1AOIB

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 27
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiB00
5CPKD 3LJAD 1KX4C 2PYOA 5B31C 1KX4D 3C1BC 1M1AC 3AYWD 3REKD 3REIA 3AN2B 3B0BA 1ID3A 5B31D 3C1BD 1M1AD 4H9SA 2HIOB 5CPIB 4AWLB 3REJC 2IO5C 3RELC 3MGQA 1P3GB 2YFVB 1BH8A 5AV5C 1KX5B 3AV1D 4ZUXB 3RELD 2NZDC 3VH5W 1S32D 4XUJC 5AV5D 5F99C 1P3FB 5AVBA 2NZDD 4X23A 4J8UA 1BH9A 1M18B 5BS7C 5GSUC 4J8VC 5CP6B 3TU4B 1P3KB 3O62A 3W97A 2AROC 4G92C 3NQJA 3X1VD 2FJ7A 4J8VD 4WU9A 3R45B 5AV9A 2BYMA 3W98B 2AROD 5B33A 3AZHD 3WKJB 5B2JB 3REHB 5BNVB 5AVCB 2CV5A 4R8PC 3LZ1B 4DRAA 3C1CB 4UUZB 4NE6A 3B6FA 4H9RA 3MGPA 4KHAB 3UTAB 4NE5A 5B32A 4R8PD 4H9SC 3AV2B 4YM6A 1P3PA 5GXQB 1AOIA 5B32G 3B0DB 3X1UD 1TZYB 1HQ3C 5B24B 1U35B 1EQZB 5DNMB 3UTBB 5CPJB 1HQ3D 4KUDB 3KSYA 4JJNB 4J8XB 3KXBA 3VH5A 5AVBC 1P3ID 5C3IB 4X23C 4J8UC 5BT1C 1F66C 4LD9D 1ZLAA 4Z5TD 4Z2MG 3KWQD 3O62C 1P34A 3W97C 3MGRA 5AY8D 3AZNA 5KDMB 1F66D 4CAYB 3O62D 4J8WA 5AV9C 3VH5T 5G49B 5B33C 2F8NG 5CPKA 5GT0B 3LJAA 2CV5C 4WNNA 5B33D 1P3OB 3B6FC 1KX4A 2HUEC 5B0YB 2CV5D 5B32C 3UT9B 3REKA 5B31A 5B1LD 3C1BA 3AZEB 3AFAB 5B1MB 1AOIC 3AN2C 5B31G 3AZJA 4HGAC 3V9RA 1AOID 3W96B 5AV6B 3AN2D 3REIB 3AV1A 3RELA 5JRGB 5GT3B 3KXBC 2HIOD 5CPID 5AV5A 1S32A 4XZQB 3LELB 1JFIA 3AZKA 3KXBD 1ZLAC 2NZDA 1P3GD 3AZLC 1P34C 3MGRC 3X1SB 3LZ0B 3AZNC 1P3BB 2JSSA 1KX3B 3W99B 4Z66B 3AZLD 3X1TB 1P3FC 3MVDC 3X1VA 2F8ND 3AZND 5CPKC 3LJAC 3VH6A 4G91C 4WV4B 1M18C 2NQBB 3WAAB 1P3FD 5CP6C 2AROA 3MVDD 3TU4C 3AZHA 1M18D 5CP6D 3TU4D 3REKC 1P3KD 4ZBJC 5AV8B 2YFWB 5B2JC 4R8PA 3VH6T 5FUGA 3REHC 5AVCC 3AZMB 4WU8C 3W98D 3WKJD 4WU9B 4CSRA 5BO0A 5B2JD 3A6NA 3AZJC 3REHD 4WU8D 5AVCD 5B0ZC 3UTAC 3X1UA 4H9QB 3AZJD 3AV1C 3KUYB 3B6GB 5B0ZD 3UTAD 1HQ3A 1S32C 3WTPB 1TZYC 1N1JB 5GXQD 3AZKC 1P3IA 1WWSA 3UTBC 1TZYD 5B40A 1B67A 3MGSB 1U35D 1M19B 4KUDC 4Z5TA 3KWQA 5B2IB 3AZKD 4LD9A 3AZGB 5AY8A 3X1VC 3UTBD 5CPJD 1F66A 4KUDD 4JJND 4M6BA 3AZHC 4KGCA 1P3MB 4QLCB 1P3LB 4H9PB 3AZIB 4H9OA 1H3OB 4H9NA 5B1LA 5DNNA 5GT0D 3A6NC 3AYWB 5E5AB 3X1UC 3A6ND 5B0YD 3AZEC 3AZFB 3AN2A 5BNXB 2F8NK 3AZED 3AFAD 5B1MD 1P3IC 1M1AB 1TAFB 2HIOA 5CPIA 3W96C 4NFTA 5B40C 4LD9C 2CWEA 4Z5TC 3KWQC 4EO5C 1B6WA 1P3GA 3W96D 5AY8C 5AV6D 5B40D 1R4VA 3LELC 4ZUXA 5JA4B 2RVQD 5JRGD 3AZLA 2F8NA 3REJB 2IO5B 1P3AB 3LELD 3NQUB 3VH6W 3MNNC 1P3FA 3MVDA 1KX3C 4KGCC 2NZDB 3X1SD 1P3BD 1M18A 4XUJB 3MNND 5CP6A 4YS3B 5F99B 3TU4A 1P3KA 1KX3D 4KGCD 3WAAC 2BYKB 4Z66D 3X1TD 5B1LC 5DNNC 3WA9B 2NQBD 3R45A 4Z2MH 5GSUB 4J8VB 3WAAD 3W98A 3WKJA 5DNND 5B2JA 3REHA 4WU8A 5BNVA 5AVCA 3LZ1A 3C1CA 4UUZA 2F8NH 4KHAA 5B0ZA 3UTAA 2PYOB 3AZMD 2HIOC 5CPIC 3AV2A 4AWLC 5GXQA 1ID3B 3KUYC 1P3GC 1TZYA 1U35A 1KX5C 3WTPC 3KUYD 4ZUXC 3B6GD 5DNMA 3UTBA 5CPJA 1WWIA 3MGQB 4KUDA 4JJNA 1KX5D 3WTPD 4ZUXD 3MGSC 4J8XA 1M19C 1BH8B 3AZGC 2LY8A 3MGSD 1M19D 5B2ID 1P3KC 3AZGD 5AVBB 5KDMA 4X23B 4CAYA 4J8UB 1BH9B 3W98C 5G49A 3WKJC 3O62B 3W97B 5GT0A 1P3LC 3NQJB 2FJ7B 4E45A 3LZ1C 3C1CC 1P3MD 5AV9B 2BYMB 1P3LD 1P3OA 5B33B 5B0YA 3UT9A 3LZ1D 3C1CD 2CV5B 3AV2C 5E5AC 3B6FB 3AZEA 2L5AA 5GXQC 2HUEB 4H9RB 5B1MA 3AFAA 3MGPB 3B0DC 5B32B 3AZFC 3AV2D 5E5AD 5B24C 1U35C 1EQZC 4YM6B 1P3PB 5DNMC 3W96A 3AZFD 5AV6A 1AOIB 5CPJC 5B24D 1EQZD 4JJNC 5JRGA 4J8XC 4HGAB 5GT3A 5DNMD 5C3IC 4XZQA 3LELA 4J8XD 3KXBB 1P3AC 3X1SA 3LZ0A 1P3BA 3MNNA 1KX3A 3W99A 4Z66A 3X1TA 1ZLAB 3REJD 1P3AD 3AZLB 1P34B 2F8NB 5GT0C 3MGRB 3AZNB 2NQBA 3WAAA 4YS3C 4E44A 4J8WB 3MVDB 1P3OC 5B0YC 4XUJD 4YS3D 3LJAB 5CPKB 5F99D 3UT9C 4G91B 3WA9C 5AV8A 4WNNB 2YFWA 1P3OD 3WA9D 3UT9D 3AFAC 5B1MC 1KX4B 5GSUD 3AZMA 3REKB 4ZBJB 5B31B 3C1BB 4NE3A 2PYOC 4WU8B 5AV6C 4H9QA 3REIC 3KUYA 3B6GA 5JRGC 2RVQC 2PYOD 3AZJB 1ID3C 5GT3C 5B0ZB 3V9RB 2YFVA 1KX5A 4XZQC 3WTPA 3REID 1N1JA 1Q9CA 1ID3D 5GT3D 3AV1B 3RELB 4XZQD 3X1SC 3LZ0C 1P3BC 3MGSA 3MGQC 1S32B 1M19A 5AV5B 5B2IA 1JFIB 3B0CW 3W99C 3AZGA 4Z66C 3AZKB 3X1TC 3LZ0D 3MGQD 3W99D 2NQBC 3X1VB 3WTPE 1KU5A 1P3MA 4QLCA 5AV8C 1P3LA 2AROB 5AVBD 4H9PA 4G92B 3AZHB 3AZIA 4X23D 4J8UD 5BT1D 2FJ7C 3AZMC 5AV8D 1F1EA 1H3OA 4WU9C 3W97D 3AYWA 2FJ7D 1BFMA 4R8PB 5FUGB 5E5AA 4WU9D 5AV9D 1A7WA 3B6GC 4CSRB 5BO0B 3A6NB 3AZFA 3MGPC 5B24A 1EQZA 3X1UB 5BNXA 3B6FD 4YM6C 3MGPD 5B32D 1TAFA 1P3PC 1M1AA 1HQ3B 4YM6D 5B2IC 1P3PD 5CHLB 1P3IB 1HTAA 4DRBA 5JA4A 5B40B 4LD9B 4Z5TB 3KWQB 3REJA 4EO5B 1P3AA 5AY8B 3NQUA 1F66B 1P3MC 4QLCC 4WZSB 3AZIC 4XUJA 4YS3A 3B0CT 5F99A 3MNNB 2BYKA 4QLCD 1ZLAD 4KGCB 3AZID 4J8WC 1P34D 3MGRD 3WA9A 3AYWC 5BS7A 5GSUA 4J8VA 1ULYA 4H9OB 4J8WD 4H9NB 5B1LB 5DNNB
chains in the Genus database with same CATH superfamily
5CPKD 3LJAD 1KX4C 2PYOA 5B31C 1KX4D 3C1BC 3F6TA 1M1AC 3AYWD 3REKD 3REIA 3AN2B 3B0BA 1ID3A 5B31D 3C1BD 1M1AD 4H9SA 2HIOB 5CPIB 4AWLB 3REJC 2IO5C 3RELC 3MGQA 1P3GB 2YFVB 1BH8A 5AV5C 1KX5B 3AV1D 4ZUXB 3RELD 2NZDC 3VH5W 1S32D 4XUJC 5AV5D 5F99C 1P3FB 5AVBA 2NZDD 4X23A 4J8UA 1BH9A 1M18B 5BS7C 5GSUC 4J8VC 5CP6B 3TU4B 1P3KB 3O62A 3W97A 2Y2LA 2AROC 4G92C 3NQJA 3X1VD 2FJ7A 4J8VD 4WU9A 3R45B 5AV9A 2BYMA 3W98B 2AROD 5B33A 3AZHD 3WKJB 5B2JB 3REHB 5BNVB 5AVCB 2CV5A 4R8PC 3LZ1B 4DRAA 3C1CB 4UUZB 4NE6A 3EPJA 3B6FA 4H9RA 3MGPA 4KHAB 3UTAB 4NE5A 5B32A 4R8PD 4H9SC 3AV2B 4YM6A 2Y2OA 1P3PA 5GXQB 1AOIA 5B32G 3B0DB 3FDDA 3X1UD 1TZYB 1HQ3C 5B24B 1U35B 1EQZB 5DNMB 3UTBB 5CPJB 1HQ3D 4KUDB 3KSYA 4JJNB 4J8XB 3A1KA 3KXBA 3VH5A 5AVBC 1P3ID 2F2AC 5C3IB 4X23C 4J8UC 5BT1C 1F66C 2BG1A 4LD9D 1ZLAA 4Z5TD 4Z2MG 3KWQD 3O62C 1P34A 3W97C 3MGRA 5AY8D 3AZNA 5KDMB 1F66D 4CAYB 3O62D 4J8WA 5AV9C 3VH5T 5G49B 5B33C 2F8NG 5CPKA 5GT0B 3LJAA 2CV5C 4WNNA 5B33D 1P3OB 1PZRA 3B6FC 1KX4A 2HUEC 5B0YB 2CV5D 5B32C 3UT9B 3REKA 5B31A 5B1LD 3C1BA 3AZEB 4DQYB 3AFAB 5B1MB 1AOIC 3AN2C 5B31G 3AZJA 4HGAC 2XD5A 3V9RA 1AOID 3W96B 5AV6B 3AN2D 2FFFB 3REIB 3AV1A 3RELA 5JRGB 3H0RC 5GT3B 3KXBC 2HIOD 5CPID 5AV5A 1S32A 4XZQB 3LELB 1JFIA 3AZKA 3KXBD 1ZLAC 2NZDA 1P3GD 3AZLC 1P34C 3MGRC 3X1SB 3LZ0B 3AZNC 1P3BB 2JSSA 2Y2JA 3P5JB 1KX3B 3W99B 4Z66B 3AZLD 3X1TB 1P3FC 3MVDC 3X1VA 2F8ND 3AZND 5CPKC 3LJAC 3VH6A 4G91C 4WV4B 1M18C 2NQBB 3WAAB 1P3FD 5CP6C 2AROA 3MVDD 3TU4C 3AZHA 1Z2CB 1M18D 5CP6D 3TU4D 3REKC 2Y2QA 1P3KD 4ZBJC 5AV8B 2YFWB 2DF4C 5B2JC 4R8PA 4UPKA 3VH6T 5FUGA 3REHC 5AVCC 3AZMB 4WU8C 3W98D 3WKJD 4WU9B 4CSRA 5BO0A 5B2JD 3A6NA 3AZJC 3REHD 4WU8D 5AVCD 5B0ZC 3UTAC 3X1UA 4H9QB 3AZJD 3AV1C 3KUYB 3B6GB 5B0ZD 3UTAD 1HQ3A 2Y2MA 1S32C 3WTPB 1TZYC 1N1JB 2XD1A 5GXQD 3AZKC 1P3IA 1WWSA 3UTBC 1TZYD 5B40A 1B67A 3MGSB 1U35D 1M19B 4KUDC 4Z5TA 3KWQA 1W2EA 5B2IB 3AZKD 4LD9A 3AZGB 5AY8A 3X1VC 3UTBD 5CPJD 1F66A 4KUDD 4JJND 4M6BA 3EPLA 3AZHC 3IP4C 2Y2HA 4KGCA 1P3MB 4QLCB 1P3LB 4H9PB 3AZIB 3A1IA 2UWXA 2ZY5A 4H9OA 1H3OB 4H9NA 5B1LA 5DNNA 5GT0D 3A6NC 3AYWB 2G5IC 5E5AB 3X1UC 3A6ND 5B0YD 3AZEC 3AZFB 3AN2A 5BNXB 2F8NK 3AZED 3AFAD 5B1MD 1P3IC 1M1AB 1TAFB 2HIOA 5CPIA 3KFUG 3W96C 4NFTA 5B40C 4LD9C 2CWEA 4Z5TC 3KWQC 4EO5C 1B6WA 1P3GA 3W96D 5AY8C 5AV6D 5B40D 1R4VA 3H0LC 3LELC 4ZUXA 5JA4B 2RVQD 5JRGD 3EPHA 3AZLA 2F8NA 3AL0C 3REJB 2IO5B 1P3AB 3LELD 3NQUB 3VH6W 3MNNC 1P3FA 3MVDA 1KX3C 4KGCC 2NZDB 3X1SD 1P3BD 1M18A 4XUJB 3MNND 5CP6A 4YS3B 5F99B 3TU4A 1P3KA 1KX3D 4KGCD 3WAAC 2BYKB 4Z66D 3X1TD 5B1LC 5DNNC 3H0MC 3WA9B 2NQBD 3R45A 4Z2MH 5GSUB 4J8VB 3WAAD 3W98A 3WKJA 5DNND 5B2JA 3REHA 4WU8A 5BNVA 5AVCA 3LZ1A 3C1CA 4UUZA 2F8NH 4KHAA 5B0ZA 3UTAA 2PYOB 3AZMD 2HIOC 5CPIC 3AV2A 4AWLC 5GXQA 1ID3B 3KUYC 1P3GC 1TZYA 1U35A 1KX5C 2ZY2A 3WTPC 3KUYD 4ZUXC 3B6GD 5DNMA 3UTBA 5CPJA 1WWIA 3MGQB 4KUDA 4JJNA 1KX5D 3WTPD 4ZUXD 3MGSC 4J8XA 1M19C 1BH8B 3AZGC 2LY8A 3MGSD 1M19D 5B2ID 1P3KC 3AZGD 5AVBB 5KDMA 4X23B 4CAYA 4J8UB 1BH9B 3W98C 5G49A 3WKJC 3O62B 3W97B 5GT0A 1P3LC 3NQJB 2FJ7B 4E45A 3LZ1C 3C1CC 1P3MD 5AV9B 2BYMB 1P3LD 1P3OA 5B33B 5B0YA 3UT9A 3LZ1D 3C1CD 2CV5B 3AV2C 5E5AC 3B6FB 3AZEA 5GXQC 2L5AA 2HUEB 4H9RB 5B1MA 3AFAA 3MGPB 3B0DC 5B32B 3AZFC 3AV2D 5E5AD 5B24C 1U35C 1EQZC 4YM6B 1P3PB 5DNMC 3W96A 3AZFD 5AV6A 1AOIB 5CPJC 5B24D 1EQZD 4JJNC 5JRGA 4J8XC 4HGAB 2JCHA 5GT3A 5DNMD 5C3IC 2G5HC 4XZQA 3LELA 4J8XD 3KXBB 2Y2IA 1P3AC 3X1SA 3LZ0A 1P3BA 3MNNA 1KX3A 3W99A 4Z66A 3X1TA 2JE5A 3REJD 1ZLAB 1P3AD 2Y2KA 3AZLB 1P34B 2F8NB 5GT0C 3MGRB 3AZNB 2NQBA 3WAAA 2W8SA 4YS3C 4E44A 2Y2NA 4J8WB 3MVDB 1P3OC 5B0YC 4XUJD 4YS3D 3LJAB 5CPKB 5F99D 3UT9C 4G91B 3WA9C 5AV8A 4WNNB 2YFWA 1P3OD 3WA9D 3UT9D 3AFAC 5B1MC 1KX4B 5GSUD 3AZMA 2ZM5A 3REKB 4ZBJB 5B31B 3C1BB 4NE3A 2PYOC 4WU8B 5AV6C 4H9QA 3REIC 3KUYA 3B6GA 5JRGC 2RVQC 2PYOD 3AZJB 1ID3C 5GT3C 5B0ZB 3V9RB 2YFVA 1KX5A 4XZQC 3WTPA 3REID 1N1JA 1Q9CA 1ID3D 5GT3D 3AV1B 3RELB 4XZQD 3X1SC 3LZ0C 1P3BC 3MGSA 3MGQC 1S32B 1M19A 5AV5B 5B2IA 1JFIB 3B0CW 3W99C 3AZGA 4Z66C 1T3UA 3AZKB 3X1TC 3LZ0D 3MGQD 2ZY3A 2Y2PA 3W99D 2NQBC 2DQNC 2J8PA 3X1VB 3WTPE 1KU5A 1P3MA 4QLCA 5AV8C 1P3LA 2AROB 5AVBD 4H9PA 4G92B 3AZHB 3AZIA 4X23D 4J8UD 5BT1D 2FJ7C 3AZMC 5AV8D 1F1EA 1H3OA 4WU9C 3W97D 3AYWA 2FJ7D 3EPKA 3EG5B 1BFMA 4R8PB 5FUGB 5E5AA 4WU9D 5AV9D 1A7WA 3B6GC 4CSRB 5BO0B 3A6NB 2RIQA 3AZFA 3MGPC 5B24A 1EQZA 4WJ3C 3X1UB 5BNXA 3B6FD 4YM6C 3MGPD 5B32D 1TAFA 1P3PC 1M1AA 1HQ3B 4YM6D 5B2IC 1P3PD 5CHLB 1P3IB 1HTAA 4DRBA 5JA4A 5B40B 4LD9B 4Z5TB 3KWQB 3REJA 4EO5B 1P3AA 5AY8B 3NQUA 1F66B 1P3MC 2Y2GA 4QLCC 4WZSB 3AZIC 4XUJA 4YS3A 3B0CT 5F99A 2VQRA 3MNNB 2BYKA 4QLCD 1ZLAD 4KGCB 3AZID 4J8WC 1P34D 2ZY4A 3MGRD 3WA9A 3AYWC 5BS7A 5GSUA 4J8VA 1ULYA 4H9OB 4J8WD 4H9NB 5B1LB 5DNNB
chains in the Genus database with same CATH topology
5CPKD 3LJAD 1KX4C 2PYOA 5B31C 1KX4D 3C1BC 3F6TA 1M1AC 3AYWD 3REKD 3REIA 3AN2B 3B0BA 1ID3A 5B31D 3C1BD 1M1AD 4H9SA 2HIOB 5CPIB 4AWLB 3REJC 2IO5C 3RELC 3MGQA 1P3GB 2YFVB 1BH8A 5AV5C 1KX5B 3AV1D 4ZUXB 3RELD 2NZDC 3VH5W 1S32D 4XUJC 5AV5D 5F99C 1P3FB 5AVBA 2NZDD 4X23A 4J8UA 1BH9A 1M18B 5BS7C 5GSUC 4J8VC 5CP6B 3TU4B 1P3KB 3O62A 3W97A 2Y2LA 2AROC 4G92C 3NQJA 3X1VD 2FJ7A 4J8VD 4WU9A 3R45B 5AV9A 2BYMA 3W98B 2AROD 5B33A 3AZHD 3WKJB 5B2JB 3REHB 5BNVB 5AVCB 2CV5A 4R8PC 3LZ1B 4DRAA 3C1CB 4UUZB 4NE6A 3EPJA 3B6FA 4H9RA 3MGPA 4KHAB 3UTAB 4NE5A 5B32A 4R8PD 4H9SC 3AV2B 4YM6A 2Y2OA 1P3PA 5GXQB 1AOIA 5B32G 3B0DB 3FDDA 3X1UD 1TZYB 1HQ3C 5B24B 1U35B 1EQZB 5DNMB 3UTBB 5CPJB 1HQ3D 4KUDB 3KSYA 4JJNB 4J8XB 3A1KA 3KXBA 3VH5A 5AVBC 1P3ID 2F2AC 5C3IB 4X23C 4J8UC 5BT1C 1F66C 2BG1A 4LD9D 1ZLAA 4Z5TD 4Z2MG 3KWQD 3O62C 1P34A 3W97C 3MGRA 5AY8D 3AZNA 5KDMB 1F66D 4CAYB 3O62D 4J8WA 5AV9C 3VH5T 5G49B 5B33C 2F8NG 5CPKA 5GT0B 3LJAA 2CV5C 4WNNA 5B33D 1P3OB 1PZRA 3B6FC 1KX4A 2HUEC 5B0YB 2CV5D 5B32C 3UT9B 3REKA 5B31A 5B1LD 3C1BA 3AZEB 4DQYB 3AFAB 5B1MB 1AOIC 3AN2C 5B31G 3AZJA 4HGAC 2XD5A 3V9RA 1AOID 3W96B 5AV6B 3AN2D 2FFFB 3REIB 3AV1A 3RELA 5JRGB 3H0RC 5GT3B 3KXBC 2HIOD 5CPID 5AV5A 1S32A 4XZQB 3LELB 1JFIA 3AZKA 3KXBD 1ZLAC 2NZDA 1P3GD 3AZLC 1P34C 3MGRC 3X1SB 3LZ0B 3AZNC 1P3BB 2JSSA 2Y2JA 3P5JB 1KX3B 3W99B 4Z66B 3AZLD 3X1TB 1P3FC 3MVDC 3X1VA 2F8ND 3AZND 5CPKC 3LJAC 3VH6A 4G91C 4WV4B 1M18C 2NQBB 3WAAB 1P3FD 5CP6C 2AROA 3MVDD 3TU4C 3AZHA 1Z2CB 1M18D 5CP6D 3TU4D 3REKC 2Y2QA 1P3KD 4ZBJC 5AV8B 2YFWB 2DF4C 5B2JC 4R8PA 4UPKA 3VH6T 5FUGA 3REHC 5AVCC 3AZMB 4WU8C 3W98D 3WKJD 4WU9B 4CSRA 5BO0A 5B2JD 3A6NA 3AZJC 3REHD 4WU8D 5AVCD 5B0ZC 3UTAC 3X1UA 4H9QB 3AZJD 3AV1C 3KUYB 3B6GB 5B0ZD 3UTAD 1HQ3A 2Y2MA 1S32C 3WTPB 1TZYC 1N1JB 2XD1A 5GXQD 3AZKC 1P3IA 1WWSA 3UTBC 1TZYD 5B40A 1B67A 3MGSB 1U35D 1M19B 4KUDC 4Z5TA 3KWQA 1W2EA 5B2IB 3AZKD 4LD9A 3AZGB 5AY8A 3X1VC 3UTBD 5CPJD 1F66A 4KUDD 4JJND 4M6BA 3EPLA 3AZHC 3IP4C 2Y2HA 4KGCA 1P3MB 4QLCB 1P3LB 4H9PB 3AZIB 3A1IA 2UWXA 2ZY5A 4H9OA 1H3OB 4H9NA 5B1LA 5DNNA 5GT0D 3A6NC 3AYWB 2G5IC 5E5AB 3X1UC 3A6ND 5B0YD 3AZEC 3AZFB 3AN2A 5BNXB 2F8NK 3AZED 3AFAD 5B1MD 1P3IC 1M1AB 1TAFB 2HIOA 5CPIA 3KFUG 3W96C 4NFTA 5B40C 4LD9C 2CWEA 4Z5TC 3KWQC 4EO5C 1B6WA 1P3GA 3W96D 5AY8C 5AV6D 5B40D 1R4VA 3H0LC 3LELC 4ZUXA 5JA4B 2RVQD 5JRGD 3EPHA 3AZLA 2F8NA 3AL0C 3REJB 2IO5B 1P3AB 3LELD 3NQUB 3VH6W 3MNNC 1P3FA 3MVDA 1KX3C 4KGCC 2NZDB 3X1SD 1P3BD 1M18A 4XUJB 3MNND 5CP6A 4YS3B 5F99B 3TU4A 1P3KA 1KX3D 4KGCD 3WAAC 2BYKB 4Z66D 3X1TD 5B1LC 5DNNC 3H0MC 3WA9B 2NQBD 3R45A 4Z2MH 5GSUB 4J8VB 3WAAD 3W98A 3WKJA 5DNND 5B2JA 3REHA 4WU8A 5BNVA 5AVCA 3LZ1A 3C1CA 4UUZA 2F8NH 4KHAA 5B0ZA 3UTAA 2PYOB 3AZMD 2HIOC 5CPIC 3AV2A 4AWLC 5GXQA 1ID3B 3KUYC 1P3GC 1TZYA 1U35A 1KX5C 2ZY2A 3WTPC 3KUYD 4ZUXC 3B6GD 5DNMA 3UTBA 5CPJA 1WWIA 3MGQB 4KUDA 4JJNA 1KX5D 3WTPD 4ZUXD 3MGSC 4J8XA 1M19C 1BH8B 3AZGC 2LY8A 3MGSD 1M19D 5B2ID 1P3KC 3AZGD 5AVBB 5KDMA 4X23B 4CAYA 4J8UB 1BH9B 3W98C 5G49A 3WKJC 3O62B 3W97B 5GT0A 1P3LC 3NQJB 2FJ7B 4E45A 3LZ1C 3C1CC 1P3MD 5AV9B 2BYMB 1P3LD 1P3OA 5B33B 5B0YA 3UT9A 3LZ1D 3C1CD 2CV5B 3AV2C 5E5AC 3B6FB 3AZEA 5GXQC 2L5AA 2HUEB 4H9RB 5B1MA 3AFAA 3MGPB 3B0DC 5B32B 3AZFC 3AV2D 5E5AD 5B24C 1U35C 1EQZC 4YM6B 1P3PB 5DNMC 3W96A 3AZFD 5AV6A 1AOIB 5CPJC 5B24D 1EQZD 4JJNC 5JRGA 4J8XC 4HGAB 2JCHA 5GT3A 5DNMD 5C3IC 2G5HC 4XZQA 3LELA 4J8XD 3KXBB 2Y2IA 1P3AC 3X1SA 3LZ0A 1P3BA 3MNNA 1KX3A 3W99A 4Z66A 3X1TA 2JE5A 3REJD 1ZLAB 1P3AD 2Y2KA 3AZLB 1P34B 2F8NB 5GT0C 3MGRB 3AZNB 2NQBA 3WAAA 2W8SA 4YS3C 4E44A 2Y2NA 4J8WB 3MVDB 1P3OC 5B0YC 4XUJD 4YS3D 3LJAB 5CPKB 5F99D 3UT9C 4G91B 3WA9C 5AV8A 4WNNB 2YFWA 1P3OD 3WA9D 3UT9D 3AFAC 5B1MC 1KX4B 5GSUD 3AZMA 2ZM5A 3REKB 4ZBJB 5B31B 3C1BB 4NE3A 2PYOC 4WU8B 5AV6C 4H9QA 3REIC 3KUYA 3B6GA 5JRGC 2RVQC 2PYOD 3AZJB 1ID3C 5GT3C 5B0ZB 3V9RB 2YFVA 1KX5A 4XZQC 3WTPA 3REID 1N1JA 1Q9CA 1ID3D 5GT3D 3AV1B 3RELB 4XZQD 3X1SC 3LZ0C 1P3BC 3MGSA 3MGQC 1S32B 1M19A 5AV5B 5B2IA 1JFIB 3B0CW 3W99C 3AZGA 4Z66C 1T3UA 3AZKB 3X1TC 3LZ0D 3MGQD 2ZY3A 2Y2PA 3W99D 2NQBC 2DQNC 2J8PA 3X1VB 3WTPE 1KU5A 1P3MA 4QLCA 5AV8C 1P3LA 2AROB 5AVBD 4H9PA 4G92B 3AZHB 3AZIA 4X23D 4J8UD 5BT1D 2FJ7C 3AZMC 5AV8D 1F1EA 1H3OA 4WU9C 3W97D 3AYWA 2FJ7D 3EPKA 3EG5B 1BFMA 4R8PB 5FUGB 5E5AA 4WU9D 5AV9D 1A7WA 3B6GC 4CSRB 5BO0B 3A6NB 2RIQA 3AZFA 3MGPC 5B24A 1EQZA 4WJ3C 3X1UB 5BNXA 3B6FD 4YM6C 3MGPD 5B32D 1TAFA 1P3PC 1M1AA 1HQ3B 4YM6D 5B2IC 1P3PD 5CHLB 1P3IB 1HTAA 4DRBA 5JA4A 5B40B 4LD9B 4Z5TB 3KWQB 3REJA 4EO5B 1P3AA 5AY8B 3NQUA 1F66B 1P3MC 2Y2GA 4QLCC 4WZSB 3AZIC 4XUJA 4YS3A 3B0CT 5F99A 2VQRA 3MNNB 2BYKA 4QLCD 1ZLAD 4KGCB 3AZID 4J8WC 1P34D 2ZY4A 3MGRD 3WA9A 3AYWC 5BS7A 5GSUA 4J8VA 1ULYA 4H9OB 4J8WD 4H9NB 5B1LB 5DNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPK D;  3LJA D;  1KX4 C;  2PYO A;  5B31 C;  1KX4 D;  3C1B C;  1M1A C;  3AYW D;  3REK D;  3REI A;  3AN2 B;  3B0B A;  1ID3 A;  5B31 D;  3C1B D;  1M1A D;  4H9S A;  2HIO B;  5CPI B;  4AWL B;  3REJ C;  2IO5 C;  3REL C;  3MGQ A;  1P3G B;  2YFV B;  1BH8 A;  5AV5 C;  1KX5 B;  3AV1 D;  4ZUX B;  3REL D;  2NZD C;  3VH5 W;  1S32 D;  4XUJ C;  5AV5 D;  5F99 C;  1P3F B;  5AVB A;  2NZD D;  4X23 A;  4J8U A;  1BH9 A;  1M18 B;  5BS7 C;  5GSU C;  4J8V C;  5CP6 B;  3TU4 B;  1P3K B;  3O62 A;  3W97 A;  2ARO C;  4G92 C;  3NQJ A;  3X1V D;  2FJ7 A;  4J8V D;  4WU9 A;  3R45 B;  5AV9 A;  2BYM A;  3W98 B;  2ARO D;  5B33 A;  3AZH D;  3WKJ B;  5B2J B;  3REH B;  5BNV B;  5AVC B;  2CV5 A;  4R8P C;  3LZ1 B;  4DRA A;  3C1C B;  4UUZ B;  4NE6 A;  3B6F A;  4H9R A;  3MGP A;  4KHA B;  3UTA B;  4NE5 A;  5B32 A;  4R8P D;  4H9S C;  3AV2 B;  4YM6 A;  1P3P A;  5GXQ B;  1AOI A;  5B32 G;  3B0D B;  3X1U D;  1TZY B;  1HQ3 C;  5B24 B;  1U35 B;  1EQZ B;  5DNM B;  3UTB B;  5CPJ B;  1HQ3 D;  4KUD B;  3KSY A;  4JJN B;  4J8X B;  3KXB A;  3VH5 A;  5AVB C;  1P3I D;  5C3I B;  4X23 C;  4J8U C;  5BT1 C;  1F66 C;  4LD9 D;  1ZLA A;  4Z5T D;  4Z2M G;  3KWQ D;  3O62 C;  1P34 A;  3W97 C;  3MGR A;  5AY8 D;  3AZN A;  5KDM B;  1F66 D;  4CAY B;  3O62 D;  4J8W A;  5AV9 C;  3VH5 T;  5G49 B;  5B33 C;  2F8N G;  5CPK A;  5GT0 B;  3LJA A;  2CV5 C;  4WNN A;  5B33 D;  1P3O B;  3B6F C;  1KX4 A;  2HUE C;  5B0Y B;  2CV5 D;  5B32 C;  3UT9 B;  3REK A;  5B31 A;  5B1L D;  3C1B A;  3AZE B;  3AFA B;  5B1M B;  1AOI C;  3AN2 C;  5B31 G;  3AZJ A;  4HGA C;  3V9R A;  1AOI D;  3W96 B;  5AV6 B;  3AN2 D;  3REI B;  3AV1 A;  3REL A;  5JRG B;  5GT3 B;  3KXB C;  2HIO D;  5CPI D;  5AV5 A;  1S32 A;  4XZQ B;  3LEL B;  1JFI A;  3AZK A;  3KXB D;  1ZLA C;  2NZD A;  1P3G D;  3AZL C;  1P34 C;  3MGR C;  3X1S B;  3LZ0 B;  3AZN C;  1P3B B;  2JSS A;  1KX3 B;  3W99 B;  4Z66 B;  3AZL D;  3X1T B;  1P3F C;  3MVD C;  3X1V A;  2F8N D;  3AZN D;  5CPK C;  3LJA C;  3VH6 A;  4G91 C;  4WV4 B;  1M18 C;  2NQB B;  3WAA B;  1P3F D;  5CP6 C;  2ARO A;  3MVD D;  3TU4 C;  3AZH A;  1M18 D;  5CP6 D;  3TU4 D;  3REK C;  1P3K D;  4ZBJ C;  5AV8 B;  2YFW B;  5B2J C;  4R8P A;  3VH6 T;  5FUG A;  3REH C;  5AVC C;  3AZM B;  4WU8 C;  3W98 D;  3WKJ D;  4WU9 B;  4CSR A;  5BO0 A;  5B2J D;  3A6N A;  3AZJ C;  3REH D;  4WU8 D;  5AVC D;  5B0Z C;  3UTA C;  3X1U A;  4H9Q B;  3AZJ D;  3AV1 C;  3KUY B;  3B6G B;  5B0Z D;  3UTA D;  1HQ3 A;  1S32 C;  3WTP B;  1TZY C;  1N1J B;  5GXQ D;  3AZK C;  1P3I A;  1WWS A;  3UTB C;  1TZY D;  5B40 A;  1B67 A;  3MGS B;  1U35 D;  1M19 B;  4KUD C;  4Z5T A;  3KWQ A;  5B2I B;  3AZK D;  4LD9 A;  3AZG B;  5AY8 A;  3X1V C;  3UTB D;  5CPJ D;  1F66 A;  4KUD D;  4JJN D;  4M6B A;  3AZH C;  4KGC A;  1P3M B;  4QLC B;  1P3L B;  4H9P B;  3AZI B;  4H9O A;  1H3O B;  4H9N A;  5B1L A;  5DNN A;  5GT0 D;  3A6N C;  3AYW B;  5E5A B;  3X1U C;  3A6N D;  5B0Y D;  3AZE C;  3AZF B;  3AN2 A;  5BNX B;  2F8N K;  3AZE D;  3AFA D;  5B1M D;  1P3I C;  1M1A B;  1TAF B;  2HIO A;  5CPI A;  3W96 C;  4NFT A;  5B40 C;  4LD9 C;  2CWE A;  4Z5T C;  3KWQ C;  4EO5 C;  1B6W A;  1P3G A;  3W96 D;  5AY8 C;  5AV6 D;  5B40 D;  1R4V A;  3LEL C;  4ZUX A;  5JA4 B;  2RVQ D;  5JRG D;  3AZL A;  2F8N A;  3REJ B;  2IO5 B;  1P3A B;  3LEL D;  3NQU B;  3VH6 W;  3MNN C;  1P3F A;  3MVD A;  1KX3 C;  4KGC C;  2NZD B;  3X1S D;  1P3B D;  1M18 A;  4XUJ B;  3MNN D;  5CP6 A;  4YS3 B;  5F99 B;  3TU4 A;  1P3K A;  1KX3 D;  4KGC D;  3WAA C;  2BYK B;  4Z66 D;  3X1T D;  5B1L C;  5DNN C;  3WA9 B;  2NQB D;  3R45 A;  4Z2M H;  5GSU B;  4J8V B;  3WAA D;  3W98 A;  3WKJ A;  5DNN D;  5B2J A;  3REH A;  4WU8 A;  5BNV A;  5AVC A;  3LZ1 A;  3C1C A;  4UUZ A;  2F8N H;  4KHA A;  5B0Z A;  3UTA A;  2PYO B;  3AZM D;  2HIO C;  5CPI C;  3AV2 A;  4AWL C;  5GXQ A;  1ID3 B;  3KUY C;  1P3G C;  1TZY A;  1U35 A;  1KX5 C;  3WTP C;  3KUY D;  4ZUX C;  3B6G D;  5DNM A;  3UTB A;  5CPJ A;  1WWI A;  3MGQ B;  4KUD A;  4JJN A;  1KX5 D;  3WTP D;  4ZUX D;  3MGS C;  4J8X A;  1M19 C;  1BH8 B;  3AZG C;  2LY8 A;  3MGS D;  1M19 D;  5B2I D;  1P3K C;  3AZG D;  5AVB B;  5KDM A;  4X23 B;  4CAY A;  4J8U B;  1BH9 B;  3W98 C;  5G49 A;  3WKJ C;  3O62 B;  3W97 B;  5GT0 A;  1P3L C;  3NQJ B;  2FJ7 B;  4E45 A;  3LZ1 C;  3C1C C;  1P3M D;  5AV9 B;  2BYM B;  1P3L D;  1P3O A;  5B33 B;  5B0Y A;  3UT9 A;  3LZ1 D;  3C1C D;  2CV5 B;  3AV2 C;  5E5A C;  3B6F B;  3AZE A;  2L5A A;  5GXQ C;  2HUE B;  4H9R B;  5B1M A;  3AFA A;  3MGP B;  3B0D C;  5B32 B;  3AZF C;  3AV2 D;  5E5A D;  5B24 C;  1U35 C;  1EQZ C;  4YM6 B;  1P3P B;  5DNM C;  3W96 A;  3AZF D;  5AV6 A;  1AOI B;  5CPJ C;  5B24 D;  1EQZ D;  4JJN C;  5JRG A;  4J8X C;  4HGA B;  5GT3 A;  5DNM D;  5C3I C;  4XZQ A;  3LEL A;  4J8X D;  3KXB B;  1P3A C;  3X1S A;  3LZ0 A;  1P3B A;  3MNN A;  1KX3 A;  3W99 A;  4Z66 A;  3X1T A;  1ZLA B;  3REJ D;  1P3A D;  3AZL B;  1P34 B;  2F8N B;  5GT0 C;  3MGR B;  3AZN B;  2NQB A;  3WAA A;  4YS3 C;  4E44 A;  4J8W B;  3MVD B;  1P3O C;  5B0Y C;  4XUJ D;  4YS3 D;  3LJA B;  5CPK B;  5F99 D;  3UT9 C;  4G91 B;  3WA9 C;  5AV8 A;  4WNN B;  2YFW A;  1P3O D;  3WA9 D;  3UT9 D;  3AFA C;  5B1M C;  1KX4 B;  5GSU D;  3AZM A;  3REK B;  4ZBJ B;  5B31 B;  3C1B B;  4NE3 A;  2PYO C;  4WU8 B;  5AV6 C;  4H9Q A;  3REI C;  3KUY A;  3B6G A;  5JRG C;  2RVQ C;  2PYO D;  3AZJ B;  1ID3 C;  5GT3 C;  5B0Z B;  3V9R B;  2YFV A;  1KX5 A;  4XZQ C;  3WTP A;  3REI D;  1N1J A;  1Q9C A;  1ID3 D;  5GT3 D;  3AV1 B;  3REL B;  4XZQ D;  3X1S C;  3LZ0 C;  1P3B C;  3MGS A;  3MGQ C;  1S32 B;  1M19 A;  5AV5 B;  5B2I A;  1JFI B;  3B0C W;  3W99 C;  3AZG A;  4Z66 C;  3AZK B;  3X1T C;  3LZ0 D;  3MGQ D;  3W99 D;  2NQB C;  3X1V B;  3WTP E;  1KU5 A;  1P3M A;  4QLC A;  5AV8 C;  1P3L A;  2ARO B;  5AVB D;  4H9P A;  4G92 B;  3AZH B;  3AZI A;  4X23 D;  4J8U D;  5BT1 D;  2FJ7 C;  3AZM C;  5AV8 D;  1F1E A;  1H3O A;  4WU9 C;  3W97 D;  3AYW A;  2FJ7 D;  1BFM A;  4R8P B;  5FUG B;  5E5A A;  4WU9 D;  5AV9 D;  1A7W A;  3B6G C;  4CSR B;  5BO0 B;  3A6N B;  3AZF A;  3MGP C;  5B24 A;  1EQZ A;  3X1U B;  5BNX A;  3B6F D;  4YM6 C;  3MGP D;  5B32 D;  1TAF A;  1P3P C;  1M1A A;  1HQ3 B;  4YM6 D;  5B2I C;  1P3P D;  5CHL B;  1P3I B;  1HTA A;  4DRB A;  5JA4 A;  5B40 B;  4LD9 B;  4Z5T B;  3KWQ B;  3REJ A;  4EO5 B;  1P3A A;  5AY8 B;  3NQU A;  1F66 B;  1P3M C;  4QLC C;  4WZS B;  3AZI C;  4XUJ A;  4YS3 A;  3B0C T;  5F99 A;  3MNN B;  2BYK A;  4QLC D;  1ZLA D;  4KGC B;  3AZI D;  4J8W C;  1P34 D;  3MGR D;  3WA9 A;  3AYW C;  5BS7 A;  5GSU A;  4J8V A;  1ULY A;  4H9O B;  4J8W D;  4H9N B;  5B1L B;  5DNN B; 
#chains in the Genus database with same CATH topology
 5CPK D;  3LJA D;  1KX4 C;  2PYO A;  5B31 C;  1KX4 D;  3C1B C;  3F6T A;  1M1A C;  3AYW D;  3REK D;  3REI A;  3AN2 B;  3B0B A;  1ID3 A;  5B31 D;  3C1B D;  1M1A D;  4H9S A;  2HIO B;  5CPI B;  4AWL B;  3REJ C;  2IO5 C;  3REL C;  3MGQ A;  1P3G B;  2YFV B;  1BH8 A;  5AV5 C;  1KX5 B;  3AV1 D;  4ZUX B;  3REL D;  2NZD C;  3VH5 W;  1S32 D;  4XUJ C;  5AV5 D;  5F99 C;  1P3F B;  5AVB A;  2NZD D;  4X23 A;  4J8U A;  1BH9 A;  1M18 B;  5BS7 C;  5GSU C;  4J8V C;  5CP6 B;  3TU4 B;  1P3K B;  3O62 A;  3W97 A;  2Y2L A;  2ARO C;  4G92 C;  3NQJ A;  3X1V D;  2FJ7 A;  4J8V D;  4WU9 A;  3R45 B;  5AV9 A;  2BYM A;  3W98 B;  2ARO D;  5B33 A;  3AZH D;  3WKJ B;  5B2J B;  3REH B;  5BNV B;  5AVC B;  2CV5 A;  4R8P C;  3LZ1 B;  4DRA A;  3C1C B;  4UUZ B;  4NE6 A;  3EPJ A;  3B6F A;  4H9R A;  3MGP A;  4KHA B;  3UTA B;  4NE5 A;  5B32 A;  4R8P D;  4H9S C;  3AV2 B;  4YM6 A;  2Y2O A;  1P3P A;  5GXQ B;  1AOI A;  5B32 G;  3B0D B;  3FDD A;  3X1U D;  1TZY B;  1HQ3 C;  5B24 B;  1U35 B;  1EQZ B;  5DNM B;  3UTB B;  5CPJ B;  1HQ3 D;  4KUD B;  3KSY A;  4JJN B;  4J8X B;  3A1K A;  3KXB A;  3VH5 A;  5AVB C;  1P3I D;  2F2A C;  5C3I B;  4X23 C;  4J8U C;  5BT1 C;  1F66 C;  2BG1 A;  4LD9 D;  1ZLA A;  4Z5T D;  4Z2M G;  3KWQ D;  3O62 C;  1P34 A;  3W97 C;  3MGR A;  5AY8 D;  3AZN A;  5KDM B;  1F66 D;  4CAY B;  3O62 D;  4J8W A;  5AV9 C;  3VH5 T;  5G49 B;  5B33 C;  2F8N G;  5CPK A;  5GT0 B;  3LJA A;  2CV5 C;  4WNN A;  5B33 D;  1P3O B;  1PZR A;  3B6F C;  1KX4 A;  2HUE C;  5B0Y B;  2CV5 D;  5B32 C;  3UT9 B;  3REK A;  5B31 A;  5B1L D;  3C1B A;  3AZE B;  4DQY B;  3AFA B;  5B1M B;  1AOI C;  3AN2 C;  5B31 G;  3AZJ A;  4HGA C;  2XD5 A;  3V9R A;  1AOI D;  3W96 B;  5AV6 B;  3AN2 D;  2FFF B;  3REI B;  3AV1 A;  3REL A;  5JRG B;  3H0R C;  5GT3 B;  3KXB C;  2HIO D;  5CPI D;  5AV5 A;  1S32 A;  4XZQ B;  3LEL B;  1JFI A;  3AZK A;  3KXB D;  1ZLA C;  2NZD A;  1P3G D;  3AZL C;  1P34 C;  3MGR C;  3X1S B;  3LZ0 B;  3AZN C;  1P3B B;  2JSS A;  2Y2J A;  3P5J B;  1KX3 B;  3W99 B;  4Z66 B;  3AZL D;  3X1T B;  1P3F C;  3MVD C;  3X1V A;  2F8N D;  3AZN D;  5CPK C;  3LJA C;  3VH6 A;  4G91 C;  4WV4 B;  1M18 C;  2NQB B;  3WAA B;  1P3F D;  5CP6 C;  2ARO A;  3MVD D;  3TU4 C;  3AZH A;  1Z2C B;  1M18 D;  5CP6 D;  3TU4 D;  3REK C;  2Y2Q A;  1P3K D;  4ZBJ C;  5AV8 B;  2YFW B;  2DF4 C;  5B2J C;  4R8P A;  4UPK A;  3VH6 T;  5FUG A;  3REH C;  5AVC C;  3AZM B;  4WU8 C;  3W98 D;  3WKJ D;  4WU9 B;  4CSR A;  5BO0 A;  5B2J D;  3A6N A;  3AZJ C;  3REH D;  4WU8 D;  5AVC D;  5B0Z C;  3UTA C;  3X1U A;  4H9Q B;  3AZJ D;  3AV1 C;  3KUY B;  3B6G B;  5B0Z D;  3UTA D;  1HQ3 A;  2Y2M A;  1S32 C;  3WTP B;  1TZY C;  1N1J B;  2XD1 A;  5GXQ D;  3AZK C;  1P3I A;  1WWS A;  3UTB C;  1TZY D;  5B40 A;  1B67 A;  3MGS B;  1U35 D;  1M19 B;  4KUD C;  4Z5T A;  3KWQ A;  1W2E A;  5B2I B;  3AZK D;  4LD9 A;  3AZG B;  5AY8 A;  3X1V C;  3UTB D;  5CPJ D;  1F66 A;  4KUD D;  4JJN D;  4M6B A;  3EPL A;  3AZH C;  3IP4 C;  2Y2H A;  4KGC A;  1P3M B;  4QLC B;  1P3L B;  4H9P B;  3AZI B;  3A1I A;  2UWX A;  2ZY5 A;  4H9O A;  1H3O B;  4H9N A;  5B1L A;  5DNN A;  5GT0 D;  3A6N C;  3AYW B;  2G5I C;  5E5A B;  3X1U C;  3A6N D;  5B0Y D;  3AZE C;  3AZF B;  3AN2 A;  5BNX B;  2F8N K;  3AZE D;  3AFA D;  5B1M D;  1P3I C;  1M1A B;  1TAF B;  2HIO A;  5CPI A;  3KFU G;  3W96 C;  4NFT A;  5B40 C;  4LD9 C;  2CWE A;  4Z5T C;  3KWQ C;  4EO5 C;  1B6W A;  1P3G A;  3W96 D;  5AY8 C;  5AV6 D;  5B40 D;  1R4V A;  3H0L C;  3LEL C;  4ZUX A;  5JA4 B;  2RVQ D;  5JRG D;  3EPH A;  3AZL A;  2F8N A;  3AL0 C;  3REJ B;  2IO5 B;  1P3A B;  3LEL D;  3NQU B;  3VH6 W;  3MNN C;  1P3F A;  3MVD A;  1KX3 C;  4KGC C;  2NZD B;  3X1S D;  1P3B D;  1M18 A;  4XUJ B;  3MNN D;  5CP6 A;  4YS3 B;  5F99 B;  3TU4 A;  1P3K A;  1KX3 D;  4KGC D;  3WAA C;  2BYK B;  4Z66 D;  3X1T D;  5B1L C;  5DNN C;  3H0M C;  3WA9 B;  2NQB D;  3R45 A;  4Z2M H;  5GSU B;  4J8V B;  3WAA D;  3W98 A;  3WKJ A;  5DNN D;  5B2J A;  3REH A;  4WU8 A;  5BNV A;  5AVC A;  3LZ1 A;  3C1C A;  4UUZ A;  2F8N H;  4KHA A;  5B0Z A;  3UTA A;  2PYO B;  3AZM D;  2HIO C;  5CPI C;  3AV2 A;  4AWL C;  5GXQ A;  1ID3 B;  3KUY C;  1P3G C;  1TZY A;  1U35 A;  1KX5 C;  2ZY2 A;  3WTP C;  3KUY D;  4ZUX C;  3B6G D;  5DNM A;  3UTB A;  5CPJ A;  1WWI A;  3MGQ B;  4KUD A;  4JJN A;  1KX5 D;  3WTP D;  4ZUX D;  3MGS C;  4J8X A;  1M19 C;  1BH8 B;  3AZG C;  2LY8 A;  3MGS D;  1M19 D;  5B2I D;  1P3K C;  3AZG D;  5AVB B;  5KDM A;  4X23 B;  4CAY A;  4J8U B;  1BH9 B;  3W98 C;  5G49 A;  3WKJ C;  3O62 B;  3W97 B;  5GT0 A;  1P3L C;  3NQJ B;  2FJ7 B;  4E45 A;  3LZ1 C;  3C1C C;  1P3M D;  5AV9 B;  2BYM B;  1P3L D;  1P3O A;  5B33 B;  5B0Y A;  3UT9 A;  3LZ1 D;  3C1C D;  2CV5 B;  3AV2 C;  5E5A C;  3B6F B;  3AZE A;  5GXQ C;  2L5A A;  2HUE B;  4H9R B;  5B1M A;  3AFA A;  3MGP B;  3B0D C;  5B32 B;  3AZF C;  3AV2 D;  5E5A D;  5B24 C;  1U35 C;  1EQZ C;  4YM6 B;  1P3P B;  5DNM C;  3W96 A;  3AZF D;  5AV6 A;  1AOI B;  5CPJ C;  5B24 D;  1EQZ D;  4JJN C;  5JRG A;  4J8X C;  4HGA B;  2JCH A;  5GT3 A;  5DNM D;  5C3I C;  2G5H C;  4XZQ A;  3LEL A;  4J8X D;  3KXB B;  2Y2I A;  1P3A C;  3X1S A;  3LZ0 A;  1P3B A;  3MNN A;  1KX3 A;  3W99 A;  4Z66 A;  3X1T A;  2JE5 A;  3REJ D;  1ZLA B;  1P3A D;  2Y2K A;  3AZL B;  1P34 B;  2F8N B;  5GT0 C;  3MGR B;  3AZN B;  2NQB A;  3WAA A;  2W8S A;  4YS3 C;  4E44 A;  2Y2N A;  4J8W B;  3MVD B;  1P3O C;  5B0Y C;  4XUJ D;  4YS3 D;  3LJA B;  5CPK B;  5F99 D;  3UT9 C;  4G91 B;  3WA9 C;  5AV8 A;  4WNN B;  2YFW A;  1P3O D;  3WA9 D;  3UT9 D;  3AFA C;  5B1M C;  1KX4 B;  5GSU D;  3AZM A;  2ZM5 A;  3REK B;  4ZBJ B;  5B31 B;  3C1B B;  4NE3 A;  2PYO C;  4WU8 B;  5AV6 C;  4H9Q A;  3REI C;  3KUY A;  3B6G A;  5JRG C;  2RVQ C;  2PYO D;  3AZJ B;  1ID3 C;  5GT3 C;  5B0Z B;  3V9R B;  2YFV A;  1KX5 A;  4XZQ C;  3WTP A;  3REI D;  1N1J A;  1Q9C A;  1ID3 D;  5GT3 D;  3AV1 B;  3REL B;  4XZQ D;  3X1S C;  3LZ0 C;  1P3B C;  3MGS A;  3MGQ C;  1S32 B;  1M19 A;  5AV5 B;  5B2I A;  1JFI B;  3B0C W;  3W99 C;  3AZG A;  4Z66 C;  1T3U A;  3AZK B;  3X1T C;  3LZ0 D;  3MGQ D;  2ZY3 A;  2Y2P A;  3W99 D;  2NQB C;  2DQN C;  2J8P A;  3X1V B;  3WTP E;  1KU5 A;  1P3M A;  4QLC A;  5AV8 C;  1P3L A;  2ARO B;  5AVB D;  4H9P A;  4G92 B;  3AZH B;  3AZI A;  4X23 D;  4J8U D;  5BT1 D;  2FJ7 C;  3AZM C;  5AV8 D;  1F1E A;  1H3O A;  4WU9 C;  3W97 D;  3AYW A;  2FJ7 D;  3EPK A;  3EG5 B;  1BFM A;  4R8P B;  5FUG B;  5E5A A;  4WU9 D;  5AV9 D;  1A7W A;  3B6G C;  4CSR B;  5BO0 B;  3A6N B;  2RIQ A;  3AZF A;  3MGP C;  5B24 A;  1EQZ A;  4WJ3 C;  3X1U B;  5BNX A;  3B6F D;  4YM6 C;  3MGP D;  5B32 D;  1TAF A;  1P3P C;  1M1A A;  1HQ3 B;  4YM6 D;  5B2I C;  1P3P D;  5CHL B;  1P3I B;  1HTA A;  4DRB A;  5JA4 A;  5B40 B;  4LD9 B;  4Z5T B;  3KWQ B;  3REJ A;  4EO5 B;  1P3A A;  5AY8 B;  3NQU A;  1F66 B;  1P3M C;  2Y2G A;  4QLC C;  4WZS B;  3AZI C;  4XUJ A;  4YS3 A;  3B0C T;  5F99 A;  2VQR A;  3MNN B;  2BYK A;  4QLC D;  1ZLA D;  4KGC B;  3AZI D;  4J8W C;  1P34 D;  2ZY4 A;  3MGR D;  3WA9 A;  3AYW C;  5BS7 A;  5GSU A;  4J8V A;  1ULY A;  4H9O B;  4J8W D;  4H9N B;  5B1L B;  5DNN B; 
#chains in the Genus database with same CATH homology
 5CPK D;  3LJA D;  1KX4 C;  2PYO A;  5B31 C;  1KX4 D;  3C1B C;  3F6T A;  1M1A C;  3AYW D;  3REK D;  3REI A;  3AN2 B;  3B0B A;  1ID3 A;  5B31 D;  3C1B D;  1M1A D;  4H9S A;  2HIO B;  5CPI B;  4AWL B;  3REJ C;  2IO5 C;  3REL C;  3MGQ A;  1P3G B;  2YFV B;  1BH8 A;  5AV5 C;  1KX5 B;  3AV1 D;  4ZUX B;  3REL D;  2NZD C;  3VH5 W;  1S32 D;  4XUJ C;  5AV5 D;  5F99 C;  1P3F B;  5AVB A;  2NZD D;  4X23 A;  4J8U A;  1BH9 A;  1M18 B;  5BS7 C;  5GSU C;  4J8V C;  5CP6 B;  3TU4 B;  1P3K B;  3O62 A;  3W97 A;  2Y2L A;  2ARO C;  4G92 C;  3NQJ A;  3X1V D;  2FJ7 A;  4J8V D;  4WU9 A;  3R45 B;  5AV9 A;  2BYM A;  3W98 B;  2ARO D;  5B33 A;  3AZH D;  3WKJ B;  5B2J B;  3REH B;  5BNV B;  5AVC B;  2CV5 A;  4R8P C;  3LZ1 B;  4DRA A;  3C1C B;  4UUZ B;  4NE6 A;  3EPJ A;  3B6F A;  4H9R A;  3MGP A;  4KHA B;  3UTA B;  4NE5 A;  5B32 A;  4R8P D;  4H9S C;  3AV2 B;  4YM6 A;  2Y2O A;  1P3P A;  5GXQ B;  1AOI A;  5B32 G;  3B0D B;  3FDD A;  3X1U D;  1TZY B;  1HQ3 C;  5B24 B;  1U35 B;  1EQZ B;  5DNM B;  3UTB B;  5CPJ B;  1HQ3 D;  4KUD B;  3KSY A;  4JJN B;  4J8X B;  3A1K A;  3KXB A;  3VH5 A;  5AVB C;  1P3I D;  2F2A C;  5C3I B;  4X23 C;  4J8U C;  5BT1 C;  1F66 C;  2BG1 A;  4LD9 D;  1ZLA A;  4Z5T D;  4Z2M G;  3KWQ D;  3O62 C;  1P34 A;  3W97 C;  3MGR A;  5AY8 D;  3AZN A;  5KDM B;  1F66 D;  4CAY B;  3O62 D;  4J8W A;  5AV9 C;  3VH5 T;  5G49 B;  5B33 C;  2F8N G;  5CPK A;  5GT0 B;  3LJA A;  2CV5 C;  4WNN A;  5B33 D;  1P3O B;  1PZR A;  3B6F C;  1KX4 A;  2HUE C;  5B0Y B;  2CV5 D;  5B32 C;  3UT9 B;  3REK A;  5B31 A;  5B1L D;  3C1B A;  3AZE B;  4DQY B;  3AFA B;  5B1M B;  1AOI C;  3AN2 C;  5B31 G;  3AZJ A;  4HGA C;  2XD5 A;  3V9R A;  1AOI D;  3W96 B;  5AV6 B;  3AN2 D;  2FFF B;  3REI B;  3AV1 A;  3REL A;  5JRG B;  3H0R C;  5GT3 B;  3KXB C;  2HIO D;  5CPI D;  5AV5 A;  1S32 A;  4XZQ B;  3LEL B;  1JFI A;  3AZK A;  3KXB D;  1ZLA C;  2NZD A;  1P3G D;  3AZL C;  1P34 C;  3MGR C;  3X1S B;  3LZ0 B;  3AZN C;  1P3B B;  2JSS A;  2Y2J A;  3P5J B;  1KX3 B;  3W99 B;  4Z66 B;  3AZL D;  3X1T B;  1P3F C;  3MVD C;  3X1V A;  2F8N D;  3AZN D;  5CPK C;  3LJA C;  3VH6 A;  4G91 C;  4WV4 B;  1M18 C;  2NQB B;  3WAA B;  1P3F D;  5CP6 C;  2ARO A;  3MVD D;  3TU4 C;  3AZH A;  1Z2C B;  1M18 D;  5CP6 D;  3TU4 D;  3REK C;  2Y2Q A;  1P3K D;  4ZBJ C;  5AV8 B;  2YFW B;  2DF4 C;  5B2J C;  4R8P A;  4UPK A;  3VH6 T;  5FUG A;  3REH C;  5AVC C;  3AZM B;  4WU8 C;  3W98 D;  3WKJ D;  4WU9 B;  4CSR A;  5BO0 A;  5B2J D;  3A6N A;  3AZJ C;  3REH D;  4WU8 D;  5AVC D;  5B0Z C;  3UTA C;  3X1U A;  4H9Q B;  3AZJ D;  3AV1 C;  3KUY B;  3B6G B;  5B0Z D;  3UTA D;  1HQ3 A;  2Y2M A;  1S32 C;  3WTP B;  1TZY C;  1N1J B;  2XD1 A;  5GXQ D;  3AZK C;  1P3I A;  1WWS A;  3UTB C;  1TZY D;  5B40 A;  1B67 A;  3MGS B;  1U35 D;  1M19 B;  4KUD C;  4Z5T A;  3KWQ A;  1W2E A;  5B2I B;  3AZK D;  4LD9 A;  3AZG B;  5AY8 A;  3X1V C;  3UTB D;  5CPJ D;  1F66 A;  4KUD D;  4JJN D;  4M6B A;  3EPL A;  3AZH C;  3IP4 C;  2Y2H A;  4KGC A;  1P3M B;  4QLC B;  1P3L B;  4H9P B;  3AZI B;  3A1I A;  2UWX A;  2ZY5 A;  4H9O A;  1H3O B;  4H9N A;  5B1L A;  5DNN A;  5GT0 D;  3A6N C;  3AYW B;  2G5I C;  5E5A B;  3X1U C;  3A6N D;  5B0Y D;  3AZE C;  3AZF B;  3AN2 A;  5BNX B;  2F8N K;  3AZE D;  3AFA D;  5B1M D;  1P3I C;  1M1A B;  1TAF B;  2HIO A;  5CPI A;  3KFU G;  3W96 C;  4NFT A;  5B40 C;  4LD9 C;  2CWE A;  4Z5T C;  3KWQ C;  4EO5 C;  1B6W A;  1P3G A;  3W96 D;  5AY8 C;  5AV6 D;  5B40 D;  1R4V A;  3H0L C;  3LEL C;  4ZUX A;  5JA4 B;  2RVQ D;  5JRG D;  3EPH A;  3AZL A;  2F8N A;  3AL0 C;  3REJ B;  2IO5 B;  1P3A B;  3LEL D;  3NQU B;  3VH6 W;  3MNN C;  1P3F A;  3MVD A;  1KX3 C;  4KGC C;  2NZD B;  3X1S D;  1P3B D;  1M18 A;  4XUJ B;  3MNN D;  5CP6 A;  4YS3 B;  5F99 B;  3TU4 A;  1P3K A;  1KX3 D;  4KGC D;  3WAA C;  2BYK B;  4Z66 D;  3X1T D;  5B1L C;  5DNN C;  3H0M C;  3WA9 B;  2NQB D;  3R45 A;  4Z2M H;  5GSU B;  4J8V B;  3WAA D;  3W98 A;  3WKJ A;  5DNN D;  5B2J A;  3REH A;  4WU8 A;  5BNV A;  5AVC A;  3LZ1 A;  3C1C A;  4UUZ A;  2F8N H;  4KHA A;  5B0Z A;  3UTA A;  2PYO B;  3AZM D;  2HIO C;  5CPI C;  3AV2 A;  4AWL C;  5GXQ A;  1ID3 B;  3KUY C;  1P3G C;  1TZY A;  1U35 A;  1KX5 C;  2ZY2 A;  3WTP C;  3KUY D;  4ZUX C;  3B6G D;  5DNM A;  3UTB A;  5CPJ A;  1WWI A;  3MGQ B;  4KUD A;  4JJN A;  1KX5 D;  3WTP D;  4ZUX D;  3MGS C;  4J8X A;  1M19 C;  1BH8 B;  3AZG C;  2LY8 A;  3MGS D;  1M19 D;  5B2I D;  1P3K C;  3AZG D;  5AVB B;  5KDM A;  4X23 B;  4CAY A;  4J8U B;  1BH9 B;  3W98 C;  5G49 A;  3WKJ C;  3O62 B;  3W97 B;  5GT0 A;  1P3L C;  3NQJ B;  2FJ7 B;  4E45 A;  3LZ1 C;  3C1C C;  1P3M D;  5AV9 B;  2BYM B;  1P3L D;  1P3O A;  5B33 B;  5B0Y A;  3UT9 A;  3LZ1 D;  3C1C D;  2CV5 B;  3AV2 C;  5E5A C;  3B6F B;  3AZE A;  5GXQ C;  2L5A A;  2HUE B;  4H9R B;  5B1M A;  3AFA A;  3MGP B;  3B0D C;  5B32 B;  3AZF C;  3AV2 D;  5E5A D;  5B24 C;  1U35 C;  1EQZ C;  4YM6 B;  1P3P B;  5DNM C;  3W96 A;  3AZF D;  5AV6 A;  1AOI B;  5CPJ C;  5B24 D;  1EQZ D;  4JJN C;  5JRG A;  4J8X C;  4HGA B;  2JCH A;  5GT3 A;  5DNM D;  5C3I C;  2G5H C;  4XZQ A;  3LEL A;  4J8X D;  3KXB B;  2Y2I A;  1P3A C;  3X1S A;  3LZ0 A;  1P3B A;  3MNN A;  1KX3 A;  3W99 A;  4Z66 A;  3X1T A;  2JE5 A;  3REJ D;  1ZLA B;  1P3A D;  2Y2K A;  3AZL B;  1P34 B;  2F8N B;  5GT0 C;  3MGR B;  3AZN B;  2NQB A;  3WAA A;  2W8S A;  4YS3 C;  4E44 A;  2Y2N A;  4J8W B;  3MVD B;  1P3O C;  5B0Y C;  4XUJ D;  4YS3 D;  3LJA B;  5CPK B;  5F99 D;  3UT9 C;  4G91 B;  3WA9 C;  5AV8 A;  4WNN B;  2YFW A;  1P3O D;  3WA9 D;  3UT9 D;  3AFA C;  5B1M C;  1KX4 B;  5GSU D;  3AZM A;  2ZM5 A;  3REK B;  4ZBJ B;  5B31 B;  3C1B B;  4NE3 A;  2PYO C;  4WU8 B;  5AV6 C;  4H9Q A;  3REI C;  3KUY A;  3B6G A;  5JRG C;  2RVQ C;  2PYO D;  3AZJ B;  1ID3 C;  5GT3 C;  5B0Z B;  3V9R B;  2YFV A;  1KX5 A;  4XZQ C;  3WTP A;  3REI D;  1N1J A;  1Q9C A;  1ID3 D;  5GT3 D;  3AV1 B;  3REL B;  4XZQ D;  3X1S C;  3LZ0 C;  1P3B C;  3MGS A;  3MGQ C;  1S32 B;  1M19 A;  5AV5 B;  5B2I A;  1JFI B;  3B0C W;  3W99 C;  3AZG A;  4Z66 C;  1T3U A;  3AZK B;  3X1T C;  3LZ0 D;  3MGQ D;  2ZY3 A;  2Y2P A;  3W99 D;  2NQB C;  2DQN C;  2J8P A;  3X1V B;  3WTP E;  1KU5 A;  1P3M A;  4QLC A;  5AV8 C;  1P3L A;  2ARO B;  5AVB D;  4H9P A;  4G92 B;  3AZH B;  3AZI A;  4X23 D;  4J8U D;  5BT1 D;  2FJ7 C;  3AZM C;  5AV8 D;  1F1E A;  1H3O A;  4WU9 C;  3W97 D;  3AYW A;  2FJ7 D;  3EPK A;  3EG5 B;  1BFM A;  4R8P B;  5FUG B;  5E5A A;  4WU9 D;  5AV9 D;  1A7W A;  3B6G C;  4CSR B;  5BO0 B;  3A6N B;  2RIQ A;  3AZF A;  3MGP C;  5B24 A;  1EQZ A;  4WJ3 C;  3X1U B;  5BNX A;  3B6F D;  4YM6 C;  3MGP D;  5B32 D;  1TAF A;  1P3P C;  1M1A A;  1HQ3 B;  4YM6 D;  5B2I C;  1P3P D;  5CHL B;  1P3I B;  1HTA A;  4DRB A;  5JA4 A;  5B40 B;  4LD9 B;  4Z5T B;  3KWQ B;  3REJ A;  4EO5 B;  1P3A A;  5AY8 B;  3NQU A;  1F66 B;  1P3M C;  2Y2G A;  4QLC C;  4WZS B;  3AZI C;  4XUJ A;  4YS3 A;  3B0C T;  5F99 A;  2VQR A;  3MNN B;  2BYK A;  4QLC D;  1ZLA D;  4KGC B;  3AZI D;  4J8W C;  1P34 D;  2ZY4 A;  3MGR D;  3WA9 A;  3AYW C;  5BS7 A;  5GSU A;  4J8V A;  1ULY A;  4H9O B;  4J8W D;  4H9N B;  5B1L B;  5DNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...