1AOIB

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 27
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiB00
3MNNC 3UTAD 1KX5D 5B31D 5CPIB 3REKB 2AROD 1P34C 3AN2A 5BO0A 1M1AB 1H3OA 4J8VA 1ZLAA 4LD9B 1S32A 1JFIA 3X1UA 3W96D 4AWLB 3KXBA 5CP6D 3LJAD 3REIA 1M19C 3WKJA 3WA9D 4QLCA 5B24C 3AZLD 3RELC 4KUDA 2F8NK 3C1BC 5AVBA 4J8WB 3UT9D 4G92B 1P3BC 3AZHC 5DNMB 4WU8C 3NQJA 2YFVA 4DRBA 4WU9C 4R8PD 3AZFB 1P3FC 5B40A 1BH8B 2PYOA 4X23C 4ZUXC 5FUGA 5B1LB 5B0YA 4Z66D 3AYWB 2FJ7C 1M18B 3VH6T 4H9QA 3TU4B 2BYKA 3W97A 4H9PA 5B1MD 3LZ0A 3UTAB 1KX5B 5B31B 1U35D 2AROB 4KGCC 3UTBD 1B6WA 1AOIA 1TZYC 1BH9B 3KWQC 5B2JA 3W96B 3LJAB 5CP6B 4CSRA 3WA9B 3AFAA 1BFMA 3C1CD 1P3PD 3AZLB 4Z5TA 3MGSD 1P3OA 4WNNA 4WZSB 1P3LA 3UT9B 3TU4D 3AZGA 3AZMC 5CPKA 5AV8A 5JRGD 5GT0C 5B0ZC 3MGRA 4R8PB 3O62C 4EO5C 3VH5A 3LZ1C 3AZMA 3VH6A 4Z66B 4J8XC 3AZND 4JJND 5B1MB 2HUEC 1U35B 2NZDD 1M19A 5B24A 3REJA 3RELA 1KX4C 5B32C 3LELA 3A6NC 3B6FD 3C1CB 1P3PB 5AV9A 3WAAB 5DNND 3MVDD 1P3BA 3REKC 5GXQA 4WU8A 1ULYA 1M1AC 3B6GC 3NQUB 4WU9A 1N1JA 1P3FA 4LD9C 5JRGB 4X23A 2FJ7A 5AVCD 4AWLC 5GSUA 2NQBA 3AZJC 1KX3D 3AV2C 4J8VD 4KGCA 1S32D 4XZQC 5AV5C 3AZNB 4J8WC 4JJNB 4UUZA 3X1UD 1F66C 4G92C 5B2IA 3KXBD 1TZYA 3REID 3WKJD 2NZDB 3AZID 3AZFC 4KHAA 4KUDD 3R45A 5JA4B 5BNVA 5B1LC 3AYWC 2F8ND 5B33D 3TU4C 1HQ3A 5DNNB 3MVDB 4WV4B 3UTAC 1Q9CA 1KX5C 5B31C 5GT0A 3V9RB 5B0ZA 2YFWB 3AV1A 2PYOD 1P3ID 2L5AA 5B0YD 3O62A 3LZ1A 5G49B 4H9NA 5CP6C 5AV6A 3W97D 3WA9C 5GT3C 3WTPC 3REHB 3AZLC 4E45A 4NE3A 3MGQD 5BO0B 1KX3B 1H3OB 4J8VB 1S32B 1AOID 3UT9C 1JFIB 3X1UB 5B2JD 3KXBB 2HIOA 3WKJB 3AFAD 3AZIB 1KX4A 4Z5TD 1P3OD 3A6NA 1ID3D 4Z66C 1P3AA 3WTPE 3REKA 3AZGD 5AV8D 2F8NB 2RVQD 5B33B 1M1AA 5E5AC 3B6GA 5BT1C 4LD9A 5B1MC 1P3GA 3NQJB 2YFVB 3MGRD 1P3KD 2PYOB 2JSSA 1P3IB 5B0YB 5F99C 3AZJA 4H9QB 3AV2A 2IO5B 3AZED 1EQZC 4ZBJC 2BYKB 3W97B 4XUJA 4XZQA 1TAFA 5AV5A 4J8WA 3C1CC 2BYMB 1F66A 3WAAC 3MGQB 3MGPA 2F8NH 4DRAA 1M19D 1AOIB 3X1SA 4NE5A 3AZFA 5B2JB 3REJD 3X1VA 5JRGC 3AFAB 3LELD 3W99D 4Z5TB 2CV5D 5AV9D 3AZKD 4WNNB 1P3OB 3B0DC 1ID3B 3KUYC 2LY8A 4CAYA 4YS3D 1HTAA 5GXQD 4WU8D 1P3MC 5B31A 3AZGB 4YM6A 3AZNC 4X23D 4J8UA 3X1TC 4JJNC 3W98D 5GSUD 1P3KB 3MGRB 3MNNA 1KU5A 4Z2MH 2NQBD 5GT3A 3WTPA 1P34A 4H9RB 3AZEB 3VH5W 5B2ID 3UTBB 5DNNC 3MVDC 1M19B 5B32G 5AY8C 3REJB 3C1BA 5C3IC 3LELB 3MGSB 3W99B 1HQ3D 2CV5B 5AV9B 3AZKB 4H9SC 5CPIC 3REHC 3AZHA 5E5AA 5CPJD 3AV1D 4YS3B 5GXQB 4WU8B 1KX3C 4J8VC 1N1JB 4H9OB 4ZUXA 3LZ1D 4X23B 3W98B 5F99A 5GSUB 5AV6D 3WKJC 1EQZA 3AZIC 3AN2D 2NQBB 1ZLAD 3C1CA 3WAAA 5B2IB 3KWQA 5DNMC 2HIOD 4QLCD 5B33C 1KX4D 5JRGA 5AVBD 1P3IC 5B0YC 1P3AD 1M18C 3KUYA 3B6FB 5B31G 1P3MA 1M1AD 2IO5C 3B6GD 1HQ3B 3W97C 4NE6A 1P3GD 2AROC 3B0BA 3X1TA 5B40D 5CPJB 3AV1B 3MGQC 3LZ1B 1AOIC 3W96C 5AVCB 3LJAC 3AZJD 3AV2D 4H9NB 3LZ0D 4J8XA 5AV6B 4XUJD 4XZQD 3AFAC 5AV5D 3AN2B 4Z5TC 4G91B 1P3OC 1F66D 1ZLAB 1ID3C 3MGPD 3B0CW 3X1SD 5BNXA 3REIB 3AZGC 3X1VD 2RVQC 2HIOB 5AY8A 4QLCB 5B32A 4R8PC 4KUDB 1P3KC 5KDMA 1P3LD 1A7WA 5AVBB 1P3AB 5CPIA 3REHA 5CPKD 4YM6D 1KX3A 3B6GB 3AZEC 4J8UD 1P3GB 1U35C 3UTBC 5B40B 3AZMD 5FUGB 3MNND 5GT3D 3WTPD 1P34D 3AZIA 3AZJB 3REJC 4H9PB 3AV2B 3LZ0B 4XUJB 4XZQB 3LELC 1P3PC 1TAFB 5AV5B 3MGSC 3W99C 2CV5C 1F66B 4E44A 5AV9C 3AZKC 2F8NA 3MGPB 5DNMA 5B33A 5B24D 4YS3C 5GXQC 3X1SB 3RELD 1BH8A 4CSRB 4NFTA 1B67A 5B1LA 5BS7C 3C1BD 3AYWA 3X1VB 1P3IA 1M18A 3W98C 5GSUC 3VH5T 3TU4A 1P3BD 1P3LB 3AZHD 4HGAB 5E5AD 2NQBC 3UTAA 4CAYB 5BT1D 1KX5A 4WU9D 1F1EA 5CPKB 2AROA 1P3FD 5AV8B 1WWIA 2BYMA 4ZUXD 2FJ7D 4YM6B 3MGQA 4J8UB 5F99D 1BH9A 5B2IC 2NZDC 3W96A 3AZMB 3LJAA 5CP6A 1EQZD 3WA9A 3MNNB 5GT3B 3WTPB 3AZLA 1P34B 4KGCD 3WAAD 1ID3A 3VH6W 1TZYD 3UT9A 3B6FC 3KWQD 1HQ3C 5B24B 5CPJC 3AV1C 4R8PA 3RELB 1P3KA 4Z66A 3KUYD 3C1BB 5AVCC 1P3MD 4H9RA 5AV6C 1P3BB 3AZHB 5GT0D 5B0ZD 5B1MA 3AZEA 5E5AB 3X1TD 1R4VA 3AN2C 4G91C 4WU9B 3O62D 1U35A 1ZLAC 1P3FB 3UTBA 1S32C 4ZUXB 2FJ7B 3X1UC 3KXBC 3REIC 5F99B 4J8XD 2HIOC 4QLCC 1EQZB 4ZBJB 4KUDC 2CWEA 1P3PA 5CHLB 3MGSA 4KGCB 2F8NG 5AVBC 2CV5A 3W99A 3AZKA 1P3AC 4UUZB 1TZYB 4YS3A 3NQUA 3KWQB 5AY8D 5B32D 4H9OA 1P3GC 5BS7A 3A6ND 4KHAB 3R45B 5BNVB 5B40C 2PYOC 3W98A 1WWSA 3B0DB 5CPID 3REHD 3REKD 3KUYB 3B0CT 1P3MB 4LD9D 3LZ0C 3AZNA 3KSYA 4XUJC 4JJNA 5GT0B 5B0ZB 3X1TB 3O62B 4EO5B 2NZDA 3MGPC 4Z2MG 3X1SC 5B2JC 5JA4A 4M6BA 4J8XB 3X1VC 4J8WD 2HUEB 3B6FA 1P3LC 4HGAC 5DNNA 5DNMD 3MVDA 3AZFD 5CPKC 3V9RA 5BNXB 2YFWA 5AV8C 5CPJA 5B1LD 4YM6C 3AYWD 1KX4B 5AY8B 4J8UC 5G49A 5B32B 1M18D 3MGRC 3A6NB 5AVCA 5C3IB 5KDMB 4H9SA
chains in the Genus database with same CATH superfamily
3MNNC 3UTAD 1KX5D 5B31D 5CPIB 3REKB 2AROD 1P34C 3AN2A 5BO0A 1M1AB 1H3OA 4J8VA 1ZLAA 4LD9B 1S32A 1JFIA 3AL0C 3X1UA 3W96D 4AWLB 3KXBA 5CP6D 3LJAD 3REIA 1M19C 3WKJA 3WA9D 4QLCA 2Y2LA 5B24C 3AZLD 3EG5B 3RELC 4KUDA 3H0MC 2F8NK 3C1BC 5AVBA 4J8WB 3UT9D 4G92B 1P3BC 3AZHC 5DNMB 4WU8C 3NQJA 2YFVA 4DRBA 2Y2IA 4R8PD 3AZFB 4WU9C 1P3FC 5B40A 1BH8B 2PYOA 4X23C 4ZUXC 5FUGA 5B1LB 5B0YA 4Z66D 3AYWB 2FJ7C 1M18B 3VH6T 3H0LC 4H9QA 3TU4B 2XD5A 2BYKA 3W97A 4H9PA 5B1MD 3LZ0A 3UTAB 1KX5B 5B31B 1U35D 2AROB 4KGCC 3UTBD 1B6WA 2ZY2A 1AOIA 1TZYC 1BH9B 3KWQC 5B2JA 3W96B 3LJAB 5CP6B 4CSRA 3WA9B 3AFAA 1BFMA 3C1CD 1P3PD 3AZLB 4Z5TA 3MGSD 1P3OA 4WNNA 2XD1A 4WZSB 1P3LA 3UT9B 3TU4D 3AZGA 3AZMC 5CPKA 5AV8A 5JRGD 5GT0C 5B0ZC 3MGRA 4R8PB 3O62C 4EO5C 3VH5A 3LZ1C 3AZMA 3VH6A 4Z66B 4J8XC 3AZND 4JJND 5B1MB 2HUEC 1U35B 2NZDD 3EPLA 1M19A 5B24A 3REJA 3RELA 1KX4C 5B32C 3LELA 3A6NC 3B6FD 3C1CB 1P3PB 5AV9A 3WAAB 5DNND 3MVDD 1P3BA 3REKC 5GXQA 4WU8A 1ULYA 1M1AC 3B6GC 3NQUB 4WU9A 1N1JA 1P3FA 4LD9C 5JRGB 4X23A 2FJ7A 3EPHA 5AVCD 4AWLC 5GSUA 2NQBA 3AZJC 1KX3D 3AV2C 4J8VD 4KGCA 1S32D 4XZQC 5AV5C 3AZNB 4J8WC 4JJNB 4UUZA 3X1UD 1F66C 4G92C 5B2IA 3KXBD 1TZYA 3REID 3WKJD 2NZDB 3AZID 3AZFC 4KHAA 4KUDD 3R45A 5JA4B 5BNVA 5B1LC 2Y2HA 2Y2GA 3AYWC 2F8ND 5B33D 3TU4C 1HQ3A 3A1IA 5DNNB 3MVDB 4WV4B 3UTAC 1Q9CA 1KX5C 5B31C 5GT0A 3V9RB 1W2EA 2YFWB 5B0ZA 3AV1A 2PYOD 1P3ID 2L5AA 2Y2QA 5B0YD 3O62A 3LZ1A 5G49B 4H9NA 5CP6C 5AV6A 3W97D 3WA9C 5GT3C 3WTPC 3REHB 3AZLC 4E45A 4NE3A 3MGQD 5BO0B 1KX3B 1H3OB 4J8VB 1S32B 1AOID 3UT9C 1JFIB 2UWXA 3X1UB 5B2JD 3KXBB 2ZM5A 2HIOA 3WKJB 3AFAD 3AZIB 1KX4A 4Z5TD 1P3OD 3A6NA 1ID3D 4Z66C 1P3AA 3WTPE 3REKA 3AZGD 2RIQA 5AV8D 2F8NB 2RVQD 5B33B 1M1AA 5E5AC 3B6GA 5BT1C 4LD9A 5B1MC 1P3GA 3NQJB 2YFVB 3MGRD 1P3KD 3KFUG 2W8SA 2PYOB 2JSSA 1P3IB 5B0YB 1T3UA 5F99C 3AZJA 4H9QB 3AV2A 2IO5B 3AZED 1EQZC 4ZBJC 2BYKB 3W97B 4XUJA 4XZQA 1TAFA 5AV5A 2J8PA 4J8WA 3C1CC 2BYMB 1F66A 3WAAC 3MGQB 3MGPA 2F8NH 4DRAA 1M19D 1AOIB 3X1SA 4NE5A 3AZFA 5B2JB 3REJD 1PZRA 4WJ3C 3X1VA 5JRGC 3AFAB 3LELD 3W99D 4Z5TB 2CV5D 5AV9D 3AZKD 4WNNB 1P3OB 3B0DC 1ID3B 3KUYC 2LY8A 4CAYA 4YS3D 1HTAA 2JCHA 5GXQD 4WU8D 1P3MC 5B31A 3AZGB 4YM6A 3AZNC 4X23D 4J8UA 3X1TC 4JJNC 3W98D 4DQYB 2Y2JA 5GSUD 1P3KB 3MGRB 2VQRA 2BG1A 3MNNA 1KU5A 4Z2MH 2NQBD 5GT3A 3WTPA 1P34A 4H9RB 3AZEB 3VH5W 2Y2PA 5B2ID 3UTBB 5DNNC 3MVDC 1M19B 5B32G 5AY8C 3REJB 3C1BA 5C3IC 3LELB 3MGSB 3W99B 1HQ3D 2CV5B 5AV9B 3AZKB 4H9SC 5CPIC 3REHC 3AZHA 2Y2KA 5E5AA 5CPJD 3AV1D 4YS3B 5GXQB 4WU8B 1KX3C 4J8VC 1N1JB 4H9OB 4ZUXA 3LZ1D 4X23B 3W98B 5F99A 5GSUB 5AV6D 3WKJC 3EPKA 1EQZA 3AZIC 3AN2D 2NQBB 1ZLAD 3C1CA 3WAAA 5B2IB 3KWQA 5DNMC 2HIOD 4QLCD 5B33C 1KX4D 5JRGA 5AVBD 1P3IC 5B0YC 1P3AD 1M18C 3KUYA 3B6FB 5B31G 1P3MA 1M1AD 2IO5C 3B6GD 1HQ3B 3W97C 4NE6A 1P3GD 2AROC 3B0BA 3X1TA 5B40D 5CPJB 3AV1B 3MGQC 3LZ1B 1AOIC 3W96C 5AVCB 3LJAC 3AZJD 3AV2D 4H9NB 3LZ0D 4J8XA 5AV6B 4XUJD 4XZQD 3AFAC 5AV5D 3AN2B 4Z5TC 4G91B 1P3OC 1F66D 1ZLAB 1ID3C 3MGPD 3B0CW 3X1SD 5BNXA 3REIB 3AZGC 3X1VD 2RVQC 2HIOB 5AY8A 4QLCB 5B32A 3IP4C 3A1KA 4R8PC 4KUDB 1P3KC 5KDMA 1P3LD 1A7WA 5AVBB 1P3AB 5CPIA 3REHA 5CPKD 3EPJA 4YM6D 1KX3A 2G5IC 3AZEC 4J8UD 3B6GB 1P3GB 1U35C 3UTBC 5B40B 3AZMD 5FUGB 3MNND 5GT3D 3WTPD 1P34D 3AZIA 3AZJB 3REJC 4H9PB 3AV2B 3LZ0B 4XUJB 4XZQB 3LELC 1P3PC 1TAFB 5AV5B 3MGSC 3W99C 2CV5C 1F66B 4E44A 5AV9C 3AZKC 2F8NA 3MGPB 5DNMA 5B33A 1Z2CB 5B24D 3FDDA 4YS3C 5GXQC 3X1SB 3RELD 1BH8A 4CSRB 4NFTA 1B67A 5B1LA 5BS7C 3C1BD 3AYWA 3X1VB 1P3IA 1M18A 3W98C 5GSUC 3VH5T 3TU4A 1P3BD 1P3LB 3AZHD 4HGAB 5E5AD 2NQBC 3UTAA 4CAYB 5BT1D 1KX5A 4WU9D 1F1EA 5CPKB 2AROA 1P3FD 5AV8B 1WWIA 2BYMA 4ZUXD 2FJ7D 4YM6B 3MGQA 2ZY5A 4J8UB 2F2AC 5F99D 1BH9A 5B2IC 2NZDC 3W96A 3AZMB 3LJAA 5CP6A 1EQZD 3WA9A 3MNNB 3F6TA 5GT3B 3WTPB 3AZLA 1P34B 4KGCD 2DQNC 3WAAD 1ID3A 3VH6W 1TZYD 3UT9A 3B6FC 3KWQD 1HQ3C 2G5HC 5B24B 5CPJC 3AV1C 4R8PA 3RELB 1P3KA 4Z66A 3KUYD 3C1BB 5AVCC 4UPKA 1P3MD 4H9RA 5AV6C 1P3BB 3AZHB 5GT0D 5B0ZD 5B1MA 3AZEA 5E5AB 3X1TD 1R4VA 3AN2C 4G91C 4WU9B 3O62D 1U35A 1ZLAC 1P3FB 3UTBA 1S32C 4ZUXB 2FJ7B 3X1UC 3KXBC 3REIC 3H0RC 5F99B 4J8XD 2HIOC 4QLCC 1EQZB 4ZBJB 2ZY3A 2FFFB 4KUDC 2CWEA 1P3PA 5CHLB 3MGSA 4KGCB 2F8NG 5AVBC 2CV5A 3W99A 3AZKA 1P3AC 4UUZB 1TZYB 4YS3A 3NQUA 3KWQB 2Y2NA 5AY8D 5B32D 4H9OA 1P3GC 5BS7A 3A6ND 4KHAB 3R45B 5BNVB 5B40C 2PYOC 3W98A 1WWSA 3B0DB 5CPID 3REHD 2Y2OA 3KUYB 3REKD 3B0CT 1P3MB 4LD9D 3LZ0C 3AZNA 2JE5A 3KSYA 4XUJC 4JJNA 5GT0B 5B0ZB 3X1TB 3O62B 4EO5B 2NZDA 3MGPC 2DF4C 4Z2MG 3X1SC 5B2JC 5JA4A 4M6BA 4J8XB 3X1VC 4J8WD 2Y2MA 2HUEB 3B6FA 1P3LC 4HGAC 5DNNA 5DNMD 3MVDA 2ZY4A 3AZFD 5CPKC 3V9RA 5BNXB 2YFWA 5AV8C 5CPJA 5B1LD 4YM6C 3AYWD 1KX4B 5AY8B 4J8UC 5G49A 5B32B 1M18D 3MGRC 3A6NB 5AVCA 5C3IB 5KDMB 3P5JB 4H9SA
chains in the Genus database with same CATH topology
3MNNC 3UTAD 1KX5D 5B31D 5CPIB 3REKB 2AROD 1P34C 3AN2A 5BO0A 1M1AB 1H3OA 4J8VA 1ZLAA 4LD9B 1S32A 1JFIA 3AL0C 3X1UA 3W96D 4AWLB 3KXBA 5CP6D 3LJAD 3REIA 1M19C 3WKJA 3WA9D 4QLCA 2Y2LA 5B24C 3AZLD 3EG5B 3RELC 4KUDA 3H0MC 2F8NK 3C1BC 5AVBA 4J8WB 3UT9D 4G92B 1P3BC 3AZHC 5DNMB 4WU8C 3NQJA 2YFVA 4DRBA 2Y2IA 4R8PD 3AZFB 4WU9C 1P3FC 5B40A 1BH8B 2PYOA 4X23C 4ZUXC 5FUGA 5B1LB 5B0YA 4Z66D 3AYWB 2FJ7C 1M18B 3VH6T 3H0LC 4H9QA 3TU4B 2XD5A 2BYKA 3W97A 4H9PA 5B1MD 3LZ0A 3UTAB 1KX5B 5B31B 1U35D 2AROB 4KGCC 3UTBD 1B6WA 2ZY2A 1AOIA 1TZYC 1BH9B 3KWQC 5B2JA 3W96B 3LJAB 5CP6B 4CSRA 3WA9B 3AFAA 1BFMA 3C1CD 1P3PD 3AZLB 4Z5TA 3MGSD 1P3OA 4WNNA 2XD1A 4WZSB 1P3LA 3UT9B 3TU4D 3AZGA 3AZMC 5CPKA 5AV8A 5JRGD 5GT0C 5B0ZC 3MGRA 4R8PB 3O62C 4EO5C 3VH5A 3LZ1C 3AZMA 3VH6A 4Z66B 4J8XC 3AZND 4JJND 5B1MB 2HUEC 1U35B 2NZDD 3EPLA 1M19A 5B24A 3REJA 3RELA 1KX4C 5B32C 3LELA 3A6NC 3B6FD 3C1CB 1P3PB 5AV9A 3WAAB 5DNND 3MVDD 1P3BA 3REKC 5GXQA 4WU8A 1ULYA 1M1AC 3B6GC 3NQUB 4WU9A 1N1JA 1P3FA 4LD9C 5JRGB 4X23A 2FJ7A 3EPHA 5AVCD 4AWLC 5GSUA 2NQBA 3AZJC 1KX3D 3AV2C 4J8VD 4KGCA 1S32D 4XZQC 5AV5C 3AZNB 4J8WC 4JJNB 4UUZA 3X1UD 1F66C 4G92C 5B2IA 3KXBD 1TZYA 3REID 3WKJD 2NZDB 3AZID 3AZFC 4KHAA 4KUDD 3R45A 5JA4B 5BNVA 5B1LC 2Y2HA 2Y2GA 3AYWC 2F8ND 5B33D 3TU4C 1HQ3A 3A1IA 5DNNB 3MVDB 4WV4B 3UTAC 1Q9CA 1KX5C 5B31C 5GT0A 3V9RB 1W2EA 2YFWB 5B0ZA 3AV1A 2PYOD 1P3ID 2L5AA 2Y2QA 5B0YD 3O62A 3LZ1A 5G49B 4H9NA 5CP6C 5AV6A 3W97D 3WA9C 5GT3C 3WTPC 3REHB 3AZLC 4E45A 4NE3A 3MGQD 5BO0B 1KX3B 1H3OB 4J8VB 1S32B 1AOID 3UT9C 1JFIB 2UWXA 3X1UB 5B2JD 3KXBB 2ZM5A 2HIOA 3WKJB 3AFAD 3AZIB 1KX4A 4Z5TD 1P3OD 3A6NA 1ID3D 4Z66C 1P3AA 3WTPE 3REKA 3AZGD 2RIQA 5AV8D 2F8NB 2RVQD 5B33B 1M1AA 5E5AC 3B6GA 5BT1C 4LD9A 5B1MC 1P3GA 3NQJB 2YFVB 3MGRD 1P3KD 3KFUG 2W8SA 2PYOB 2JSSA 1P3IB 5B0YB 1T3UA 5F99C 3AZJA 4H9QB 3AV2A 2IO5B 3AZED 1EQZC 4ZBJC 2BYKB 3W97B 4XUJA 4XZQA 1TAFA 5AV5A 2J8PA 4J8WA 3C1CC 2BYMB 1F66A 3WAAC 3MGQB 3MGPA 2F8NH 4DRAA 1M19D 1AOIB 3X1SA 4NE5A 3AZFA 5B2JB 3REJD 1PZRA 4WJ3C 3X1VA 5JRGC 3AFAB 3LELD 3W99D 4Z5TB 2CV5D 5AV9D 3AZKD 4WNNB 1P3OB 3B0DC 1ID3B 3KUYC 2LY8A 4CAYA 4YS3D 1HTAA 2JCHA 5GXQD 4WU8D 1P3MC 5B31A 3AZGB 4YM6A 3AZNC 4X23D 4J8UA 3X1TC 4JJNC 3W98D 4DQYB 2Y2JA 5GSUD 1P3KB 3MGRB 2VQRA 2BG1A 3MNNA 1KU5A 4Z2MH 2NQBD 5GT3A 3WTPA 1P34A 4H9RB 3AZEB 3VH5W 2Y2PA 5B2ID 3UTBB 5DNNC 3MVDC 1M19B 5B32G 5AY8C 3REJB 3C1BA 5C3IC 3LELB 3MGSB 3W99B 1HQ3D 2CV5B 5AV9B 3AZKB 4H9SC 5CPIC 3REHC 3AZHA 2Y2KA 5E5AA 5CPJD 3AV1D 4YS3B 5GXQB 4WU8B 1KX3C 4J8VC 1N1JB 4H9OB 4ZUXA 3LZ1D 4X23B 3W98B 5F99A 5GSUB 5AV6D 3WKJC 3EPKA 1EQZA 3AZIC 3AN2D 2NQBB 1ZLAD 3C1CA 3WAAA 5B2IB 3KWQA 5DNMC 2HIOD 4QLCD 5B33C 1KX4D 5JRGA 5AVBD 1P3IC 5B0YC 1P3AD 1M18C 3KUYA 3B6FB 5B31G 1P3MA 1M1AD 2IO5C 3B6GD 1HQ3B 3W97C 4NE6A 1P3GD 2AROC 3B0BA 3X1TA 5B40D 5CPJB 3AV1B 3MGQC 3LZ1B 1AOIC 3W96C 5AVCB 3LJAC 3AZJD 3AV2D 4H9NB 3LZ0D 4J8XA 5AV6B 4XUJD 4XZQD 3AFAC 5AV5D 3AN2B 4Z5TC 4G91B 1P3OC 1F66D 1ZLAB 1ID3C 3MGPD 3B0CW 3X1SD 5BNXA 3REIB 3AZGC 3X1VD 2RVQC 2HIOB 5AY8A 4QLCB 5B32A 3IP4C 3A1KA 4R8PC 4KUDB 1P3KC 5KDMA 1P3LD 1A7WA 5AVBB 1P3AB 5CPIA 3REHA 5CPKD 3EPJA 4YM6D 1KX3A 2G5IC 3AZEC 4J8UD 3B6GB 1P3GB 1U35C 3UTBC 5B40B 3AZMD 5FUGB 3MNND 5GT3D 3WTPD 1P34D 3AZIA 3AZJB 3REJC 4H9PB 3AV2B 3LZ0B 4XUJB 4XZQB 3LELC 1P3PC 1TAFB 5AV5B 3MGSC 3W99C 2CV5C 1F66B 4E44A 5AV9C 3AZKC 2F8NA 3MGPB 5DNMA 5B33A 1Z2CB 5B24D 3FDDA 4YS3C 5GXQC 3X1SB 3RELD 1BH8A 4CSRB 4NFTA 1B67A 5B1LA 5BS7C 3C1BD 3AYWA 3X1VB 1P3IA 1M18A 3W98C 5GSUC 3VH5T 3TU4A 1P3BD 1P3LB 3AZHD 4HGAB 5E5AD 2NQBC 3UTAA 4CAYB 5BT1D 1KX5A 4WU9D 1F1EA 5CPKB 2AROA 1P3FD 5AV8B 1WWIA 2BYMA 4ZUXD 2FJ7D 4YM6B 3MGQA 2ZY5A 4J8UB 2F2AC 5F99D 1BH9A 5B2IC 2NZDC 3W96A 3AZMB 3LJAA 5CP6A 1EQZD 3WA9A 3MNNB 3F6TA 5GT3B 3WTPB 3AZLA 1P34B 4KGCD 2DQNC 3WAAD 1ID3A 3VH6W 1TZYD 3UT9A 3B6FC 3KWQD 1HQ3C 2G5HC 5B24B 5CPJC 3AV1C 4R8PA 3RELB 1P3KA 4Z66A 3KUYD 3C1BB 5AVCC 4UPKA 1P3MD 4H9RA 5AV6C 1P3BB 3AZHB 5GT0D 5B0ZD 5B1MA 3AZEA 5E5AB 3X1TD 1R4VA 3AN2C 4G91C 4WU9B 3O62D 1U35A 1ZLAC 1P3FB 3UTBA 1S32C 4ZUXB 2FJ7B 3X1UC 3KXBC 3REIC 3H0RC 5F99B 4J8XD 2HIOC 4QLCC 1EQZB 4ZBJB 2ZY3A 2FFFB 4KUDC 2CWEA 1P3PA 5CHLB 3MGSA 4KGCB 2F8NG 5AVBC 2CV5A 3W99A 3AZKA 1P3AC 4UUZB 1TZYB 4YS3A 3NQUA 3KWQB 2Y2NA 5AY8D 5B32D 4H9OA 1P3GC 5BS7A 3A6ND 4KHAB 3R45B 5BNVB 5B40C 2PYOC 3W98A 1WWSA 3B0DB 5CPID 3REHD 2Y2OA 3KUYB 3REKD 3B0CT 1P3MB 4LD9D 3LZ0C 3AZNA 2JE5A 3KSYA 4XUJC 4JJNA 5GT0B 5B0ZB 3X1TB 3O62B 4EO5B 2NZDA 3MGPC 2DF4C 4Z2MG 3X1SC 5B2JC 5JA4A 4M6BA 4J8XB 3X1VC 4J8WD 2Y2MA 2HUEB 3B6FA 1P3LC 4HGAC 5DNNA 5DNMD 3MVDA 2ZY4A 3AZFD 5CPKC 3V9RA 5BNXB 2YFWA 5AV8C 5CPJA 5B1LD 4YM6C 3AYWD 1KX4B 5AY8B 4J8UC 5G49A 5B32B 1M18D 3MGRC 3A6NB 5AVCA 5C3IB 5KDMB 3P5JB 4H9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN C;  3UTA D;  1KX5 D;  5B31 D;  5CPI B;  3REK B;  2ARO D;  1P34 C;  3AN2 A;  5BO0 A;  1M1A B;  1H3O A;  4J8V A;  1ZLA A;  4LD9 B;  1S32 A;  1JFI A;  3X1U A;  3W96 D;  4AWL B;  3KXB A;  5CP6 D;  3LJA D;  3REI A;  1M19 C;  3WKJ A;  3WA9 D;  4QLC A;  5B24 C;  3AZL D;  3REL C;  4KUD A;  2F8N K;  3C1B C;  5AVB A;  4J8W B;  3UT9 D;  4G92 B;  1P3B C;  3AZH C;  5DNM B;  4WU8 C;  3NQJ A;  2YFV A;  4DRB A;  4WU9 C;  4R8P D;  3AZF B;  1P3F C;  5B40 A;  1BH8 B;  2PYO A;  4X23 C;  4ZUX C;  5FUG A;  5B1L B;  5B0Y A;  4Z66 D;  3AYW B;  2FJ7 C;  1M18 B;  3VH6 T;  4H9Q A;  3TU4 B;  2BYK A;  3W97 A;  4H9P A;  5B1M D;  3LZ0 A;  3UTA B;  1KX5 B;  5B31 B;  1U35 D;  2ARO B;  4KGC C;  3UTB D;  1B6W A;  1AOI A;  1TZY C;  1BH9 B;  3KWQ C;  5B2J A;  3W96 B;  3LJA B;  5CP6 B;  4CSR A;  3WA9 B;  3AFA A;  1BFM A;  3C1C D;  1P3P D;  3AZL B;  4Z5T A;  3MGS D;  1P3O A;  4WNN A;  4WZS B;  1P3L A;  3UT9 B;  3TU4 D;  3AZG A;  3AZM C;  5CPK A;  5AV8 A;  5JRG D;  5GT0 C;  5B0Z C;  3MGR A;  4R8P B;  3O62 C;  4EO5 C;  3VH5 A;  3LZ1 C;  3AZM A;  3VH6 A;  4Z66 B;  4J8X C;  3AZN D;  4JJN D;  5B1M B;  2HUE C;  1U35 B;  2NZD D;  1M19 A;  5B24 A;  3REJ A;  3REL A;  1KX4 C;  5B32 C;  3LEL A;  3A6N C;  3B6F D;  3C1C B;  1P3P B;  5AV9 A;  3WAA B;  5DNN D;  3MVD D;  1P3B A;  3REK C;  5GXQ A;  4WU8 A;  1ULY A;  1M1A C;  3B6G C;  3NQU B;  4WU9 A;  1N1J A;  1P3F A;  4LD9 C;  5JRG B;  4X23 A;  2FJ7 A;  5AVC D;  4AWL C;  5GSU A;  2NQB A;  3AZJ C;  1KX3 D;  3AV2 C;  4J8V D;  4KGC A;  1S32 D;  4XZQ C;  5AV5 C;  3AZN B;  4J8W C;  4JJN B;  4UUZ A;  3X1U D;  1F66 C;  4G92 C;  5B2I A;  3KXB D;  1TZY A;  3REI D;  3WKJ D;  2NZD B;  3AZI D;  3AZF C;  4KHA A;  4KUD D;  3R45 A;  5JA4 B;  5BNV A;  5B1L C;  3AYW C;  2F8N D;  5B33 D;  3TU4 C;  1HQ3 A;  5DNN B;  3MVD B;  4WV4 B;  3UTA C;  1Q9C A;  1KX5 C;  5B31 C;  5GT0 A;  3V9R B;  5B0Z A;  2YFW B;  3AV1 A;  2PYO D;  1P3I D;  2L5A A;  5B0Y D;  3O62 A;  3LZ1 A;  5G49 B;  4H9N A;  5CP6 C;  5AV6 A;  3W97 D;  3WA9 C;  5GT3 C;  3WTP C;  3REH B;  3AZL C;  4E45 A;  4NE3 A;  3MGQ D;  5BO0 B;  1KX3 B;  1H3O B;  4J8V B;  1S32 B;  1AOI D;  3UT9 C;  1JFI B;  3X1U B;  5B2J D;  3KXB B;  2HIO A;  3WKJ B;  3AFA D;  3AZI B;  1KX4 A;  4Z5T D;  1P3O D;  3A6N A;  1ID3 D;  4Z66 C;  1P3A A;  3WTP E;  3REK A;  3AZG D;  5AV8 D;  2F8N B;  2RVQ D;  5B33 B;  1M1A A;  5E5A C;  3B6G A;  5BT1 C;  4LD9 A;  5B1M C;  1P3G A;  3NQJ B;  2YFV B;  3MGR D;  1P3K D;  2PYO B;  2JSS A;  1P3I B;  5B0Y B;  5F99 C;  3AZJ A;  4H9Q B;  3AV2 A;  2IO5 B;  3AZE D;  1EQZ C;  4ZBJ C;  2BYK B;  3W97 B;  4XUJ A;  4XZQ A;  1TAF A;  5AV5 A;  4J8W A;  3C1C C;  2BYM B;  1F66 A;  3WAA C;  3MGQ B;  3MGP A;  2F8N H;  4DRA A;  1M19 D;  1AOI B;  3X1S A;  4NE5 A;  3AZF A;  5B2J B;  3REJ D;  3X1V A;  5JRG C;  3AFA B;  3LEL D;  3W99 D;  4Z5T B;  2CV5 D;  5AV9 D;  3AZK D;  4WNN B;  1P3O B;  3B0D C;  1ID3 B;  3KUY C;  2LY8 A;  4CAY A;  4YS3 D;  1HTA A;  5GXQ D;  4WU8 D;  1P3M C;  5B31 A;  3AZG B;  4YM6 A;  3AZN C;  4X23 D;  4J8U A;  3X1T C;  4JJN C;  3W98 D;  5GSU D;  1P3K B;  3MGR B;  3MNN A;  1KU5 A;  4Z2M H;  2NQB D;  5GT3 A;  3WTP A;  1P34 A;  4H9R B;  3AZE B;  3VH5 W;  5B2I D;  3UTB B;  5DNN C;  3MVD C;  1M19 B;  5B32 G;  5AY8 C;  3REJ B;  3C1B A;  5C3I C;  3LEL B;  3MGS B;  3W99 B;  1HQ3 D;  2CV5 B;  5AV9 B;  3AZK B;  4H9S C;  5CPI C;  3REH C;  3AZH A;  5E5A A;  5CPJ D;  3AV1 D;  4YS3 B;  5GXQ B;  4WU8 B;  1KX3 C;  4J8V C;  1N1J B;  4H9O B;  4ZUX A;  3LZ1 D;  4X23 B;  3W98 B;  5F99 A;  5GSU B;  5AV6 D;  3WKJ C;  1EQZ A;  3AZI C;  3AN2 D;  2NQB B;  1ZLA D;  3C1C A;  3WAA A;  5B2I B;  3KWQ A;  5DNM C;  2HIO D;  4QLC D;  5B33 C;  1KX4 D;  5JRG A;  5AVB D;  1P3I C;  5B0Y C;  1P3A D;  1M18 C;  3KUY A;  3B6F B;  5B31 G;  1P3M A;  1M1A D;  2IO5 C;  3B6G D;  1HQ3 B;  3W97 C;  4NE6 A;  1P3G D;  2ARO C;  3B0B A;  3X1T A;  5B40 D;  5CPJ B;  3AV1 B;  3MGQ C;  3LZ1 B;  1AOI C;  3W96 C;  5AVC B;  3LJA C;  3AZJ D;  3AV2 D;  4H9N B;  3LZ0 D;  4J8X A;  5AV6 B;  4XUJ D;  4XZQ D;  3AFA C;  5AV5 D;  3AN2 B;  4Z5T C;  4G91 B;  1P3O C;  1F66 D;  1ZLA B;  1ID3 C;  3MGP D;  3B0C W;  3X1S D;  5BNX A;  3REI B;  3AZG C;  3X1V D;  2RVQ C;  2HIO B;  5AY8 A;  4QLC B;  5B32 A;  4R8P C;  4KUD B;  1P3K C;  5KDM A;  1P3L D;  1A7W A;  5AVB B;  1P3A B;  5CPI A;  3REH A;  5CPK D;  4YM6 D;  1KX3 A;  3B6G B;  3AZE C;  4J8U D;  1P3G B;  1U35 C;  3UTB C;  5B40 B;  3AZM D;  5FUG B;  3MNN D;  5GT3 D;  3WTP D;  1P34 D;  3AZI A;  3AZJ B;  3REJ C;  4H9P B;  3AV2 B;  3LZ0 B;  4XUJ B;  4XZQ B;  3LEL C;  1P3P C;  1TAF B;  5AV5 B;  3MGS C;  3W99 C;  2CV5 C;  1F66 B;  4E44 A;  5AV9 C;  3AZK C;  2F8N A;  3MGP B;  5DNM A;  5B33 A;  5B24 D;  4YS3 C;  5GXQ C;  3X1S B;  3REL D;  1BH8 A;  4CSR B;  4NFT A;  1B67 A;  5B1L A;  5BS7 C;  3C1B D;  3AYW A;  3X1V B;  1P3I A;  1M18 A;  3W98 C;  5GSU C;  3VH5 T;  3TU4 A;  1P3B D;  1P3L B;  3AZH D;  4HGA B;  5E5A D;  2NQB C;  3UTA A;  4CAY B;  5BT1 D;  1KX5 A;  4WU9 D;  1F1E A;  5CPK B;  2ARO A;  1P3F D;  5AV8 B;  1WWI A;  2BYM A;  4ZUX D;  2FJ7 D;  4YM6 B;  3MGQ A;  4J8U B;  5F99 D;  1BH9 A;  5B2I C;  2NZD C;  3W96 A;  3AZM B;  3LJA A;  5CP6 A;  1EQZ D;  3WA9 A;  3MNN B;  5GT3 B;  3WTP B;  3AZL A;  1P34 B;  4KGC D;  3WAA D;  1ID3 A;  3VH6 W;  1TZY D;  3UT9 A;  3B6F C;  3KWQ D;  1HQ3 C;  5B24 B;  5CPJ C;  3AV1 C;  4R8P A;  3REL B;  1P3K A;  4Z66 A;  3KUY D;  3C1B B;  5AVC C;  1P3M D;  4H9R A;  5AV6 C;  1P3B B;  3AZH B;  5GT0 D;  5B0Z D;  5B1M A;  3AZE A;  5E5A B;  3X1T D;  1R4V A;  3AN2 C;  4G91 C;  4WU9 B;  3O62 D;  1U35 A;  1ZLA C;  1P3F B;  3UTB A;  1S32 C;  4ZUX B;  2FJ7 B;  3X1U C;  3KXB C;  3REI C;  5F99 B;  4J8X D;  2HIO C;  4QLC C;  1EQZ B;  4ZBJ B;  4KUD C;  2CWE A;  1P3P A;  5CHL B;  3MGS A;  4KGC B;  2F8N G;  5AVB C;  2CV5 A;  3W99 A;  3AZK A;  1P3A C;  4UUZ B;  1TZY B;  4YS3 A;  3NQU A;  3KWQ B;  5AY8 D;  5B32 D;  4H9O A;  1P3G C;  5BS7 A;  3A6N D;  4KHA B;  3R45 B;  5BNV B;  5B40 C;  2PYO C;  3W98 A;  1WWS A;  3B0D B;  5CPI D;  3REH D;  3REK D;  3KUY B;  3B0C T;  1P3M B;  4LD9 D;  3LZ0 C;  3AZN A;  3KSY A;  4XUJ C;  4JJN A;  5GT0 B;  5B0Z B;  3X1T B;  3O62 B;  4EO5 B;  2NZD A;  3MGP C;  4Z2M G;  3X1S C;  5B2J C;  5JA4 A;  4M6B A;  4J8X B;  3X1V C;  4J8W D;  2HUE B;  3B6F A;  1P3L C;  4HGA C;  5DNN A;  5DNM D;  3MVD A;  3AZF D;  5CPK C;  3V9R A;  5BNX B;  2YFW A;  5AV8 C;  5CPJ A;  5B1L D;  4YM6 C;  3AYW D;  1KX4 B;  5AY8 B;  4J8U C;  5G49 A;  5B32 B;  1M18 D;  3MGR C;  3A6N B;  5AVC A;  5C3I B;  5KDM B;  4H9S A; 
#chains in the Genus database with same CATH topology
 3MNN C;  3UTA D;  1KX5 D;  5B31 D;  5CPI B;  3REK B;  2ARO D;  1P34 C;  3AN2 A;  5BO0 A;  1M1A B;  1H3O A;  4J8V A;  1ZLA A;  4LD9 B;  1S32 A;  1JFI A;  3AL0 C;  3X1U A;  3W96 D;  4AWL B;  3KXB A;  5CP6 D;  3LJA D;  3REI A;  1M19 C;  3WKJ A;  3WA9 D;  4QLC A;  2Y2L A;  5B24 C;  3AZL D;  3EG5 B;  3REL C;  4KUD A;  3H0M C;  2F8N K;  3C1B C;  5AVB A;  4J8W B;  3UT9 D;  4G92 B;  1P3B C;  3AZH C;  5DNM B;  4WU8 C;  3NQJ A;  2YFV A;  4DRB A;  2Y2I A;  4R8P D;  3AZF B;  4WU9 C;  1P3F C;  5B40 A;  1BH8 B;  2PYO A;  4X23 C;  4ZUX C;  5FUG A;  5B1L B;  5B0Y A;  4Z66 D;  3AYW B;  2FJ7 C;  1M18 B;  3VH6 T;  3H0L C;  4H9Q A;  3TU4 B;  2XD5 A;  2BYK A;  3W97 A;  4H9P A;  5B1M D;  3LZ0 A;  3UTA B;  1KX5 B;  5B31 B;  1U35 D;  2ARO B;  4KGC C;  3UTB D;  1B6W A;  2ZY2 A;  1AOI A;  1TZY C;  1BH9 B;  3KWQ C;  5B2J A;  3W96 B;  3LJA B;  5CP6 B;  4CSR A;  3WA9 B;  3AFA A;  1BFM A;  3C1C D;  1P3P D;  3AZL B;  4Z5T A;  3MGS D;  1P3O A;  4WNN A;  2XD1 A;  4WZS B;  1P3L A;  3UT9 B;  3TU4 D;  3AZG A;  3AZM C;  5CPK A;  5AV8 A;  5JRG D;  5GT0 C;  5B0Z C;  3MGR A;  4R8P B;  3O62 C;  4EO5 C;  3VH5 A;  3LZ1 C;  3AZM A;  3VH6 A;  4Z66 B;  4J8X C;  3AZN D;  4JJN D;  5B1M B;  2HUE C;  1U35 B;  2NZD D;  3EPL A;  1M19 A;  5B24 A;  3REJ A;  3REL A;  1KX4 C;  5B32 C;  3LEL A;  3A6N C;  3B6F D;  3C1C B;  1P3P B;  5AV9 A;  3WAA B;  5DNN D;  3MVD D;  1P3B A;  3REK C;  5GXQ A;  4WU8 A;  1ULY A;  1M1A C;  3B6G C;  3NQU B;  4WU9 A;  1N1J A;  1P3F A;  4LD9 C;  5JRG B;  4X23 A;  2FJ7 A;  3EPH A;  5AVC D;  4AWL C;  5GSU A;  2NQB A;  3AZJ C;  1KX3 D;  3AV2 C;  4J8V D;  4KGC A;  1S32 D;  4XZQ C;  5AV5 C;  3AZN B;  4J8W C;  4JJN B;  4UUZ A;  3X1U D;  1F66 C;  4G92 C;  5B2I A;  3KXB D;  1TZY A;  3REI D;  3WKJ D;  2NZD B;  3AZI D;  3AZF C;  4KHA A;  4KUD D;  3R45 A;  5JA4 B;  5BNV A;  5B1L C;  2Y2H A;  2Y2G A;  3AYW C;  2F8N D;  5B33 D;  3TU4 C;  1HQ3 A;  3A1I A;  5DNN B;  3MVD B;  4WV4 B;  3UTA C;  1Q9C A;  1KX5 C;  5B31 C;  5GT0 A;  3V9R B;  1W2E A;  2YFW B;  5B0Z A;  3AV1 A;  2PYO D;  1P3I D;  2L5A A;  2Y2Q A;  5B0Y D;  3O62 A;  3LZ1 A;  5G49 B;  4H9N A;  5CP6 C;  5AV6 A;  3W97 D;  3WA9 C;  5GT3 C;  3WTP C;  3REH B;  3AZL C;  4E45 A;  4NE3 A;  3MGQ D;  5BO0 B;  1KX3 B;  1H3O B;  4J8V B;  1S32 B;  1AOI D;  3UT9 C;  1JFI B;  2UWX A;  3X1U B;  5B2J D;  3KXB B;  2ZM5 A;  2HIO A;  3WKJ B;  3AFA D;  3AZI B;  1KX4 A;  4Z5T D;  1P3O D;  3A6N A;  1ID3 D;  4Z66 C;  1P3A A;  3WTP E;  3REK A;  3AZG D;  2RIQ A;  5AV8 D;  2F8N B;  2RVQ D;  5B33 B;  1M1A A;  5E5A C;  3B6G A;  5BT1 C;  4LD9 A;  5B1M C;  1P3G A;  3NQJ B;  2YFV B;  3MGR D;  1P3K D;  3KFU G;  2W8S A;  2PYO B;  2JSS A;  1P3I B;  5B0Y B;  1T3U A;  5F99 C;  3AZJ A;  4H9Q B;  3AV2 A;  2IO5 B;  3AZE D;  1EQZ C;  4ZBJ C;  2BYK B;  3W97 B;  4XUJ A;  4XZQ A;  1TAF A;  5AV5 A;  2J8P A;  4J8W A;  3C1C C;  2BYM B;  1F66 A;  3WAA C;  3MGQ B;  3MGP A;  2F8N H;  4DRA A;  1M19 D;  1AOI B;  3X1S A;  4NE5 A;  3AZF A;  5B2J B;  3REJ D;  1PZR A;  4WJ3 C;  3X1V A;  5JRG C;  3AFA B;  3LEL D;  3W99 D;  4Z5T B;  2CV5 D;  5AV9 D;  3AZK D;  4WNN B;  1P3O B;  3B0D C;  1ID3 B;  3KUY C;  2LY8 A;  4CAY A;  4YS3 D;  1HTA A;  2JCH A;  5GXQ D;  4WU8 D;  1P3M C;  5B31 A;  3AZG B;  4YM6 A;  3AZN C;  4X23 D;  4J8U A;  3X1T C;  4JJN C;  3W98 D;  4DQY B;  2Y2J A;  5GSU D;  1P3K B;  3MGR B;  2VQR A;  2BG1 A;  3MNN A;  1KU5 A;  4Z2M H;  2NQB D;  5GT3 A;  3WTP A;  1P34 A;  4H9R B;  3AZE B;  3VH5 W;  2Y2P A;  5B2I D;  3UTB B;  5DNN C;  3MVD C;  1M19 B;  5B32 G;  5AY8 C;  3REJ B;  3C1B A;  5C3I C;  3LEL B;  3MGS B;  3W99 B;  1HQ3 D;  2CV5 B;  5AV9 B;  3AZK B;  4H9S C;  5CPI C;  3REH C;  3AZH A;  2Y2K A;  5E5A A;  5CPJ D;  3AV1 D;  4YS3 B;  5GXQ B;  4WU8 B;  1KX3 C;  4J8V C;  1N1J B;  4H9O B;  4ZUX A;  3LZ1 D;  4X23 B;  3W98 B;  5F99 A;  5GSU B;  5AV6 D;  3WKJ C;  3EPK A;  1EQZ A;  3AZI C;  3AN2 D;  2NQB B;  1ZLA D;  3C1C A;  3WAA A;  5B2I B;  3KWQ A;  5DNM C;  2HIO D;  4QLC D;  5B33 C;  1KX4 D;  5JRG A;  5AVB D;  1P3I C;  5B0Y C;  1P3A D;  1M18 C;  3KUY A;  3B6F B;  5B31 G;  1P3M A;  1M1A D;  2IO5 C;  3B6G D;  1HQ3 B;  3W97 C;  4NE6 A;  1P3G D;  2ARO C;  3B0B A;  3X1T A;  5B40 D;  5CPJ B;  3AV1 B;  3MGQ C;  3LZ1 B;  1AOI C;  3W96 C;  5AVC B;  3LJA C;  3AZJ D;  3AV2 D;  4H9N B;  3LZ0 D;  4J8X A;  5AV6 B;  4XUJ D;  4XZQ D;  3AFA C;  5AV5 D;  3AN2 B;  4Z5T C;  4G91 B;  1P3O C;  1F66 D;  1ZLA B;  1ID3 C;  3MGP D;  3B0C W;  3X1S D;  5BNX A;  3REI B;  3AZG C;  3X1V D;  2RVQ C;  2HIO B;  5AY8 A;  4QLC B;  5B32 A;  3IP4 C;  3A1K A;  4R8P C;  4KUD B;  1P3K C;  5KDM A;  1P3L D;  1A7W A;  5AVB B;  1P3A B;  5CPI A;  3REH A;  5CPK D;  3EPJ A;  4YM6 D;  1KX3 A;  2G5I C;  3AZE C;  4J8U D;  3B6G B;  1P3G B;  1U35 C;  3UTB C;  5B40 B;  3AZM D;  5FUG B;  3MNN D;  5GT3 D;  3WTP D;  1P34 D;  3AZI A;  3AZJ B;  3REJ C;  4H9P B;  3AV2 B;  3LZ0 B;  4XUJ B;  4XZQ B;  3LEL C;  1P3P C;  1TAF B;  5AV5 B;  3MGS C;  3W99 C;  2CV5 C;  1F66 B;  4E44 A;  5AV9 C;  3AZK C;  2F8N A;  3MGP B;  5DNM A;  5B33 A;  1Z2C B;  5B24 D;  3FDD A;  4YS3 C;  5GXQ C;  3X1S B;  3REL D;  1BH8 A;  4CSR B;  4NFT A;  1B67 A;  5B1L A;  5BS7 C;  3C1B D;  3AYW A;  3X1V B;  1P3I A;  1M18 A;  3W98 C;  5GSU C;  3VH5 T;  3TU4 A;  1P3B D;  1P3L B;  3AZH D;  4HGA B;  5E5A D;  2NQB C;  3UTA A;  4CAY B;  5BT1 D;  1KX5 A;  4WU9 D;  1F1E A;  5CPK B;  2ARO A;  1P3F D;  5AV8 B;  1WWI A;  2BYM A;  4ZUX D;  2FJ7 D;  4YM6 B;  3MGQ A;  2ZY5 A;  4J8U B;  2F2A C;  5F99 D;  1BH9 A;  5B2I C;  2NZD C;  3W96 A;  3AZM B;  3LJA A;  5CP6 A;  1EQZ D;  3WA9 A;  3MNN B;  3F6T A;  5GT3 B;  3WTP B;  3AZL A;  1P34 B;  4KGC D;  2DQN C;  3WAA D;  1ID3 A;  3VH6 W;  1TZY D;  3UT9 A;  3B6F C;  3KWQ D;  1HQ3 C;  2G5H C;  5B24 B;  5CPJ C;  3AV1 C;  4R8P A;  3REL B;  1P3K A;  4Z66 A;  3KUY D;  3C1B B;  5AVC C;  4UPK A;  1P3M D;  4H9R A;  5AV6 C;  1P3B B;  3AZH B;  5GT0 D;  5B0Z D;  5B1M A;  3AZE A;  5E5A B;  3X1T D;  1R4V A;  3AN2 C;  4G91 C;  4WU9 B;  3O62 D;  1U35 A;  1ZLA C;  1P3F B;  3UTB A;  1S32 C;  4ZUX B;  2FJ7 B;  3X1U C;  3KXB C;  3REI C;  3H0R C;  5F99 B;  4J8X D;  2HIO C;  4QLC C;  1EQZ B;  4ZBJ B;  2ZY3 A;  2FFF B;  4KUD C;  2CWE A;  1P3P A;  5CHL B;  3MGS A;  4KGC B;  2F8N G;  5AVB C;  2CV5 A;  3W99 A;  3AZK A;  1P3A C;  4UUZ B;  1TZY B;  4YS3 A;  3NQU A;  3KWQ B;  2Y2N A;  5AY8 D;  5B32 D;  4H9O A;  1P3G C;  5BS7 A;  3A6N D;  4KHA B;  3R45 B;  5BNV B;  5B40 C;  2PYO C;  3W98 A;  1WWS A;  3B0D B;  5CPI D;  3REH D;  2Y2O A;  3KUY B;  3REK D;  3B0C T;  1P3M B;  4LD9 D;  3LZ0 C;  3AZN A;  2JE5 A;  3KSY A;  4XUJ C;  4JJN A;  5GT0 B;  5B0Z B;  3X1T B;  3O62 B;  4EO5 B;  2NZD A;  3MGP C;  2DF4 C;  4Z2M G;  3X1S C;  5B2J C;  5JA4 A;  4M6B A;  4J8X B;  3X1V C;  4J8W D;  2Y2M A;  2HUE B;  3B6F A;  1P3L C;  4HGA C;  5DNN A;  5DNM D;  3MVD A;  2ZY4 A;  3AZF D;  5CPK C;  3V9R A;  5BNX B;  2YFW A;  5AV8 C;  5CPJ A;  5B1L D;  4YM6 C;  3AYW D;  1KX4 B;  5AY8 B;  4J8U C;  5G49 A;  5B32 B;  1M18 D;  3MGR C;  3A6N B;  5AVC A;  5C3I B;  5KDM B;  3P5J B;  4H9S A; 
#chains in the Genus database with same CATH homology
 3MNN C;  3UTA D;  1KX5 D;  5B31 D;  5CPI B;  3REK B;  2ARO D;  1P34 C;  3AN2 A;  5BO0 A;  1M1A B;  1H3O A;  4J8V A;  1ZLA A;  4LD9 B;  1S32 A;  1JFI A;  3AL0 C;  3X1U A;  3W96 D;  4AWL B;  3KXB A;  5CP6 D;  3LJA D;  3REI A;  1M19 C;  3WKJ A;  3WA9 D;  4QLC A;  2Y2L A;  5B24 C;  3AZL D;  3EG5 B;  3REL C;  4KUD A;  3H0M C;  2F8N K;  3C1B C;  5AVB A;  4J8W B;  3UT9 D;  4G92 B;  1P3B C;  3AZH C;  5DNM B;  4WU8 C;  3NQJ A;  2YFV A;  4DRB A;  2Y2I A;  4R8P D;  3AZF B;  4WU9 C;  1P3F C;  5B40 A;  1BH8 B;  2PYO A;  4X23 C;  4ZUX C;  5FUG A;  5B1L B;  5B0Y A;  4Z66 D;  3AYW B;  2FJ7 C;  1M18 B;  3VH6 T;  3H0L C;  4H9Q A;  3TU4 B;  2XD5 A;  2BYK A;  3W97 A;  4H9P A;  5B1M D;  3LZ0 A;  3UTA B;  1KX5 B;  5B31 B;  1U35 D;  2ARO B;  4KGC C;  3UTB D;  1B6W A;  2ZY2 A;  1AOI A;  1TZY C;  1BH9 B;  3KWQ C;  5B2J A;  3W96 B;  3LJA B;  5CP6 B;  4CSR A;  3WA9 B;  3AFA A;  1BFM A;  3C1C D;  1P3P D;  3AZL B;  4Z5T A;  3MGS D;  1P3O A;  4WNN A;  2XD1 A;  4WZS B;  1P3L A;  3UT9 B;  3TU4 D;  3AZG A;  3AZM C;  5CPK A;  5AV8 A;  5JRG D;  5GT0 C;  5B0Z C;  3MGR A;  4R8P B;  3O62 C;  4EO5 C;  3VH5 A;  3LZ1 C;  3AZM A;  3VH6 A;  4Z66 B;  4J8X C;  3AZN D;  4JJN D;  5B1M B;  2HUE C;  1U35 B;  2NZD D;  3EPL A;  1M19 A;  5B24 A;  3REJ A;  3REL A;  1KX4 C;  5B32 C;  3LEL A;  3A6N C;  3B6F D;  3C1C B;  1P3P B;  5AV9 A;  3WAA B;  5DNN D;  3MVD D;  1P3B A;  3REK C;  5GXQ A;  4WU8 A;  1ULY A;  1M1A C;  3B6G C;  3NQU B;  4WU9 A;  1N1J A;  1P3F A;  4LD9 C;  5JRG B;  4X23 A;  2FJ7 A;  3EPH A;  5AVC D;  4AWL C;  5GSU A;  2NQB A;  3AZJ C;  1KX3 D;  3AV2 C;  4J8V D;  4KGC A;  1S32 D;  4XZQ C;  5AV5 C;  3AZN B;  4J8W C;  4JJN B;  4UUZ A;  3X1U D;  1F66 C;  4G92 C;  5B2I A;  3KXB D;  1TZY A;  3REI D;  3WKJ D;  2NZD B;  3AZI D;  3AZF C;  4KHA A;  4KUD D;  3R45 A;  5JA4 B;  5BNV A;  5B1L C;  2Y2H A;  2Y2G A;  3AYW C;  2F8N D;  5B33 D;  3TU4 C;  1HQ3 A;  3A1I A;  5DNN B;  3MVD B;  4WV4 B;  3UTA C;  1Q9C A;  1KX5 C;  5B31 C;  5GT0 A;  3V9R B;  1W2E A;  2YFW B;  5B0Z A;  3AV1 A;  2PYO D;  1P3I D;  2L5A A;  2Y2Q A;  5B0Y D;  3O62 A;  3LZ1 A;  5G49 B;  4H9N A;  5CP6 C;  5AV6 A;  3W97 D;  3WA9 C;  5GT3 C;  3WTP C;  3REH B;  3AZL C;  4E45 A;  4NE3 A;  3MGQ D;  5BO0 B;  1KX3 B;  1H3O B;  4J8V B;  1S32 B;  1AOI D;  3UT9 C;  1JFI B;  2UWX A;  3X1U B;  5B2J D;  3KXB B;  2ZM5 A;  2HIO A;  3WKJ B;  3AFA D;  3AZI B;  1KX4 A;  4Z5T D;  1P3O D;  3A6N A;  1ID3 D;  4Z66 C;  1P3A A;  3WTP E;  3REK A;  3AZG D;  2RIQ A;  5AV8 D;  2F8N B;  2RVQ D;  5B33 B;  1M1A A;  5E5A C;  3B6G A;  5BT1 C;  4LD9 A;  5B1M C;  1P3G A;  3NQJ B;  2YFV B;  3MGR D;  1P3K D;  3KFU G;  2W8S A;  2PYO B;  2JSS A;  1P3I B;  5B0Y B;  1T3U A;  5F99 C;  3AZJ A;  4H9Q B;  3AV2 A;  2IO5 B;  3AZE D;  1EQZ C;  4ZBJ C;  2BYK B;  3W97 B;  4XUJ A;  4XZQ A;  1TAF A;  5AV5 A;  2J8P A;  4J8W A;  3C1C C;  2BYM B;  1F66 A;  3WAA C;  3MGQ B;  3MGP A;  2F8N H;  4DRA A;  1M19 D;  1AOI B;  3X1S A;  4NE5 A;  3AZF A;  5B2J B;  3REJ D;  1PZR A;  4WJ3 C;  3X1V A;  5JRG C;  3AFA B;  3LEL D;  3W99 D;  4Z5T B;  2CV5 D;  5AV9 D;  3AZK D;  4WNN B;  1P3O B;  3B0D C;  1ID3 B;  3KUY C;  2LY8 A;  4CAY A;  4YS3 D;  1HTA A;  2JCH A;  5GXQ D;  4WU8 D;  1P3M C;  5B31 A;  3AZG B;  4YM6 A;  3AZN C;  4X23 D;  4J8U A;  3X1T C;  4JJN C;  3W98 D;  4DQY B;  2Y2J A;  5GSU D;  1P3K B;  3MGR B;  2VQR A;  2BG1 A;  3MNN A;  1KU5 A;  4Z2M H;  2NQB D;  5GT3 A;  3WTP A;  1P34 A;  4H9R B;  3AZE B;  3VH5 W;  2Y2P A;  5B2I D;  3UTB B;  5DNN C;  3MVD C;  1M19 B;  5B32 G;  5AY8 C;  3REJ B;  3C1B A;  5C3I C;  3LEL B;  3MGS B;  3W99 B;  1HQ3 D;  2CV5 B;  5AV9 B;  3AZK B;  4H9S C;  5CPI C;  3REH C;  3AZH A;  2Y2K A;  5E5A A;  5CPJ D;  3AV1 D;  4YS3 B;  5GXQ B;  4WU8 B;  1KX3 C;  4J8V C;  1N1J B;  4H9O B;  4ZUX A;  3LZ1 D;  4X23 B;  3W98 B;  5F99 A;  5GSU B;  5AV6 D;  3WKJ C;  3EPK A;  1EQZ A;  3AZI C;  3AN2 D;  2NQB B;  1ZLA D;  3C1C A;  3WAA A;  5B2I B;  3KWQ A;  5DNM C;  2HIO D;  4QLC D;  5B33 C;  1KX4 D;  5JRG A;  5AVB D;  1P3I C;  5B0Y C;  1P3A D;  1M18 C;  3KUY A;  3B6F B;  5B31 G;  1P3M A;  1M1A D;  2IO5 C;  3B6G D;  1HQ3 B;  3W97 C;  4NE6 A;  1P3G D;  2ARO C;  3B0B A;  3X1T A;  5B40 D;  5CPJ B;  3AV1 B;  3MGQ C;  3LZ1 B;  1AOI C;  3W96 C;  5AVC B;  3LJA C;  3AZJ D;  3AV2 D;  4H9N B;  3LZ0 D;  4J8X A;  5AV6 B;  4XUJ D;  4XZQ D;  3AFA C;  5AV5 D;  3AN2 B;  4Z5T C;  4G91 B;  1P3O C;  1F66 D;  1ZLA B;  1ID3 C;  3MGP D;  3B0C W;  3X1S D;  5BNX A;  3REI B;  3AZG C;  3X1V D;  2RVQ C;  2HIO B;  5AY8 A;  4QLC B;  5B32 A;  3IP4 C;  3A1K A;  4R8P C;  4KUD B;  1P3K C;  5KDM A;  1P3L D;  1A7W A;  5AVB B;  1P3A B;  5CPI A;  3REH A;  5CPK D;  3EPJ A;  4YM6 D;  1KX3 A;  2G5I C;  3AZE C;  4J8U D;  3B6G B;  1P3G B;  1U35 C;  3UTB C;  5B40 B;  3AZM D;  5FUG B;  3MNN D;  5GT3 D;  3WTP D;  1P34 D;  3AZI A;  3AZJ B;  3REJ C;  4H9P B;  3AV2 B;  3LZ0 B;  4XUJ B;  4XZQ B;  3LEL C;  1P3P C;  1TAF B;  5AV5 B;  3MGS C;  3W99 C;  2CV5 C;  1F66 B;  4E44 A;  5AV9 C;  3AZK C;  2F8N A;  3MGP B;  5DNM A;  5B33 A;  1Z2C B;  5B24 D;  3FDD A;  4YS3 C;  5GXQ C;  3X1S B;  3REL D;  1BH8 A;  4CSR B;  4NFT A;  1B67 A;  5B1L A;  5BS7 C;  3C1B D;  3AYW A;  3X1V B;  1P3I A;  1M18 A;  3W98 C;  5GSU C;  3VH5 T;  3TU4 A;  1P3B D;  1P3L B;  3AZH D;  4HGA B;  5E5A D;  2NQB C;  3UTA A;  4CAY B;  5BT1 D;  1KX5 A;  4WU9 D;  1F1E A;  5CPK B;  2ARO A;  1P3F D;  5AV8 B;  1WWI A;  2BYM A;  4ZUX D;  2FJ7 D;  4YM6 B;  3MGQ A;  2ZY5 A;  4J8U B;  2F2A C;  5F99 D;  1BH9 A;  5B2I C;  2NZD C;  3W96 A;  3AZM B;  3LJA A;  5CP6 A;  1EQZ D;  3WA9 A;  3MNN B;  3F6T A;  5GT3 B;  3WTP B;  3AZL A;  1P34 B;  4KGC D;  2DQN C;  3WAA D;  1ID3 A;  3VH6 W;  1TZY D;  3UT9 A;  3B6F C;  3KWQ D;  1HQ3 C;  2G5H C;  5B24 B;  5CPJ C;  3AV1 C;  4R8P A;  3REL B;  1P3K A;  4Z66 A;  3KUY D;  3C1B B;  5AVC C;  4UPK A;  1P3M D;  4H9R A;  5AV6 C;  1P3B B;  3AZH B;  5GT0 D;  5B0Z D;  5B1M A;  3AZE A;  5E5A B;  3X1T D;  1R4V A;  3AN2 C;  4G91 C;  4WU9 B;  3O62 D;  1U35 A;  1ZLA C;  1P3F B;  3UTB A;  1S32 C;  4ZUX B;  2FJ7 B;  3X1U C;  3KXB C;  3REI C;  3H0R C;  5F99 B;  4J8X D;  2HIO C;  4QLC C;  1EQZ B;  4ZBJ B;  2ZY3 A;  2FFF B;  4KUD C;  2CWE A;  1P3P A;  5CHL B;  3MGS A;  4KGC B;  2F8N G;  5AVB C;  2CV5 A;  3W99 A;  3AZK A;  1P3A C;  4UUZ B;  1TZY B;  4YS3 A;  3NQU A;  3KWQ B;  2Y2N A;  5AY8 D;  5B32 D;  4H9O A;  1P3G C;  5BS7 A;  3A6N D;  4KHA B;  3R45 B;  5BNV B;  5B40 C;  2PYO C;  3W98 A;  1WWS A;  3B0D B;  5CPI D;  3REH D;  2Y2O A;  3KUY B;  3REK D;  3B0C T;  1P3M B;  4LD9 D;  3LZ0 C;  3AZN A;  2JE5 A;  3KSY A;  4XUJ C;  4JJN A;  5GT0 B;  5B0Z B;  3X1T B;  3O62 B;  4EO5 B;  2NZD A;  3MGP C;  2DF4 C;  4Z2M G;  3X1S C;  5B2J C;  5JA4 A;  4M6B A;  4J8X B;  3X1V C;  4J8W D;  2Y2M A;  2HUE B;  3B6F A;  1P3L C;  4HGA C;  5DNN A;  5DNM D;  3MVD A;  2ZY4 A;  3AZF D;  5CPK C;  3V9R A;  5BNX B;  2YFW A;  5AV8 C;  5CPJ A;  5B1L D;  4YM6 C;  3AYW D;  1KX4 B;  5AY8 B;  4J8U C;  5G49 A;  5B32 B;  1M18 D;  3MGR C;  3A6N B;  5AVC A;  5C3I B;  5KDM B;  3P5J B;  4H9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...