3AZLC

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlC00
1M18B 1P34A 3B0CT 4YS3B 5AV8D 1P3IA 3W99B 2FJ7A 5B1MB 3W98D 2YFWB 3AV1C 1TZYC 3MNNA 3AV2A 3AZEC 5AV5C 5AVBD 2YFVA 5CPJB 1KU5A 2F8NA 3UT9C 5B40C 1M18D 4H9OA 4NE6A 5B0ZB 3W99D 5AV8A 5B1MD 3LELB 1M18C 4YS3C 3W98A 3W99C 4XUJB 3KWQB 5B1MC 3R45A 5CPJD 3AZJC 1TAFB 2F8NG 5CPJC 5CPKD 5B0ZD 1M18A 5BNXB 1Q9CA 4JJNC 5CPIB 3W99A 3LELD 5B1MA 2YFWA 4XUJD 3KWQD 1ULYA 4EO5B 3LELC 3B0CW 3AZLB 4XUJC 3KWQC 5B24B 5GXQB 5CPJA 4H9PB 1M19B 3AYWB 3REJC 5B0ZA 5CPID 3LELA 3MGQB 4XUJA 3KWQA 3AZLD 5B24D 2AROB 1P3BC 4EO5C 5GXQD 1TAFA 3AZGB 1M19D 3AYWD 5GXQC 1B6WA 5BNXA 5CPIA 1M19C 3AYWC 3MGQD 2NQBB 3AN2B 3AZLA 2AROD 5B24A 1KX4B 3VH6T 5GXQA 2AROC 4H9PA 1M19A 5F99B 3AYWA 3AZGC 1S32B 3MGQA 1HQ3B 3AZFB 3B0BA 2NQBD 4ZBJB 3AN2D 5GT3B 1KX4D 2AROA 5GSUB 4KGCB 1U35B 3AZGA 4NE3A 5F99D 3LZ1B 5F99C 1S32D 3RELD 1HQ3D 3AZFD 4Z2MH 2CV5B 2NQBA 1S32C 3AN2A 1HQ3C 2IO5B 5GT3D 3AZFC 3AZNB 1KX4A 2F8NH 5GSUD 4CSRB 4KGCD 5C3IC 3LZ1D 3W97B 5F99A 5GSUC 1EQZB 2F8NK 4KGCC 1U35C 1S32A 3V9RB 5BS7A 3MVDB 1HQ3A 3A6NC 3AZFA 2PYOB 2CV5D 1HTAA 4WU8B 3AZIB 1ZLAB 3B6GC 5GT3A 3AZND 2CV5C 2IO5C 5GSUA 3AZNC 4KGCA 5AVCB 3VH6A 1P3AB 3W97D 3LZ1A 1EQZD 3W97C 1BFMA 3MVDD 1EQZC 2PYOD 1TZYB 2CV5A 5JA4B 4WU8D 3AZEB 1ZLAD 5CP6B 5AV5B 3AZNA 5B31B 5KDMB 3AZIC 4WU8C 1ZLAC 4CSRA 3UT9B 5AVCD 1P3AD 5B40B 3W97A 5AY8B 2L5AA 1EQZA 3WAAC 3WTPB 4QLCC 1AOIC 3V9RA 3MVDA 2PYOA 3AV1D 4H9SC 1TZYD 5G49B 3AZED 4WU8A 1ZLAA 4M6BA 5CP6D 5AV5D 5B31D 5CP6C 3UT9D 5FUGA 3AZJB 4H9QB 1BH8B 5B31C 5B40D 5AY8D 5B2JB 5AVCA 1P3AA 1A7WA 3WTPD 4JJNB 1R4VA 2NZDC 5AY8C 5E5AB 4YS3D 3WTPC 3AV1A 1TZYA 5JA4A 3AZEA 5CP6A 5AV5A 3VH5W 5B31A 4LD9B 5KDMA 2BYKB 3UT9A 3AZJD 4H9NA 5B40A 5B2JD 5AY8A 3REJB 4JJND 3WTPA 5B2JC 3WA9B 4R8PC 4YS3A 5G49A 5E5AC 1P3BB 4XZQC 4LD9D 3KUYB 5B31G 1M1AC 4WNNB 4H9QA 1BH8A 3AZJA 4LD9C 5B2JA 1KX5C 3REJD 1P3OB 4JJNA 3WA9D 1JFIB 3WA9C 5B0YB 3MGPB 1P3BD 3W96C 3KUYD 4LD9A 3MGSB 4J8VB 2BYKA 3KUYC 1BH9B 3REJA 1P3OD 3WA9A 1F66C 1P3OC 3B6FB 3AZHB 5B0YD 3MGPD 5AV9B 2BYMB 2JSSA 1P3BA 5B0YC 3KUYA 3MGPC 3MGSD 4J8VD 2HIOB 3AZMC 4WNNA 4Z5TB 3TU4B 3MGSC 4J8VC 1P3OA 3AZGD 3LZ0B 3B6FD 3AZHD 4YM6C 1JFIA 5B0YA 3B6FC 5AV9D 3MGPA 3AZHC 1B67A 5DNMC 5AV9C 3MGSA 4J8VA 2HIOD 5C3IB 3TU4D 1BH9A 3O62B 2HIOC 4Z5TC 3TU4C 3C1BB 3LZ0D 3KSYA 3B6FA 3A6NB 3AZHA 5JRGB 3LZ0C 3B6GB 4WU9B 5AV9A 2BYMA 1WWSA 2HIOA 3TU4A 3O62D 1P3PB 3REHB 1U35D 3O62C 3NQUB 3LZ0A 3A6ND 3VH6W 5JRGD 3X1SB 3C1BC 3B6GD 5BO0B 4WU9D 4NFTA 5JRGC 4WU9C 1P3PD 5BNVB 3O62A 3REHD 3WAAB 2LY8A 1U35A 4QLCB 1P3PC 1AOIB 4G91C 3REHC 3A6NA 3X1SD 5JRGA 3B6GA 4WU9A 1P3KC 3X1SC 4J8WC 5CHLB 3AZID 5B2IB 3AZKB 3X1UC 1P3PA 3LJAC 3REHA 3WAAD 1P3IB 2NZDB 4QLCD 3UTBB 1AOID 3X1TB 3NQUA 3X1SA 3AZIA 4X23C 1WWIA 5B33B 5B2ID 3AZKD 5GT0C 5BNVA 1P3FC 3WAAA 2NZDD 5B2IC 3AZKC 4CAYB 4QLCA 3X1TD 1P34C 1AOIA 4R8PB 3REIB 1P3IC 2FJ7C 4H9SA 3UTBC 3X1TC 5AVBB 4XZQB 3AV2C 1M1AB 5B33D 5B2IA 4J8XB 3AZKA 1KX5B 3B0DB 5B33C 2NZDA 4NE5A 3UTBA 4G92C 3X1TA 4R8PD 3REID 5AV8C 5E5AD 3W98C 5B32B 3REIC 1ID3B 4XZQD 3W96B 3AFAB 4DRAA 5AVBC 1M1AD 2CWEA 5B33A 5B1LB 4J8XD 1KX5D 5CPKB 3REKB 1N1JB 4J8XC 4CAYA 5BT1D 1F66B 3B0DC 4R8PA 3REIA 5BT1C 5E5AA 4Z2MG 5B32D 5AVBA 1ID3D 3W96D 3AFAD 4XZQA 5B32C 3AZMB 1M1AA 5B1LD 3AFAC 1ID3C 4J8XA 1KX5A 3REKD 5B1LC 3VH5A 4J8UB 5B0ZC 5CPKC 1F66D 3REKC 4YM6B 5B32A 4KUDB 1ID3A 3W96A 3AFAA 5DNMB 4Z66B 3AZMD 5B1LA 3X1VB 1H3OB 5CPKA 4ZUXB 3REKA 3WKJB 1N1JA 4J8UD 1F66A 4YM6D 4KHAB 5CPIC 4WZSB 4J8UC 2RVQD 4KUDD 3MGRB 5B32G 2RVQC 5DNMD 4Z66D 3AZLC 4KUDC 5B24C 3AZMA 3X1VD 4Z66C 4ZUXD 3WKJD 3NQJB 4Z5TD 4H9RB 3X1VC 4J8UA 4ZUXC 3WKJC 4YM6A 3UTAB 4E44A 3MGQC 2HUEB 5DNNB 3MGRD 4KUDA 4E45A 5DNMA 4Z66A 3MGRC 3X1VA 1H3OA 4ZUXA 3WKJA 3C1CB 4Z5TA 1P3LB 4G91B 4HGAB 3RELB 4KHAA 3C1BD 3UTAD 4DRBA 5DNND 1P3KB 2NQBC 4WV4B 3MGRA 4J8WB 4AWLB 3KXBB 3UTAC 5AV6B 2HUEC 5DNNC 3AN2C 1KX4C 3X1UB 3LJAB 3C1CD 3NQJA 4H9RA 1P3LD 1P3MB 3C1CC 1P3LC 5BS7C 3C1BA 3UTAA 4HGAC 3RELC 5DNNA 1P3KD 4ZBJC 4J8WD 3KXBD 1KX3B 5AV6D 4UUZB 1F1EA 5GT3C 4X23B 4AWLC 3X1UD 5GT0B 3KXBC 5AV6C 3LJAD 1P3GB 1P3FB 3C1CA 3LZ1C 1P34B 1P3MD 1P3LA 3RELA 2FJ7B 1P3MC 1P3KA 3MNNB 4J8WA 1KX3D 3AV2B 3KXBA 5BO0A 5AV6A 2YFVB 5FUGB 4X23D 5GT0D 1KX3C 3X1UA 1P3GD 2F8NB 3LJAA 1P3FD 1P34D 3VH5T 4H9OB 4G92B 1P3GC 1P3MA 1P3ID 3AV1B 5AV8B 2FJ7D 3UTBD 3MVDC 3W98B 2PYOC 3MNND 3AV2D 3WTPE 1KX3A 4UUZA 4H9NB 3R45B 4X23A 3MNNC 5GT0A 2F8ND 1P3GA 1P3FA 5AVCC 1P3AC
chains in the Genus database with same CATH superfamily
1M18B 1P34A 3B0CT 4YS3B 5AV8D 1P3IA 3W99B 2FJ7A 5B1MB 3W98D 2YFWB 3AV1C 1TZYC 3MNNA 3AV2A 3AZEC 5AV5C 5AVBD 2YFVA 5CPJB 1KU5A 2F8NA 3UT9C 5B40C 2Y2NA 1M18D 4H9OA 4NE6A 5B0ZB 2UWXA 3W99D 5AV8A 5B1MD 3LELB 1M18C 4YS3C 3W98A 3W99C 4XUJB 3KWQB 5B1MC 2DF4C 3R45A 5CPJD 3AZJC 1TAFB 2F8NG 5CPJC 2JCHA 5CPKD 5B0ZD 1M18A 5BNXB 1Q9CA 4JJNC 5CPIB 3W99A 3LELD 5B1MA 2YFWA 4XUJD 3KWQD 1ULYA 4EO5B 3LELC 3B0CW 3AZLB 4XUJC 3KWQC 5B24B 3H0LC 5GXQB 5CPJA 4H9PB 1M19B 3AYWB 3REJC 5B0ZA 5CPID 3LELA 3MGQB 4XUJA 3KWQA 3AZLD 5B24D 2AROB 1P3BC 4EO5C 5GXQD 1TAFA 3AZGB 1M19D 3AYWD 5GXQC 1B6WA 3AL0C 4DQYB 5BNXA 5CPIA 1M19C 3AYWC 3MGQD 2XD5A 2NQBB 3AN2B 3AZLA 2AROD 5B24A 1KX4B 3VH6T 5GXQA 2AROC 4H9PA 1M19A 5F99B 3AYWA 3AZGC 1S32B 3MGQA 1HQ3B 3AZFB 3B0BA 2NQBD 4ZBJB 3AN2D 5GT3B 1KX4D 2AROA 5GSUB 3F6TA 4KGCB 1U35B 3AZGA 4NE3A 5F99D 3LZ1B 5F99C 1S32D 2FFFB 3RELD 1HQ3D 3AZFD 4Z2MH 2CV5B 2NQBA 1S32C 3AN2A 1HQ3C 2IO5B 5GT3D 3AZFC 3AZNB 1KX4A 2F8NH 5GSUD 4CSRB 4KGCD 5C3IC 3LZ1D 3W97B 5F99A 5GSUC 1EQZB 2F8NK 4KGCC 1U35C 1S32A 3V9RB 5BS7A 3MVDB 1HQ3A 3A6NC 3AZFA 2PYOB 2CV5D 1HTAA 4WU8B 3AZIB 1ZLAB 3B6GC 5GT3A 3AZND 2CV5C 2JE5A 2IO5C 5GSUA 3AZNC 4KGCA 2DQNC 5AVCB 3VH6A 1P3AB 3W97D 3LZ1A 1EQZD 3W97C 1BFMA 3MVDD 1EQZC 2PYOD 1TZYB 2CV5A 5JA4B 4WU8D 3AZEB 1ZLAD 3KFUG 5CP6B 5AV5B 3AZNA 5B31B 5KDMB 3AZIC 4WU8C 1ZLAC 4CSRA 3UT9B 5AVCD 1P3AD 5B40B 3W97A 5AY8B 2L5AA 1EQZA 3WAAC 3WTPB 4QLCC 1AOIC 3V9RA 3MVDA 2PYOA 3AV1D 4H9SC 1TZYD 5G49B 3AZED 4WU8A 1ZLAA 4WJ3C 4M6BA 5CP6D 5AV5D 5B31D 5CP6C 3UT9D 5FUGA 3AZJB 4H9QB 1BH8B 5B31C 5B40D 5AY8D 5B2JB 5AVCA 1P3AA 2VQRA 1A7WA 3WTPD 4JJNB 1R4VA 2NZDC 5AY8C 5E5AB 4YS3D 3WTPC 3AV1A 1TZYA 5JA4A 3AZEA 5CP6A 5AV5A 3VH5W 4UPKA 3FDDA 5B31A 4LD9B 5KDMA 2BYKB 2Y2HA 3UT9A 4H9NA 3AZJD 5B40A 5B2JD 5AY8A 3REJB 3IP4C 4JJND 3WTPA 2Y2OA 5B2JC 2F2AC 3WA9B 4R8PC 4YS3A 2Y2QA 3P5JB 5G49A 5E5AC 1P3BB 4XZQC 4LD9D 3KUYB 5B31G 1M1AC 4WNNB 4H9QA 1BH8A 3AZJA 4LD9C 5B2JA 1KX5C 3REJD 1P3OB 4JJNA 3WA9D 1JFIB 3WA9C 5B0YB 3MGPB 1P3BD 3W96C 3KUYD 4LD9A 3MGSB 4J8VB 2BYKA 3KUYC 1BH9B 3REJA 1P3OD 3WA9A 1F66C 1P3OC 3B6FB 3AZHB 5B0YD 3MGPD 5AV9B 2BYMB 2JSSA 1P3BA 5B0YC 3KUYA 3MGPC 3MGSD 4J8VD 2HIOB 3AZMC 4WNNA 4Z5TB 3TU4B 3MGSC 4J8VC 1P3OA 3AZGD 3LZ0B 3B6FD 3AZHD 4YM6C 1W2EA 1JFIA 5B0YA 3B6FC 5AV9D 3MGPA 3AZHC 1B67A 5DNMC 5AV9C 3MGSA 4J8VA 2HIOD 5C3IB 2ZY3A 3TU4D 1BH9A 3O62B 2HIOC 4Z5TC 3TU4C 3EPKA 3C1BB 3LZ0D 3KSYA 3B6FA 3A6NB 2Y2MA 3AZHA 3EPHA 2W8SA 5JRGB 3LZ0C 3B6GB 4WU9B 5AV9A 2BYMA 1WWSA 2HIOA 3TU4A 3O62D 1P3PB 3REHB 1U35D 3O62C 3NQUB 3LZ0A 3A6ND 3VH6W 5JRGD 3X1SB 3C1BC 3B6GD 5BO0B 3H0MC 2ZY2A 4WU9D 4NFTA 5JRGC 4WU9C 1P3PD 5BNVB 3O62A 3REHD 3WAAB 2LY8A 1U35A 4QLCB 1P3PC 1AOIB 4G91C 3REHC 3A6NA 3X1SD 5JRGA 2XD1A 3B6GA 4WU9A 1P3KC 3X1SC 4J8WC 5CHLB 3AZID 2ZM5A 5B2IB 3AZKB 3X1UC 1Z2CB 1P3PA 3LJAC 3REHA 3WAAD 1P3IB 2NZDB 4QLCD 3UTBB 1AOID 3X1TB 3NQUA 3X1SA 2Y2PA 3AZIA 4X23C 1WWIA 5B33B 5B2ID 3AZKD 5GT0C 5BNVA 1P3FC 3WAAA 2NZDD 5B2IC 3AZKC 4CAYB 4QLCA 3X1TD 1P34C 2RIQA 1AOIA 4R8PB 3EPJA 3REIB 1P3IC 2FJ7C 4H9SA 3UTBC 3X1TC 5AVBB 4XZQB 3AV2C 1M1AB 5B33D 5B2IA 4J8XB 3AZKA 1KX5B 3B0DB 5B33C 2NZDA 4NE5A 3UTBA 4G92C 3X1TA 4R8PD 3REID 5AV8C 5E5AD 3W98C 5B32B 3REIC 1ID3B 4XZQD 3W96B 3AFAB 4DRAA 5AVBC 1M1AD 2CWEA 5B33A 5B1LB 4J8XD 1KX5D 5CPKB 3REKB 1N1JB 4J8XC 4CAYA 5BT1D 1F66B 3B0DC 4R8PA 3REIA 5BT1C 5E5AA 4Z2MG 5B32D 5AVBA 1ID3D 3A1KA 3W96D 3AFAD 4XZQA 5B32C 3AZMB 1M1AA 5B1LD 3AFAC 1ID3C 4J8XA 1KX5A 3REKD 2J8PA 5B1LC 3VH5A 4J8UB 5B0ZC 5CPKC 1F66D 3REKC 4YM6B 5B32A 4KUDB 3EPLA 1ID3A 3W96A 3AFAA 3H0RC 5DNMB 3A1IA 4Z66B 3AZMD 5B1LA 3X1VB 1H3OB 5CPKA 4ZUXB 3REKA 2Y2KA 3WKJB 1N1JA 4J8UD 1F66A 4YM6D 4KHAB 5CPIC 4WZSB 4J8UC 2ZY5A 2RVQD 4KUDD 3MGRB 5B32G 2RVQC 5DNMD 4Z66D 3AZLC 4KUDC 5B24C 3AZMA 3X1VD 4Z66C 4ZUXD 3WKJD 3NQJB 4Z5TD 2G5HC 4H9RB 3X1VC 4J8UA 1PZRA 4ZUXC 3WKJC 4YM6A 3EG5B 3UTAB 4E44A 3MGQC 2HUEB 5DNNB 3MGRD 4KUDA 4E45A 5DNMA 4Z66A 3MGRC 1T3UA 3X1VA 1H3OA 4ZUXA 3WKJA 3C1CB 4Z5TA 1P3LB 4G91B 4HGAB 3RELB 4KHAA 3C1BD 3UTAD 4DRBA 5DNND 1P3KB 2NQBC 4WV4B 3MGRA 4J8WB 4AWLB 3KXBB 3UTAC 5AV6B 2HUEC 5DNNC 3AN2C 1KX4C 3X1UB 3LJAB 3C1CD 3NQJA 4H9RA 1P3LD 1P3MB 3C1CC 1P3LC 5BS7C 3C1BA 3UTAA 4HGAC 3RELC 5DNNA 1P3KD 4ZBJC 4J8WD 2BG1A 3KXBD 1KX3B 2Y2LA 4UUZB 5AV6D 1F1EA 5GT3C 4X23B 2Y2GA 3X1UD 5GT0B 3KXBC 5AV6C 4AWLC 3LJAD 1P3GB 1P3FB 3C1CA 3LZ1C 1P34B 1P3MD 1P3LA 3RELA 2FJ7B 2G5IC 1P3MC 1P3KA 3MNNB 4J8WA 1KX3D 3AV2B 3KXBA 5BO0A 5AV6A 2YFVB 5FUGB 4X23D 5GT0D 1KX3C 3X1UA 1P3GD 2F8NB 3LJAA 1P3FD 1P34D 3VH5T 4H9OB 4G92B 1P3GC 1P3MA 1P3ID 3AV1B 5AV8B 2FJ7D 3UTBD 3MVDC 2ZY4A 2PYOC 3W98B 3MNND 3AV2D 2Y2JA 3WTPE 1KX3A 4UUZA 4H9NB 3R45B 4X23A 3MNNC 5GT0A 2F8ND 1P3GA 1P3FA 5AVCC 1P3AC 2Y2IA
chains in the Genus database with same CATH topology
1M18B 1P34A 3B0CT 4YS3B 5AV8D 1P3IA 3W99B 2FJ7A 5B1MB 3W98D 2YFWB 3AV1C 1TZYC 3MNNA 3AV2A 3AZEC 5AV5C 5AVBD 2YFVA 5CPJB 1KU5A 2F8NA 3UT9C 5B40C 2Y2NA 1M18D 4H9OA 4NE6A 5B0ZB 2UWXA 3W99D 5AV8A 5B1MD 3LELB 1M18C 4YS3C 3W98A 3W99C 4XUJB 3KWQB 5B1MC 2DF4C 3R45A 5CPJD 3AZJC 1TAFB 2F8NG 5CPJC 2JCHA 5CPKD 5B0ZD 1M18A 5BNXB 1Q9CA 4JJNC 5CPIB 3W99A 3LELD 5B1MA 2YFWA 4XUJD 3KWQD 1ULYA 4EO5B 3LELC 3B0CW 3AZLB 4XUJC 3KWQC 5B24B 3H0LC 5GXQB 5CPJA 4H9PB 1M19B 3AYWB 3REJC 5B0ZA 5CPID 3LELA 3MGQB 4XUJA 3KWQA 3AZLD 5B24D 2AROB 1P3BC 4EO5C 5GXQD 1TAFA 3AZGB 1M19D 3AYWD 5GXQC 1B6WA 3AL0C 4DQYB 5BNXA 5CPIA 1M19C 3AYWC 3MGQD 2XD5A 2NQBB 3AN2B 3AZLA 2AROD 5B24A 1KX4B 3VH6T 5GXQA 2AROC 4H9PA 1M19A 5F99B 3AYWA 3AZGC 1S32B 3MGQA 1HQ3B 3AZFB 3B0BA 2NQBD 4ZBJB 3AN2D 5GT3B 1KX4D 2AROA 5GSUB 3F6TA 4KGCB 1U35B 3AZGA 4NE3A 5F99D 3LZ1B 5F99C 1S32D 2FFFB 3RELD 1HQ3D 3AZFD 4Z2MH 2CV5B 2NQBA 1S32C 3AN2A 1HQ3C 2IO5B 5GT3D 3AZFC 3AZNB 1KX4A 2F8NH 5GSUD 4CSRB 4KGCD 5C3IC 3LZ1D 3W97B 5F99A 5GSUC 1EQZB 2F8NK 4KGCC 1U35C 1S32A 3V9RB 5BS7A 3MVDB 1HQ3A 3A6NC 3AZFA 2PYOB 2CV5D 1HTAA 4WU8B 3AZIB 1ZLAB 3B6GC 5GT3A 3AZND 2CV5C 2JE5A 2IO5C 5GSUA 3AZNC 4KGCA 2DQNC 5AVCB 3VH6A 1P3AB 3W97D 3LZ1A 1EQZD 3W97C 1BFMA 3MVDD 1EQZC 2PYOD 1TZYB 2CV5A 5JA4B 4WU8D 3AZEB 1ZLAD 3KFUG 5CP6B 5AV5B 3AZNA 5B31B 5KDMB 3AZIC 4WU8C 1ZLAC 4CSRA 3UT9B 5AVCD 1P3AD 5B40B 3W97A 5AY8B 2L5AA 1EQZA 3WAAC 3WTPB 4QLCC 1AOIC 3V9RA 3MVDA 2PYOA 3AV1D 4H9SC 1TZYD 5G49B 3AZED 4WU8A 1ZLAA 4WJ3C 4M6BA 5CP6D 5AV5D 5B31D 5CP6C 3UT9D 5FUGA 3AZJB 4H9QB 1BH8B 5B31C 5B40D 5AY8D 5B2JB 5AVCA 1P3AA 2VQRA 1A7WA 3WTPD 4JJNB 1R4VA 2NZDC 5AY8C 5E5AB 4YS3D 3WTPC 3AV1A 1TZYA 5JA4A 3AZEA 5CP6A 5AV5A 3VH5W 4UPKA 3FDDA 5B31A 4LD9B 5KDMA 2BYKB 2Y2HA 3UT9A 4H9NA 3AZJD 5B40A 5B2JD 5AY8A 3REJB 3IP4C 4JJND 3WTPA 2Y2OA 5B2JC 2F2AC 3WA9B 4R8PC 4YS3A 2Y2QA 3P5JB 5G49A 5E5AC 1P3BB 4XZQC 4LD9D 3KUYB 5B31G 1M1AC 4WNNB 4H9QA 1BH8A 3AZJA 4LD9C 5B2JA 1KX5C 3REJD 1P3OB 4JJNA 3WA9D 1JFIB 3WA9C 5B0YB 3MGPB 1P3BD 3W96C 3KUYD 4LD9A 3MGSB 4J8VB 2BYKA 3KUYC 1BH9B 3REJA 1P3OD 3WA9A 1F66C 1P3OC 3B6FB 3AZHB 5B0YD 3MGPD 5AV9B 2BYMB 2JSSA 1P3BA 5B0YC 3KUYA 3MGPC 3MGSD 4J8VD 2HIOB 3AZMC 4WNNA 4Z5TB 3TU4B 3MGSC 4J8VC 1P3OA 3AZGD 3LZ0B 3B6FD 3AZHD 4YM6C 1W2EA 1JFIA 5B0YA 3B6FC 5AV9D 3MGPA 3AZHC 1B67A 5DNMC 5AV9C 3MGSA 4J8VA 2HIOD 5C3IB 2ZY3A 3TU4D 1BH9A 3O62B 2HIOC 4Z5TC 3TU4C 3EPKA 3C1BB 3LZ0D 3KSYA 3B6FA 3A6NB 2Y2MA 3AZHA 3EPHA 2W8SA 5JRGB 3LZ0C 3B6GB 4WU9B 5AV9A 2BYMA 1WWSA 2HIOA 3TU4A 3O62D 1P3PB 3REHB 1U35D 3O62C 3NQUB 3LZ0A 3A6ND 3VH6W 5JRGD 3X1SB 3C1BC 3B6GD 5BO0B 3H0MC 2ZY2A 4WU9D 4NFTA 5JRGC 4WU9C 1P3PD 5BNVB 3O62A 3REHD 3WAAB 2LY8A 1U35A 4QLCB 1P3PC 1AOIB 4G91C 3REHC 3A6NA 3X1SD 5JRGA 2XD1A 3B6GA 4WU9A 1P3KC 3X1SC 4J8WC 5CHLB 3AZID 2ZM5A 5B2IB 3AZKB 3X1UC 1Z2CB 1P3PA 3LJAC 3REHA 3WAAD 1P3IB 2NZDB 4QLCD 3UTBB 1AOID 3X1TB 3NQUA 3X1SA 2Y2PA 3AZIA 4X23C 1WWIA 5B33B 5B2ID 3AZKD 5GT0C 5BNVA 1P3FC 3WAAA 2NZDD 5B2IC 3AZKC 4CAYB 4QLCA 3X1TD 1P34C 2RIQA 1AOIA 4R8PB 3EPJA 3REIB 1P3IC 2FJ7C 4H9SA 3UTBC 3X1TC 5AVBB 4XZQB 3AV2C 1M1AB 5B33D 5B2IA 4J8XB 3AZKA 1KX5B 3B0DB 5B33C 2NZDA 4NE5A 3UTBA 4G92C 3X1TA 4R8PD 3REID 5AV8C 5E5AD 3W98C 5B32B 3REIC 1ID3B 4XZQD 3W96B 3AFAB 4DRAA 5AVBC 1M1AD 2CWEA 5B33A 5B1LB 4J8XD 1KX5D 5CPKB 3REKB 1N1JB 4J8XC 4CAYA 5BT1D 1F66B 3B0DC 4R8PA 3REIA 5BT1C 5E5AA 4Z2MG 5B32D 5AVBA 1ID3D 3A1KA 3W96D 3AFAD 4XZQA 5B32C 3AZMB 1M1AA 5B1LD 3AFAC 1ID3C 4J8XA 1KX5A 3REKD 2J8PA 5B1LC 3VH5A 4J8UB 5B0ZC 5CPKC 1F66D 3REKC 4YM6B 5B32A 4KUDB 3EPLA 1ID3A 3W96A 3AFAA 3H0RC 5DNMB 3A1IA 4Z66B 3AZMD 5B1LA 3X1VB 1H3OB 5CPKA 4ZUXB 3REKA 2Y2KA 3WKJB 1N1JA 4J8UD 1F66A 4YM6D 4KHAB 5CPIC 4WZSB 4J8UC 2ZY5A 2RVQD 4KUDD 3MGRB 5B32G 2RVQC 5DNMD 4Z66D 3AZLC 4KUDC 5B24C 3AZMA 3X1VD 4Z66C 4ZUXD 3WKJD 3NQJB 4Z5TD 2G5HC 4H9RB 3X1VC 4J8UA 1PZRA 4ZUXC 3WKJC 4YM6A 3EG5B 3UTAB 4E44A 3MGQC 2HUEB 5DNNB 3MGRD 4KUDA 4E45A 5DNMA 4Z66A 3MGRC 1T3UA 3X1VA 1H3OA 4ZUXA 3WKJA 3C1CB 4Z5TA 1P3LB 4G91B 4HGAB 3RELB 4KHAA 3C1BD 3UTAD 4DRBA 5DNND 1P3KB 2NQBC 4WV4B 3MGRA 4J8WB 4AWLB 3KXBB 3UTAC 5AV6B 2HUEC 5DNNC 3AN2C 1KX4C 3X1UB 3LJAB 3C1CD 3NQJA 4H9RA 1P3LD 1P3MB 3C1CC 1P3LC 5BS7C 3C1BA 3UTAA 4HGAC 3RELC 5DNNA 1P3KD 4ZBJC 4J8WD 2BG1A 3KXBD 1KX3B 2Y2LA 4UUZB 5AV6D 1F1EA 5GT3C 4X23B 2Y2GA 3X1UD 5GT0B 3KXBC 5AV6C 4AWLC 3LJAD 1P3GB 1P3FB 3C1CA 3LZ1C 1P34B 1P3MD 1P3LA 3RELA 2FJ7B 2G5IC 1P3MC 1P3KA 3MNNB 4J8WA 1KX3D 3AV2B 3KXBA 5BO0A 5AV6A 2YFVB 5FUGB 4X23D 5GT0D 1KX3C 3X1UA 1P3GD 2F8NB 3LJAA 1P3FD 1P34D 3VH5T 4H9OB 4G92B 1P3GC 1P3MA 1P3ID 3AV1B 5AV8B 2FJ7D 3UTBD 3MVDC 2ZY4A 2PYOC 3W98B 3MNND 3AV2D 2Y2JA 3WTPE 1KX3A 4UUZA 4H9NB 3R45B 4X23A 3MNNC 5GT0A 2F8ND 1P3GA 1P3FA 5AVCC 1P3AC 2Y2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 B;  1P34 A;  3B0C T;  4YS3 B;  5AV8 D;  1P3I A;  3W99 B;  2FJ7 A;  5B1M B;  3W98 D;  2YFW B;  3AV1 C;  1TZY C;  3MNN A;  3AV2 A;  3AZE C;  5AV5 C;  5AVB D;  2YFV A;  5CPJ B;  1KU5 A;  2F8N A;  3UT9 C;  5B40 C;  1M18 D;  4H9O A;  4NE6 A;  5B0Z B;  3W99 D;  5AV8 A;  5B1M D;  3LEL B;  1M18 C;  4YS3 C;  3W98 A;  3W99 C;  4XUJ B;  3KWQ B;  5B1M C;  3R45 A;  5CPJ D;  3AZJ C;  1TAF B;  2F8N G;  5CPJ C;  5CPK D;  5B0Z D;  1M18 A;  5BNX B;  1Q9C A;  4JJN C;  5CPI B;  3W99 A;  3LEL D;  5B1M A;  2YFW A;  4XUJ D;  3KWQ D;  1ULY A;  4EO5 B;  3LEL C;  3B0C W;  3AZL B;  4XUJ C;  3KWQ C;  5B24 B;  5GXQ B;  5CPJ A;  4H9P B;  1M19 B;  3AYW B;  3REJ C;  5B0Z A;  5CPI D;  3LEL A;  3MGQ B;  4XUJ A;  3KWQ A;  3AZL D;  5B24 D;  2ARO B;  1P3B C;  4EO5 C;  5GXQ D;  1TAF A;  3AZG B;  1M19 D;  3AYW D;  5GXQ C;  1B6W A;  5BNX A;  5CPI A;  1M19 C;  3AYW C;  3MGQ D;  2NQB B;  3AN2 B;  3AZL A;  2ARO D;  5B24 A;  1KX4 B;  3VH6 T;  5GXQ A;  2ARO C;  4H9P A;  1M19 A;  5F99 B;  3AYW A;  3AZG C;  1S32 B;  3MGQ A;  1HQ3 B;  3AZF B;  3B0B A;  2NQB D;  4ZBJ B;  3AN2 D;  5GT3 B;  1KX4 D;  2ARO A;  5GSU B;  4KGC B;  1U35 B;  3AZG A;  4NE3 A;  5F99 D;  3LZ1 B;  5F99 C;  1S32 D;  3REL D;  1HQ3 D;  3AZF D;  4Z2M H;  2CV5 B;  2NQB A;  1S32 C;  3AN2 A;  1HQ3 C;  2IO5 B;  5GT3 D;  3AZF C;  3AZN B;  1KX4 A;  2F8N H;  5GSU D;  4CSR B;  4KGC D;  5C3I C;  3LZ1 D;  3W97 B;  5F99 A;  5GSU C;  1EQZ B;  2F8N K;  4KGC C;  1U35 C;  1S32 A;  3V9R B;  5BS7 A;  3MVD B;  1HQ3 A;  3A6N C;  3AZF A;  2PYO B;  2CV5 D;  1HTA A;  4WU8 B;  3AZI B;  1ZLA B;  3B6G C;  5GT3 A;  3AZN D;  2CV5 C;  2IO5 C;  5GSU A;  3AZN C;  4KGC A;  5AVC B;  3VH6 A;  1P3A B;  3W97 D;  3LZ1 A;  1EQZ D;  3W97 C;  1BFM A;  3MVD D;  1EQZ C;  2PYO D;  1TZY B;  2CV5 A;  5JA4 B;  4WU8 D;  3AZE B;  1ZLA D;  5CP6 B;  5AV5 B;  3AZN A;  5B31 B;  5KDM B;  3AZI C;  4WU8 C;  1ZLA C;  4CSR A;  3UT9 B;  5AVC D;  1P3A D;  5B40 B;  3W97 A;  5AY8 B;  2L5A A;  1EQZ A;  3WAA C;  3WTP B;  4QLC C;  1AOI C;  3V9R A;  3MVD A;  2PYO A;  3AV1 D;  4H9S C;  1TZY D;  5G49 B;  3AZE D;  4WU8 A;  1ZLA A;  4M6B A;  5CP6 D;  5AV5 D;  5B31 D;  5CP6 C;  3UT9 D;  5FUG A;  3AZJ B;  4H9Q B;  1BH8 B;  5B31 C;  5B40 D;  5AY8 D;  5B2J B;  5AVC A;  1P3A A;  1A7W A;  3WTP D;  4JJN B;  1R4V A;  2NZD C;  5AY8 C;  5E5A B;  4YS3 D;  3WTP C;  3AV1 A;  1TZY A;  5JA4 A;  3AZE A;  5CP6 A;  5AV5 A;  3VH5 W;  5B31 A;  4LD9 B;  5KDM A;  2BYK B;  3UT9 A;  3AZJ D;  4H9N A;  5B40 A;  5B2J D;  5AY8 A;  3REJ B;  4JJN D;  3WTP A;  5B2J C;  3WA9 B;  4R8P C;  4YS3 A;  5G49 A;  5E5A C;  1P3B B;  4XZQ C;  4LD9 D;  3KUY B;  5B31 G;  1M1A C;  4WNN B;  4H9Q A;  1BH8 A;  3AZJ A;  4LD9 C;  5B2J A;  1KX5 C;  3REJ D;  1P3O B;  4JJN A;  3WA9 D;  1JFI B;  3WA9 C;  5B0Y B;  3MGP B;  1P3B D;  3W96 C;  3KUY D;  4LD9 A;  3MGS B;  4J8V B;  2BYK A;  3KUY C;  1BH9 B;  3REJ A;  1P3O D;  3WA9 A;  1F66 C;  1P3O C;  3B6F B;  3AZH B;  5B0Y D;  3MGP D;  5AV9 B;  2BYM B;  2JSS A;  1P3B A;  5B0Y C;  3KUY A;  3MGP C;  3MGS D;  4J8V D;  2HIO B;  3AZM C;  4WNN A;  4Z5T B;  3TU4 B;  3MGS C;  4J8V C;  1P3O A;  3AZG D;  3LZ0 B;  3B6F D;  3AZH D;  4YM6 C;  1JFI A;  5B0Y A;  3B6F C;  5AV9 D;  3MGP A;  3AZH C;  1B67 A;  5DNM C;  5AV9 C;  3MGS A;  4J8V A;  2HIO D;  5C3I B;  3TU4 D;  1BH9 A;  3O62 B;  2HIO C;  4Z5T C;  3TU4 C;  3C1B B;  3LZ0 D;  3KSY A;  3B6F A;  3A6N B;  3AZH A;  5JRG B;  3LZ0 C;  3B6G B;  4WU9 B;  5AV9 A;  2BYM A;  1WWS A;  2HIO A;  3TU4 A;  3O62 D;  1P3P B;  3REH B;  1U35 D;  3O62 C;  3NQU B;  3LZ0 A;  3A6N D;  3VH6 W;  5JRG D;  3X1S B;  3C1B C;  3B6G D;  5BO0 B;  4WU9 D;  4NFT A;  5JRG C;  4WU9 C;  1P3P D;  5BNV B;  3O62 A;  3REH D;  3WAA B;  2LY8 A;  1U35 A;  4QLC B;  1P3P C;  1AOI B;  4G91 C;  3REH C;  3A6N A;  3X1S D;  5JRG A;  3B6G A;  4WU9 A;  1P3K C;  3X1S C;  4J8W C;  5CHL B;  3AZI D;  5B2I B;  3AZK B;  3X1U C;  1P3P A;  3LJA C;  3REH A;  3WAA D;  1P3I B;  2NZD B;  4QLC D;  3UTB B;  1AOI D;  3X1T B;  3NQU A;  3X1S A;  3AZI A;  4X23 C;  1WWI A;  5B33 B;  5B2I D;  3AZK D;  5GT0 C;  5BNV A;  1P3F C;  3WAA A;  2NZD D;  5B2I C;  3AZK C;  4CAY B;  4QLC A;  3X1T D;  1P34 C;  1AOI A;  4R8P B;  3REI B;  1P3I C;  2FJ7 C;  4H9S A;  3UTB C;  3X1T C;  5AVB B;  4XZQ B;  3AV2 C;  1M1A B;  5B33 D;  5B2I A;  4J8X B;  3AZK A;  1KX5 B;  3B0D B;  5B33 C;  2NZD A;  4NE5 A;  3UTB A;  4G92 C;  3X1T A;  4R8P D;  3REI D;  5AV8 C;  5E5A D;  3W98 C;  5B32 B;  3REI C;  1ID3 B;  4XZQ D;  3W96 B;  3AFA B;  4DRA A;  5AVB C;  1M1A D;  2CWE A;  5B33 A;  5B1L B;  4J8X D;  1KX5 D;  5CPK B;  3REK B;  1N1J B;  4J8X C;  4CAY A;  5BT1 D;  1F66 B;  3B0D C;  4R8P A;  3REI A;  5BT1 C;  5E5A A;  4Z2M G;  5B32 D;  5AVB A;  1ID3 D;  3W96 D;  3AFA D;  4XZQ A;  5B32 C;  3AZM B;  1M1A A;  5B1L D;  3AFA C;  1ID3 C;  4J8X A;  1KX5 A;  3REK D;  5B1L C;  3VH5 A;  4J8U B;  5B0Z C;  5CPK C;  1F66 D;  3REK C;  4YM6 B;  5B32 A;  4KUD B;  1ID3 A;  3W96 A;  3AFA A;  5DNM B;  4Z66 B;  3AZM D;  5B1L A;  3X1V B;  1H3O B;  5CPK A;  4ZUX B;  3REK A;  3WKJ B;  1N1J A;  4J8U D;  1F66 A;  4YM6 D;  4KHA B;  5CPI C;  4WZS B;  4J8U C;  2RVQ D;  4KUD D;  3MGR B;  5B32 G;  2RVQ C;  5DNM D;  4Z66 D;  3AZL C;  4KUD C;  5B24 C;  3AZM A;  3X1V D;  4Z66 C;  4ZUX D;  3WKJ D;  3NQJ B;  4Z5T D;  4H9R B;  3X1V C;  4J8U A;  4ZUX C;  3WKJ C;  4YM6 A;  3UTA B;  4E44 A;  3MGQ C;  2HUE B;  5DNN B;  3MGR D;  4KUD A;  4E45 A;  5DNM A;  4Z66 A;  3MGR C;  3X1V A;  1H3O A;  4ZUX A;  3WKJ A;  3C1C B;  4Z5T A;  1P3L B;  4G91 B;  4HGA B;  3REL B;  4KHA A;  3C1B D;  3UTA D;  4DRB A;  5DNN D;  1P3K B;  2NQB C;  4WV4 B;  3MGR A;  4J8W B;  4AWL B;  3KXB B;  3UTA C;  5AV6 B;  2HUE C;  5DNN C;  3AN2 C;  1KX4 C;  3X1U B;  3LJA B;  3C1C D;  3NQJ A;  4H9R A;  1P3L D;  1P3M B;  3C1C C;  1P3L C;  5BS7 C;  3C1B A;  3UTA A;  4HGA C;  3REL C;  5DNN A;  1P3K D;  4ZBJ C;  4J8W D;  3KXB D;  1KX3 B;  5AV6 D;  4UUZ B;  1F1E A;  5GT3 C;  4X23 B;  4AWL C;  3X1U D;  5GT0 B;  3KXB C;  5AV6 C;  3LJA D;  1P3G B;  1P3F B;  3C1C A;  3LZ1 C;  1P34 B;  1P3M D;  1P3L A;  3REL A;  2FJ7 B;  1P3M C;  1P3K A;  3MNN B;  4J8W A;  1KX3 D;  3AV2 B;  3KXB A;  5BO0 A;  5AV6 A;  2YFV B;  5FUG B;  4X23 D;  5GT0 D;  1KX3 C;  3X1U A;  1P3G D;  2F8N B;  3LJA A;  1P3F D;  1P34 D;  3VH5 T;  4H9O B;  4G92 B;  1P3G C;  1P3M A;  1P3I D;  3AV1 B;  5AV8 B;  2FJ7 D;  3UTB D;  3MVD C;  3W98 B;  2PYO C;  3MNN D;  3AV2 D;  3WTP E;  1KX3 A;  4UUZ A;  4H9N B;  3R45 B;  4X23 A;  3MNN C;  5GT0 A;  2F8N D;  1P3G A;  1P3F A;  5AVC C;  1P3A C; 
#chains in the Genus database with same CATH topology
 1M18 B;  1P34 A;  3B0C T;  4YS3 B;  5AV8 D;  1P3I A;  3W99 B;  2FJ7 A;  5B1M B;  3W98 D;  2YFW B;  3AV1 C;  1TZY C;  3MNN A;  3AV2 A;  3AZE C;  5AV5 C;  5AVB D;  2YFV A;  5CPJ B;  1KU5 A;  2F8N A;  3UT9 C;  5B40 C;  2Y2N A;  1M18 D;  4H9O A;  4NE6 A;  5B0Z B;  2UWX A;  3W99 D;  5AV8 A;  5B1M D;  3LEL B;  1M18 C;  4YS3 C;  3W98 A;  3W99 C;  4XUJ B;  3KWQ B;  5B1M C;  2DF4 C;  3R45 A;  5CPJ D;  3AZJ C;  1TAF B;  2F8N G;  5CPJ C;  2JCH A;  5CPK D;  5B0Z D;  1M18 A;  5BNX B;  1Q9C A;  4JJN C;  5CPI B;  3W99 A;  3LEL D;  5B1M A;  2YFW A;  4XUJ D;  3KWQ D;  1ULY A;  4EO5 B;  3LEL C;  3B0C W;  3AZL B;  4XUJ C;  3KWQ C;  5B24 B;  3H0L C;  5GXQ B;  5CPJ A;  4H9P B;  1M19 B;  3AYW B;  3REJ C;  5B0Z A;  5CPI D;  3LEL A;  3MGQ B;  4XUJ A;  3KWQ A;  3AZL D;  5B24 D;  2ARO B;  1P3B C;  4EO5 C;  5GXQ D;  1TAF A;  3AZG B;  1M19 D;  3AYW D;  5GXQ C;  1B6W A;  3AL0 C;  4DQY B;  5BNX A;  5CPI A;  1M19 C;  3AYW C;  3MGQ D;  2XD5 A;  2NQB B;  3AN2 B;  3AZL A;  2ARO D;  5B24 A;  1KX4 B;  3VH6 T;  5GXQ A;  2ARO C;  4H9P A;  1M19 A;  5F99 B;  3AYW A;  3AZG C;  1S32 B;  3MGQ A;  1HQ3 B;  3AZF B;  3B0B A;  2NQB D;  4ZBJ B;  3AN2 D;  5GT3 B;  1KX4 D;  2ARO A;  5GSU B;  3F6T A;  4KGC B;  1U35 B;  3AZG A;  4NE3 A;  5F99 D;  3LZ1 B;  5F99 C;  1S32 D;  2FFF B;  3REL D;  1HQ3 D;  3AZF D;  4Z2M H;  2CV5 B;  2NQB A;  1S32 C;  3AN2 A;  1HQ3 C;  2IO5 B;  5GT3 D;  3AZF C;  3AZN B;  1KX4 A;  2F8N H;  5GSU D;  4CSR B;  4KGC D;  5C3I C;  3LZ1 D;  3W97 B;  5F99 A;  5GSU C;  1EQZ B;  2F8N K;  4KGC C;  1U35 C;  1S32 A;  3V9R B;  5BS7 A;  3MVD B;  1HQ3 A;  3A6N C;  3AZF A;  2PYO B;  2CV5 D;  1HTA A;  4WU8 B;  3AZI B;  1ZLA B;  3B6G C;  5GT3 A;  3AZN D;  2CV5 C;  2JE5 A;  2IO5 C;  5GSU A;  3AZN C;  4KGC A;  2DQN C;  5AVC B;  3VH6 A;  1P3A B;  3W97 D;  3LZ1 A;  1EQZ D;  3W97 C;  1BFM A;  3MVD D;  1EQZ C;  2PYO D;  1TZY B;  2CV5 A;  5JA4 B;  4WU8 D;  3AZE B;  1ZLA D;  3KFU G;  5CP6 B;  5AV5 B;  3AZN A;  5B31 B;  5KDM B;  3AZI C;  4WU8 C;  1ZLA C;  4CSR A;  3UT9 B;  5AVC D;  1P3A D;  5B40 B;  3W97 A;  5AY8 B;  2L5A A;  1EQZ A;  3WAA C;  3WTP B;  4QLC C;  1AOI C;  3V9R A;  3MVD A;  2PYO A;  3AV1 D;  4H9S C;  1TZY D;  5G49 B;  3AZE D;  4WU8 A;  1ZLA A;  4WJ3 C;  4M6B A;  5CP6 D;  5AV5 D;  5B31 D;  5CP6 C;  3UT9 D;  5FUG A;  3AZJ B;  4H9Q B;  1BH8 B;  5B31 C;  5B40 D;  5AY8 D;  5B2J B;  5AVC A;  1P3A A;  2VQR A;  1A7W A;  3WTP D;  4JJN B;  1R4V A;  2NZD C;  5AY8 C;  5E5A B;  4YS3 D;  3WTP C;  3AV1 A;  1TZY A;  5JA4 A;  3AZE A;  5CP6 A;  5AV5 A;  3VH5 W;  4UPK A;  3FDD A;  5B31 A;  4LD9 B;  5KDM A;  2BYK B;  2Y2H A;  3UT9 A;  4H9N A;  3AZJ D;  5B40 A;  5B2J D;  5AY8 A;  3REJ B;  3IP4 C;  4JJN D;  3WTP A;  2Y2O A;  5B2J C;  2F2A C;  3WA9 B;  4R8P C;  4YS3 A;  2Y2Q A;  3P5J B;  5G49 A;  5E5A C;  1P3B B;  4XZQ C;  4LD9 D;  3KUY B;  5B31 G;  1M1A C;  4WNN B;  4H9Q A;  1BH8 A;  3AZJ A;  4LD9 C;  5B2J A;  1KX5 C;  3REJ D;  1P3O B;  4JJN A;  3WA9 D;  1JFI B;  3WA9 C;  5B0Y B;  3MGP B;  1P3B D;  3W96 C;  3KUY D;  4LD9 A;  3MGS B;  4J8V B;  2BYK A;  3KUY C;  1BH9 B;  3REJ A;  1P3O D;  3WA9 A;  1F66 C;  1P3O C;  3B6F B;  3AZH B;  5B0Y D;  3MGP D;  5AV9 B;  2BYM B;  2JSS A;  1P3B A;  5B0Y C;  3KUY A;  3MGP C;  3MGS D;  4J8V D;  2HIO B;  3AZM C;  4WNN A;  4Z5T B;  3TU4 B;  3MGS C;  4J8V C;  1P3O A;  3AZG D;  3LZ0 B;  3B6F D;  3AZH D;  4YM6 C;  1W2E A;  1JFI A;  5B0Y A;  3B6F C;  5AV9 D;  3MGP A;  3AZH C;  1B67 A;  5DNM C;  5AV9 C;  3MGS A;  4J8V A;  2HIO D;  5C3I B;  2ZY3 A;  3TU4 D;  1BH9 A;  3O62 B;  2HIO C;  4Z5T C;  3TU4 C;  3EPK A;  3C1B B;  3LZ0 D;  3KSY A;  3B6F A;  3A6N B;  2Y2M A;  3AZH A;  3EPH A;  2W8S A;  5JRG B;  3LZ0 C;  3B6G B;  4WU9 B;  5AV9 A;  2BYM A;  1WWS A;  2HIO A;  3TU4 A;  3O62 D;  1P3P B;  3REH B;  1U35 D;  3O62 C;  3NQU B;  3LZ0 A;  3A6N D;  3VH6 W;  5JRG D;  3X1S B;  3C1B C;  3B6G D;  5BO0 B;  3H0M C;  2ZY2 A;  4WU9 D;  4NFT A;  5JRG C;  4WU9 C;  1P3P D;  5BNV B;  3O62 A;  3REH D;  3WAA B;  2LY8 A;  1U35 A;  4QLC B;  1P3P C;  1AOI B;  4G91 C;  3REH C;  3A6N A;  3X1S D;  5JRG A;  2XD1 A;  3B6G A;  4WU9 A;  1P3K C;  3X1S C;  4J8W C;  5CHL B;  3AZI D;  2ZM5 A;  5B2I B;  3AZK B;  3X1U C;  1Z2C B;  1P3P A;  3LJA C;  3REH A;  3WAA D;  1P3I B;  2NZD B;  4QLC D;  3UTB B;  1AOI D;  3X1T B;  3NQU A;  3X1S A;  2Y2P A;  3AZI A;  4X23 C;  1WWI A;  5B33 B;  5B2I D;  3AZK D;  5GT0 C;  5BNV A;  1P3F C;  3WAA A;  2NZD D;  5B2I C;  3AZK C;  4CAY B;  4QLC A;  3X1T D;  1P34 C;  2RIQ A;  1AOI A;  4R8P B;  3EPJ A;  3REI B;  1P3I C;  2FJ7 C;  4H9S A;  3UTB C;  3X1T C;  5AVB B;  4XZQ B;  3AV2 C;  1M1A B;  5B33 D;  5B2I A;  4J8X B;  3AZK A;  1KX5 B;  3B0D B;  5B33 C;  2NZD A;  4NE5 A;  3UTB A;  4G92 C;  3X1T A;  4R8P D;  3REI D;  5AV8 C;  5E5A D;  3W98 C;  5B32 B;  3REI C;  1ID3 B;  4XZQ D;  3W96 B;  3AFA B;  4DRA A;  5AVB C;  1M1A D;  2CWE A;  5B33 A;  5B1L B;  4J8X D;  1KX5 D;  5CPK B;  3REK B;  1N1J B;  4J8X C;  4CAY A;  5BT1 D;  1F66 B;  3B0D C;  4R8P A;  3REI A;  5BT1 C;  5E5A A;  4Z2M G;  5B32 D;  5AVB A;  1ID3 D;  3A1K A;  3W96 D;  3AFA D;  4XZQ A;  5B32 C;  3AZM B;  1M1A A;  5B1L D;  3AFA C;  1ID3 C;  4J8X A;  1KX5 A;  3REK D;  2J8P A;  5B1L C;  3VH5 A;  4J8U B;  5B0Z C;  5CPK C;  1F66 D;  3REK C;  4YM6 B;  5B32 A;  4KUD B;  3EPL A;  1ID3 A;  3W96 A;  3AFA A;  3H0R C;  5DNM B;  3A1I A;  4Z66 B;  3AZM D;  5B1L A;  3X1V B;  1H3O B;  5CPK A;  4ZUX B;  3REK A;  2Y2K A;  3WKJ B;  1N1J A;  4J8U D;  1F66 A;  4YM6 D;  4KHA B;  5CPI C;  4WZS B;  4J8U C;  2ZY5 A;  2RVQ D;  4KUD D;  3MGR B;  5B32 G;  2RVQ C;  5DNM D;  4Z66 D;  3AZL C;  4KUD C;  5B24 C;  3AZM A;  3X1V D;  4Z66 C;  4ZUX D;  3WKJ D;  3NQJ B;  4Z5T D;  2G5H C;  4H9R B;  3X1V C;  4J8U A;  1PZR A;  4ZUX C;  3WKJ C;  4YM6 A;  3EG5 B;  3UTA B;  4E44 A;  3MGQ C;  2HUE B;  5DNN B;  3MGR D;  4KUD A;  4E45 A;  5DNM A;  4Z66 A;  3MGR C;  1T3U A;  3X1V A;  1H3O A;  4ZUX A;  3WKJ A;  3C1C B;  4Z5T A;  1P3L B;  4G91 B;  4HGA B;  3REL B;  4KHA A;  3C1B D;  3UTA D;  4DRB A;  5DNN D;  1P3K B;  2NQB C;  4WV4 B;  3MGR A;  4J8W B;  4AWL B;  3KXB B;  3UTA C;  5AV6 B;  2HUE C;  5DNN C;  3AN2 C;  1KX4 C;  3X1U B;  3LJA B;  3C1C D;  3NQJ A;  4H9R A;  1P3L D;  1P3M B;  3C1C C;  1P3L C;  5BS7 C;  3C1B A;  3UTA A;  4HGA C;  3REL C;  5DNN A;  1P3K D;  4ZBJ C;  4J8W D;  2BG1 A;  3KXB D;  1KX3 B;  2Y2L A;  4UUZ B;  5AV6 D;  1F1E A;  5GT3 C;  4X23 B;  2Y2G A;  3X1U D;  5GT0 B;  3KXB C;  5AV6 C;  4AWL C;  3LJA D;  1P3G B;  1P3F B;  3C1C A;  3LZ1 C;  1P34 B;  1P3M D;  1P3L A;  3REL A;  2FJ7 B;  2G5I C;  1P3M C;  1P3K A;  3MNN B;  4J8W A;  1KX3 D;  3AV2 B;  3KXB A;  5BO0 A;  5AV6 A;  2YFV B;  5FUG B;  4X23 D;  5GT0 D;  1KX3 C;  3X1U A;  1P3G D;  2F8N B;  3LJA A;  1P3F D;  1P34 D;  3VH5 T;  4H9O B;  4G92 B;  1P3G C;  1P3M A;  1P3I D;  3AV1 B;  5AV8 B;  2FJ7 D;  3UTB D;  3MVD C;  2ZY4 A;  2PYO C;  3W98 B;  3MNN D;  3AV2 D;  2Y2J A;  3WTP E;  1KX3 A;  4UUZ A;  4H9N B;  3R45 B;  4X23 A;  3MNN C;  5GT0 A;  2F8N D;  1P3G A;  1P3F A;  5AVC C;  1P3A C;  2Y2I A; 
#chains in the Genus database with same CATH homology
 1M18 B;  1P34 A;  3B0C T;  4YS3 B;  5AV8 D;  1P3I A;  3W99 B;  2FJ7 A;  5B1M B;  3W98 D;  2YFW B;  3AV1 C;  1TZY C;  3MNN A;  3AV2 A;  3AZE C;  5AV5 C;  5AVB D;  2YFV A;  5CPJ B;  1KU5 A;  2F8N A;  3UT9 C;  5B40 C;  2Y2N A;  1M18 D;  4H9O A;  4NE6 A;  5B0Z B;  2UWX A;  3W99 D;  5AV8 A;  5B1M D;  3LEL B;  1M18 C;  4YS3 C;  3W98 A;  3W99 C;  4XUJ B;  3KWQ B;  5B1M C;  2DF4 C;  3R45 A;  5CPJ D;  3AZJ C;  1TAF B;  2F8N G;  5CPJ C;  2JCH A;  5CPK D;  5B0Z D;  1M18 A;  5BNX B;  1Q9C A;  4JJN C;  5CPI B;  3W99 A;  3LEL D;  5B1M A;  2YFW A;  4XUJ D;  3KWQ D;  1ULY A;  4EO5 B;  3LEL C;  3B0C W;  3AZL B;  4XUJ C;  3KWQ C;  5B24 B;  3H0L C;  5GXQ B;  5CPJ A;  4H9P B;  1M19 B;  3AYW B;  3REJ C;  5B0Z A;  5CPI D;  3LEL A;  3MGQ B;  4XUJ A;  3KWQ A;  3AZL D;  5B24 D;  2ARO B;  1P3B C;  4EO5 C;  5GXQ D;  1TAF A;  3AZG B;  1M19 D;  3AYW D;  5GXQ C;  1B6W A;  3AL0 C;  4DQY B;  5BNX A;  5CPI A;  1M19 C;  3AYW C;  3MGQ D;  2XD5 A;  2NQB B;  3AN2 B;  3AZL A;  2ARO D;  5B24 A;  1KX4 B;  3VH6 T;  5GXQ A;  2ARO C;  4H9P A;  1M19 A;  5F99 B;  3AYW A;  3AZG C;  1S32 B;  3MGQ A;  1HQ3 B;  3AZF B;  3B0B A;  2NQB D;  4ZBJ B;  3AN2 D;  5GT3 B;  1KX4 D;  2ARO A;  5GSU B;  3F6T A;  4KGC B;  1U35 B;  3AZG A;  4NE3 A;  5F99 D;  3LZ1 B;  5F99 C;  1S32 D;  2FFF B;  3REL D;  1HQ3 D;  3AZF D;  4Z2M H;  2CV5 B;  2NQB A;  1S32 C;  3AN2 A;  1HQ3 C;  2IO5 B;  5GT3 D;  3AZF C;  3AZN B;  1KX4 A;  2F8N H;  5GSU D;  4CSR B;  4KGC D;  5C3I C;  3LZ1 D;  3W97 B;  5F99 A;  5GSU C;  1EQZ B;  2F8N K;  4KGC C;  1U35 C;  1S32 A;  3V9R B;  5BS7 A;  3MVD B;  1HQ3 A;  3A6N C;  3AZF A;  2PYO B;  2CV5 D;  1HTA A;  4WU8 B;  3AZI B;  1ZLA B;  3B6G C;  5GT3 A;  3AZN D;  2CV5 C;  2JE5 A;  2IO5 C;  5GSU A;  3AZN C;  4KGC A;  2DQN C;  5AVC B;  3VH6 A;  1P3A B;  3W97 D;  3LZ1 A;  1EQZ D;  3W97 C;  1BFM A;  3MVD D;  1EQZ C;  2PYO D;  1TZY B;  2CV5 A;  5JA4 B;  4WU8 D;  3AZE B;  1ZLA D;  3KFU G;  5CP6 B;  5AV5 B;  3AZN A;  5B31 B;  5KDM B;  3AZI C;  4WU8 C;  1ZLA C;  4CSR A;  3UT9 B;  5AVC D;  1P3A D;  5B40 B;  3W97 A;  5AY8 B;  2L5A A;  1EQZ A;  3WAA C;  3WTP B;  4QLC C;  1AOI C;  3V9R A;  3MVD A;  2PYO A;  3AV1 D;  4H9S C;  1TZY D;  5G49 B;  3AZE D;  4WU8 A;  1ZLA A;  4WJ3 C;  4M6B A;  5CP6 D;  5AV5 D;  5B31 D;  5CP6 C;  3UT9 D;  5FUG A;  3AZJ B;  4H9Q B;  1BH8 B;  5B31 C;  5B40 D;  5AY8 D;  5B2J B;  5AVC A;  1P3A A;  2VQR A;  1A7W A;  3WTP D;  4JJN B;  1R4V A;  2NZD C;  5AY8 C;  5E5A B;  4YS3 D;  3WTP C;  3AV1 A;  1TZY A;  5JA4 A;  3AZE A;  5CP6 A;  5AV5 A;  3VH5 W;  4UPK A;  3FDD A;  5B31 A;  4LD9 B;  5KDM A;  2BYK B;  2Y2H A;  3UT9 A;  4H9N A;  3AZJ D;  5B40 A;  5B2J D;  5AY8 A;  3REJ B;  3IP4 C;  4JJN D;  3WTP A;  2Y2O A;  5B2J C;  2F2A C;  3WA9 B;  4R8P C;  4YS3 A;  2Y2Q A;  3P5J B;  5G49 A;  5E5A C;  1P3B B;  4XZQ C;  4LD9 D;  3KUY B;  5B31 G;  1M1A C;  4WNN B;  4H9Q A;  1BH8 A;  3AZJ A;  4LD9 C;  5B2J A;  1KX5 C;  3REJ D;  1P3O B;  4JJN A;  3WA9 D;  1JFI B;  3WA9 C;  5B0Y B;  3MGP B;  1P3B D;  3W96 C;  3KUY D;  4LD9 A;  3MGS B;  4J8V B;  2BYK A;  3KUY C;  1BH9 B;  3REJ A;  1P3O D;  3WA9 A;  1F66 C;  1P3O C;  3B6F B;  3AZH B;  5B0Y D;  3MGP D;  5AV9 B;  2BYM B;  2JSS A;  1P3B A;  5B0Y C;  3KUY A;  3MGP C;  3MGS D;  4J8V D;  2HIO B;  3AZM C;  4WNN A;  4Z5T B;  3TU4 B;  3MGS C;  4J8V C;  1P3O A;  3AZG D;  3LZ0 B;  3B6F D;  3AZH D;  4YM6 C;  1W2E A;  1JFI A;  5B0Y A;  3B6F C;  5AV9 D;  3MGP A;  3AZH C;  1B67 A;  5DNM C;  5AV9 C;  3MGS A;  4J8V A;  2HIO D;  5C3I B;  2ZY3 A;  3TU4 D;  1BH9 A;  3O62 B;  2HIO C;  4Z5T C;  3TU4 C;  3EPK A;  3C1B B;  3LZ0 D;  3KSY A;  3B6F A;  3A6N B;  2Y2M A;  3AZH A;  3EPH A;  2W8S A;  5JRG B;  3LZ0 C;  3B6G B;  4WU9 B;  5AV9 A;  2BYM A;  1WWS A;  2HIO A;  3TU4 A;  3O62 D;  1P3P B;  3REH B;  1U35 D;  3O62 C;  3NQU B;  3LZ0 A;  3A6N D;  3VH6 W;  5JRG D;  3X1S B;  3C1B C;  3B6G D;  5BO0 B;  3H0M C;  2ZY2 A;  4WU9 D;  4NFT A;  5JRG C;  4WU9 C;  1P3P D;  5BNV B;  3O62 A;  3REH D;  3WAA B;  2LY8 A;  1U35 A;  4QLC B;  1P3P C;  1AOI B;  4G91 C;  3REH C;  3A6N A;  3X1S D;  5JRG A;  2XD1 A;  3B6G A;  4WU9 A;  1P3K C;  3X1S C;  4J8W C;  5CHL B;  3AZI D;  2ZM5 A;  5B2I B;  3AZK B;  3X1U C;  1Z2C B;  1P3P A;  3LJA C;  3REH A;  3WAA D;  1P3I B;  2NZD B;  4QLC D;  3UTB B;  1AOI D;  3X1T B;  3NQU A;  3X1S A;  2Y2P A;  3AZI A;  4X23 C;  1WWI A;  5B33 B;  5B2I D;  3AZK D;  5GT0 C;  5BNV A;  1P3F C;  3WAA A;  2NZD D;  5B2I C;  3AZK C;  4CAY B;  4QLC A;  3X1T D;  1P34 C;  2RIQ A;  1AOI A;  4R8P B;  3EPJ A;  3REI B;  1P3I C;  2FJ7 C;  4H9S A;  3UTB C;  3X1T C;  5AVB B;  4XZQ B;  3AV2 C;  1M1A B;  5B33 D;  5B2I A;  4J8X B;  3AZK A;  1KX5 B;  3B0D B;  5B33 C;  2NZD A;  4NE5 A;  3UTB A;  4G92 C;  3X1T A;  4R8P D;  3REI D;  5AV8 C;  5E5A D;  3W98 C;  5B32 B;  3REI C;  1ID3 B;  4XZQ D;  3W96 B;  3AFA B;  4DRA A;  5AVB C;  1M1A D;  2CWE A;  5B33 A;  5B1L B;  4J8X D;  1KX5 D;  5CPK B;  3REK B;  1N1J B;  4J8X C;  4CAY A;  5BT1 D;  1F66 B;  3B0D C;  4R8P A;  3REI A;  5BT1 C;  5E5A A;  4Z2M G;  5B32 D;  5AVB A;  1ID3 D;  3A1K A;  3W96 D;  3AFA D;  4XZQ A;  5B32 C;  3AZM B;  1M1A A;  5B1L D;  3AFA C;  1ID3 C;  4J8X A;  1KX5 A;  3REK D;  2J8P A;  5B1L C;  3VH5 A;  4J8U B;  5B0Z C;  5CPK C;  1F66 D;  3REK C;  4YM6 B;  5B32 A;  4KUD B;  3EPL A;  1ID3 A;  3W96 A;  3AFA A;  3H0R C;  5DNM B;  3A1I A;  4Z66 B;  3AZM D;  5B1L A;  3X1V B;  1H3O B;  5CPK A;  4ZUX B;  3REK A;  2Y2K A;  3WKJ B;  1N1J A;  4J8U D;  1F66 A;  4YM6 D;  4KHA B;  5CPI C;  4WZS B;  4J8U C;  2ZY5 A;  2RVQ D;  4KUD D;  3MGR B;  5B32 G;  2RVQ C;  5DNM D;  4Z66 D;  3AZL C;  4KUD C;  5B24 C;  3AZM A;  3X1V D;  4Z66 C;  4ZUX D;  3WKJ D;  3NQJ B;  4Z5T D;  2G5H C;  4H9R B;  3X1V C;  4J8U A;  1PZR A;  4ZUX C;  3WKJ C;  4YM6 A;  3EG5 B;  3UTA B;  4E44 A;  3MGQ C;  2HUE B;  5DNN B;  3MGR D;  4KUD A;  4E45 A;  5DNM A;  4Z66 A;  3MGR C;  1T3U A;  3X1V A;  1H3O A;  4ZUX A;  3WKJ A;  3C1C B;  4Z5T A;  1P3L B;  4G91 B;  4HGA B;  3REL B;  4KHA A;  3C1B D;  3UTA D;  4DRB A;  5DNN D;  1P3K B;  2NQB C;  4WV4 B;  3MGR A;  4J8W B;  4AWL B;  3KXB B;  3UTA C;  5AV6 B;  2HUE C;  5DNN C;  3AN2 C;  1KX4 C;  3X1U B;  3LJA B;  3C1C D;  3NQJ A;  4H9R A;  1P3L D;  1P3M B;  3C1C C;  1P3L C;  5BS7 C;  3C1B A;  3UTA A;  4HGA C;  3REL C;  5DNN A;  1P3K D;  4ZBJ C;  4J8W D;  2BG1 A;  3KXB D;  1KX3 B;  2Y2L A;  4UUZ B;  5AV6 D;  1F1E A;  5GT3 C;  4X23 B;  2Y2G A;  3X1U D;  5GT0 B;  3KXB C;  5AV6 C;  4AWL C;  3LJA D;  1P3G B;  1P3F B;  3C1C A;  3LZ1 C;  1P34 B;  1P3M D;  1P3L A;  3REL A;  2FJ7 B;  2G5I C;  1P3M C;  1P3K A;  3MNN B;  4J8W A;  1KX3 D;  3AV2 B;  3KXB A;  5BO0 A;  5AV6 A;  2YFV B;  5FUG B;  4X23 D;  5GT0 D;  1KX3 C;  3X1U A;  1P3G D;  2F8N B;  3LJA A;  1P3F D;  1P34 D;  3VH5 T;  4H9O B;  4G92 B;  1P3G C;  1P3M A;  1P3I D;  3AV1 B;  5AV8 B;  2FJ7 D;  3UTB D;  3MVD C;  2ZY4 A;  2PYO C;  3W98 B;  3MNN D;  3AV2 D;  2Y2J A;  3WTP E;  1KX3 A;  4UUZ A;  4H9N B;  3R45 B;  4X23 A;  3MNN C;  5GT0 A;  2F8N D;  1P3G A;  1P3F A;  5AVC C;  1P3A C;  2Y2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...