3S67A

Crystal structure of v57p mutant of human cystatin c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIPAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
publication title Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s67A00
1N5HA 4IT7A 1DVCA 5LC7A 1A67A 1GD3A 1IV7A 1FUWA 1LXEA 1G96A 4N6UA 3UL6A 5ELUA 1STFI 3KSED 4N6TA 1PFPA 2OCTA 3Q2PA 1M9GA 1A90A 1EQKA 4N6LA 1MNLA 3QRDA 4TX4A 2W9QA 2KXGA 2CH9A 3MWZA 3K9MC 3KFQC 1NB3I 1NB5I 1GD4A 5EQLA 4EYCA 3NX0A 3S67A 3PYJA 3GAXA 3PS8A 1N9JA 4N6NB 5ELJA 1FA3A 4N6MA 1WNHA 4N6OB 4N6V0 3PXMA 1R4CA 2W9PA 1CYVA 1YVBI 2O9UX 4ZM8A 1DVDA 3IMAB 1IV9A 3SVAA 1CEWI 4CCVA 5LC6A 2BO9B 1MOLA 1RN7A 1KWIA 1TIJA 1ROAA 1CYUA 3L0RA 1N5PA 3LH4A 5A0OB 3UL5A 4LZIA
chains in the Genus database with same CATH superfamily
3G6E3 4O2HA 5IG3A 4ILFA 1SIHA 4RZMA 2B1XB 3WR2A 4IT7A 3GWRA 1KQS2 3F8XA 1VQL3 1DVCA 3HK4A 1BNJA 4AKZA 2BU4A 3CCM3 3OXAA 4KFDA 4O8SA 1UCIA 1W4NA 3A5EA 1GD3A 3AHWA 1IV7A 1Q9EA 1GY7A 1I3FA 3X3ZA 4HKVB 3G713 2L1SA 2QEX3 1NO3A 1FGMA 1BRGA 1AV4A 1YNVX 1X1WA 3LTCA 4IIAA 1OHOA 3X40A 3G4S3 5IG0A 1BRIA 4PEJA 1RJOA 3J7Yd 2INXA 5AIIA 3UL6A 1E3RA 3NBBA 1Q7Y4 3DGYA 1BIRA 2Y74A 1OHPA 3FG3A 4MMYB 5AI1A 2FGTA 1JZOA 5CF1A 2V1LA 1LOVA 1ASKA 3SOAA 3DGMA 1W00A 1VQ63 1K734 1B2ZA 3BU4A 5FGOA 3CCL3 4RNTA 1KSIA 3PCRA 2PZVA 5FW5A 2W6JH 1EQKA 1QAFA 1K8A4 2P38A 3JUQA 3WA3A 1MNLA 4U13A 1IDPA 2ZHXB 1TUHA 3EB8A 3RGRA 5AEWB 4OVMA 3MG1A 1X1UA 2Y73A 4TX4A 2CK3H 3OWUA 3ZG5A 6RNTA 2CFWA 2BT3A 2OTJ3 1DE3A 3NQYA 3MWZA 1LOWA 3FKAA 3DGOA 2YFLB 5EQLA 4XDVA 3KIIA 1D6YA 2GU1A 4NPBA 4EYCA 3CNXA 3AHSA 1OF5A 3SEDA 2H0IA 3MG2A 3S67A 3CC73 1Y4KA 2CC3A 3DY5A 1I3IA 1JBTA 3LXUX 1Q814 1W02A 2RSXA 1FZUA 3CCJ3 3OWSA 1IVVA 1W2B2 4LYLB 2RBIA 4BL3A 1GS3A 3PZWA 3BB9A 1OGZA 3FLJA 2H0HA 2XF3A 1YIJ3 1NDOB 1BSEA 5IF6A 2GSPA 2KAAA 1O7GB 1ZS7A 1ZX2A 2CX1A 4N6V0 4K1VA 2KF6A 1TU5A 1E97A 1RCKA 1R4CA 2W9PA 2YFJB 3D3LA 5G1LA 1BNSA 1BNEA 3S29A 1VQ93 3ZFZA 1VQ73 5D82A 1UUVB 3MKIA 4K1UA 1LRAA 1SJWA 4R9LA 3G16A 4JRFA 2M7OA 2LQVA 1FUSA 2CHCA 3CD63 4EC6A 4EW5A 1TFOA 2CWTA 1HU9A 3SLUA 2HMNB 7GSPA 3KCHA 5M1AA 3EBTA 2Z76A 4EBGA 1JB4A 1S5AA 1SQWA 1W6CA 4STDA 5CLKA 4AKYA 1BNRA 5EVHA 4R80A 5BIRA 1GYBA 1ROVA 4HM4B 1BRSA 3B4OA 4HM0B 3LT9A 1JB2A 4WWUC 3UL5A 3CNMA 5IERA 1OH0A 1SPUA 4LZIA 4BU4A 1BRJA 5IENA 1EG9B 1DMNA 2UX0A 3LOYA 4J5GA 2GU3A 3PGBA 1S723 3X3XA 4FMAA 1NJI4 1YJW3 1K28A 1VQ83 2CKFB 3CCS3 1UUGB 4X2HA 2BMOB 1GSPA 1O7WB 4BTXA 1A67A 4HM1B 4GL6A 2C4BA 4RBNA 3OW22 4HZBB 5JPUA 3NV0A 4LEHA 2GBXB 1Q7HA 3F8HA 1I2FA 2MF7A 3I0YA 4O3VA 1BUQA 1JN5A 1RHLA 3CME3 1LVNA 2L4VA 2W03A 2ZL8A 5IG5A 2GXFA 2ZDJA 4HM7B 1A2VA 1W2ZA 4CJNA 1Q864 1FUWA 3X3YA 1RGEA 1SARA 1E3VA 1LXEA 2R41A 3DM8A 2K54A 5HGRA 4K61A 3UB1A 1MWTA 2BNGA 3DGNA 1VZZA 2XEPA 1IQYA 3S27A 3K0ZA 5ELUA 1STFI 4BTWA 5CF2A 1RDSA 1DYUA 1I0VA 3LT8A 2D1WA 4O02B 1J2BA 3WDGB 1VQM3 1B27A 2W56B 4WYKB 5AIGA 1YI23 1LQGC 2OCTA 1Q40A 2F86B 2HMOB 1M904 1M9GA 3GZXB 1UI8A 3U1WA 1GMRA 2QA43 3URPA 1A90A 3CCR3 4FMCA 1EEJA 1Z1SA 3BNEA 3F14A 3WMDA 1QVG2 1KD14 2E2UA 1TRPA 3DGLA 7STDA 2W9QA 2KXGA 1LNIA 2HMJB 2CH9A 1EKMA 3EQQB 3K9MC 1MGWA 3D5IA 2JQ5A 3Q3FA 1NB3I 1NB5I 2YX9A 1WMOA 1GD4A 3SOYA 4FR9A 2CG1A 4FMDA 2P0MA 1T5YA 3H51A 3NX0A 4G1MB 3PYJA 1JKGA 1RLSA 1ZGXA 5BU4A 3EN1B 1GMPA 1B2XA 1PYLA 1FW7A 1FGQA 1LNHA 1BANA 2PNCA 1YJ93 1RSNA 3LZAA 4N6MA 1Q42A 3I563 4KFEA 1GOUA 3AMOB 1WTHA 2GEXA 4XDWA 1B3SA 5CXOA 3LTAA 3B8LA 3FH1A 3N8BA 1JJ22 3D9RA 2F4YA 4N6OB 4MMXB 2CX0A 2OWPA 5G2GA 3DMCA 3SYUA 1Q824 3PXMA 4FMBA 4BL2A 3IPTA 3KKGA 1ZO2A 3F7SA 5TGNA 3VGNA 3JUMA 2Z6BA 1CYVA 3NUVA 2BHMA 3EN8A 1PU4A 3RDEA 3MSOA 3CC23 1RN1A 4J5KA 3K63A 4CPKA 1IVUA 1VQP3 3RGAA 1QMAA 1O7MB 3E99A 2WGQA 1X1XA 1YVBI 1YGEA 2KCDA 2O9UX 3T8UA 2SARA 3X42A 9RNTA 2OTL3 1GY6A 4XM4A 3NQZA 2KF3A 4ORLA 1IV9A 1ISKA 5IEPA 1CEWI 3V99A 2XFTA 2HOHA 1UCJA 4IPBA 3T8NA 2OQEC 1JB5A 5LC6A 3FGYA 1B20A 1BOXA 1KWIA 1MOLA 2CG0A 2GBWB 3AGNA 4FCMA 4RNYA 3WOFB 1FGRA 2J8XB 3HOHA 3PCSA 4XBTA 3CCV3 1D6ZA 1I2GA 3FG4A 1FYSA 4K90B 3AGOA 3MHEA 1G0TA 4MMZB 1YGWA 4L8PA 5A0OB 1HYFA 1TJDA 3HZPA 1YIT3 3EHCA 3EC9A 1GMQA 1RGAA 2MC8A 3F9SA 4HVNA 3WODG 3EBYA 1L5GB 3NBJA 1C54A 1BVIA 4BTYA 3Q1CA 5AYSC 4MJDA 3UNLA 1GY5A 2K3DA 1B2SA 1UUWB 5AIHA 1VQK3 2OOVC 3H3HA 2Q07A 4KZ1A 5AEUB 5D83A 3CU3A 4H61A 1F8NA 4WP5A 1UGIA 4KFFA 1V74A 3DH2A 1G02A 3OWYA 4HM5B 1I0XA 4WFOA 1STDA 1UGHI 2E2TA 1NU3A 2H0GA 5DREA 2IUJA 1O7PB 1RKYA 2CFKA 4AEQA 4QWTA 3GRDA 1M1XB 1RGKA 1RGGA 2F99A 2KRTA 1B2UA 5AIFA 1O7NB 1O7HB 1G96A 4N6UA 1W6GA 3JUPA 3Q90A 2C11A 3LMLA 3DXOA 1BRKA 3NV0B 2IMJA 4N6TA 5M19A 5JPPA 3CPW2 1DMMA 1RCLA 2CW9A 2XFSA 3S5CA 1QALA 3F7XA 4HM2B 1AQZA 1OCVA 3BLZA 1UCKA 1HKXA 1OGXA 1DETA 2AADA 2P0XA 2WGOA 3HIGA 4BIRA 3BNBA 3CC43 2GEYA 4MEIA 2CWUA 3EE1A 3CCE3 1BSDA 3F40A 4HBRA 2F5MA 3U97A 2KF4A 1BAOA 1OUNA 1BNIA 1IVXA 3ECFA 4LSOA 4XBXA 1OPYA 3WA2X 3KFQC 1IT8A 1VQQA 4EV2A 3I553 3CCQ3 1IT7A 4GHOA 3SXXA 2QGUA 2STDA 1T2IA 3B4PA 2F98A 2BMRB 1T3BA 2P09A 2OQEA 3O8YA 1A2PA 1EA2A 3VSYA 3DUKA 1K9M4 3GAXA 2FXTA 2UGIA 3PS8A 1N9JA 2CWVA 4N6NB 1CH0A 5ELJA 1B21A 1IVWA 2RNTA 2Z77A 4HM6B 4WHAA 4HJLB 1YJN3 3EJVA 5KP1A 1FA3A 1RNBA 1R4YA 1GOYA 2SBLA 4OUQA 1JBSA 2E2VA 4NREA 2RFRA 2CFGA 5CK6A 1UDII 2OOVA 2JDIH 1K41A 3A76A 3T0UA 4FCZA 3UJMA 1A2KA 3ER7A 1BGSA 1MWUA 1NWWA 2RGQA 3KE7A 3SX1A 1N8QA 5HOHA 5JBSA 5KP3A 3LYGA 6STDA 3MYTA 1D6UA 1W6YA 2XGLA 2XRXB 7RNTA 4N3VA 1T2HA 1BNGA 2A15A 4XB5A 1AVLA 2CFDA 5D81A 3D4AA 4L8OA 1B2MA 3HI7A 3IJEB 4RNZA 3STDA 5AYRB 1DVDA 8RNTA 1ULIB 1BSAA 2IYJA 2XH9A 3G0KA 3IMAB 3MG3A 3NM2A 3SVAA 4EXRA 2IA7A 2WO0A 3OX9A 4HM8B 4J9AA 1TTOA 2W56A 1U8CB 4WYKA 2BO9B 1QVF2 1RN7A 2F56A 3GSPA 4XBYA 1RGHA 2XGNA 1TIJA 2W2CA 4JF8A 3G8ZA 3V98A 5I97A 3CXC2 1OF5B 1CYUA 1RMSA 2QIYA 1QAKA 1BRNL 1N5PA 1KC84 3K5TA 2FNQA 5IEOA 3S28A 3KN4A 5IW9A 1OHSA 3VF1A 4OK0A 4GB5A 1WQLB 2F5WA 1N5HA 3RNTA 2ZA4A 1AY7A 2ML6A 3D79A 1OACA 1PY3A 3BIRA 1UW1A 3NXJA 1RRHA 3JVCA 3NBRA 1RGFA 3FF2A 4J8TA 4R1KA 5LC7A 1FUTA 1DMQA 2D42A 1W5ZA 1BUJA 4LGQA 1IQ8A 2B24B 1HZ1A 1MGRA 3D5GA 3JUOA 1GOVA 1JV2B 2R4IA 2HMKB 2XR8B 4HYZA 1V58A 1RN4A 1IU7A 1N9EA 2XSOB 1LQMB 4KT3B 1BU4A 2W04A 3AMOA 1SIIA 4CDLA 5KP4A 3FSDA 1JRQA 5GSPA 5RNTA 3KSED 2Z7AA 4H3UA 3B7CA 5EEOA 1PFPA 4HZ9B 1FGTA 3NHXA 1U5OA 3Q2PA 3CCU3 5STDA 3GZRA 1AR0A 1NNVA 3JUNA 1MWRA 3WOEB 4R9KA 3MPHA 4N6LA 1JNQA 1RTUA 3NM7A 4X2OA 1LOXA 4R4KA 1VQ53 2IY2A 2CFLA 2BMQB 1VQO3 1C7HA 4Q53A 3QRDA 5M18A 2HMLB 1TFKA 3N54B 3FG1A 1MWSA 3QK9A 2ML5A 2WOFA 4DKIA 3M8CA 1CQSA 2KF5A 3WHOA 1EUIC 4GSPA 4I4KA 8CHOA 2K0MA 3HX8A 2YFIB 4NHFA 3LTDA 1US1A 3BNDA 1QJGA 2RCDA 1IK3A 1TP6A 1I8VA 3ZG0A 1IYYA 1RNTA 1VQN3 3KZTA 1JN5B 4HAAA 2UUGC 1JZDA 5IG4A 3ROBA 1I70A 1YHQ3 1BSCA 1YVSA 1WNHA 3GZBA 1RRLA 3V92A 3EF8A 2CIUA 4FCJA 1ULJB 1N8R4 3CPOA 1V57A 3GZYB 1AVKA 3K7CA 3N9HA 4L7KA 3HIIA 1X1YA 1W7CA 2I9WA 1BRHA 3FZWA 3OV4A 5DRVA 3TDGA 1Q40B 1TRQA 4KVHA 3BNCA 4EV5A 2BIRA 2C10A 4ZM8A 3CMA3 2AAEA 3X41A 1JBRA 1BNFA 1FGOA 2WOHA 2O3OA 2XSHB 3EX9A 3FF0A 1WMNA 3FCSB 4CCVA 3KSPA 4LMIA 5G1KA 1M1K4 1LOYA 5BXQA 2W0QA 3LTBA 1ROAA 1WMPA 3ALAA 3DZLA 4HOHA 2LYXA 2P05A 1W01A 3L0RA 1RGCA 3LH4A 4I5QA 1JKGB 1VQ43 6GSPA 1I2EA 1UCLA 1RGLA 5BVBA 4HM3B 1UI7A 1BSBA 1IQXA 2HMMB 2IUKA
chains in the Genus database with same CATH topology
3G6E3 4O2HA 5IG3A 1SIHA 4RZMA 2B1XB 4IT7A 3GWRA 1KQS2 3F8XA 1VQL3 1DVCA 3HK4A 4AKZA 3CCM3 3OXAA 4KFDA 4O8SA 1W4NA 1GD3A 1IV7A 1GY7A 3X3ZA 3G713 4HKVB 2QEX3 1NO3A 1FGMA 1AV4A 3LTCA 4IIAA 1OHOA 3X40A 3G4S3 5IG0A 4PEJA 1RJOA 3J7Yd 2INXA 5AIIA 3UL6A 1E3RA 3NBBA 1Q7Y4 2Y74A 1OHPA 3FG3A 4MMYB 5AI1A 2FGTA 5CF1A 2V1LA 1ASKA 3SOAA 3DGMA 1W00A 1VQ63 1K734 5FGOA 3CCL3 1KSIA 3PCRA 2PZVA 5FW5A 2W6JH 1EQKA 1QAFA 1K8A4 2P38A 3JUQA 3WA3A 1MNLA 4U13A 1IDPA 3RGRA 1TUHA 3EB8A 5AEWB 4OVMA 3MG1A 2Y73A 4TX4A 2CK3H 3OWUA 2OTJ3 2CFWA 2BT3A 3NQYA 3MWZA 3FKAA 3DGOA 2YFLB 5EQLA 4XDVA 3KIIA 1D6YA 2GU1A 4EYCA 3CNXA 1OF5A 3SEDA 3MG2A 3S67A 3CC73 1Y4KA 2CC3A 3DY5A 3LXUX 1Q814 1W02A 2RSXA 3CCJ3 3OWSA 1IVVA 1W2B2 1GS3A 3PZWA 3BB9A 1OGZA 3FLJA 2XF3A 1YIJ3 1NDOB 5IF6A 1O7GB 1ZX2A 4N6V0 4K1VA 1TU5A 1E97A 1R4CA 2W9PA 2YFJB 3D3LA 3S29A 1VQ93 1VQ73 5D82A 1UUVB 3MKIA 4K1UA 1SJWA 4R9LA 3G16A 4JRFA 2M7OA 2LQVA 2CHCA 3CD63 4EC6A 1TFOA 2CWTA 1HU9A 3SLUA 2HMNB 3EBTA 2Z76A 4EBGA 1JB4A 1S5AA 1SQWA 1W6CA 4STDA 5CLKA 4AKYA 5EVHA 4R80A 1GYBA 1ROVA 4HM4B 3B4OA 4HM0B 3LT9A 1JB2A 4WWUC 3UL5A 3CNMA 5IERA 1OH0A 1SPUA 4LZIA 5IENA 2UX0A 1EG9B 1DMNA 3LOYA 2GU3A 3PGBA 1S723 3X3XA 4FMAA 1NJI4 1YJW3 1K28A 1VQ83 2CKFB 3CCS3 4X2HA 2BMOB 1O7WB 4BTXA 1A67A 4HM1B 4GL6A 4RBNA 3OW22 4HZBB 5JPUA 3NV0A 4LEHA 2GBXB 3F8HA 3I0YA 2MF7A 4O3VA 1BUQA 1JN5A 3CME3 1LVNA 2L4VA 2W03A 2ZL8A 5IG5A 2GXFA 2ZDJA 4HM7B 1A2VA 1W2ZA 1Q864 1FUWA 3X3YA 1E3VA 1LXEA 3DM8A 5HGRA 2K54A 4K61A 3UB1A 2BNGA 3DGNA 1VZZA 2XEPA 1IQYA 3S27A 3K0ZA 5ELUA 1STFI 4BTWA 5CF2A 1DYUA 3LT8A 2D1WA 4O02B 1J2BA 3WDGB 1VQM3 2W56B 4WYKB 5AIGA 1YI23 2OCTA 1Q40A 2F86B 2HMOB 1M904 1M9GA 3GZXB 1UI8A 3U1WA 2QA43 1A90A 3CCR3 4FMCA 3WMDA 1Z1SA 3BNEA 3F14A 1QVG2 1KD14 2E2UA 3DGLA 7STDA 2W9QA 2KXGA 2HMJB 2CH9A 1EKMA 3EQQB 3K9MC 2JQ5A 1NB3I 1NB5I 2YX9A 1WMOA 1GD4A 3SOYA 4FR9A 2CG1A 4FMDA 2P0MA 1T5YA 3H51A 3NX0A 4G1MB 3PYJA 1JKGA 3EN1B 1FGQA 1LNHA 2PNCA 1YJ93 4N6MA 3LZAA 1Q42A 3I563 4KFEA 3AMOB 1WTHA 2GEXA 4XDWA 5CXOA 3LTAA 3B8LA 3FH1A 3N8BA 1JJ22 3D9RA 4N6OB 4MMXB 2OWPA 5G2GA 3DMCA 1Q824 3PXMA 4FMBA 3IPTA 3KKGA 1ZO2A 3F7SA 5TGNA 3VGNA 3JUMA 2Z6BA 1CYVA 3NUVA 2BHMA 3EN8A 1PU4A 3RDEA 3MSOA 3CC23 3K63A 1VQP3 1IVUA 3RGAA 1QMAA 1O7MB 3E99A 2WGQA 1YVBI 1YGEA 2KCDA 2O9UX 3T8UA 3X42A 2OTL3 1GY6A 4XM4A 3NQZA 4ORLA 1IV9A 1ISKA 5IEPA 1CEWI 3V99A 2XFTA 3T8NA 4IPBA 2OQEC 1JB5A 5LC6A 3FGYA 1MOLA 1KWIA 2CG0A 4FCMA 2GBWB 4RNYA 3WOFB 3CCV3 1FGRA 3PCSA 4XBTA 1D6ZA 3FG4A 4K90B 3MHEA 4MMZB 4L8PA 5A0OB 3HZPA 1YIT3 3EHCA 3EC9A 2MC8A 3F9SA 4HVNA 3WODG 3EBYA 1L5GB 3NBJA 4BTYA 3Q1CA 5AYSC 4MJDA 3UNLA 1GY5A 5AIHA 1UUWB 1VQK3 2OOVC 3H3HA 2Q07A 4KZ1A 5AEUB 5D83A 3CU3A 4H61A 1F8NA 4WP5A 4KFFA 1V74A 3OWYA 4HM5B 4WFOA 1STDA 2E2TA 2IUJA 1NU3A 5DREA 1RKYA 1O7PB 2CFKA 4AEQA 4QWTA 3GRDA 1M1XB 2F99A 2KRTA 5AIFA 1O7NB 1O7HB 1G96A 4N6UA 1W6GA 3JUPA 3Q90A 2C11A 3LMLA 3DXOA 3NV0B 2IMJA 4N6TA 5JPPA 3CPW2 1DMMA 2CW9A 2XFSA 3S5CA 1QALA 3F7XA 4HM2B 1OCVA 3BLZA 2WGOA 1HKXA 1OGXA 2P0XA 3HIGA 3BNBA 3CC43 2GEYA 4MEIA 2CWUA 3EE1A 3CCE3 3F40A 4HBRA 3U97A 1OUNA 1IVXA 3ECFA 4LSOA 4XBXA 1OPYA 3WA2X 3KFQC 1IT8A 4EV2A 3I553 3CCQ3 1IT7A 3SXXA 2QGUA 2STDA 3B4PA 2F98A 2BMRB 2P09A 2OQEA 3O8YA 1EA2A 3VSYA 3DUKA 1K9M4 3GAXA 2FXTA 3PS8A 1N9JA 2CWVA 4N6NB 5ELJA 1IVWA 4WHAA 2Z77A 4HM6B 4HJLB 1YJN3 3EJVA 5KP1A 1FA3A 2SBLA 4OUQA 2E2VA 4NREA 2RFRA 2CFGA 5CK6A 2OOVA 2JDIH 1K41A 3A76A 3T0UA 4FCZA 3UJMA 1A2KA 3ER7A 3KE7A 1NWWA 2RGQA 3SX1A 1N8QA 5JBSA 5KP3A 3LYGA 6STDA 3MYTA 1D6UA 1W6YA 2XGLA 2XRXB 4N3VA 2A15A 4XB5A 1AVLA 2CFDA 5D81A 4L8OA 3HI7A 3IJEB 4RNZA 3STDA 5AYRB 1DVDA 1ULIB 3G0KA 2XH9A 3IMAB 3MG3A 3SVAA 3NM2A 4EXRA 2IA7A 2WO0A 3OX9A 4HM8B 4J9AA 2W56A 4WYKA 1U8CB 1QVF2 2BO9B 1RN7A 4XBYA 2XGNA 1TIJA 2W2CA 4JF8A 3G8ZA 3V98A 5I97A 3CXC2 1OF5B 1CYUA 2QIYA 1QAKA 1N5PA 1KC84 3K5TA 2FNQA 5IEOA 3S28A 3KN4A 5IW9A 1OHSA 3VF1A 4OK0A 4GB5A 1WQLB 1N5HA 2ML6A 1OACA 1UW1A 3NXJA 1RRHA 3JVCA 3NBRA 3FF2A 4J8TA 5LC7A 4R1KA 1DMQA 2D42A 1W5ZA 4LGQA 1IQ8A 2B24B 3JUOA 1JV2B 2R4IA 2HMKB 2XR8B 4HYZA 1IU7A 1N9EA 2XSOB 2W04A 3AMOA 1SIIA 4CDLA 5KP4A 3FSDA 1JRQA 3KSED 2Z7AA 4H3UA 3B7CA 5EEOA 1PFPA 4HZ9B 1FGTA 3NHXA 1U5OA 3Q2PA 3CCU3 5STDA 3GZRA 1AR0A 3JUNA 3WOEB 4R9KA 3MPHA 4N6LA 1JNQA 3NM7A 4X2OA 1LOXA 4R4KA 1VQ53 2CFLA 2BMQB 1VQO3 1C7HA 4Q53A 3QRDA 2HMLB 1TFKA 3N54B 3FG1A 3QK9A 2ML5A 2WOFA 3M8CA 1CQSA 4I4KA 8CHOA 2K0MA 3HX8A 2YFIB 4NHFA 3LTDA 1US1A 3BNDA 1QJGA 2RCDA 1IK3A 1TP6A 1VQN3 3KZTA 1JN5B 5IG4A 3ROBA 1YHQ3 1WNHA 3GZBA 1RRLA 3V92A 3EF8A 2CIUA 4FCJA 1ULJB 1N8R4 3CPOA 3GZYB 1AVKA 3K7CA 3N9HA 4L7KA 3HIIA 1W7CA 2I9WA 3FZWA 3OV4A 5DRVA 3TDGA 1Q40B 4KVHA 3BNCA 4EV5A 2C10A 4ZM8A 3CMA3 3X41A 1FGOA 2WOHA 2O3OA 2XSHB 3EX9A 3FF0A 1WMNA 3FCSB 4CCVA 3KSPA 4LMIA 1M1K4 5BXQA 2W0QA 3LTBA 1ROAA 1WMPA 3ALAA 3DZLA 2LYXA 2P05A 1W01A 3L0RA 3LH4A 1VQ43 1JKGB 5BVBA 4HM3B 1UI7A 1IQXA 2HMMB 2IUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5H A;  4IT7 A;  1DVC A;  5LC7 A;  1A67 A;  1GD3 A;  1IV7 A;  1FUW A;  1LXE A;  1G96 A;  4N6U A;  3UL6 A;  5ELU A;  1STF I;  3KSE D;  4N6T A;  1PFP A;  2OCT A;  3Q2P A;  1M9G A;  1A90 A;  1EQK A;  4N6L A;  1MNL A;  3QRD A;  4TX4 A;  2W9Q A;  2KXG A;  2CH9 A;  3MWZ A;  3K9M C;  3KFQ C;  1NB3 I;  1NB5 I;  1GD4 A;  5EQL A;  4EYC A;  3NX0 A;  3S67 A;  3PYJ A;  3GAX A;  3PS8 A;  1N9J A;  4N6N B;  5ELJ A;  1FA3 A;  4N6M A;  1WNH A;  4N6O B;  4N6V 0;  3PXM A;  1R4C A;  2W9P A;  1CYV A;  1YVB I;  2O9U X;  4ZM8 A;  1DVD A;  3IMA B;  1IV9 A;  3SVA A;  1CEW I;  4CCV A;  5LC6 A;  2BO9 B;  1MOL A;  1RN7 A;  1KWI A;  1TIJ A;  1ROA A;  1CYU A;  3L0R A;  1N5P A;  3LH4 A;  5A0O B;  3UL5 A;  4LZI A; 
#chains in the Genus database with same CATH topology
 3G6E 3;  4O2H A;  5IG3 A;  4ILF A;  1SIH A;  4RZM A;  2B1X B;  3WR2 A;  4IT7 A;  3GWR A;  1KQS 2;  3F8X A;  1VQL 3;  1DVC A;  3HK4 A;  1BNJ A;  4AKZ A;  2BU4 A;  3CCM 3;  3OXA A;  4KFD A;  4O8S A;  1UCI A;  1W4N A;  3A5E A;  1GD3 A;  3AHW A;  1IV7 A;  1Q9E A;  1GY7 A;  1I3F A;  3X3Z A;  4HKV B;  3G71 3;  2L1S A;  2QEX 3;  1NO3 A;  1FGM A;  1BRG A;  1AV4 A;  1YNV X;  1X1W A;  3LTC A;  4IIA A;  1OHO A;  3X40 A;  3G4S 3;  5IG0 A;  1BRI A;  4PEJ A;  1RJO A;  3J7Y d;  2INX A;  5AII A;  3UL6 A;  1E3R A;  3NBB A;  1Q7Y 4;  3DGY A;  1BIR A;  2Y74 A;  1OHP A;  3FG3 A;  4MMY B;  5AI1 A;  2FGT A;  1JZO A;  5CF1 A;  2V1L A;  1LOV A;  1ASK A;  3SOA A;  3DGM A;  1W00 A;  1VQ6 3;  1K73 4;  1B2Z A;  3BU4 A;  5FGO A;  3CCL 3;  4RNT A;  1KSI A;  3PCR A;  2PZV A;  5FW5 A;  2W6J H;  1EQK A;  1QAF A;  1K8A 4;  2P38 A;  3JUQ A;  3WA3 A;  1MNL A;  4U13 A;  1IDP A;  2ZHX B;  1TUH A;  3EB8 A;  3RGR A;  5AEW B;  4OVM A;  3MG1 A;  1X1U A;  2Y73 A;  4TX4 A;  2CK3 H;  3OWU A;  3ZG5 A;  6RNT A;  2CFW A;  2BT3 A;  2OTJ 3;  1DE3 A;  3NQY A;  3MWZ A;  1LOW A;  3FKA A;  3DGO A;  2YFL B;  5EQL A;  4XDV A;  3KII A;  1D6Y A;  2GU1 A;  4NPB A;  4EYC A;  3CNX A;  3AHS A;  1OF5 A;  3SED A;  2H0I A;  3MG2 A;  3S67 A;  3CC7 3;  1Y4K A;  2CC3 A;  3DY5 A;  1I3I A;  1JBT A;  3LXU X;  1Q81 4;  1W02 A;  2RSX A;  1FZU A;  3CCJ 3;  3OWS A;  1IVV A;  1W2B 2;  4LYL B;  2RBI A;  4BL3 A;  1GS3 A;  3PZW A;  3BB9 A;  1OGZ A;  3FLJ A;  2H0H A;  2XF3 A;  1YIJ 3;  1NDO B;  1BSE A;  5IF6 A;  2GSP A;  2KAA A;  1O7G B;  1ZS7 A;  1ZX2 A;  2CX1 A;  4N6V 0;  4K1V A;  2KF6 A;  1TU5 A;  1E97 A;  1RCK A;  1R4C A;  2W9P A;  2YFJ B;  3D3L A;  5G1L A;  1BNS A;  1BNE A;  3S29 A;  1VQ9 3;  3ZFZ A;  1VQ7 3;  5D82 A;  1UUV B;  3MKI A;  4K1U A;  1LRA A;  1SJW A;  4R9L A;  3G16 A;  4JRF A;  2M7O A;  2LQV A;  1FUS A;  2CHC A;  3CD6 3;  4EC6 A;  4EW5 A;  1TFO A;  2CWT A;  1HU9 A;  3SLU A;  2HMN B;  7GSP A;  3KCH A;  5M1A A;  3EBT A;  2Z76 A;  4EBG A;  1JB4 A;  1S5A A;  1SQW A;  1W6C A;  4STD A;  5CLK A;  4AKY A;  1BNR A;  5EVH A;  4R80 A;  5BIR A;  1GYB A;  1ROV A;  4HM4 B;  1BRS A;  3B4O A;  4HM0 B;  3LT9 A;  1JB2 A;  4WWU C;  3UL5 A;  3CNM A;  5IER A;  1OH0 A;  1SPU A;  4LZI A;  4BU4 A;  1BRJ A;  5IEN A;  1EG9 B;  1DMN A;  2UX0 A;  3LOY A;  4J5G A;  2GU3 A;  3PGB A;  1S72 3;  3X3X A;  4FMA A;  1NJI 4;  1YJW 3;  1K28 A;  1VQ8 3;  2CKF B;  3CCS 3;  1UUG B;  4X2H A;  2BMO B;  1GSP A;  1O7W B;  4BTX A;  1A67 A;  4HM1 B;  4GL6 A;  2C4B A;  4RBN A;  3OW2 2;  4HZB B;  5JPU A;  3NV0 A;  4LEH A;  2GBX B;  1Q7H A;  3F8H A;  1I2F A;  2MF7 A;  3I0Y A;  4O3V A;  1BUQ A;  1JN5 A;  1RHL A;  3CME 3;  1LVN A;  2L4V A;  2W03 A;  2ZL8 A;  5IG5 A;  2GXF A;  2ZDJ A;  4HM7 B;  1A2V A;  1W2Z A;  4CJN A;  1Q86 4;  1FUW A;  3X3Y A;  1RGE A;  1SAR A;  1E3V A;  1LXE A;  2R41 A;  3DM8 A;  2K54 A;  5HGR A;  4K61 A;  3UB1 A;  1MWT A;  2BNG A;  3DGN A;  1VZZ A;  2XEP A;  1IQY A;  3S27 A;  3K0Z A;  5ELU A;  1STF I;  4BTW A;  5CF2 A;  1RDS A;  1DYU A;  1I0V A;  3LT8 A;  2D1W A;  4O02 B;  1J2B A;  3WDG B;  1VQM 3;  1B27 A;  2W56 B;  4WYK B;  5AIG A;  1YI2 3;  1LQG C;  2OCT A;  1Q40 A;  2F86 B;  2HMO B;  1M90 4;  1M9G A;  3GZX B;  1UI8 A;  3U1W A;  1GMR A;  2QA4 3;  3URP A;  1A90 A;  3CCR 3;  4FMC A;  1EEJ A;  1Z1S A;  3BNE A;  3F14 A;  3WMD A;  1QVG 2;  1KD1 4;  2E2U A;  1TRP A;  3DGL A;  7STD A;  2W9Q A;  2KXG A;  1LNI A;  2HMJ B;  2CH9 A;  1EKM A;  3EQQ B;  3K9M C;  1MGW A;  3D5I A;  2JQ5 A;  3Q3F A;  1NB3 I;  1NB5 I;  2YX9 A;  1WMO A;  1GD4 A;  3SOY A;  4FR9 A;  2CG1 A;  4FMD A;  2P0M A;  1T5Y A;  3H51 A;  3NX0 A;  4G1M B;  3PYJ A;  1JKG A;  1RLS A;  1ZGX A;  5BU4 A;  3EN1 B;  1GMP A;  1B2X A;  1PYL A;  1FW7 A;  1FGQ A;  1LNH A;  1BAN A;  2PNC A;  1YJ9 3;  1RSN A;  3LZA A;  4N6M A;  1Q42 A;  3I56 3;  4KFE A;  1GOU A;  3AMO B;  1WTH A;  2GEX A;  4XDW A;  1B3S A;  5CXO A;  3LTA A;  3B8L A;  3FH1 A;  3N8B A;  1JJ2 2;  3D9R A;  2F4Y A;  4N6O B;  4MMX B;  2CX0 A;  2OWP A;  5G2G A;  3DMC A;  3SYU A;  1Q82 4;  3PXM A;  4FMB A;  4BL2 A;  3IPT A;  3KKG A;  1ZO2 A;  3F7S A;  5TGN A;  3VGN A;  3JUM A;  2Z6B A;  1CYV A;  3NUV A;  2BHM A;  3EN8 A;  1PU4 A;  3RDE A;  3MSO A;  3CC2 3;  1RN1 A;  4J5K A;  3K63 A;  4CPK A;  1IVU A;  1VQP 3;  3RGA A;  1QMA A;  1O7M B;  3E99 A;  2WGQ A;  1X1X A;  1YVB I;  1YGE A;  2KCD A;  2O9U X;  3T8U A;  2SAR A;  3X42 A;  9RNT A;  2OTL 3;  1GY6 A;  4XM4 A;  3NQZ A;  2KF3 A;  4ORL A;  1IV9 A;  1ISK A;  5IEP A;  1CEW I;  3V99 A;  2XFT A;  2HOH A;  1UCJ A;  4IPB A;  3T8N A;  2OQE C;  1JB5 A;  5LC6 A;  3FGY A;  1B20 A;  1BOX A;  1KWI A;  1MOL A;  2CG0 A;  2GBW B;  3AGN A;  4FCM A;  4RNY A;  3WOF B;  1FGR A;  2J8X B;  3HOH A;  3PCS A;  4XBT A;  3CCV 3;  1D6Z A;  1I2G A;  3FG4 A;  1FYS A;  4K90 B;  3AGO A;  3MHE A;  1G0T A;  4MMZ B;  1YGW A;  4L8P A;  5A0O B;  1HYF A;  1TJD A;  3HZP A;  1YIT 3;  3EHC A;  3EC9 A;  1GMQ A;  1RGA A;  2MC8 A;  3F9S A;  4HVN A;  3WOD G;  3EBY A;  1L5G B;  3NBJ A;  1C54 A;  1BVI A;  4BTY A;  3Q1C A;  5AYS C;  4MJD A;  3UNL A;  1GY5 A;  2K3D A;  1B2S A;  1UUW B;  5AIH A;  1VQK 3;  2OOV C;  3H3H A;  2Q07 A;  4KZ1 A;  5AEU B;  5D83 A;  3CU3 A;  4H61 A;  1F8N A;  4WP5 A;  1UGI A;  4KFF A;  1V74 A;  3DH2 A;  1G02 A;  3OWY A;  4HM5 B;  1I0X A;  4WFO A;  1STD A;  1UGH I;  2E2T A;  1NU3 A;  2H0G A;  5DRE A;  2IUJ A;  1O7P B;  1RKY A;  2CFK A;  4AEQ A;  4QWT A;  3GRD A;  1M1X B;  1RGK A;  1RGG A;  2F99 A;  2KRT A;  1B2U A;  5AIF A;  1O7N B;  1O7H B;  1G96 A;  4N6U A;  1W6G A;  3JUP A;  3Q90 A;  2C11 A;  3LML A;  3DXO A;  1BRK A;  3NV0 B;  2IMJ A;  4N6T A;  5M19 A;  5JPP A;  3CPW 2;  1DMM A;  1RCL A;  2CW9 A;  2XFS A;  3S5C A;  1QAL A;  3F7X A;  4HM2 B;  1AQZ A;  1OCV A;  3BLZ A;  1UCK A;  1HKX A;  1OGX A;  1DET A;  2AAD A;  2P0X A;  2WGO A;  3HIG A;  4BIR A;  3BNB A;  3CC4 3;  2GEY A;  4MEI A;  2CWU A;  3EE1 A;  3CCE 3;  1BSD A;  3F40 A;  4HBR A;  2F5M A;  3U97 A;  2KF4 A;  1BAO A;  1OUN A;  1BNI A;  1IVX A;  3ECF A;  4LSO A;  4XBX A;  1OPY A;  3WA2 X;  3KFQ C;  1IT8 A;  1VQQ A;  4EV2 A;  3I55 3;  3CCQ 3;  1IT7 A;  4GHO A;  3SXX A;  2QGU A;  2STD A;  1T2I A;  3B4P A;  2F98 A;  2BMR B;  1T3B A;  2P09 A;  2OQE A;  3O8Y A;  1A2P A;  1EA2 A;  3VSY A;  3DUK A;  1K9M 4;  3GAX A;  2FXT A;  2UGI A;  3PS8 A;  1N9J A;  2CWV A;  4N6N B;  1CH0 A;  5ELJ A;  1B21 A;  1IVW A;  2RNT A;  2Z77 A;  4HM6 B;  4WHA A;  4HJL B;  1YJN 3;  3EJV A;  5KP1 A;  1FA3 A;  1RNB A;  1R4Y A;  1GOY A;  2SBL A;  4OUQ A;  1JBS A;  2E2V A;  4NRE A;  2RFR A;  2CFG A;  5CK6 A;  1UDI I;  2OOV A;  2JDI H;  1K41 A;  3A76 A;  3T0U A;  4FCZ A;  3UJM A;  1A2K A;  3ER7 A;  1BGS A;  1MWU A;  1NWW A;  2RGQ A;  3KE7 A;  3SX1 A;  1N8Q A;  5HOH A;  5JBS A;  5KP3 A;  3LYG A;  6STD A;  3MYT A;  1D6U A;  1W6Y A;  2XGL A;  2XRX B;  7RNT A;  4N3V A;  1T2H A;  1BNG A;  2A15 A;  4XB5 A;  1AVL A;  2CFD A;  5D81 A;  3D4A A;  4L8O A;  1B2M A;  3HI7 A;  3IJE B;  4RNZ A;  3STD A;  5AYR B;  1DVD A;  8RNT A;  1ULI B;  1BSA A;  2IYJ A;  2XH9 A;  3G0K A;  3IMA B;  3MG3 A;  3NM2 A;  3SVA A;  4EXR A;  2IA7 A;  2WO0 A;  3OX9 A;  4HM8 B;  4J9A A;  1TTO A;  2W56 A;  1U8C B;  4WYK A;  2BO9 B;  1QVF 2;  1RN7 A;  2F56 A;  3GSP A;  4XBY A;  1RGH A;  2XGN A;  1TIJ A;  2W2C A;  4JF8 A;  3G8Z A;  3V98 A;  5I97 A;  3CXC 2;  1OF5 B;  1CYU A;  1RMS A;  2QIY A;  1QAK A;  1BRN L;  1N5P A;  1KC8 4;  3K5T A;  2FNQ A;  5IEO A;  3S28 A;  3KN4 A;  5IW9 A;  1OHS A;  3VF1 A;  4OK0 A;  4GB5 A;  1WQL B;  2F5W A;  1N5H A;  3RNT A;  2ZA4 A;  1AY7 A;  2ML6 A;  3D79 A;  1OAC A;  1PY3 A;  3BIR A;  1UW1 A;  3NXJ A;  1RRH A;  3JVC A;  3NBR A;  1RGF A;  3FF2 A;  4J8T A;  4R1K A;  5LC7 A;  1FUT A;  1DMQ A;  2D42 A;  1W5Z A;  1BUJ A;  4LGQ A;  1IQ8 A;  2B24 B;  1HZ1 A;  1MGR A;  3D5G A;  3JUO A;  1GOV A;  1JV2 B;  2R4I A;  2HMK B;  2XR8 B;  4HYZ A;  1V58 A;  1RN4 A;  1IU7 A;  1N9E A;  2XSO B;  1LQM B;  4KT3 B;  1BU4 A;  2W04 A;  3AMO A;  1SII A;  4CDL A;  5KP4 A;  3FSD A;  1JRQ A;  5GSP A;  5RNT A;  3KSE D;  2Z7A A;  4H3U A;  3B7C A;  5EEO A;  1PFP A;  4HZ9 B;  1FGT A;  3NHX A;  1U5O A;  3Q2P A;  3CCU 3;  5STD A;  3GZR A;  1AR0 A;  1NNV A;  3JUN A;  1MWR A;  3WOE B;  4R9K A;  3MPH A;  4N6L A;  1JNQ A;  1RTU A;  3NM7 A;  4X2O A;  1LOX A;  4R4K A;  1VQ5 3;  2IY2 A;  2CFL A;  2BMQ B;  1VQO 3;  1C7H A;  4Q53 A;  3QRD A;  5M18 A;  2HML B;  1TFK A;  3N54 B;  3FG1 A;  1MWS A;  3QK9 A;  2ML5 A;  2WOF A;  4DKI A;  3M8C A;  1CQS A;  2KF5 A;  3WHO A;  1EUI C;  4GSP A;  4I4K A;  8CHO A;  2K0M A;  3HX8 A;  2YFI B;  4NHF A;  3LTD A;  1US1 A;  3BND A;  1QJG A;  2RCD A;  1IK3 A;  1TP6 A;  1I8V A;  3ZG0 A;  1IYY A;  1RNT A;  1VQN 3;  3KZT A;  1JN5 B;  4HAA A;  2UUG C;  1JZD A;  5IG4 A;  3ROB A;  1I70 A;  1YHQ 3;  1BSC A;  1YVS A;  1WNH A;  3GZB A;  1RRL A;  3V92 A;  3EF8 A;  2CIU A;  4FCJ A;  1ULJ B;  1N8R 4;  3CPO A;  1V57 A;  3GZY B;  1AVK A;  3K7C A;  3N9H A;  4L7K A;  3HII A;  1X1Y A;  1W7C A;  2I9W A;  1BRH A;  3FZW A;  3OV4 A;  5DRV A;  3TDG A;  1Q40 B;  1TRQ A;  4KVH A;  3BNC A;  4EV5 A;  2BIR A;  2C10 A;  4ZM8 A;  3CMA 3;  2AAE A;  3X41 A;  1JBR A;  1BNF A;  1FGO A;  2WOH A;  2O3O A;  2XSH B;  3EX9 A;  3FF0 A;  1WMN A;  3FCS B;  4CCV A;  3KSP A;  4LMI A;  5G1K A;  1M1K 4;  1LOY A;  5BXQ A;  2W0Q A;  3LTB A;  1ROA A;  1WMP A;  3ALA A;  3DZL A;  4HOH A;  2LYX A;  2P05 A;  1W01 A;  3L0R A;  1RGC A;  3LH4 A;  4I5Q A;  1JKG B;  1VQ4 3;  6GSP A;  1I2E A;  1UCL A;  1RGL A;  5BVB A;  4HM3 B;  1UI7 A;  1BSB A;  1IQX A;  2HMM B;  2IUK A; 
#chains in the Genus database with same CATH homology
 3G6E 3;  4O2H A;  5IG3 A;  1SIH A;  4RZM A;  2B1X B;  4IT7 A;  3GWR A;  1KQS 2;  3F8X A;  1VQL 3;  1DVC A;  3HK4 A;  4AKZ A;  3CCM 3;  3OXA A;  4KFD A;  4O8S A;  1W4N A;  1GD3 A;  1IV7 A;  1GY7 A;  3X3Z A;  3G71 3;  4HKV B;  2QEX 3;  1NO3 A;  1FGM A;  1AV4 A;  3LTC A;  4IIA A;  1OHO A;  3X40 A;  3G4S 3;  5IG0 A;  4PEJ A;  1RJO A;  3J7Y d;  2INX A;  5AII A;  3UL6 A;  1E3R A;  3NBB A;  1Q7Y 4;  2Y74 A;  1OHP A;  3FG3 A;  4MMY B;  5AI1 A;  2FGT A;  5CF1 A;  2V1L A;  1ASK A;  3SOA A;  3DGM A;  1W00 A;  1VQ6 3;  1K73 4;  5FGO A;  3CCL 3;  1KSI A;  3PCR A;  2PZV A;  5FW5 A;  2W6J H;  1EQK A;  1QAF A;  1K8A 4;  2P38 A;  3JUQ A;  3WA3 A;  1MNL A;  4U13 A;  1IDP A;  3RGR A;  1TUH A;  3EB8 A;  5AEW B;  4OVM A;  3MG1 A;  2Y73 A;  4TX4 A;  2CK3 H;  3OWU A;  2OTJ 3;  2CFW A;  2BT3 A;  3NQY A;  3MWZ A;  3FKA A;  3DGO A;  2YFL B;  5EQL A;  4XDV A;  3KII A;  1D6Y A;  2GU1 A;  4EYC A;  3CNX A;  1OF5 A;  3SED A;  3MG2 A;  3S67 A;  3CC7 3;  1Y4K A;  2CC3 A;  3DY5 A;  3LXU X;  1Q81 4;  1W02 A;  2RSX A;  3CCJ 3;  3OWS A;  1IVV A;  1W2B 2;  1GS3 A;  3PZW A;  3BB9 A;  1OGZ A;  3FLJ A;  2XF3 A;  1YIJ 3;  1NDO B;  5IF6 A;  1O7G B;  1ZX2 A;  4N6V 0;  4K1V A;  1TU5 A;  1E97 A;  1R4C A;  2W9P A;  2YFJ B;  3D3L A;  3S29 A;  1VQ9 3;  1VQ7 3;  5D82 A;  1UUV B;  3MKI A;  4K1U A;  1SJW A;  4R9L A;  3G16 A;  4JRF A;  2M7O A;  2LQV A;  2CHC A;  3CD6 3;  4EC6 A;  1TFO A;  2CWT A;  1HU9 A;  3SLU A;  2HMN B;  3EBT A;  2Z76 A;  4EBG A;  1JB4 A;  1S5A A;  1SQW A;  1W6C A;  4STD A;  5CLK A;  4AKY A;  5EVH A;  4R80 A;  1GYB A;  1ROV A;  4HM4 B;  3B4O A;  4HM0 B;  3LT9 A;  1JB2 A;  4WWU C;  3UL5 A;  3CNM A;  5IER A;  1OH0 A;  1SPU A;  4LZI A;  5IEN A;  2UX0 A;  1EG9 B;  1DMN A;  3LOY A;  2GU3 A;  3PGB A;  1S72 3;  3X3X A;  4FMA A;  1NJI 4;  1YJW 3;  1K28 A;  1VQ8 3;  2CKF B;  3CCS 3;  4X2H A;  2BMO B;  1O7W B;  4BTX A;  1A67 A;  4HM1 B;  4GL6 A;  4RBN A;  3OW2 2;  4HZB B;  5JPU A;  3NV0 A;  4LEH A;  2GBX B;  3F8H A;  3I0Y A;  2MF7 A;  4O3V A;  1BUQ A;  1JN5 A;  3CME 3;  1LVN A;  2L4V A;  2W03 A;  2ZL8 A;  5IG5 A;  2GXF A;  2ZDJ A;  4HM7 B;  1A2V A;  1W2Z A;  1Q86 4;  1FUW A;  3X3Y A;  1E3V A;  1LXE A;  3DM8 A;  5HGR A;  2K54 A;  4K61 A;  3UB1 A;  2BNG A;  3DGN A;  1VZZ A;  2XEP A;  1IQY A;  3S27 A;  3K0Z A;  5ELU A;  1STF I;  4BTW A;  5CF2 A;  1DYU A;  3LT8 A;  2D1W A;  4O02 B;  1J2B A;  3WDG B;  1VQM 3;  2W56 B;  4WYK B;  5AIG A;  1YI2 3;  2OCT A;  1Q40 A;  2F86 B;  2HMO B;  1M90 4;  1M9G A;  3GZX B;  1UI8 A;  3U1W A;  2QA4 3;  1A90 A;  3CCR 3;  4FMC A;  3WMD A;  1Z1S A;  3BNE A;  3F14 A;  1QVG 2;  1KD1 4;  2E2U A;  3DGL A;  7STD A;  2W9Q A;  2KXG A;  2HMJ B;  2CH9 A;  1EKM A;  3EQQ B;  3K9M C;  2JQ5 A;  1NB3 I;  1NB5 I;  2YX9 A;  1WMO A;  1GD4 A;  3SOY A;  4FR9 A;  2CG1 A;  4FMD A;  2P0M A;  1T5Y A;  3H51 A;  3NX0 A;  4G1M B;  3PYJ A;  1JKG A;  3EN1 B;  1FGQ A;  1LNH A;  2PNC A;  1YJ9 3;  4N6M A;  3LZA A;  1Q42 A;  3I56 3;  4KFE A;  3AMO B;  1WTH A;  2GEX A;  4XDW A;  5CXO A;  3LTA A;  3B8L A;  3FH1 A;  3N8B A;  1JJ2 2;  3D9R A;  4N6O B;  4MMX B;  2OWP A;  5G2G A;  3DMC A;  1Q82 4;  3PXM A;  4FMB A;  3IPT A;  3KKG A;  1ZO2 A;  3F7S A;  5TGN A;  3VGN A;  3JUM A;  2Z6B A;  1CYV A;  3NUV A;  2BHM A;  3EN8 A;  1PU4 A;  3RDE A;  3MSO A;  3CC2 3;  3K63 A;  1VQP 3;  1IVU A;  3RGA A;  1QMA A;  1O7M B;  3E99 A;  2WGQ A;  1YVB I;  1YGE A;  2KCD A;  2O9U X;  3T8U A;  3X42 A;  2OTL 3;  1GY6 A;  4XM4 A;  3NQZ A;  4ORL A;  1IV9 A;  1ISK A;  5IEP A;  1CEW I;  3V99 A;  2XFT A;  3T8N A;  4IPB A;  2OQE C;  1JB5 A;  5LC6 A;  3FGY A;  1MOL A;  1KWI A;  2CG0 A;  4FCM A;  2GBW B;  4RNY A;  3WOF B;  3CCV 3;  1FGR A;  3PCS A;  4XBT A;  1D6Z A;  3FG4 A;  4K90 B;  3MHE A;  4MMZ B;  4L8P A;  5A0O B;  3HZP A;  1YIT 3;  3EHC A;  3EC9 A;  2MC8 A;  3F9S A;  4HVN A;  3WOD G;  3EBY A;  1L5G B;  3NBJ A;  4BTY A;  3Q1C A;  5AYS C;  4MJD A;  3UNL A;  1GY5 A;  5AIH A;  1UUW B;  1VQK 3;  2OOV C;  3H3H A;  2Q07 A;  4KZ1 A;  5AEU B;  5D83 A;  3CU3 A;  4H61 A;  1F8N A;  4WP5 A;  4KFF A;  1V74 A;  3OWY A;  4HM5 B;  4WFO A;  1STD A;  2E2T A;  2IUJ A;  1NU3 A;  5DRE A;  1RKY A;  1O7P B;  2CFK A;  4AEQ A;  4QWT A;  3GRD A;  1M1X B;  2F99 A;  2KRT A;  5AIF A;  1O7N B;  1O7H B;  1G96 A;  4N6U A;  1W6G A;  3JUP A;  3Q90 A;  2C11 A;  3LML A;  3DXO A;  3NV0 B;  2IMJ A;  4N6T A;  5JPP A;  3CPW 2;  1DMM A;  2CW9 A;  2XFS A;  3S5C A;  1QAL A;  3F7X A;  4HM2 B;  1OCV A;  3BLZ A;  2WGO A;  1HKX A;  1OGX A;  2P0X A;  3HIG A;  3BNB A;  3CC4 3;  2GEY A;  4MEI A;  2CWU A;  3EE1 A;  3CCE 3;  3F40 A;  4HBR A;  3U97 A;  1OUN A;  1IVX A;  3ECF A;  4LSO A;  4XBX A;  1OPY A;  3WA2 X;  3KFQ C;  1IT8 A;  4EV2 A;  3I55 3;  3CCQ 3;  1IT7 A;  3SXX A;  2QGU A;  2STD A;  3B4P A;  2F98 A;  2BMR B;  2P09 A;  2OQE A;  3O8Y A;  1EA2 A;  3VSY A;  3DUK A;  1K9M 4;  3GAX A;  2FXT A;  3PS8 A;  1N9J A;  2CWV A;  4N6N B;  5ELJ A;  1IVW A;  4WHA A;  2Z77 A;  4HM6 B;  4HJL B;  1YJN 3;  3EJV A;  5KP1 A;  1FA3 A;  2SBL A;  4OUQ A;  2E2V A;  4NRE A;  2RFR A;  2CFG A;  5CK6 A;  2OOV A;  2JDI H;  1K41 A;  3A76 A;  3T0U A;  4FCZ A;  3UJM A;  1A2K A;  3ER7 A;  3KE7 A;  1NWW A;  2RGQ A;  3SX1 A;  1N8Q A;  5JBS A;  5KP3 A;  3LYG A;  6STD A;  3MYT A;  1D6U A;  1W6Y A;  2XGL A;  2XRX B;  4N3V A;  2A15 A;  4XB5 A;  1AVL A;  2CFD A;  5D81 A;  4L8O A;  3HI7 A;  3IJE B;  4RNZ A;  3STD A;  5AYR B;  1DVD A;  1ULI B;  3G0K A;  2XH9 A;  3IMA B;  3MG3 A;  3SVA A;  3NM2 A;  4EXR A;  2IA7 A;  2WO0 A;  3OX9 A;  4HM8 B;  4J9A A;  2W56 A;  4WYK A;  1U8C B;  1QVF 2;  2BO9 B;  1RN7 A;  4XBY A;  2XGN A;  1TIJ A;  2W2C A;  4JF8 A;  3G8Z A;  3V98 A;  5I97 A;  3CXC 2;  1OF5 B;  1CYU A;  2QIY A;  1QAK A;  1N5P A;  1KC8 4;  3K5T A;  2FNQ A;  5IEO A;  3S28 A;  3KN4 A;  5IW9 A;  1OHS A;  3VF1 A;  4OK0 A;  4GB5 A;  1WQL B;  1N5H A;  2ML6 A;  1OAC A;  1UW1 A;  3NXJ A;  1RRH A;  3JVC A;  3NBR A;  3FF2 A;  4J8T A;  5LC7 A;  4R1K A;  1DMQ A;  2D42 A;  1W5Z A;  4LGQ A;  1IQ8 A;  2B24 B;  3JUO A;  1JV2 B;  2R4I A;  2HMK B;  2XR8 B;  4HYZ A;  1IU7 A;  1N9E A;  2XSO B;  2W04 A;  3AMO A;  1SII A;  4CDL A;  5KP4 A;  3FSD A;  1JRQ A;  3KSE D;  2Z7A A;  4H3U A;  3B7C A;  5EEO A;  1PFP A;  4HZ9 B;  1FGT A;  3NHX A;  1U5O A;  3Q2P A;  3CCU 3;  5STD A;  3GZR A;  1AR0 A;  3JUN A;  3WOE B;  4R9K A;  3MPH A;  4N6L A;  1JNQ A;  3NM7 A;  4X2O A;  1LOX A;  4R4K A;  1VQ5 3;  2CFL A;  2BMQ B;  1VQO 3;  1C7H A;  4Q53 A;  3QRD A;  2HML B;  1TFK A;  3N54 B;  3FG1 A;  3QK9 A;  2ML5 A;  2WOF A;  3M8C A;  1CQS A;  4I4K A;  8CHO A;  2K0M A;  3HX8 A;  2YFI B;  4NHF A;  3LTD A;  1US1 A;  3BND A;  1QJG A;  2RCD A;  1IK3 A;  1TP6 A;  1VQN 3;  3KZT A;  1JN5 B;  5IG4 A;  3ROB A;  1YHQ 3;  1WNH A;  3GZB A;  1RRL A;  3V92 A;  3EF8 A;  2CIU A;  4FCJ A;  1ULJ B;  1N8R 4;  3CPO A;  3GZY B;  1AVK A;  3K7C A;  3N9H A;  4L7K A;  3HII A;  1W7C A;  2I9W A;  3FZW A;  3OV4 A;  5DRV A;  3TDG A;  1Q40 B;  4KVH A;  3BNC A;  4EV5 A;  2C10 A;  4ZM8 A;  3CMA 3;  3X41 A;  1FGO A;  2WOH A;  2O3O A;  2XSH B;  3EX9 A;  3FF0 A;  1WMN A;  3FCS B;  4CCV A;  3KSP A;  4LMI A;  1M1K 4;  5BXQ A;  2W0Q A;  3LTB A;  1ROA A;  1WMP A;  3ALA A;  3DZL A;  2LYX A;  2P05 A;  1W01 A;  3L0R A;  3LH4 A;  1VQ4 3;  1JKG B;  5BVB A;  4HM3 B;  1UI7 A;  1IQX A;  2HMM B;  2IUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...