1AOIB

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
molecule tags Dna binding protein/dna
source organism Xenopus laevis
total genus 27
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiB00
3WTPB 3AN2A 1P3LC 1P3AB 5GT0B 4R8PA 5AVCB 5F99C 3KWQB 4QLCC 2F8NK 3WKJC 2LY8A 4KUDA 5CPIB 5CPJD 1HQ3B 4WU9C 3WA9C 2HIOD 3WAAC 5BS7A 3C1CD 1P34D 5AV8A 1M18D 5AVBA 4H9OB 5AV9D 5GXQC 2FJ7C 4KHAA 5BT1C 3MNNB 4H9PB 4Z66B 3AZED 5DNNA 5B31D 1BH8A 5B1LB 1KX4C 1ID3B 3A6ND 1N1JB 3MVDD 3B6GA 3AZGA 3AV2A 3AV1A 5B31G 5AV5C 3AZLC 5E5AD 4WU8B 4ZUXD 5CPKD 4JJNC 3AZFB 3AFAD 2BYMB 3AZID 5JRGB 4J8VC 3REKD 1JFIA 3KXBC 4R8PB 3MGQA 3X1UC 3X1SD 5B32C 4NFTA 3X1VC 5B2ID 1AOID 4J8UD 3UT9C 5B0YC 3MGRC 5AVBB 4WU9D 3UTBD 3O62C 2CV5D 2AROA 3LZ0A 3REHB 3W99D 5DNNB 2PYOC 1M19C 5DNMA 5AY8C 1BH8B 1P3BA 5GXQD 2FJ7D 1U35A 5BT1D 1B67A 3LELC 3AZJA 3B6GB 4KGCA 3AV2B 3AV1B 3LJAC 2NZDC 2CWEA 3W97D 5CHLB 4X23C 3LZ1C 1KX4D 1KX3A 5B24C 5AV6C 5CP6C 3TU4A 3C1BD 2F8ND 3AZLD 3V9RB 4G91B 1JFIB 5B2JB 4XUJB 1EQZA 3MGQB 5B0ZB 2F8NG 3R45B 3W96A 3WTPA 3AN2D 1P3OA 3RELB 4J8VD 1P34C 1M18C 3MGPD 5GT0A 4KUDD 3KXBD 4WNNB 5CPIA 1P3FB 1HQ3A 3X1UD 5AV9C 5B32D 1M1AC 1P3MD 3REJA 3AZMA 3B0DB 4Z5TC 4J8XD 3AYWC 3LZ0B 4J8WB 5B1MB 4EO5C 3X1VD 5B31C 1P3PA 2YFWA 4YS3D 4YM6C 5B32G 1S32C 3MNNA 1P3BB 3X1TD 4H9PA 3O62D 1KX5C 1TZYC 3AZJB 4KGCB 5CPJB 5E5AC 5BO0A 5B1LA 5AY8D 2HIOB 1WWSA 5G49B 4ZUXC 1P3KC 1N1JA 5CPKC 3AZGD 4QLCA 1F66C 3LELD 3AFAC 3TU4B 3LJAD 3REKC 4LD9D 2NZDD 3AZHB 1P3GC 3WAAA 3LZ1D 5B24D 2RVQC 5AV6D 1EQZB 2BYMA 5CP6D 5JRGA 3B0BA 1P3AC 3W96B 1P3OB 5AVCC 1P3IC 5B2IC 1AOIC 4J8UC 5B33C 3UTBC 2CV5C 5BNXB 3REJB 3AZMB 3REID 4HGAC 3W99C 5B40C 1F1EA 5C3IB 1P3PB 5AV5A 5FUGB 2YFWB 4XZQC 4CAYA 1H3OB 2AROD 1M1AD 3W98C 5GT3D 3REHA 3AYWD 1ZLAB 4Z5TD 3X1SB 5BNVB 3UTAB 3W97C 5BO0B 4YM6D 1S32D 1P3LB 1KX5D 5F99B 1TZYD 4QLCB 3WKJB 3C1BC 3WA9B 4WV4B 3KUYD 1P3KD 3WAAB 3AZNC 1ULYA 3MGSD 3UT9A 1F66D 4WZSB 3AN2C 5GXQB 2FJ7B 3V9RA 1P3GD 4R8PC 3MGPC 3B6FD 5B2JA 4KUDC 5GSUD 2PYOA 4XUJA 5B0ZA 2RVQD 2NQBD 3AZKA 3R45A 1R4VA 3RELA 1P3MC 5BS7C 4J8XC 5AV8C 1P3AD 5GT0D 5AVCD 1P3ID 4NE3A 3KWQD 4H9RB 4WNNA 1P3FA 1HQ3D 4Z2MG 1TAFB 4YS3C 5B33D 5AV5B 3AZLB 2BYKB 1Q9CA 4CAYB 3X1TC 5DNNC 4J8WA 5B1MA 4JJNB 5B40D 3B0CW 3MNND 4H9SA 4XZQD 4Z66D 3B6GC 3AZGC 3AV2C 3W98D 3KXBB 5CPJA 4LD9C 5B1LD 5B32B 1ID3D 2HIOA 5G49A 3C1CA 1P34A 4M6BA 1M18A 2IO5C 5AV9A 3UT9B 5B0YB 3MGRB 4WU8D 1WWIA 3AZHA 4G92B 3O62B 2HUEC 3AZEA 3B0CT 3AZND 3AZFD 4AWLC 2PYOB 5JRGD 1M19B 5AY8B 4E45A 3AZKB 3A6NA 3MVDA 3REIC 4R8PD 3LJAB 5E5AA 2AROC 5BNXA 5GT3C 4X23B 5AV8D 4NE5A 5AV6B 5DNMC 5AVBD 3AZIA 5FUGA 4DRBA 3REKA 4ZBJC 1P3BC 1U35C 1H3OA 3AZJC 1ZLAA 4KGCC 5DNND 3X1SA 5BNVA 3UTAA 3KUYC 1P3LA 1KX3C 5B2IA 3C1CB 1P34B 1M18B 1AOIA 3B6GD 3AV2D 5F99A 3AV1D 3MGSC 4J8UA 3WKJA 3UTBA 5AV9B 4WU9A 3WA9A 2CV5A 3B6FC 3AZEB 4DRAA 5GSUC 3W99A 1EQZC 3KSYA 5B31B 2NQBC 3W96C 3WTPC 3VH5W 5GXQA 2FJ7A 1S32B 3A6NB 5GT0C 3MVDB 3KWQC 5B2JD 1KX5B 5CPIC 3MGQD 1HQ3C 5B0ZD 3W97A 5E5AB 3AZMC 1KX4A 4ZUXB 5CPKB 1P3PC 2JSSA 4H9RA 1P3FD 1TAFA 3AFAB 3C1BA 3AZIB 3AZLA 3MNNC 3REKB 2BYKA 4Z66C 1P3GB 3VH5T 3LZ0D 4UUZA 5B1MD 3NQJB 4JJNA 5B1LC 5DNMD 1ID3C 1HTAA 4J8VA 1P3BD 3MGPA 1U35D 1P3IB 2YFVA 5B2IB 3AZJD 3KXBA 4KGCD 1AOIB 3X1UA 4J8UB 4WU8C 5B33B 5B32A 3UTBB 4WU9B 1P3MA 2CV5B 4J8XA 1KX3D 3X1VA 3AZFC 4H9QB 4HGAB 5B40B 3W99B 5JRGC 3TU4D 5B0YA 3MGRA 4CSRB 4YS3A 3AZHD 4XZQB 3O62A 3X1TA 3W98B 3WTPE 3NQUA 1EQZD 1BH9A 1M19A 5AY8A 3W97B 3WTPD 3W96D 1P3OD 1KX4B 3LELA 1A7WA 5AVBC 5CPID 5KDMA 3LJAA 4LD9A 2NZDA 3C1BB 2F8NB 3REHC 3REJD 4X23A 3LZ1A 3AZMD 3AZNB 5B24A 4UUZB 5AV6A 4Z2MH 1P3PD 5CP6A 3AN2B 4J8VB 1ZLAD 3MGPB 3AV1C 2YFVB 4KUDB 3UTAD 3X1UB 1P3LD 1P3MB 4J8XB 5AV8B 3REIA 5F99D 4QLCD 3X1VB 3WKJD 3VH6A 4G92C 3WA9D 4YS3B 4KHAB 1M1AA 4G91C 3WAAD 5GT3A 3X1TB 3AYWA 5B2JC 4Z5TA 4XUJC 3MGQC 5B0ZC 3NQUB 5B31A 3AZKC 1BH9B 3RELC 4YM6A 1S32A 3AZGB 1KX5A 3VH5A 1TZYA 1P3FC 3LELB 4E44A 1B6WA 5KDMB 4LD9B 3KUYA 4H9NA 2F8NH 2NZDB 1KU5A 3B0DC 4ZUXA 1P3KA 3LZ0C 4J8WC 5B1MC 3LZ1B 5CPKA 3MGSA 5B24B 1F66A 3AFAA 5CP6B 5JA4A 2IO5B 5AV5D 4H9SC 4NE6A 1P3GA 3B6FA 2HUEB 3REHD 3NQJA 5GSUA 4JJND 5CPJC 2NQBA 4AWLB 1BFMA 2HIOC 3C1CC 1P3AA 5AVCA 1P3IA 3KWQA 3VH6W 3REIB 2L5AA 3TU4C 5B33A 3AZHC 3AZEC 2AROB 1M1AB 5GT3B 3AYWB 4Z5TB 4H9QA 5B40A 4H9OA 4EO5B 3UT9D 5B0YD 3MGRD 5DNMB 4CSRA 3A6NC 4ZBJB 4XZQA 3MVDC 4Z66A 1P3OC 1U35B 4YM6B 3W98A 2PYOD 1TZYB 3VH6T 4XUJD 1M19D 3AZKD 1ID3A 3KUYB 4H9NB 3RELD 3REJC 1P3KB 1KX3B 5C3IC 3AZIC 3MGSB 1F66B 4WU8A 2F8NA 5JA4B 1ZLAC 4X23D 3B6FB 3AZNA 3X1SC 4J8WD 3AZFA 3UTAC 5GSUB 2NQBB
chains in the Genus database with same CATH superfamily
3WTPB 3AN2A 1P3LC 1P3AB 5GT0B 4R8PA 5AVCB 5F99C 3KWQB 4QLCC 2F8NK 3WKJC 2LY8A 4KUDA 5CPIB 5CPJD 1HQ3B 4WU9C 3WA9C 2HIOD 3WAAC 5BS7A 3C1CD 1P34D 5AV8A 1M18D 5AVBA 2Y2NA 4H9OB 5AV9D 5GXQC 2FJ7C 4KHAA 5BT1C 3MNNB 4H9PB 4Z66B 3AZED 5DNNA 5B31D 1BH8A 5B1LB 1KX4C 1ID3B 2ZY4A 3A6ND 1N1JB 3MVDD 3B6GA 3P5JB 3AZGA 3AV2A 3AV1A 5B31G 2XD1A 5AV5C 3AZLC 5E5AD 4WU8B 4ZUXD 5CPKD 4JJNC 3AZFB 3AFAD 2BYMB 2ZM5A 5JRGB 3AZID 4J8VC 3REKD 1JFIA 3KXBC 3EPHA 4R8PB 3MGQA 3X1UC 2J8PA 3X1SD 5B32C 4NFTA 3X1VC 5B2ID 1AOID 4J8UD 3UT9C 5B0YC 3MGRC 5AVBB 4WU9D 3UTBD 3O62C 2CV5D 2AROA 3LZ0A 3REHB 3W99D 5DNNB 2PYOC 1M19C 5DNMA 5AY8C 1BH8B 1P3BA 5GXQD 2FJ7D 1U35A 5BT1D 1B67A 2DQNC 3LELC 3AZJA 3B6GB 4KGCA 2DF4C 3AV2B 3AV1B 3LJAC 2NZDC 2CWEA 3W97D 5CHLB 4X23C 3LZ1C 1KX4D 1KX3A 5B24C 5AV6C 5CP6C 3TU4A 3C1BD 2F8ND 3AZLD 3V9RB 4G91B 1JFIB 5B2JB 2Y2GA 2Y2MA 4XUJB 3MGQB 1EQZA 5B0ZB 2F8NG 3R45B 3W96A 3WTPA 3AN2D 1P3OA 3RELB 4J8VD 2ZY2A 1P34C 1M18C 3MGPD 5GT0A 4KUDD 3KXBD 4WNNB 5CPIA 1P3FB 1HQ3A 3X1UD 5AV9C 5B32D 1M1AC 1P3MD 3REJA 3AZMA 3B0DB 4Z5TC 4J8XD 3AYWC 3LZ0B 4J8WB 5B1MB 4EO5C 3X1VD 5B31C 1P3PA 2YFWA 4YS3D 5B32G 4YM6C 1S32C 3MNNA 1P3BB 3X1TD 4H9PA 3O62D 1KX5C 1TZYC 3AZJB 4KGCB 5CPJB 5E5AC 5BO0A 2Y2KA 5B1LA 5AY8D 2HIOB 1WWSA 5G49B 4ZUXC 1P3KC 1N1JA 5CPKC 3AZGD 4QLCA 1F66C 3LELD 3AFAC 3TU4B 3LJAD 3REKC 4LD9D 2NZDD 3AZHB 1P3GC 3WAAA 2Y2OA 3LZ1D 2W8SA 5B24D 2RVQC 5AV6D 1EQZB 2BYMA 5CP6D 5JRGA 3B0BA 1P3AC 3W96B 1P3OB 5AVCC 1P3IC 5B2IC 1AOIC 2JE5A 4J8UC 5B33C 3UTBC 3KFUG 2CV5C 5BNXB 3REJB 3AZMB 3REID 4HGAC 3W99C 2Y2QA 5B40C 1F1EA 5C3IB 1P3PB 5AV5A 5FUGB 2YFWB 4XZQC 4CAYA 1H3OB 2AROD 1M1AD 3W98C 5GT3D 3REHA 3AYWD 1ZLAB 4Z5TD 3X1SB 5BNVB 3UTAB 3W97C 5BO0B 4YM6D 1S32D 1P3LB 2Y2JA 1KX5D 5F99B 1TZYD 4QLCB 3WKJB 3C1BC 3WA9B 4WV4B 3KUYD 1P3KD 3WAAB 3AZNC 3IP4C 1ULYA 3MGSD 3UT9A 1F66D 4WZSB 3AN2C 5GXQB 2FJ7B 3H0MC 3V9RA 1P3GD 4R8PC 3MGPC 3B6FD 5B2JA 4KUDC 5GSUD 2PYOA 4XUJA 5B0ZA 2RVQD 2NQBD 3AZKA 3R45A 1R4VA 3RELA 1P3MC 5BS7C 4J8XC 5AV8C 1P3AD 5GT0D 5AVCD 1P3ID 4NE3A 3KWQD 4H9RB 4WNNA 1P3FA 1HQ3D 4Z2MG 1TAFB 4YS3C 5B33D 5AV5B 3AZLB 2BYKB 1Q9CA 4CAYB 3X1TC 2Y2PA 5DNNC 1T3UA 5B1MA 4J8WA 4JJNB 5B40D 2G5IC 3B0CW 3FDDA 3MNND 4H9SA 4XZQD 4DQYB 4Z66D 3B6GC 3AZGC 3EPJA 3AV2C 3W98D 3KXBB 5CPJA 4LD9C 5B1LD 5B32B 1ID3D 2HIOA 2VQRA 5G49A 3C1CA 1P34A 4M6BA 1M18A 2IO5C 5AV9A 3UT9B 5B0YB 3MGRB 3A1IA 4WU8D 1WWIA 3AZHA 4G92B 3O62B 2HUEC 3AZEA 3B0CT 3AZND 3AZFD 4AWLC 2PYOB 5JRGD 1M19B 5AY8B 4E45A 3AZKB 3A6NA 3MVDA 3REIC 4R8PD 3LJAB 5E5AA 2AROC 2JCHA 5BNXA 5GT3C 4X23B 5AV8D 3EPKA 5AV6B 4NE5A 5DNMC 5AVBD 3AZIA 5FUGA 4DRBA 3REKA 4ZBJC 1P3BC 2RIQA 3H0LC 1U35C 1H3OA 3AZJC 1ZLAA 4KGCC 5DNND 3X1SA 5BNVA 3UTAA 3KUYC 1P3LA 1KX3C 5B2IA 3C1CB 1P34B 1M18B 1AOIA 3B6GD 3AV2D 5F99A 3AV1D 3MGSC 4J8UA 3WKJA 3UTBA 5AV9B 4WU9A 3WA9A 2CV5A 3B6FC 3AZEB 4DRAA 5GSUC 3W99A 1EQZC 3KSYA 5B31B 2NQBC 3W96C 3WTPC 3VH5W 5GXQA 2FJ7A 1S32B 3A6NB 5GT0C 3MVDB 3KWQC 5B2JD 1KX5B 5CPIC 3MGQD 1HQ3C 5B0ZD 3W97A 5E5AB 2XD5A 3AZMC 2ZY3A 1KX4A 4ZUXB 5CPKB 1P3PC 2JSSA 4H9RA 1P3FD 1TAFA 3AFAB 3C1BA 3AZIB 3AZLA 3MNNC 3REKB 2BYKA 4Z66C 1P3GB 3VH5T 3LZ0D 4UUZA 5B1MD 3NQJB 4JJNA 5B1LC 5DNMD 1ID3C 1HTAA 4J8VA 1P3BD 3MGPA 1U35D 1P3IB 2YFVA 5B2IB 3AZJD 3KXBA 4KGCD 1AOIB 3X1UA 4J8UB 4WU8C 5B33B 5B32A 3UTBB 4WU9B 1P3MA 2CV5B 4J8XA 3EPLA 1KX3D 3X1VA 3AZFC 4H9QB 4HGAB 5B40B 3W99B 5JRGC 3TU4D 1Z2CB 5B0YA 4CSRB 3MGRA 4YS3A 3AZHD 4XZQB 3O62A 3X1TA 2Y2IA 3W98B 2UWXA 3WTPE 2ZY5A 3NQUA 1EQZD 1BH9A 1M19A 5AY8A 3W97B 3WTPD 3W96D 1P3OD 1KX4B 3LELA 1A7WA 5AVBC 5CPID 5KDMA 3LJAA 4LD9A 2NZDA 2F2AC 3C1BB 2F8NB 3REHC 3REJD 4X23A 3LZ1A 3AZMD 3AZNB 5B24A 4UUZB 5AV6A 4Z2MH 1P3PD 5CP6A 3AN2B 4J8VB 1ZLAD 3MGPB 3AV1C 2Y2LA 2YFVB 4KUDB 3UTAD 3X1UB 1P3LD 1P3MB 4J8XB 5AV8B 3REIA 3A1KA 5F99D 4QLCD 3X1VB 3WKJD 3VH6A 4G92C 3WA9D 4YS3B 4KHAB 1M1AA 4G91C 3WAAD 5GT3A 3X1TB 3AYWA 5B2JC 4Z5TA 4XUJC 3MGQC 5B0ZC 3NQUB 5B31A 3AZKC 1BH9B 3RELC 4YM6A 1S32A 3H0RC 3AZGB 1KX5A 3VH5A 1TZYA 1P3FC 3LELB 4E44A 1B6WA 4UPKA 5KDMB 3KUYA 4H9NA 2F8NH 4LD9B 2NZDB 1KU5A 3B0DC 4ZUXA 1P3KA 3LZ0C 4J8WC 5B1MC 3LZ1B 5CPKA 3MGSA 5B24B 2G5HC 3F6TA 1F66A 3AFAA 5CP6B 5JA4A 2IO5B 5AV5D 4H9SC 4NE6A 1P3GA 3B6FA 2HUEB 3REHD 3NQJA 5GSUA 4JJND 5CPJC 2NQBA 4AWLB 1BFMA 2HIOC 3C1CC 1P3AA 3AL0C 4WJ3C 5AVCA 1P3IA 3KWQA 3VH6W 3REIB 2L5AA 1PZRA 3TU4C 5B33A 3AZHC 3AZEC 2AROB 3EG5B 1M1AB 5GT3B 3AYWB 4Z5TB 4H9QA 5B40A 4H9OA 2FFFB 4EO5B 3UT9D 5B0YD 3MGRD 5DNMB 1W2EA 4CSRA 3A6NC 4ZBJB 4XZQA 3MVDC 4Z66A 1P3OC 1U35B 4YM6B 3W98A 2PYOD 1TZYB 3VH6T 4XUJD 1M19D 3AZKD 1ID3A 3KUYB 4H9NB 3RELD 3REJC 1P3KB 1KX3B 5C3IC 2BG1A 3AZIC 3MGSB 1F66B 4WU8A 2F8NA 5JA4B 1ZLAC 4X23D 3B6FB 3AZNA 3X1SC 4J8WD 3AZFA 3UTAC 5GSUB 2Y2HA 2NQBB
chains in the Genus database with same CATH topology
3WTPB 3AN2A 1P3LC 1P3AB 5GT0B 4R8PA 5AVCB 5F99C 3KWQB 4QLCC 2F8NK 3WKJC 2LY8A 4KUDA 5CPIB 5CPJD 1HQ3B 4WU9C 3WA9C 2HIOD 3WAAC 5BS7A 3C1CD 1P34D 5AV8A 1M18D 5AVBA 2Y2NA 4H9OB 5AV9D 5GXQC 2FJ7C 4KHAA 5BT1C 3MNNB 4H9PB 4Z66B 3AZED 5DNNA 5B31D 1BH8A 5B1LB 1KX4C 1ID3B 2ZY4A 3A6ND 1N1JB 3MVDD 3B6GA 3P5JB 3AZGA 3AV2A 3AV1A 5B31G 2XD1A 5AV5C 3AZLC 5E5AD 4WU8B 4ZUXD 5CPKD 4JJNC 3AZFB 3AFAD 2BYMB 2ZM5A 5JRGB 3AZID 4J8VC 3REKD 1JFIA 3KXBC 3EPHA 4R8PB 3MGQA 3X1UC 2J8PA 3X1SD 5B32C 4NFTA 3X1VC 5B2ID 1AOID 4J8UD 3UT9C 5B0YC 3MGRC 5AVBB 4WU9D 3UTBD 3O62C 2CV5D 2AROA 3LZ0A 3REHB 3W99D 5DNNB 2PYOC 1M19C 5DNMA 5AY8C 1BH8B 1P3BA 5GXQD 2FJ7D 1U35A 5BT1D 1B67A 2DQNC 3LELC 3AZJA 3B6GB 4KGCA 2DF4C 3AV2B 3AV1B 3LJAC 2NZDC 2CWEA 3W97D 5CHLB 4X23C 3LZ1C 1KX4D 1KX3A 5B24C 5AV6C 5CP6C 3TU4A 3C1BD 2F8ND 3AZLD 3V9RB 4G91B 1JFIB 5B2JB 2Y2GA 2Y2MA 4XUJB 3MGQB 1EQZA 5B0ZB 2F8NG 3R45B 3W96A 3WTPA 3AN2D 1P3OA 3RELB 4J8VD 2ZY2A 1P34C 1M18C 3MGPD 5GT0A 4KUDD 3KXBD 4WNNB 5CPIA 1P3FB 1HQ3A 3X1UD 5AV9C 5B32D 1M1AC 1P3MD 3REJA 3AZMA 3B0DB 4Z5TC 4J8XD 3AYWC 3LZ0B 4J8WB 5B1MB 4EO5C 3X1VD 5B31C 1P3PA 2YFWA 4YS3D 5B32G 4YM6C 1S32C 3MNNA 1P3BB 3X1TD 4H9PA 3O62D 1KX5C 1TZYC 3AZJB 4KGCB 5CPJB 5E5AC 5BO0A 2Y2KA 5B1LA 5AY8D 2HIOB 1WWSA 5G49B 4ZUXC 1P3KC 1N1JA 5CPKC 3AZGD 4QLCA 1F66C 3LELD 3AFAC 3TU4B 3LJAD 3REKC 4LD9D 2NZDD 3AZHB 1P3GC 3WAAA 2Y2OA 3LZ1D 2W8SA 5B24D 2RVQC 5AV6D 1EQZB 2BYMA 5CP6D 5JRGA 3B0BA 1P3AC 3W96B 1P3OB 5AVCC 1P3IC 5B2IC 1AOIC 2JE5A 4J8UC 5B33C 3UTBC 3KFUG 2CV5C 5BNXB 3REJB 3AZMB 3REID 4HGAC 3W99C 2Y2QA 5B40C 1F1EA 5C3IB 1P3PB 5AV5A 5FUGB 2YFWB 4XZQC 4CAYA 1H3OB 2AROD 1M1AD 3W98C 5GT3D 3REHA 3AYWD 1ZLAB 4Z5TD 3X1SB 5BNVB 3UTAB 3W97C 5BO0B 4YM6D 1S32D 1P3LB 2Y2JA 1KX5D 5F99B 1TZYD 4QLCB 3WKJB 3C1BC 3WA9B 4WV4B 3KUYD 1P3KD 3WAAB 3AZNC 3IP4C 1ULYA 3MGSD 3UT9A 1F66D 4WZSB 3AN2C 5GXQB 2FJ7B 3H0MC 3V9RA 1P3GD 4R8PC 3MGPC 3B6FD 5B2JA 4KUDC 5GSUD 2PYOA 4XUJA 5B0ZA 2RVQD 2NQBD 3AZKA 3R45A 1R4VA 3RELA 1P3MC 5BS7C 4J8XC 5AV8C 1P3AD 5GT0D 5AVCD 1P3ID 4NE3A 3KWQD 4H9RB 4WNNA 1P3FA 1HQ3D 4Z2MG 1TAFB 4YS3C 5B33D 5AV5B 3AZLB 2BYKB 1Q9CA 4CAYB 3X1TC 2Y2PA 5DNNC 1T3UA 5B1MA 4J8WA 4JJNB 5B40D 2G5IC 3B0CW 3FDDA 3MNND 4H9SA 4XZQD 4DQYB 4Z66D 3B6GC 3AZGC 3EPJA 3AV2C 3W98D 3KXBB 5CPJA 4LD9C 5B1LD 5B32B 1ID3D 2HIOA 2VQRA 5G49A 3C1CA 1P34A 4M6BA 1M18A 2IO5C 5AV9A 3UT9B 5B0YB 3MGRB 3A1IA 4WU8D 1WWIA 3AZHA 4G92B 3O62B 2HUEC 3AZEA 3B0CT 3AZND 3AZFD 4AWLC 2PYOB 5JRGD 1M19B 5AY8B 4E45A 3AZKB 3A6NA 3MVDA 3REIC 4R8PD 3LJAB 5E5AA 2AROC 2JCHA 5BNXA 5GT3C 4X23B 5AV8D 3EPKA 5AV6B 4NE5A 5DNMC 5AVBD 3AZIA 5FUGA 4DRBA 3REKA 4ZBJC 1P3BC 2RIQA 3H0LC 1U35C 1H3OA 3AZJC 1ZLAA 4KGCC 5DNND 3X1SA 5BNVA 3UTAA 3KUYC 1P3LA 1KX3C 5B2IA 3C1CB 1P34B 1M18B 1AOIA 3B6GD 3AV2D 5F99A 3AV1D 3MGSC 4J8UA 3WKJA 3UTBA 5AV9B 4WU9A 3WA9A 2CV5A 3B6FC 3AZEB 4DRAA 5GSUC 3W99A 1EQZC 3KSYA 5B31B 2NQBC 3W96C 3WTPC 3VH5W 5GXQA 2FJ7A 1S32B 3A6NB 5GT0C 3MVDB 3KWQC 5B2JD 1KX5B 5CPIC 3MGQD 1HQ3C 5B0ZD 3W97A 5E5AB 2XD5A 3AZMC 2ZY3A 1KX4A 4ZUXB 5CPKB 1P3PC 2JSSA 4H9RA 1P3FD 1TAFA 3AFAB 3C1BA 3AZIB 3AZLA 3MNNC 3REKB 2BYKA 4Z66C 1P3GB 3VH5T 3LZ0D 4UUZA 5B1MD 3NQJB 4JJNA 5B1LC 5DNMD 1ID3C 1HTAA 4J8VA 1P3BD 3MGPA 1U35D 1P3IB 2YFVA 5B2IB 3AZJD 3KXBA 4KGCD 1AOIB 3X1UA 4J8UB 4WU8C 5B33B 5B32A 3UTBB 4WU9B 1P3MA 2CV5B 4J8XA 3EPLA 1KX3D 3X1VA 3AZFC 4H9QB 4HGAB 5B40B 3W99B 5JRGC 3TU4D 1Z2CB 5B0YA 4CSRB 3MGRA 4YS3A 3AZHD 4XZQB 3O62A 3X1TA 2Y2IA 3W98B 2UWXA 3WTPE 2ZY5A 3NQUA 1EQZD 1BH9A 1M19A 5AY8A 3W97B 3WTPD 3W96D 1P3OD 1KX4B 3LELA 1A7WA 5AVBC 5CPID 5KDMA 3LJAA 4LD9A 2NZDA 2F2AC 3C1BB 2F8NB 3REHC 3REJD 4X23A 3LZ1A 3AZMD 3AZNB 5B24A 4UUZB 5AV6A 4Z2MH 1P3PD 5CP6A 3AN2B 4J8VB 1ZLAD 3MGPB 3AV1C 2Y2LA 2YFVB 4KUDB 3UTAD 3X1UB 1P3LD 1P3MB 4J8XB 5AV8B 3REIA 3A1KA 5F99D 4QLCD 3X1VB 3WKJD 3VH6A 4G92C 3WA9D 4YS3B 4KHAB 1M1AA 4G91C 3WAAD 5GT3A 3X1TB 3AYWA 5B2JC 4Z5TA 4XUJC 3MGQC 5B0ZC 3NQUB 5B31A 3AZKC 1BH9B 3RELC 4YM6A 1S32A 3H0RC 3AZGB 1KX5A 3VH5A 1TZYA 1P3FC 3LELB 4E44A 1B6WA 4UPKA 5KDMB 3KUYA 4H9NA 2F8NH 4LD9B 2NZDB 1KU5A 3B0DC 4ZUXA 1P3KA 3LZ0C 4J8WC 5B1MC 3LZ1B 5CPKA 3MGSA 5B24B 2G5HC 3F6TA 1F66A 3AFAA 5CP6B 5JA4A 2IO5B 5AV5D 4H9SC 4NE6A 1P3GA 3B6FA 2HUEB 3REHD 3NQJA 5GSUA 4JJND 5CPJC 2NQBA 4AWLB 1BFMA 2HIOC 3C1CC 1P3AA 3AL0C 4WJ3C 5AVCA 1P3IA 3KWQA 3VH6W 3REIB 2L5AA 1PZRA 3TU4C 5B33A 3AZHC 3AZEC 2AROB 3EG5B 1M1AB 5GT3B 3AYWB 4Z5TB 4H9QA 5B40A 4H9OA 2FFFB 4EO5B 3UT9D 5B0YD 3MGRD 5DNMB 1W2EA 4CSRA 3A6NC 4ZBJB 4XZQA 3MVDC 4Z66A 1P3OC 1U35B 4YM6B 3W98A 2PYOD 1TZYB 3VH6T 4XUJD 1M19D 3AZKD 1ID3A 3KUYB 4H9NB 3RELD 3REJC 1P3KB 1KX3B 5C3IC 2BG1A 3AZIC 3MGSB 1F66B 4WU8A 2F8NA 5JA4B 1ZLAC 4X23D 3B6FB 3AZNA 3X1SC 4J8WD 3AZFA 3UTAC 5GSUB 2Y2HA 2NQBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTP B;  3AN2 A;  1P3L C;  1P3A B;  5GT0 B;  4R8P A;  5AVC B;  5F99 C;  3KWQ B;  4QLC C;  2F8N K;  3WKJ C;  2LY8 A;  4KUD A;  5CPI B;  5CPJ D;  1HQ3 B;  4WU9 C;  3WA9 C;  2HIO D;  3WAA C;  5BS7 A;  3C1C D;  1P34 D;  5AV8 A;  1M18 D;  5AVB A;  4H9O B;  5AV9 D;  5GXQ C;  2FJ7 C;  4KHA A;  5BT1 C;  3MNN B;  4H9P B;  4Z66 B;  3AZE D;  5DNN A;  5B31 D;  1BH8 A;  5B1L B;  1KX4 C;  1ID3 B;  3A6N D;  1N1J B;  3MVD D;  3B6G A;  3AZG A;  3AV2 A;  3AV1 A;  5B31 G;  5AV5 C;  3AZL C;  5E5A D;  4WU8 B;  4ZUX D;  5CPK D;  4JJN C;  3AZF B;  3AFA D;  2BYM B;  3AZI D;  5JRG B;  4J8V C;  3REK D;  1JFI A;  3KXB C;  4R8P B;  3MGQ A;  3X1U C;  3X1S D;  5B32 C;  4NFT A;  3X1V C;  5B2I D;  1AOI D;  4J8U D;  3UT9 C;  5B0Y C;  3MGR C;  5AVB B;  4WU9 D;  3UTB D;  3O62 C;  2CV5 D;  2ARO A;  3LZ0 A;  3REH B;  3W99 D;  5DNN B;  2PYO C;  1M19 C;  5DNM A;  5AY8 C;  1BH8 B;  1P3B A;  5GXQ D;  2FJ7 D;  1U35 A;  5BT1 D;  1B67 A;  3LEL C;  3AZJ A;  3B6G B;  4KGC A;  3AV2 B;  3AV1 B;  3LJA C;  2NZD C;  2CWE A;  3W97 D;  5CHL B;  4X23 C;  3LZ1 C;  1KX4 D;  1KX3 A;  5B24 C;  5AV6 C;  5CP6 C;  3TU4 A;  3C1B D;  2F8N D;  3AZL D;  3V9R B;  4G91 B;  1JFI B;  5B2J B;  4XUJ B;  1EQZ A;  3MGQ B;  5B0Z B;  2F8N G;  3R45 B;  3W96 A;  3WTP A;  3AN2 D;  1P3O A;  3REL B;  4J8V D;  1P34 C;  1M18 C;  3MGP D;  5GT0 A;  4KUD D;  3KXB D;  4WNN B;  5CPI A;  1P3F B;  1HQ3 A;  3X1U D;  5AV9 C;  5B32 D;  1M1A C;  1P3M D;  3REJ A;  3AZM A;  3B0D B;  4Z5T C;  4J8X D;  3AYW C;  3LZ0 B;  4J8W B;  5B1M B;  4EO5 C;  3X1V D;  5B31 C;  1P3P A;  2YFW A;  4YS3 D;  4YM6 C;  5B32 G;  1S32 C;  3MNN A;  1P3B B;  3X1T D;  4H9P A;  3O62 D;  1KX5 C;  1TZY C;  3AZJ B;  4KGC B;  5CPJ B;  5E5A C;  5BO0 A;  5B1L A;  5AY8 D;  2HIO B;  1WWS A;  5G49 B;  4ZUX C;  1P3K C;  1N1J A;  5CPK C;  3AZG D;  4QLC A;  1F66 C;  3LEL D;  3AFA C;  3TU4 B;  3LJA D;  3REK C;  4LD9 D;  2NZD D;  3AZH B;  1P3G C;  3WAA A;  3LZ1 D;  5B24 D;  2RVQ C;  5AV6 D;  1EQZ B;  2BYM A;  5CP6 D;  5JRG A;  3B0B A;  1P3A C;  3W96 B;  1P3O B;  5AVC C;  1P3I C;  5B2I C;  1AOI C;  4J8U C;  5B33 C;  3UTB C;  2CV5 C;  5BNX B;  3REJ B;  3AZM B;  3REI D;  4HGA C;  3W99 C;  5B40 C;  1F1E A;  5C3I B;  1P3P B;  5AV5 A;  5FUG B;  2YFW B;  4XZQ C;  4CAY A;  1H3O B;  2ARO D;  1M1A D;  3W98 C;  5GT3 D;  3REH A;  3AYW D;  1ZLA B;  4Z5T D;  3X1S B;  5BNV B;  3UTA B;  3W97 C;  5BO0 B;  4YM6 D;  1S32 D;  1P3L B;  1KX5 D;  5F99 B;  1TZY D;  4QLC B;  3WKJ B;  3C1B C;  3WA9 B;  4WV4 B;  3KUY D;  1P3K D;  3WAA B;  3AZN C;  1ULY A;  3MGS D;  3UT9 A;  1F66 D;  4WZS B;  3AN2 C;  5GXQ B;  2FJ7 B;  3V9R A;  1P3G D;  4R8P C;  3MGP C;  3B6F D;  5B2J A;  4KUD C;  5GSU D;  2PYO A;  4XUJ A;  5B0Z A;  2RVQ D;  2NQB D;  3AZK A;  3R45 A;  1R4V A;  3REL A;  1P3M C;  5BS7 C;  4J8X C;  5AV8 C;  1P3A D;  5GT0 D;  5AVC D;  1P3I D;  4NE3 A;  3KWQ D;  4H9R B;  4WNN A;  1P3F A;  1HQ3 D;  4Z2M G;  1TAF B;  4YS3 C;  5B33 D;  5AV5 B;  3AZL B;  2BYK B;  1Q9C A;  4CAY B;  3X1T C;  5DNN C;  4J8W A;  5B1M A;  4JJN B;  5B40 D;  3B0C W;  3MNN D;  4H9S A;  4XZQ D;  4Z66 D;  3B6G C;  3AZG C;  3AV2 C;  3W98 D;  3KXB B;  5CPJ A;  4LD9 C;  5B1L D;  5B32 B;  1ID3 D;  2HIO A;  5G49 A;  3C1C A;  1P34 A;  4M6B A;  1M18 A;  2IO5 C;  5AV9 A;  3UT9 B;  5B0Y B;  3MGR B;  4WU8 D;  1WWI A;  3AZH A;  4G92 B;  3O62 B;  2HUE C;  3AZE A;  3B0C T;  3AZN D;  3AZF D;  4AWL C;  2PYO B;  5JRG D;  1M19 B;  5AY8 B;  4E45 A;  3AZK B;  3A6N A;  3MVD A;  3REI C;  4R8P D;  3LJA B;  5E5A A;  2ARO C;  5BNX A;  5GT3 C;  4X23 B;  5AV8 D;  4NE5 A;  5AV6 B;  5DNM C;  5AVB D;  3AZI A;  5FUG A;  4DRB A;  3REK A;  4ZBJ C;  1P3B C;  1U35 C;  1H3O A;  3AZJ C;  1ZLA A;  4KGC C;  5DNN D;  3X1S A;  5BNV A;  3UTA A;  3KUY C;  1P3L A;  1KX3 C;  5B2I A;  3C1C B;  1P34 B;  1M18 B;  1AOI A;  3B6G D;  3AV2 D;  5F99 A;  3AV1 D;  3MGS C;  4J8U A;  3WKJ A;  3UTB A;  5AV9 B;  4WU9 A;  3WA9 A;  2CV5 A;  3B6F C;  3AZE B;  4DRA A;  5GSU C;  3W99 A;  1EQZ C;  3KSY A;  5B31 B;  2NQB C;  3W96 C;  3WTP C;  3VH5 W;  5GXQ A;  2FJ7 A;  1S32 B;  3A6N B;  5GT0 C;  3MVD B;  3KWQ C;  5B2J D;  1KX5 B;  5CPI C;  3MGQ D;  1HQ3 C;  5B0Z D;  3W97 A;  5E5A B;  3AZM C;  1KX4 A;  4ZUX B;  5CPK B;  1P3P C;  2JSS A;  4H9R A;  1P3F D;  1TAF A;  3AFA B;  3C1B A;  3AZI B;  3AZL A;  3MNN C;  3REK B;  2BYK A;  4Z66 C;  1P3G B;  3VH5 T;  3LZ0 D;  4UUZ A;  5B1M D;  3NQJ B;  4JJN A;  5B1L C;  5DNM D;  1ID3 C;  1HTA A;  4J8V A;  1P3B D;  3MGP A;  1U35 D;  1P3I B;  2YFV A;  5B2I B;  3AZJ D;  3KXB A;  4KGC D;  1AOI B;  3X1U A;  4J8U B;  4WU8 C;  5B33 B;  5B32 A;  3UTB B;  4WU9 B;  1P3M A;  2CV5 B;  4J8X A;  1KX3 D;  3X1V A;  3AZF C;  4H9Q B;  4HGA B;  5B40 B;  3W99 B;  5JRG C;  3TU4 D;  5B0Y A;  3MGR A;  4CSR B;  4YS3 A;  3AZH D;  4XZQ B;  3O62 A;  3X1T A;  3W98 B;  3WTP E;  3NQU A;  1EQZ D;  1BH9 A;  1M19 A;  5AY8 A;  3W97 B;  3WTP D;  3W96 D;  1P3O D;  1KX4 B;  3LEL A;  1A7W A;  5AVB C;  5CPI D;  5KDM A;  3LJA A;  4LD9 A;  2NZD A;  3C1B B;  2F8N B;  3REH C;  3REJ D;  4X23 A;  3LZ1 A;  3AZM D;  3AZN B;  5B24 A;  4UUZ B;  5AV6 A;  4Z2M H;  1P3P D;  5CP6 A;  3AN2 B;  4J8V B;  1ZLA D;  3MGP B;  3AV1 C;  2YFV B;  4KUD B;  3UTA D;  3X1U B;  1P3L D;  1P3M B;  4J8X B;  5AV8 B;  3REI A;  5F99 D;  4QLC D;  3X1V B;  3WKJ D;  3VH6 A;  4G92 C;  3WA9 D;  4YS3 B;  4KHA B;  1M1A A;  4G91 C;  3WAA D;  5GT3 A;  3X1T B;  3AYW A;  5B2J C;  4Z5T A;  4XUJ C;  3MGQ C;  5B0Z C;  3NQU B;  5B31 A;  3AZK C;  1BH9 B;  3REL C;  4YM6 A;  1S32 A;  3AZG B;  1KX5 A;  3VH5 A;  1TZY A;  1P3F C;  3LEL B;  4E44 A;  1B6W A;  5KDM B;  4LD9 B;  3KUY A;  4H9N A;  2F8N H;  2NZD B;  1KU5 A;  3B0D C;  4ZUX A;  1P3K A;  3LZ0 C;  4J8W C;  5B1M C;  3LZ1 B;  5CPK A;  3MGS A;  5B24 B;  1F66 A;  3AFA A;  5CP6 B;  5JA4 A;  2IO5 B;  5AV5 D;  4H9S C;  4NE6 A;  1P3G A;  3B6F A;  2HUE B;  3REH D;  3NQJ A;  5GSU A;  4JJN D;  5CPJ C;  2NQB A;  4AWL B;  1BFM A;  2HIO C;  3C1C C;  1P3A A;  5AVC A;  1P3I A;  3KWQ A;  3VH6 W;  3REI B;  2L5A A;  3TU4 C;  5B33 A;  3AZH C;  3AZE C;  2ARO B;  1M1A B;  5GT3 B;  3AYW B;  4Z5T B;  4H9Q A;  5B40 A;  4H9O A;  4EO5 B;  3UT9 D;  5B0Y D;  3MGR D;  5DNM B;  4CSR A;  3A6N C;  4ZBJ B;  4XZQ A;  3MVD C;  4Z66 A;  1P3O C;  1U35 B;  4YM6 B;  3W98 A;  2PYO D;  1TZY B;  3VH6 T;  4XUJ D;  1M19 D;  3AZK D;  1ID3 A;  3KUY B;  4H9N B;  3REL D;  3REJ C;  1P3K B;  1KX3 B;  5C3I C;  3AZI C;  3MGS B;  1F66 B;  4WU8 A;  2F8N A;  5JA4 B;  1ZLA C;  4X23 D;  3B6F B;  3AZN A;  3X1S C;  4J8W D;  3AZF A;  3UTA C;  5GSU B;  2NQB B; 
#chains in the Genus database with same CATH topology
 3WTP B;  3AN2 A;  1P3L C;  1P3A B;  5GT0 B;  4R8P A;  5AVC B;  5F99 C;  3KWQ B;  4QLC C;  2F8N K;  3WKJ C;  2LY8 A;  4KUD A;  5CPI B;  5CPJ D;  1HQ3 B;  4WU9 C;  3WA9 C;  2HIO D;  3WAA C;  5BS7 A;  3C1C D;  1P34 D;  5AV8 A;  1M18 D;  5AVB A;  2Y2N A;  4H9O B;  5AV9 D;  5GXQ C;  2FJ7 C;  4KHA A;  5BT1 C;  3MNN B;  4H9P B;  4Z66 B;  3AZE D;  5DNN A;  5B31 D;  1BH8 A;  5B1L B;  1KX4 C;  1ID3 B;  2ZY4 A;  3A6N D;  1N1J B;  3MVD D;  3B6G A;  3P5J B;  3AZG A;  3AV2 A;  3AV1 A;  5B31 G;  2XD1 A;  5AV5 C;  3AZL C;  5E5A D;  4WU8 B;  4ZUX D;  5CPK D;  4JJN C;  3AZF B;  3AFA D;  2BYM B;  2ZM5 A;  5JRG B;  3AZI D;  4J8V C;  3REK D;  1JFI A;  3KXB C;  3EPH A;  4R8P B;  3MGQ A;  3X1U C;  2J8P A;  3X1S D;  5B32 C;  4NFT A;  3X1V C;  5B2I D;  1AOI D;  4J8U D;  3UT9 C;  5B0Y C;  3MGR C;  5AVB B;  4WU9 D;  3UTB D;  3O62 C;  2CV5 D;  2ARO A;  3LZ0 A;  3REH B;  3W99 D;  5DNN B;  2PYO C;  1M19 C;  5DNM A;  5AY8 C;  1BH8 B;  1P3B A;  5GXQ D;  2FJ7 D;  1U35 A;  5BT1 D;  1B67 A;  2DQN C;  3LEL C;  3AZJ A;  3B6G B;  4KGC A;  2DF4 C;  3AV2 B;  3AV1 B;  3LJA C;  2NZD C;  2CWE A;  3W97 D;  5CHL B;  4X23 C;  3LZ1 C;  1KX4 D;  1KX3 A;  5B24 C;  5AV6 C;  5CP6 C;  3TU4 A;  3C1B D;  2F8N D;  3AZL D;  3V9R B;  4G91 B;  1JFI B;  5B2J B;  2Y2G A;  2Y2M A;  4XUJ B;  3MGQ B;  1EQZ A;  5B0Z B;  2F8N G;  3R45 B;  3W96 A;  3WTP A;  3AN2 D;  1P3O A;  3REL B;  4J8V D;  2ZY2 A;  1P34 C;  1M18 C;  3MGP D;  5GT0 A;  4KUD D;  3KXB D;  4WNN B;  5CPI A;  1P3F B;  1HQ3 A;  3X1U D;  5AV9 C;  5B32 D;  1M1A C;  1P3M D;  3REJ A;  3AZM A;  3B0D B;  4Z5T C;  4J8X D;  3AYW C;  3LZ0 B;  4J8W B;  5B1M B;  4EO5 C;  3X1V D;  5B31 C;  1P3P A;  2YFW A;  4YS3 D;  5B32 G;  4YM6 C;  1S32 C;  3MNN A;  1P3B B;  3X1T D;  4H9P A;  3O62 D;  1KX5 C;  1TZY C;  3AZJ B;  4KGC B;  5CPJ B;  5E5A C;  5BO0 A;  2Y2K A;  5B1L A;  5AY8 D;  2HIO B;  1WWS A;  5G49 B;  4ZUX C;  1P3K C;  1N1J A;  5CPK C;  3AZG D;  4QLC A;  1F66 C;  3LEL D;  3AFA C;  3TU4 B;  3LJA D;  3REK C;  4LD9 D;  2NZD D;  3AZH B;  1P3G C;  3WAA A;  2Y2O A;  3LZ1 D;  2W8S A;  5B24 D;  2RVQ C;  5AV6 D;  1EQZ B;  2BYM A;  5CP6 D;  5JRG A;  3B0B A;  1P3A C;  3W96 B;  1P3O B;  5AVC C;  1P3I C;  5B2I C;  1AOI C;  2JE5 A;  4J8U C;  5B33 C;  3UTB C;  3KFU G;  2CV5 C;  5BNX B;  3REJ B;  3AZM B;  3REI D;  4HGA C;  3W99 C;  2Y2Q A;  5B40 C;  1F1E A;  5C3I B;  1P3P B;  5AV5 A;  5FUG B;  2YFW B;  4XZQ C;  4CAY A;  1H3O B;  2ARO D;  1M1A D;  3W98 C;  5GT3 D;  3REH A;  3AYW D;  1ZLA B;  4Z5T D;  3X1S B;  5BNV B;  3UTA B;  3W97 C;  5BO0 B;  4YM6 D;  1S32 D;  1P3L B;  2Y2J A;  1KX5 D;  5F99 B;  1TZY D;  4QLC B;  3WKJ B;  3C1B C;  3WA9 B;  4WV4 B;  3KUY D;  1P3K D;  3WAA B;  3AZN C;  3IP4 C;  1ULY A;  3MGS D;  3UT9 A;  1F66 D;  4WZS B;  3AN2 C;  5GXQ B;  2FJ7 B;  3H0M C;  3V9R A;  1P3G D;  4R8P C;  3MGP C;  3B6F D;  5B2J A;  4KUD C;  5GSU D;  2PYO A;  4XUJ A;  5B0Z A;  2RVQ D;  2NQB D;  3AZK A;  3R45 A;  1R4V A;  3REL A;  1P3M C;  5BS7 C;  4J8X C;  5AV8 C;  1P3A D;  5GT0 D;  5AVC D;  1P3I D;  4NE3 A;  3KWQ D;  4H9R B;  4WNN A;  1P3F A;  1HQ3 D;  4Z2M G;  1TAF B;  4YS3 C;  5B33 D;  5AV5 B;  3AZL B;  2BYK B;  1Q9C A;  4CAY B;  3X1T C;  2Y2P A;  5DNN C;  1T3U A;  5B1M A;  4J8W A;  4JJN B;  5B40 D;  2G5I C;  3B0C W;  3FDD A;  3MNN D;  4H9S A;  4XZQ D;  4DQY B;  4Z66 D;  3B6G C;  3AZG C;  3EPJ A;  3AV2 C;  3W98 D;  3KXB B;  5CPJ A;  4LD9 C;  5B1L D;  5B32 B;  1ID3 D;  2HIO A;  2VQR A;  5G49 A;  3C1C A;  1P34 A;  4M6B A;  1M18 A;  2IO5 C;  5AV9 A;  3UT9 B;  5B0Y B;  3MGR B;  3A1I A;  4WU8 D;  1WWI A;  3AZH A;  4G92 B;  3O62 B;  2HUE C;  3AZE A;  3B0C T;  3AZN D;  3AZF D;  4AWL C;  2PYO B;  5JRG D;  1M19 B;  5AY8 B;  4E45 A;  3AZK B;  3A6N A;  3MVD A;  3REI C;  4R8P D;  3LJA B;  5E5A A;  2ARO C;  2JCH A;  5BNX A;  5GT3 C;  4X23 B;  5AV8 D;  3EPK A;  5AV6 B;  4NE5 A;  5DNM C;  5AVB D;  3AZI A;  5FUG A;  4DRB A;  3REK A;  4ZBJ C;  1P3B C;  2RIQ A;  3H0L C;  1U35 C;  1H3O A;  3AZJ C;  1ZLA A;  4KGC C;  5DNN D;  3X1S A;  5BNV A;  3UTA A;  3KUY C;  1P3L A;  1KX3 C;  5B2I A;  3C1C B;  1P34 B;  1M18 B;  1AOI A;  3B6G D;  3AV2 D;  5F99 A;  3AV1 D;  3MGS C;  4J8U A;  3WKJ A;  3UTB A;  5AV9 B;  4WU9 A;  3WA9 A;  2CV5 A;  3B6F C;  3AZE B;  4DRA A;  5GSU C;  3W99 A;  1EQZ C;  3KSY A;  5B31 B;  2NQB C;  3W96 C;  3WTP C;  3VH5 W;  5GXQ A;  2FJ7 A;  1S32 B;  3A6N B;  5GT0 C;  3MVD B;  3KWQ C;  5B2J D;  1KX5 B;  5CPI C;  3MGQ D;  1HQ3 C;  5B0Z D;  3W97 A;  5E5A B;  2XD5 A;  3AZM C;  2ZY3 A;  1KX4 A;  4ZUX B;  5CPK B;  1P3P C;  2JSS A;  4H9R A;  1P3F D;  1TAF A;  3AFA B;  3C1B A;  3AZI B;  3AZL A;  3MNN C;  3REK B;  2BYK A;  4Z66 C;  1P3G B;  3VH5 T;  3LZ0 D;  4UUZ A;  5B1M D;  3NQJ B;  4JJN A;  5B1L C;  5DNM D;  1ID3 C;  1HTA A;  4J8V A;  1P3B D;  3MGP A;  1U35 D;  1P3I B;  2YFV A;  5B2I B;  3AZJ D;  3KXB A;  4KGC D;  1AOI B;  3X1U A;  4J8U B;  4WU8 C;  5B33 B;  5B32 A;  3UTB B;  4WU9 B;  1P3M A;  2CV5 B;  4J8X A;  3EPL A;  1KX3 D;  3X1V A;  3AZF C;  4H9Q B;  4HGA B;  5B40 B;  3W99 B;  5JRG C;  3TU4 D;  1Z2C B;  5B0Y A;  4CSR B;  3MGR A;  4YS3 A;  3AZH D;  4XZQ B;  3O62 A;  3X1T A;  2Y2I A;  3W98 B;  2UWX A;  3WTP E;  2ZY5 A;  3NQU A;  1EQZ D;  1BH9 A;  1M19 A;  5AY8 A;  3W97 B;  3WTP D;  3W96 D;  1P3O D;  1KX4 B;  3LEL A;  1A7W A;  5AVB C;  5CPI D;  5KDM A;  3LJA A;  4LD9 A;  2NZD A;  2F2A C;  3C1B B;  2F8N B;  3REH C;  3REJ D;  4X23 A;  3LZ1 A;  3AZM D;  3AZN B;  5B24 A;  4UUZ B;  5AV6 A;  4Z2M H;  1P3P D;  5CP6 A;  3AN2 B;  4J8V B;  1ZLA D;  3MGP B;  3AV1 C;  2Y2L A;  2YFV B;  4KUD B;  3UTA D;  3X1U B;  1P3L D;  1P3M B;  4J8X B;  5AV8 B;  3REI A;  3A1K A;  5F99 D;  4QLC D;  3X1V B;  3WKJ D;  3VH6 A;  4G92 C;  3WA9 D;  4YS3 B;  4KHA B;  1M1A A;  4G91 C;  3WAA D;  5GT3 A;  3X1T B;  3AYW A;  5B2J C;  4Z5T A;  4XUJ C;  3MGQ C;  5B0Z C;  3NQU B;  5B31 A;  3AZK C;  1BH9 B;  3REL C;  4YM6 A;  1S32 A;  3H0R C;  3AZG B;  1KX5 A;  3VH5 A;  1TZY A;  1P3F C;  3LEL B;  4E44 A;  1B6W A;  4UPK A;  5KDM B;  3KUY A;  4H9N A;  2F8N H;  4LD9 B;  2NZD B;  1KU5 A;  3B0D C;  4ZUX A;  1P3K A;  3LZ0 C;  4J8W C;  5B1M C;  3LZ1 B;  5CPK A;  3MGS A;  5B24 B;  2G5H C;  3F6T A;  1F66 A;  3AFA A;  5CP6 B;  5JA4 A;  2IO5 B;  5AV5 D;  4H9S C;  4NE6 A;  1P3G A;  3B6F A;  2HUE B;  3REH D;  3NQJ A;  5GSU A;  4JJN D;  5CPJ C;  2NQB A;  4AWL B;  1BFM A;  2HIO C;  3C1C C;  1P3A A;  3AL0 C;  4WJ3 C;  5AVC A;  1P3I A;  3KWQ A;  3VH6 W;  3REI B;  2L5A A;  1PZR A;  3TU4 C;  5B33 A;  3AZH C;  3AZE C;  2ARO B;  3EG5 B;  1M1A B;  5GT3 B;  3AYW B;  4Z5T B;  4H9Q A;  5B40 A;  4H9O A;  2FFF B;  4EO5 B;  3UT9 D;  5B0Y D;  3MGR D;  5DNM B;  1W2E A;  4CSR A;  3A6N C;  4ZBJ B;  4XZQ A;  3MVD C;  4Z66 A;  1P3O C;  1U35 B;  4YM6 B;  3W98 A;  2PYO D;  1TZY B;  3VH6 T;  4XUJ D;  1M19 D;  3AZK D;  1ID3 A;  3KUY B;  4H9N B;  3REL D;  3REJ C;  1P3K B;  1KX3 B;  5C3I C;  2BG1 A;  3AZI C;  3MGS B;  1F66 B;  4WU8 A;  2F8N A;  5JA4 B;  1ZLA C;  4X23 D;  3B6F B;  3AZN A;  3X1S C;  4J8W D;  3AZF A;  3UTA C;  5GSU B;  2Y2H A;  2NQB B; 
#chains in the Genus database with same CATH homology
 3WTP B;  3AN2 A;  1P3L C;  1P3A B;  5GT0 B;  4R8P A;  5AVC B;  5F99 C;  3KWQ B;  4QLC C;  2F8N K;  3WKJ C;  2LY8 A;  4KUD A;  5CPI B;  5CPJ D;  1HQ3 B;  4WU9 C;  3WA9 C;  2HIO D;  3WAA C;  5BS7 A;  3C1C D;  1P34 D;  5AV8 A;  1M18 D;  5AVB A;  2Y2N A;  4H9O B;  5AV9 D;  5GXQ C;  2FJ7 C;  4KHA A;  5BT1 C;  3MNN B;  4H9P B;  4Z66 B;  3AZE D;  5DNN A;  5B31 D;  1BH8 A;  5B1L B;  1KX4 C;  1ID3 B;  2ZY4 A;  3A6N D;  1N1J B;  3MVD D;  3B6G A;  3P5J B;  3AZG A;  3AV2 A;  3AV1 A;  5B31 G;  2XD1 A;  5AV5 C;  3AZL C;  5E5A D;  4WU8 B;  4ZUX D;  5CPK D;  4JJN C;  3AZF B;  3AFA D;  2BYM B;  2ZM5 A;  5JRG B;  3AZI D;  4J8V C;  3REK D;  1JFI A;  3KXB C;  3EPH A;  4R8P B;  3MGQ A;  3X1U C;  2J8P A;  3X1S D;  5B32 C;  4NFT A;  3X1V C;  5B2I D;  1AOI D;  4J8U D;  3UT9 C;  5B0Y C;  3MGR C;  5AVB B;  4WU9 D;  3UTB D;  3O62 C;  2CV5 D;  2ARO A;  3LZ0 A;  3REH B;  3W99 D;  5DNN B;  2PYO C;  1M19 C;  5DNM A;  5AY8 C;  1BH8 B;  1P3B A;  5GXQ D;  2FJ7 D;  1U35 A;  5BT1 D;  1B67 A;  2DQN C;  3LEL C;  3AZJ A;  3B6G B;  4KGC A;  2DF4 C;  3AV2 B;  3AV1 B;  3LJA C;  2NZD C;  2CWE A;  3W97 D;  5CHL B;  4X23 C;  3LZ1 C;  1KX4 D;  1KX3 A;  5B24 C;  5AV6 C;  5CP6 C;  3TU4 A;  3C1B D;  2F8N D;  3AZL D;  3V9R B;  4G91 B;  1JFI B;  5B2J B;  2Y2G A;  2Y2M A;  4XUJ B;  3MGQ B;  1EQZ A;  5B0Z B;  2F8N G;  3R45 B;  3W96 A;  3WTP A;  3AN2 D;  1P3O A;  3REL B;  4J8V D;  2ZY2 A;  1P34 C;  1M18 C;  3MGP D;  5GT0 A;  4KUD D;  3KXB D;  4WNN B;  5CPI A;  1P3F B;  1HQ3 A;  3X1U D;  5AV9 C;  5B32 D;  1M1A C;  1P3M D;  3REJ A;  3AZM A;  3B0D B;  4Z5T C;  4J8X D;  3AYW C;  3LZ0 B;  4J8W B;  5B1M B;  4EO5 C;  3X1V D;  5B31 C;  1P3P A;  2YFW A;  4YS3 D;  5B32 G;  4YM6 C;  1S32 C;  3MNN A;  1P3B B;  3X1T D;  4H9P A;  3O62 D;  1KX5 C;  1TZY C;  3AZJ B;  4KGC B;  5CPJ B;  5E5A C;  5BO0 A;  2Y2K A;  5B1L A;  5AY8 D;  2HIO B;  1WWS A;  5G49 B;  4ZUX C;  1P3K C;  1N1J A;  5CPK C;  3AZG D;  4QLC A;  1F66 C;  3LEL D;  3AFA C;  3TU4 B;  3LJA D;  3REK C;  4LD9 D;  2NZD D;  3AZH B;  1P3G C;  3WAA A;  2Y2O A;  3LZ1 D;  2W8S A;  5B24 D;  2RVQ C;  5AV6 D;  1EQZ B;  2BYM A;  5CP6 D;  5JRG A;  3B0B A;  1P3A C;  3W96 B;  1P3O B;  5AVC C;  1P3I C;  5B2I C;  1AOI C;  2JE5 A;  4J8U C;  5B33 C;  3UTB C;  3KFU G;  2CV5 C;  5BNX B;  3REJ B;  3AZM B;  3REI D;  4HGA C;  3W99 C;  2Y2Q A;  5B40 C;  1F1E A;  5C3I B;  1P3P B;  5AV5 A;  5FUG B;  2YFW B;  4XZQ C;  4CAY A;  1H3O B;  2ARO D;  1M1A D;  3W98 C;  5GT3 D;  3REH A;  3AYW D;  1ZLA B;  4Z5T D;  3X1S B;  5BNV B;  3UTA B;  3W97 C;  5BO0 B;  4YM6 D;  1S32 D;  1P3L B;  2Y2J A;  1KX5 D;  5F99 B;  1TZY D;  4QLC B;  3WKJ B;  3C1B C;  3WA9 B;  4WV4 B;  3KUY D;  1P3K D;  3WAA B;  3AZN C;  3IP4 C;  1ULY A;  3MGS D;  3UT9 A;  1F66 D;  4WZS B;  3AN2 C;  5GXQ B;  2FJ7 B;  3H0M C;  3V9R A;  1P3G D;  4R8P C;  3MGP C;  3B6F D;  5B2J A;  4KUD C;  5GSU D;  2PYO A;  4XUJ A;  5B0Z A;  2RVQ D;  2NQB D;  3AZK A;  3R45 A;  1R4V A;  3REL A;  1P3M C;  5BS7 C;  4J8X C;  5AV8 C;  1P3A D;  5GT0 D;  5AVC D;  1P3I D;  4NE3 A;  3KWQ D;  4H9R B;  4WNN A;  1P3F A;  1HQ3 D;  4Z2M G;  1TAF B;  4YS3 C;  5B33 D;  5AV5 B;  3AZL B;  2BYK B;  1Q9C A;  4CAY B;  3X1T C;  2Y2P A;  5DNN C;  1T3U A;  5B1M A;  4J8W A;  4JJN B;  5B40 D;  2G5I C;  3B0C W;  3FDD A;  3MNN D;  4H9S A;  4XZQ D;  4DQY B;  4Z66 D;  3B6G C;  3AZG C;  3EPJ A;  3AV2 C;  3W98 D;  3KXB B;  5CPJ A;  4LD9 C;  5B1L D;  5B32 B;  1ID3 D;  2HIO A;  2VQR A;  5G49 A;  3C1C A;  1P34 A;  4M6B A;  1M18 A;  2IO5 C;  5AV9 A;  3UT9 B;  5B0Y B;  3MGR B;  3A1I A;  4WU8 D;  1WWI A;  3AZH A;  4G92 B;  3O62 B;  2HUE C;  3AZE A;  3B0C T;  3AZN D;  3AZF D;  4AWL C;  2PYO B;  5JRG D;  1M19 B;  5AY8 B;  4E45 A;  3AZK B;  3A6N A;  3MVD A;  3REI C;  4R8P D;  3LJA B;  5E5A A;  2ARO C;  2JCH A;  5BNX A;  5GT3 C;  4X23 B;  5AV8 D;  3EPK A;  5AV6 B;  4NE5 A;  5DNM C;  5AVB D;  3AZI A;  5FUG A;  4DRB A;  3REK A;  4ZBJ C;  1P3B C;  2RIQ A;  3H0L C;  1U35 C;  1H3O A;  3AZJ C;  1ZLA A;  4KGC C;  5DNN D;  3X1S A;  5BNV A;  3UTA A;  3KUY C;  1P3L A;  1KX3 C;  5B2I A;  3C1C B;  1P34 B;  1M18 B;  1AOI A;  3B6G D;  3AV2 D;  5F99 A;  3AV1 D;  3MGS C;  4J8U A;  3WKJ A;  3UTB A;  5AV9 B;  4WU9 A;  3WA9 A;  2CV5 A;  3B6F C;  3AZE B;  4DRA A;  5GSU C;  3W99 A;  1EQZ C;  3KSY A;  5B31 B;  2NQB C;  3W96 C;  3WTP C;  3VH5 W;  5GXQ A;  2FJ7 A;  1S32 B;  3A6N B;  5GT0 C;  3MVD B;  3KWQ C;  5B2J D;  1KX5 B;  5CPI C;  3MGQ D;  1HQ3 C;  5B0Z D;  3W97 A;  5E5A B;  2XD5 A;  3AZM C;  2ZY3 A;  1KX4 A;  4ZUX B;  5CPK B;  1P3P C;  2JSS A;  4H9R A;  1P3F D;  1TAF A;  3AFA B;  3C1B A;  3AZI B;  3AZL A;  3MNN C;  3REK B;  2BYK A;  4Z66 C;  1P3G B;  3VH5 T;  3LZ0 D;  4UUZ A;  5B1M D;  3NQJ B;  4JJN A;  5B1L C;  5DNM D;  1ID3 C;  1HTA A;  4J8V A;  1P3B D;  3MGP A;  1U35 D;  1P3I B;  2YFV A;  5B2I B;  3AZJ D;  3KXB A;  4KGC D;  1AOI B;  3X1U A;  4J8U B;  4WU8 C;  5B33 B;  5B32 A;  3UTB B;  4WU9 B;  1P3M A;  2CV5 B;  4J8X A;  3EPL A;  1KX3 D;  3X1V A;  3AZF C;  4H9Q B;  4HGA B;  5B40 B;  3W99 B;  5JRG C;  3TU4 D;  1Z2C B;  5B0Y A;  4CSR B;  3MGR A;  4YS3 A;  3AZH D;  4XZQ B;  3O62 A;  3X1T A;  2Y2I A;  3W98 B;  2UWX A;  3WTP E;  2ZY5 A;  3NQU A;  1EQZ D;  1BH9 A;  1M19 A;  5AY8 A;  3W97 B;  3WTP D;  3W96 D;  1P3O D;  1KX4 B;  3LEL A;  1A7W A;  5AVB C;  5CPI D;  5KDM A;  3LJA A;  4LD9 A;  2NZD A;  2F2A C;  3C1B B;  2F8N B;  3REH C;  3REJ D;  4X23 A;  3LZ1 A;  3AZM D;  3AZN B;  5B24 A;  4UUZ B;  5AV6 A;  4Z2M H;  1P3P D;  5CP6 A;  3AN2 B;  4J8V B;  1ZLA D;  3MGP B;  3AV1 C;  2Y2L A;  2YFV B;  4KUD B;  3UTA D;  3X1U B;  1P3L D;  1P3M B;  4J8X B;  5AV8 B;  3REI A;  3A1K A;  5F99 D;  4QLC D;  3X1V B;  3WKJ D;  3VH6 A;  4G92 C;  3WA9 D;  4YS3 B;  4KHA B;  1M1A A;  4G91 C;  3WAA D;  5GT3 A;  3X1T B;  3AYW A;  5B2J C;  4Z5T A;  4XUJ C;  3MGQ C;  5B0Z C;  3NQU B;  5B31 A;  3AZK C;  1BH9 B;  3REL C;  4YM6 A;  1S32 A;  3H0R C;  3AZG B;  1KX5 A;  3VH5 A;  1TZY A;  1P3F C;  3LEL B;  4E44 A;  1B6W A;  4UPK A;  5KDM B;  3KUY A;  4H9N A;  2F8N H;  4LD9 B;  2NZD B;  1KU5 A;  3B0D C;  4ZUX A;  1P3K A;  3LZ0 C;  4J8W C;  5B1M C;  3LZ1 B;  5CPK A;  3MGS A;  5B24 B;  2G5H C;  3F6T A;  1F66 A;  3AFA A;  5CP6 B;  5JA4 A;  2IO5 B;  5AV5 D;  4H9S C;  4NE6 A;  1P3G A;  3B6F A;  2HUE B;  3REH D;  3NQJ A;  5GSU A;  4JJN D;  5CPJ C;  2NQB A;  4AWL B;  1BFM A;  2HIO C;  3C1C C;  1P3A A;  3AL0 C;  4WJ3 C;  5AVC A;  1P3I A;  3KWQ A;  3VH6 W;  3REI B;  2L5A A;  1PZR A;  3TU4 C;  5B33 A;  3AZH C;  3AZE C;  2ARO B;  3EG5 B;  1M1A B;  5GT3 B;  3AYW B;  4Z5T B;  4H9Q A;  5B40 A;  4H9O A;  2FFF B;  4EO5 B;  3UT9 D;  5B0Y D;  3MGR D;  5DNM B;  1W2E A;  4CSR A;  3A6N C;  4ZBJ B;  4XZQ A;  3MVD C;  4Z66 A;  1P3O C;  1U35 B;  4YM6 B;  3W98 A;  2PYO D;  1TZY B;  3VH6 T;  4XUJ D;  1M19 D;  3AZK D;  1ID3 A;  3KUY B;  4H9N B;  3REL D;  3REJ C;  1P3K B;  1KX3 B;  5C3I C;  2BG1 A;  3AZI C;  3MGS B;  1F66 B;  4WU8 A;  2F8N A;  5JA4 B;  1ZLA C;  4X23 D;  3B6F B;  3AZN A;  3X1S C;  4J8W D;  3AZF A;  3UTA C;  5GSU B;  2Y2H A;  2NQB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...