Y A;  1B20 A;  3WR2 A;  1B2Z A;  1HYF A;  1BRJ A;  1FUT A;  6GSP A;  1C54 A;  1GOY A;  1DET A;  3BIR A;  3A5E A;  1RN4 A;  3AHW A;  1BRK A;  1BSD A;  1RMS A;  5RNT A;  4GHO A;  1UCK A;  1B2U A;  1RHL A;  4RNT A;  1AY7 A;  1BIR A;  1HZ1 A;  3BU4 A;  1RGF A;  1MGR A;  1RDS A;  1SAR A;  3Q3F A;  2RBI A;  1I70 A;  1A2P A;  1RGH A;  1BRS A;  1LOV A;  3D5I A;  3HOH A;  1BRH A;  1JBR A;  2F5W A;  1CH0 A;  1ZGX A;  1BAO A;  1RNT A;  1B2S A;  3WHO A;  1RSN A;  4HAA A;  1BNJ A;  1I3I A;  1I2G A;  1I0X A;  2F56 A;  1BGS A;  2F5M A;  1X1W A;  2KF4 A;  4J5G A;  2ZA4 A;  3DH2 A;  3DGY A;  1RGC A;  1RLS A;  1LOY A;  1LNI A;  1AQZ A;  1BSE A;  1I2E A;  1UCI A;  5BU4 A;  2BU4 A;  1T2I A;  1GMP A;  1LOW A;  1X1U A;  1BVI A;  1BNS A;  1RGE A;  5GSP A;  1BRN L;  1BUJ A;  1Q9E A;  9RNT A;  1LRA A;  1TRP A;  1G02 A;  1BRI A;  1RN1 A;  1RCK A;  3GSP A;  6RNT A;  1B21 A;  1BOX A;  2GSP A;  1UCL A;  1JBT A;  3AGO A;  1BSA A;  1R4Y A;  1RGK A;  1JBS A;  1IYY A;  1FW7 A;  1I2F A;  1BU4 A;  2C4B A;  1X1X A;  2KF6 A;  1GMR A;  1RNB A;  1RGL A;  1I8V A;  1BNR A;  1TRQ A;  3RNT A;  1PYL A;  1B2M A; 
#chains in the Genus database with same CATH topology
 1JKG B;  3PCS A;  3URP A;  3DGL A;  1GSP A;  2CIU A;  2RNT A;  2HOH A;  3FG4 A;  1KWI A;  4LYL B;  2STD A;  1JB4 A;  1UCJ A;  3LXU X;  1GMQ A;  3JUP A;  1O7N B;  4N6T A;  2ML6 A;  2LYX A;  5DRV A;  2KAA A;  4EYC A;  1BNF A;  2CG0 A;  4AKZ A;  5HOH A;  1GOV A;  2XGN A;  3NUV A;  1KSI A;  2JQ5 A;  2GBX B;  1IVU A;  1JZD A;  2H0H A;  2H0I A;  2KCD A;  2CFW A;  3CPW 2;  4HZ9 B;  2LQV A;  1YNV X;  1QVF 2;  4J5K A;  1GY5 A;  2W04 A;  1TU5 A;  3KSE D;  3MHE A;  3DUK A;  1ISK A;  3KII A;  2IUJ A;  2XH9 A;  2BT3 A;  3N54 B;  5I97 A;  3O8Y A;  3SOY A;  1MGW A;  5D82 A;  2GEX A;  4FCJ A;  4HOH A;  2PZV A;  1N8R 4;  2HMM B;  1FZU A;  3D5G A;  4HJL B;  1EQK A;  2OQE A;  1WMO A;  4RNY A;  3NXJ A;  1DMQ A;  3FG1 A;  1DE3 A;  3AGN A;  3ER7 A;  3GZX B;  1S72 3;  4L8O A;  5CLK A;  4EC6 A;  3WR2 A;  4FMB A;  1FUT A;  1YJN 3;  6GSP A;  1IVX A;  1D6Y A;  2L1S A;  1C54 A;  1GOY A;  3K0Z A;  4BTW A;  1U8C B;  4N6U A;  3NQZ A;  3MG1 A;  3CCE 3;  4HM8 B;  3T0U A;  4HM1 B;  3Q1C A;  3G0K A;  4LEH A;  2WOF A;  1RHL A;  1R4C A;  2XEP A;  3CU3 A;  3I0Y A;  1OF5 A;  2W9P A;  4N6V 0;  4O8S A;  5FW5 A;  1HZ1 A;  1STD A;  3LH4 A;  4MMX B;  5AYR B;  1VQ5 3;  1UI8 A;  1FGM A;  3DGM A;  4N6M A;  1K9M 4;  1Q7H A;  2Z77 A;  1RGH A;  3OWY A;  3NM2 A;  1S5A A;  3BB9 A;  2C11 A;  3MG3 A;  1BUQ A;  1Q40 A;  1NU3 A;  1QJG A;  2F5W A;  1JN5 B;  4O02 B;  5KP3 A;  1W7C A;  3GZB A;  1BAO A;  1K41 A;  3FZW A;  1RNT A;  2W56 B;  3LML A;  4OVM A;  3KKG A;  1HKX A;  5IG3 A;  3FSD A;  3WHO A;  2OCT A;  3FF0 A;  1OUN A;  1I2G A;  1DVD A;  1SIH A;  3WA3 A;  1FGQ A;  2FGT A;  5G1L A;  2F56 A;  1BGS A;  2F5M A;  2KF4 A;  3G8Z A;  3M8C A;  1ASK A;  1MNL A;  1NB3 I;  3B7C A;  3DH2 A;  1DYU A;  3DGY A;  3RDE A;  4XBX A;  1Q81 4;  1UGI A;  1IQY A;  1LNI A;  1AQZ A;  2INX A;  1E3R A;  4WFO A;  4HM5 B;  2W03 A;  3PZW A;  2BU4 A;  1LXE A;  1YHQ 3;  1GMP A;  5KP4 A;  3ZG5 A;  1LOW A;  1W2Z A;  3JUM A;  3N9H A;  2SBL A;  4N6N B;  5FGO A;  1BVI A;  1BNS A;  3HX8 A;  1BRN L;  3N8B A;  1TUH A;  3PCR A;  5GSP A;  2XR8 B;  2K0M A;  1AR0 A;  1BRI A;  2P0X A;  1RN7 A;  4KT3 B;  2F86 B;  1ULI B;  4EXR A;  1N5P A;  3EBT A;  4NPB A;  3WMD A;  4H3U A;  1VQP 3;  5AEW B;  2UGI A;  4HVN A;  1FW7 A;  3OWU A;  2CFK A;  5G2G A;  3EX9 A;  2QGU A;  2W9Q A;  2KF6 A;  2MC8 A;  1RNB A;  2Y73 A;  1I8V A;  4EV2 A;  1O7H B;  1PYL A;  1CQS A;  3X3X A;  2B24 B;  1OHS A;  3IMA B;  5ELU A;  1E97 A;  1MOL A;  3UB1 A;  3DGO A;  1U5O A;  3K7C A;  7RNT A;  1WNH A;  4J9A A;  3EQQ B;  3CCU 3;  1BNG A;  4MJD A;  4J8T A;  3KZT A;  1VQL 3;  8RNT A;  3CPO A;  4K61 A;  3CNM A;  3CD6 3;  4R80 A;  1LQM B;  2W0Q A;  1BNI A;  1YGW A;  2BMR B;  3U97 A;  5BVB A;  1FA3 A;  3CC2 3;  2OOV C;  4RZM A;  1IVV A;  3EN8 A;  3NM7 A;  2F4Y A;  5EEO A;  1B2X A;  1Z1S A;  1RGA A;  4WHA A;  3IJE B;  3Q90 A;  1QMA A;  1FYS A;  4HM2 B;  4OK0 A;  2IY2 A;  2CH9 A;  3EF8 A;  1BRG A;  3EE1 A;  2W6J H;  2QA4 3;  1I3F A;  1OPY A;  1B27 A;  1RTU A;  2WOH A;  3GAX A;  1WTH A;  5BIR A;  1GOU A;  4KFE A;  4X2H A;  1Q82 4;  3V98 A;  4R9L A;  5D83 A;  3SLU A;  1OHP A;  3DZL A;  1L5G B;  4HZB B;  5AEU B;  4KVH A;  1SII A;  1LQG C;  2IA7 A;  1NNV A;  3S5C A;  2CW9 A;  1US1 A;  4I5Q A;  4N6L A;  1TIJ A;  4BIR A;  5IEO A;  3SYU A;  2SAR A;  3X40 A;  3I55 3;  1YVS A;  2KF5 A;  2KF3 A;  4L8P A;  2B1X B;  5AYS C;  4O2H A;  2E2V A;  2BNG A;  1YI2 3;  4NRE A;  2GXF A;  4U13 A;  3X3Z A;  2BO9 B;  1QAL A;  1JNQ A;  3OX9 A;  1K28 A;  5IF6 A;  4XBT A;  1BRK A;  1BSD A;  1GY6 A;  4BL3 A;  4K1V A;  1IV9 A;  3DGN A;  4GHO A;  3NHX A;  1IV7 A;  4BL2 A;  1V58 A;  4RNT A;  2Q07 A;  1UI7 A;  4EW5 A;  3X42 A;  1OAC A;  3OW2 2;  1BIR A;  3BU4 A;  1WQL B;  1RGF A;  1SAR A;  5M1A A;  4G1M B;  1CEW I;  4XDV A;  1I70 A;  1A2P A;  1RJO A;  4BTY A;  2IYJ A;  4MMZ B;  4LZI A;  4AEQ A;  1BRS A;  1K8A 4;  1W5Z A;  1LOV A;  2QIY A;  3DY5 A;  3D5I A;  3HOH A;  1BRH A;  1VQK 3;  1VQO 3;  2HMN B;  1QAF A;  1ZGX A;  1Q86 4;  1UDI I;  1MWR A;  3JUQ A;  2GU1 A;  1OF5 B;  2K3D A;  3MYT A;  5CXO A;  2J8X B;  3EJV A;  1I3I A;  2HMJ B;  2XF3 A;  1V57 A;  5KP1 A;  1UGH I;  5D81 A;  3CXC 2;  3H51 A;  2D1W A;  4J5G A;  1N8Q A;  1RGC A;  1IT8 A;  2D42 A;  1O7W B;  3GRD A;  1Q40 B;  1YGE A;  3MKI A;  1TP6 A;  2CWT A;  4R4K A;  3BNC A;  1I2E A;  4HM7 B;  2OOV A;  3PYJ A;  1M1X B;  1X1U A;  3LYG A;  3BLZ A;  1BUJ A;  3CCV 3;  1MWT A;  3ALA A;  2O9U X;  3UL6 A;  1RN1 A;  1RCK A;  3HI7 A;  1JB5 A;  6RNT A;  3CCR 3;  4FMA A;  3JUO A;  1UCL A;  1IU7 A;  1JBT A;  2IUK A;  3Q2P A;  2YFI B;  4ORL A;  1JBS A;  1IYY A;  2BMO B;  1QAK A;  1I2F A;  1M9G A;  3F7X A;  4XDW A;  4ZM8 A;  3K63 A;  1A2K A;  1GMR A;  1PFP A;  4HBR A;  3BND A;  1RGL A;  5CK6 A;  3ZG0 A;  1TFK A;  3CC7 3;  1BNR A;  1TRQ A;  4HKV B;  4H61 A;  3RGR A;  4K1U A;  2MF7 A;  3NV0 A;  3FH1 A;  3V92 A;  1PY3 A;  1FUW A;  1IQ8 A;  2PNC A;  3NQY A;  5AIG A;  4GB5 A;  1GYB A;  2AAE A;  1NWW A;  3F14 A;  4PEJ A;  2F98 A;  2WGO A;  1BAN A;  3SX1 A;  1W6C A;  3G16 A;  1ZO2 A;  3EB8 A;  1KQS 2;  1UW1 A;  1VQ9 3;  1M90 4;  1N5H A;  2FXT A;  3ECF A;  1TFO A;  4MEI A;  1FGO A;  5LC7 A;  1JN5 A;  1Y4K A;  1G0T A;  4MMY B;  2CKF B;  1FUS A;  4L7K A;  3E99 A;  1N9J A;  4BU4 A;  1ZX2 A;  4N3V A;  4IPB A;  2OTL 3;  1T2H A;  4HM3 B;  3SED A;  1Q42 A;  1O7M B;  3MSO A;  1TTO A;  2GEY A;  4NHF A;  4GSP A;  2BHM A;  4X2O A;  3KCH A;  2JDI H;  3HIG A;  3WOD G;  2WO0 A;  8CHO A;  1I0V A;  3F8X A;  1RCL A;  3S28 A;  1ZS7 A;  1KC8 4;  1X1Y A;  1VQN 3;  3D3L A;  2Z76 A;  3DM8 A;  1B2Z A;  3VSY A;  4RNZ A;  7STD A;  1HYF A;  2Z7A A;  1EEJ A;  2FNQ A;  1YJ9 3;  2I9W A;  5LC6 A;  1NJI 4;  3DXO A;  1OH0 A;  1VQM 3;  3DMC A;  1DET A;  4KZ1 A;  1AV4 A;  4R9K A;  3CCJ 3;  1RN4 A;  3PGB A;  4WYK A;  2ZHX B;  3AHW A;  1O7G B;  5RNT A;  4RBN A;  1OGX A;  4HM4 B;  4EBG A;  2HMO B;  5AII A;  2CG1 A;  1W6G A;  3PXM A;  4CCV A;  1AY7 A;  3X3Y A;  5DRE A;  1RDS A;  2RBI A;  3SXX A;  2YFL B;  2CK3 H;  3UJM A;  3WOE B;  1EUI C;  3MG2 A;  4O3V A;  3EN1 B;  1LVN A;  2W2C A;  4KFD A;  1PU4 A;  2KRT A;  3AMO A;  3HZP A;  2QEX 3;  2CX0 A;  1IT7 A;  1NO3 A;  1JBR A;  3V99 A;  2ZL8 A;  2R4I A;  3FCS B;  1T3B A;  3UNL A;  1CH0 A;  5JPU A;  1E3V A;  1CYU A;  1D6Z A;  3QRD A;  2XFS A;  5IW9 A;  3LTB A;  2YFJ B;  3JUN A;  2RGQ A;  5EVH A;  3G4S 3;  1B2S A;  1FGT A;  1ROV A;  3WOF B;  1BNJ A;  2CFD A;  1I0X A;  2XGL A;  3B4P A;  1FGR A;  5CF1 A;  3HK4 A;  1X1W A;  2ZA4 A;  1UUG B;  3CCQ 3;  1JJ2 2;  3CCM 3;  4XB5 A;  4Q53 A;  4KFF A;  3CNX A;  1UCI A;  2CWV A;  1K73 4;  1SJW A;  2E2U A;  4GL6 A;  3B8L A;  3KN4 A;  3F9S A;  3EHC A;  5G1K A;  1OCV A;  3G6E 3;  2UUG C;  3SOA A;  4LMI A;  4DKI A;  1JKG A;  1Q9E A;  9RNT A;  5JBS A;  1LRA A;  1TRP A;  1F8N A;  2CC3 A;  2P09 A;  3OV4 A;  1M1K 4;  1DMN A;  3H3H A;  4I4K A;  1CYV A;  2XSH B;  2K54 A;  3GSP A;  1T5Y A;  4FCZ A;  4CDL A;  2E2T A;  2CX1 A;  2O3O A;  1UUW B;  2RCD A;  4BTX A;  1BOX A;  2GSP A;  3BNE A;  3VF1 A;  6STD A;  5IEN A;  3CCL 3;  4FR9 A;  1BSA A;  1R4Y A;  2L4V A;  1HU9 A;  1TJD A;  5ELJ A;  5IEP A;  2R41 A;  5AI1 A;  2CFG A;  3X41 A;  1B2M A;  1BSB A;  1LOX A;  1RGG A;  3NX0 A;  2H0G A;  1QVG 2;  3D4A A;  5IG4 A;  1EG9 B;  3KFQ C;  5JPP A;  1J2B A;  2WGQ A;  3D9R A;  1NB5 I;  3T8U A;  3CC4 3;  2HMK B;  2Y74 A;  4QWT A;  1JB2 A;  1AVL A;  5CF2 A;  2AAD A;  1OGZ A;  2M7O A;  1STF I;  1RRH A;  3D79 A;  1B3S A;  1KD1 4;  3BNB A;  2BIR A;  2A15 A;  3F40 A;  4HM6 B;  3LTC A;  5BXQ A;  1YJW 3;  1W6Y A;  1IDP A;  3MPH A;  1OHO A;  1IK3 A;  4LSO A;  4LGQ A;  1VQ4 3;  3NV0 B;  1NDO B;  3ZFZ A;  1SQW A;  3IPT A;  5AIH A;  3FLJ A;  3NBJ A;  1Q7Y 4;  1A67 A;  1W02 A;  2OWP A;  1BNE A;  1MWS A;  1EA2 A;  1EKM A;  3K9M C;  3PS8 A;  3I56 3;  1D6U A;  5TGN A;  1IQX A;  3AHS A;  1RRL A;  2GBW B;  1JZO A;  1VZZ A;  1G96 A;  3S29 A;  7GSP A;  1BSC A;  3L0R A;  5M19 A;  1O7P B;  3KSP A;  4FMC A;  5STD A;  1B20 A;  1BRJ A;  5IG0 A;  2KXG A;  3A76 A;  4WP5 A;  1WMP A;  2C10 A;  3BIR A;  3A5E A;  3LTD A;  4XM4 A;  1ULJ B;  3ROB A;  3T8N A;  3K5T A;  2IMJ A;  3FKA A;  1YVB I;  1RMS A;  3SVA A;  1W2B 2;  1UCK A;  1B2U A;  2W56 A;  4FMD A;  3GWR A;  3CME 3;  2RFR A;  2GU3 A;  2XRX B;  4N6O B;  4WWU C;  4FCM A;  1MGR A;  3Q3F A;  4HM0 B;  2V1L A;  4OUQ A;  4AKY A;  2YX9 A;  1VQ6 3;  3WA2 X;  1DMM A;  1VQ8 3;  1GD4 A;  1UUV B;  4IIA A;  2OTJ 3;  1A2V A;  2P38 A;  3OWS A;  4EV5 A;  1IVW A;  3GZR A;  4WYK B;  5AIF A;  3KE7 A;  1N9E A;  2HML B;  1W01 A;  2OQE C;  2P05 A;  3QK9 A;  4XBY A;  2Z6B A;  1JRQ A;  3EC9 A;  3NBR A;  5HGR A;  1RKY A;  3EBY A;  1RSN A;  4ILF A;  2XFT A;  4CJN A;  3LT9 A;  4HAA A;  3UL5 A;  2CFL A;  2RSX A;  1A90 A;  1SPU A;  1V74 A;  2BMQ B;  4JRF A;  3MWZ A;  5IER A;  3CMA 3;  3J7Y d;  3B4O A;  1C7H A;  1W00 A;  1VQ7 3;  1RLS A;  3AMO B;  4CPK A;  1LOY A;  3NBB A;  3LOY A;  3F8H A;  1BSE A;  5BU4 A;  1T2I A;  1GD3 A;  3U1W A;  3FGY A;  5A0O B;  2F99 A;  3G71 3;  3OXA A;  4JF8 A;  1YIJ 3;  1RGE A;  1LNH A;  4IT7 A;  2ML5 A;  1G02 A;  4K90 B;  2CWU A;  3RGA A;  3S27 A;  5IG5 A;  4TX4 A;  3CCS 3;  1AVK A;  3FF2 A;  4R1K A;  4STD A;  1B21 A;  2ZDJ A;  1W4N A;  1MWU A;  4HYZ A;  3AGO A;  1ROA A;  1GS3 A;  3LT8 A;  1RGK A;  3S67 A;  3F7S A;  2P0M A;  3GZY B;  1YIT 3;  3FG3 A;  3HII A;  1DVC A;  1WMN A;  3WDG B;  1BU4 A;  2C4B A;  2CHC A;  5EQL A;  3STD A;  1X1X A;  2XSO B;  3VGN A;  3JVC A;  3TDG A;  3LZA A;  3LTA A;  1JV2 B;  2UX0 A;  5M18 A;  1GY7 A;  3RNT A;  1VQQ A; 
#chains in the Genus database with same CATH homology
 1BSB A;  3URP A;  7RNT A;  1RGG A;  1GSP A;  2RNT A;  2HOH A;  3D4A A;  1BNG A;  1PY3 A;  1UCJ A;  1GMQ A;  8RNT A;  2AAE A;  1BNI A;  1YGW A;  2KAA A;  1BNF A;  2AAD A;  1BAN A;  5HOH A;  1GOV A;  2F4Y A;  1B3S A;  1B2X A;  1YNV X;  1RGA A;  2BIR A;  4J5K A;  1FYS A;  1BRG A;  1I3F A;  1B27 A;  1RTU A;  1FUS A;  5BIR A;  4BU4 A;  1GOU A;  1MGW A;  1T2H A;  1BNE A;  4HOH A;  1FZU A;  1TTO A;  3AHS A;  3D5G A;  4GSP A;  4BIR A;  1DE3 A;  3SYU A;  2SAR A;  3KCH A;  1YVS A;  3AGN A;  1I0V A;  1BSC A;  2KF5 A;  1RCL A;  2KF3 A;  7GSP A;  1X1Y A;  1B20 A;  3WR2 A;  1B2Z A;  1HYF A;  1BRJ A;  1FUT A;  6GSP A;  1C54 A;  1GOY A;  1DET A;  3BIR A;  3A5E A;  1RN4 A;  3AHW A;  1BRK A;  1BSD A;  1RMS A;  5RNT A;  4GHO A;  1UCK A;  1B2U A;  1RHL A;  4RNT A;  1AY7 A;  1BIR A;  1HZ1 A;  3BU4 A;  1RGF A;  1MGR A;  1RDS A;  1SAR A;  3Q3F A;  2RBI A;  1I70 A;  1A2P A;  1RGH A;  1BRS A;  1LOV A;  3D5I A;  3HOH A;  1BRH A;  1JBR A;  2F5W A;  1CH0 A;  1ZGX A;  1BAO A;  1RNT A;  1B2S A;  3WHO A;  1RSN A;  4HAA A;  1BNJ A;  1I3I A;  1I2G A;  1I0X A;  2F56 A;  1BGS A;  2F5M A;  1X1W A;  2KF4 A;  4J5G A;  2ZA4 A;  3DH2 A;  3DGY A;  1RGC A;  1RLS A;  1LOY A;  1LNI A;  1AQZ A;  1BSE A;  1I2E A;  1UCI A;  5BU4 A;  2BU4 A;  1T2I A;  1GMP A;  1LOW A;  1X1U A;  1BVI A;  1BNS A;  1RGE A;  5GSP A;  1BRN L;  1BUJ A;  1Q9E A;  9RNT A;  1LRA A;  1TRP A;  1G02 A;  1BRI A;  1RN1 A;  1RCK A;  3GSP A;  6RNT A;  1B21 A;  1BOX A;  2GSP A;  1UCL A;  1JBT A;  3AGO A;  1BSA A;  1R4Y A;  1RGK A;  1JBS A;  1IYY A;  1FW7 A;  1I2F A;  1BU4 A;  2C4B A;  1X1X A;  2KF6 A;  1GMR A;  1RNB A;  1RGL A;  1I8V A;  1BNR A;  1TRQ A;  3RNT A;  1PYL A;  1B2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...