5AV6D

Human nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 38
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6D00
5AV6B 5B24B 3UTAD 3KXBD 5B2JB 1B67A 3MNND 1P3OA 1F66A 3AV2C 3AN2A 5AV6D 3X1SD 4Z66C 3X1VA 3LELB 1TAFB 3AZIA 3AZGB 5CPJC 5B2JD 5AV8A 5CP6A 2HIOB 1P3LB 3LZ0D 1P3AD 3LELD 3MVDC 5DNMC 3AZGD 5GXQB 4J8WC 3AZKB 3AZFB 5B40C 3B0DC 1ZLAA 2HIOD 4H9OA 4X23A 3W99C 5F99B 3VH6W 3C1BD 5DNNA 2NZDB 3TU4A 5GT3B 3KWQB 3WA9D 3AFAC 4EO5B 4YM6C 1KX5A 5GXQD 3AZKD 3KUYA 3AZFD 3AZEC 4Z5TC 1M18C 3WKJA 4KUDA 4E45A 5AV5B 2NZDD 4WU9B 4J8UC 3KWQD 5AVCA 5E5AC 3LJAC 1BFMA 4WV4B 5AVBB 3AN2B 5AV9C 3MGRC 4ZUXC 5AV5D 4UUZA 3AV1C 4WU9D 2LY8A 1P3FB 1P3IB 2CV5B 1F1EA 4JJNC 3AZJA 5B2IA 4H9PB 5AVBD 3X1UA 3B6GB 4Z66D 3MGQA 2PYOC 3W98A 1P3FD 1P34C 5CPJD 3X1TC 1P3ID 2CV5D 4NE3A 1P3GA 1P3PA 5B1LB 5DNNB 1HTAA 3UTAC 3TU4B 2YFWB 3UTBB 1S32A 3KXBC 3B6GD 4M6BA 1AOIA 4KGCB 4NE5A 2HUEB 3MNNC 3WKJB 4DRAA 5B0ZA 3NQUA 3LZ1A 5B1LD 3REJA 5BS7A 5AV6C 3O62A 3AZNA 3REKA 3REHB 3UTBD 5GSUA 5JRGB 4KGCD 4KHAA 5B2JC 3REIB 4YM6D 1M18D 4Z5TD 3LZ0C 1ID3A 2NQBA 1P3AC 5B1MA 1P3MA 4XZQD 3AYWB 3RELA 5B0YA 3REHD 3WTPA 3LELC 5JRGD 3VH6A 3AZGC 2AROA 3REID 2HIOC 3C1CA 1P3BD 4NFTA 3X1UB 4HGAB 1U35A 2YFVA 3AZMA 3X1SA 1TZYA 4CAYA 1HQ3B 4J8VA 1KX3A 5CPIB 5GXQC 3AZFC 3AZKC 1BH9A 2FJ7B 4H9NA 1P3PB 3VH6T 5B31G 5AY8A 4WU8B 1M19B 2NZDC 3AZLD 3MGSB 4R8PB 3KWQC 1HQ3D 4EO5C 2L5AA 5GT0A 3UT9B 4LD9A 2BYMB 5B31B 1BH8B 4CSRB 2FJ7D 3AZHA 1WWIA 4WU8D 1EQZB 3O62B 1M19D 5AV5C 3MGSD 4WU9C 4R8PD 5B32B 5CPKA 3UT9D 1P3MB 5AVBC 1EQZD 3A6NA 3RELB 4YS3D 4J8XB 5B24D 3WTPB 3W97B 1P3FC 1M1AB 2AROB 5B32D 3B6FA 5B33B 1P3IC 2CV5C 3C1CB 1KX4B 1JFIA 1U35B 4XUJB 3WAAA 3B6GC 4J8XD 3VH5A 3W97D 3WTPE 1M1AD 5B33D 1KX4D 4H9NB 5BNVA 5B1LC 1P3LD 3R45B 4WZSB 3AV2A 5JA4B 5DNNC 4XUJD 3TU4C 3UTBC 4KGCC 3W96B 2HUEC 5CPJA 3NQJA 1H3OB 4XZQC 3MGPB 5F99D 5BNXA 3REHC 5JRGC 5GT3D 3REIC 4YS3B 3MVDA 5DNMA 1P3OB 4J8WA 1P3BC 5B40A 1F66B 2F8NA 3AYWC 4ZBJB 2F8NH 3MGPD 3W99A 3X1VB 3WAAC 3AZIB 4QLCA 3B6FB 5AV8B 5CP6B 3AFAA 1P3OD 1M18A 3AZEA 1F66D 4HGAC 3AZLC 3AN2D 3X1VD 1HQ3C 1WWSA 5CPIC 3AZID 4J8UA 3B0CT 3KSYA 5AV8D 5CP6D 5E5AA 1ZLAB 2FJ7C 1P3PC 4H9QA 4WNNA 4H9OB 4X23B 3LJAA 4WU8C 2RVQD 1M19C 4H9SC 3MGSC 4R8PC 5AV9A 3MGRA 4ZUXA 3AV1A 1KX5B 3KUYB 3UT9C 5B31C 1ZLAD 3VH5W 1EQZC 4KUDB 4JJNA 2F8NG 3O62C 4YS3C 5B24C 5DNND 3TU4D 1ULYA 1N1JA 5B32C 5AVCB 2PYOA 1KX5D 3WKJD 1P34A 3KUYD 3X1TA 1P3KA 2F8NB 4KUDD 3RELC 4J8XC 5FUGA 4UUZB 3WTPC 3W97C 3UTAA 3B0BA 1M1AC 4QLCB 3KXBA 5AVCD 4H9RA 5B33C 1KX4C 3MNNA 3C1CC 1P3LC 3AZJB 5B2IB 1U35C 4XUJC 5KDMA 3AYWD 5AV6A 3MGQB 3W98B 5B2JA 4AWLB 4WNNB 1P3GB 3LZ0A 3AZJD 5B2ID 5F99C 1P3AA 3X1UD 1S32B 5GT3C 3W96C 1AOIB 3MGQD 3LELA 3W98D 5CPID 3AZGA 5B0ZB 3NQUB 5BT1C 2HIOA 1P3GD 3LZ1B 1P3PD 3REJB 3MGPC 3C1BA 3AZNB 3REKB 1S32D 1N1JB 5GSUB 1AOID 4KHAB 2PYOB 3WA9A 1Q9CA 1P3OC 5GXQA 3AZKA 3AZFA 1ID3B 1P3KB 1F66C 2NQBB 5B31D 3LZ1D 5B1MB 4ZBJC 3AN2C 3REJD 3O62D 4G92B 3AZND 3X1VC 5C3IB 3REKD 5B0YB 2NZDA 3KXBB 5GSUD 3AZIC 5AV8C 3KWQA 5CP6C 5CHLB 5G49A 4E44A 1ID3D 2NQBD 2RVQC 1P3MD 2YFVB 3AZMB 3RELD 3X1SB 5AV5A 1TZYB 5B0YD 4CAYB 4J8VB 3WTPD 1KX3B 4WU9A 2AROD 1ZLAC 1BH9B 3C1CD 4X23C 3LZ0B 5AY8B 1P3AB 5AVBA 1U35D 3AZMD 1TZYD 2JSSA 4J8VD 4Z66A 1KX3D 1KX5C 1P3FA 3WKJC 3KUYC 5GT0B 3VH5T 4LD9B 1P3IA 2CV5A 4KUDC 3AZHB 5AY8D 4H9PA 3C1BB 2F8NK 3B6GA 5AVCC 3WA9B 3W96D 5CPKB 5GT0D 4LD9D 5BT1D 5B1LA 3AZHD 3A6NB 4G91B 2YFWA 3UTBA 4QLCC 4KGCA 2IO5B 5CPKD 5G49B 4YM6A 5BO0A 4Z5TA 3AZJC 1JFIB 5B2IC 3X1UC 4XZQA 3A6ND 3WAAB 3MGQC 3REHA 3W98C 5JRGA 3REIA 4AWLC 3B6FD 1R4VA 1P3GC 5BNVB 1P3BA 4DRBA 3AV2B 3AYWA 3WAAD 1S32C 1AOIC 4Z66B 3V9RA 5CPJB 5B0ZC 3NQJB 3LZ1C 4X23D 3REJC 5BS7C 3AV2D 3AZNC 3REKC 5BNXB 3AZLA 5GSUC 1HQ3A 3MVDB 5DNMB 5CPIA 4J8WB 1ID3C 1P3KC 2NQBC 5B40B 3B0DB 2FJ7A 5B1MC 1P3MC 4WU8A 3W99B 4G92C 1M19A 5C3IC 5B0YC 4H9SA 3MGSA 1A7WA 4R8PA 4Z2MH 2AROC 2BYKA 3AFAB 3MVDD 5DNMD 4YM6B 4J8WD 5BO0B 3UT9A 4Z5TB 3AZEB 5B40D 2BYMA 1M18B 5B31A 1BH8A 4CSRA 2F8ND 4XZQB 1EQZA 3AZMC 3W99D 3X1SC 4YS3A 1TZYC 4J8VC 5B24A 1KX3C 4QLCD 4J8UB 5B32A 3AFAD 5E5AB 1B6WA 4H9QB 3AZED 1P3BB 3LJAB 5AY8C 5AV9B 3MGRB 4J8XA 4ZUXB 3W97A 3AV1B 3V9RB 1M1AA 1TAFA 4J8UD 5GT0C 1KU5A 5E5AD 5B33A 4LD9C 1KX4A 3LJAD 3AZHC 1P3LA 4JJNB 3C1BC 2CWEA 4XUJA 3AZLB 5AV9D 4Z2MG 3MGRD 4ZUXD 3WA9C 3AV1D 5CPKC 1P34B 3B0CW 5B0ZD 3X1TB 4JJND 3A6NC 3R45A 4NE6A 5F99A 4G91C 5FUGB 5JA4A 3UTAB 2BYKB 5GT3A 2IO5C 3W96A 3B6FC 4H9RB 2PYOD 5B32G 3MNNB 1P34D 1H3OA 3X1TD 1P3KD 5B1MD 5KDMB 3MGPA
chains in the Genus database with same CATH superfamily
5AV6B 5B24B 3UTAD 3KXBD 1M18B 4DQYB 5B2JB 1B67A 3MNND 1P3OA 1F66A 3AV2C 2DQNC 3AN2A 5AV6D 3X1SD 4Z66C 3X1VA 3LELB 1TAFB 2RIQA 3AZIA 3AZGB 5CPJC 5B2JD 5AV8A 5CP6A 2HIOB 1P3LB 3LZ0D 1P3AD 2ZY5A 3LELD 3MVDC 5DNMC 3AZGD 5GXQB 4J8WC 3AZKB 3AZFB 5B40C 3B0DC 1ZLAA 2HIOD 4H9OA 4X23A 3W99C 5F99B 3VH6W 3C1BD 5DNNA 2NZDB 3TU4A 5GT3B 3KWQB 3WA9D 3AFAC 4EO5B 4YM6C 1KX5A 5GXQD 3AZKD 3KUYA 3AZFD 3AZEC 4Z5TC 1M18C 3WKJA 3A1KA 4KUDA 2F2AC 4E45A 5AV5B 2NZDD 4WU9B 4J8UC 3KWQD 5AVCA 5E5AC 3LJAC 1BFMA 3EPJA 4WV4B 5AVBB 3AN2B 5AV9C 3MGRC 4ZUXC 5AV5D 4UUZA 3AV1C 4WU9D 4WJ3C 2LY8A 1P3FB 1P3IB 2CV5B 1F1EA 4JJNC 3AZJA 3EG5B 5B2IA 4H9PB 5AVBD 3X1UA 4UPKA 3B6GB 4Z66D 3MGQA 2PYOC 3W98A 1P3FD 1P34C 5CPJD 3X1TC 1P3ID 2CV5D 4NE3A 1P3GA 1P3PA 5B1LB 5DNNB 1HTAA 3UTAC 3TU4B 2YFWB 3UTBB 1S32A 3KXBC 3B6GD 4M6BA 1AOIA 4KGCB 4NE5A 2HUEB 3MNNC 3WKJB 4DRAA 5B0ZA 3NQUA 3LZ1A 5B1LD 3REJA 5BS7A 5AV6C 3O62A 3AZNA 3REKA 3REHB 3UTBD 5GSUA 5JRGB 4KGCD 4KHAA 5B2JC 3REIB 4YM6D 1M18D 4Z5TD 3LZ0C 1ID3A 2NQBA 1P3AC 5B1MA 1P3MA 4XZQD 3AYWB 3RELA 5B0YA 3REHD 3WTPA 3LELC 5JRGD 3VH6A 3AZGC 2AROA 3REID 2HIOC 3C1CA 1P3BD 4NFTA 3X1UB 4HGAB 1U35A 2YFVA 3AZMA 3X1SA 1TZYA 2ZY2A 1HQ3B 4CAYA 4J8VA 1KX3A 2G5IC 5CPIB 5GXQC 3AZFC 3AZKC 1BH9A 2FJ7B 4H9NA 1P3PB 1PZRA 3VH6T 5B31G 5AY8A 4WU8B 1M19B 3H0LC 2NZDC 3AZLD 2UWXA 3MGSB 4R8PB 3KWQC 1HQ3D 4EO5C 2L5AA 5GT0A 3UT9B 4LD9A 2BYMB 5B31B 1BH8B 4CSRB 2FJ7D 2Y2LA 3AZHA 1WWIA 4WU8D 1EQZB 3O62B 1M19D 5AV5C 3MGSD 4WU9C 4R8PD 5B32B 5CPKA 2ZY4A 3UT9D 1P3MB 5AVBC 1EQZD 2Y2PA 3A6NA 3RELB 4YS3D 4J8XB 2Y2NA 5B24D 3WTPB 3W97B 1P3FC 1M1AB 2AROB 5B32D 3B6FA 5B33B 2XD1A 2CV5C 3C1CB 1P3IC 1KX4B 1JFIA 2G5HC 1U35B 4XUJB 3WAAA 3B6GC 4J8XD 3VH5A 3W97D 3WTPE 1M1AD 3AL0C 5B33D 3P5JB 1KX4D 4H9NB 5BNVA 5B1LC 1P3LD 3R45B 4WZSB 3AV2A 5JA4B 5DNNC 4XUJD 3TU4C 3IP4C 3UTBC 4KGCC 3W96B 2HUEC 5CPJA 3NQJA 1H3OB 4XZQC 3MGPB 5F99D 2BG1A 5BNXA 3REHC 5JRGC 5GT3D 3REIC 4YS3B 3MVDA 5DNMA 1P3OB 1W2EA 4J8WA 1P3BC 5B40A 1F66B 2F8NA 3AYWC 4ZBJB 2F8NH 3MGPD 3W99A 3X1VB 3WAAC 3AZIB 4QLCA 3B6FB 5AV8B 5CP6B 3AFAA 1P3OD 1M18A 3AZEA 1F66D 4HGAC 3AZLC 3AN2D 3X1VD 1HQ3C 2JCHA 1WWSA 5CPIC 3AZID 4J8UA 3B0CT 3KSYA 5AV8D 5CP6D 5E5AA 1ZLAB 2FJ7C 1P3PC 4H9QA 4WNNA 4H9OB 4X23B 3LJAA 4WU8C 2RVQD 1M19C 4H9SC 3MGSC 4R8PC 5AV9A 3MGRA 4ZUXA 3AV1A 1KX5B 3KUYB 3UT9C 5B31C 1ZLAD 3VH5W 1EQZC 4KUDB 4JJNA 2F8NG 3O62C 4YS3C 5B24C 5DNND 3TU4D 1ULYA 1N1JA 5B32C 5AVCB 2PYOA 1KX5D 3WKJD 1P34A 3KUYD 2Y2JA 3X1TA 1P3KA 2F8NB 4KUDD 3RELC 4J8XC 5FUGA 4UUZB 3WTPC 3W97C 3UTAA 3EPHA 3B0BA 1M1AC 4QLCB 3KXBA 5AVCD 2DF4C 4H9RA 5B33C 1KX4C 3MNNA 3C1CC 1P3LC 3AZJB 5B2IB 1U35C 4XUJC 5KDMA 3AYWD 3H0MC 5AV6A 3MGQB 3W98B 5B2JA 2Y2IA 4AWLB 4WNNB 1P3GB 3LZ0A 3AZJD 5B2ID 5F99C 1P3AA 2XD5A 3X1UD 1S32B 5GT3C 3W96C 1AOIB 3MGQD 3LELA 3W98D 5CPID 3AZGA 5B0ZB 3NQUB 5BT1C 2HIOA 1P3GD 3LZ1B 1P3PD 2Y2GA 3REJB 3MGPC 2Y2MA 3C1BA 3AZNB 3REKB 1S32D 1N1JB 5GSUB 1AOID 4KHAB 2PYOB 3WA9A 1Q9CA 1P3OC 1T3UA 5GXQA 3AZKA 3AZFA 1ID3B 1P3KB 1F66C 2NQBB 5B31D 3LZ1D 5B1MB 4ZBJC 3AN2C 3REJD 3O62D 4G92B 3AZND 3X1VC 5C3IB 2JE5A 5B0YB 3REKD 2NZDA 3KXBB 5GSUD 3AZIC 5AV8C 3KWQA 5CP6C 5CHLB 5G49A 4E44A 1ID3D 2NQBD 2RVQC 1P3MD 2YFVB 2J8PA 3AZMB 3RELD 3X1SB 5AV5A 1TZYB 5B0YD 4CAYB 4J8VB 3WTPD 1KX3B 4WU9A 2ZM5A 2AROD 1ZLAC 1BH9B 3C1CD 4X23C 3LZ0B 5AY8B 1P3AB 5AVBA 1U35D 2W8SA 3AZMD 1TZYD 2JSSA 4J8VD 4Z66A 3FDDA 1KX3D 1KX5C 1P3FA 3WKJC 3KUYC 5GT0B 3VH5T 2Y2KA 4LD9B 1P3IA 2CV5A 4KUDC 3AZHB 5AY8D 4H9PA 3C1BB 2F8NK 3B6GA 5AVCC 3WA9B 3W96D 5CPKB 5GT0D 4LD9D 5BT1D 2Y2HA 5B1LA 3AZHD 3A6NB 4G91B 2YFWA 3UTBA 4QLCC 2Y2OA 4KGCA 2IO5B 5CPKD 5G49B 4YM6A 5BO0A 4Z5TA 3AZJC 1JFIB 5B2IC 3X1UC 4XZQA 3A6ND 3WAAB 3MGQC 3REHA 3W98C 5JRGA 3REIA 4AWLC 3B6FD 2VQRA 1R4VA 1P3GC 5BNVB 1P3BA 4DRBA 3AV2B 3AYWA 3WAAD 1S32C 1AOIC 4Z66B 3V9RA 5CPJB 5B0ZC 3NQJB 3LZ1C 4X23D 3REJC 5BS7C 3AV2D 3AZNC 3REKC 5BNXB 3AZLA 5GSUC 1HQ3A 3A1IA 3MVDB 5DNMB 5CPIA 4J8WB 1ID3C 1P3KC 2NQBC 5B40B 3B0DB 2FJ7A 5B1MC 1P3MC 4WU8A 3W99B 4G92C 1M19A 5C3IC 5B0YC 4H9SA 3MGSA 1A7WA 4R8PA 4Z2MH 2AROC 2BYKA 3AFAB 3MVDD 5DNMD 4YM6B 4J8WD 3F6TA 5BO0B 4Z5TB 3UT9A 5B40D 2BYMA 3AZEB 5B31A 1BH8A 4CSRA 2F8ND 4XZQB 1EQZA 3AZMC 3W99D 3X1SC 4YS3A 1TZYC 4J8VC 5B24A 1KX3C 4QLCD 4J8UB 5B32A 3EPKA 3AFAD 2ZY3A 5E5AB 3H0RC 1B6WA 4H9QB 3AZED 1P3BB 3LJAB 5AY8C 2FFFB 5AV9B 3MGRB 4J8XA 4ZUXB 3W97A 3AV1B 3V9RB 1M1AA 1TAFA 4J8UD 5GT0C 1KU5A 5E5AD 5B33A 4LD9C 1KX4A 3LJAD 3AZHC 1P3LA 4JJNB 3C1BC 2CWEA 4XUJA 3AZLB 5AV9D 4Z2MG 3MGRD 4ZUXD 3WA9C 3AV1D 5CPKC 1Z2CB 1P34B 3B0CW 5B0ZD 3EPLA 3X1TB 4JJND 3A6NC 3R45A 4NE6A 5F99A 4G91C 5FUGB 5JA4A 3UTAB 3KFUG 2BYKB 5GT3A 2IO5C 3W96A 3B6FC 4H9RB 2PYOD 5B32G 3MNNB 1P34D 1H3OA 3X1TD 1P3KD 5B1MD 5KDMB 3MGPA 2Y2QA
chains in the Genus database with same CATH topology
5AV6B 5B24B 3UTAD 3KXBD 1M18B 4DQYB 5B2JB 1B67A 3MNND 1P3OA 1F66A 3AV2C 2DQNC 3AN2A 5AV6D 3X1SD 4Z66C 3X1VA 3LELB 1TAFB 2RIQA 3AZIA 3AZGB 5CPJC 5B2JD 5AV8A 5CP6A 2HIOB 1P3LB 3LZ0D 1P3AD 2ZY5A 3LELD 3MVDC 5DNMC 3AZGD 5GXQB 4J8WC 3AZKB 3AZFB 5B40C 3B0DC 1ZLAA 2HIOD 4H9OA 4X23A 3W99C 5F99B 3VH6W 3C1BD 5DNNA 2NZDB 3TU4A 5GT3B 3KWQB 3WA9D 3AFAC 4EO5B 4YM6C 1KX5A 5GXQD 3AZKD 3KUYA 3AZFD 3AZEC 4Z5TC 1M18C 3WKJA 3A1KA 4KUDA 2F2AC 4E45A 5AV5B 2NZDD 4WU9B 4J8UC 3KWQD 5AVCA 5E5AC 3LJAC 1BFMA 3EPJA 4WV4B 5AVBB 3AN2B 5AV9C 3MGRC 4ZUXC 5AV5D 4UUZA 3AV1C 4WU9D 4WJ3C 2LY8A 1P3FB 1P3IB 2CV5B 1F1EA 4JJNC 3AZJA 3EG5B 5B2IA 4H9PB 5AVBD 3X1UA 4UPKA 3B6GB 4Z66D 3MGQA 2PYOC 3W98A 1P3FD 1P34C 5CPJD 3X1TC 1P3ID 2CV5D 4NE3A 1P3GA 1P3PA 5B1LB 5DNNB 1HTAA 3UTAC 3TU4B 2YFWB 3UTBB 1S32A 3KXBC 3B6GD 4M6BA 1AOIA 4KGCB 4NE5A 2HUEB 3MNNC 3WKJB 4DRAA 5B0ZA 3NQUA 3LZ1A 5B1LD 3REJA 5BS7A 5AV6C 3O62A 3AZNA 3REKA 3REHB 3UTBD 5GSUA 5JRGB 4KGCD 4KHAA 5B2JC 3REIB 4YM6D 1M18D 4Z5TD 3LZ0C 1ID3A 2NQBA 1P3AC 5B1MA 1P3MA 4XZQD 3AYWB 3RELA 5B0YA 3REHD 3WTPA 3LELC 5JRGD 3VH6A 3AZGC 2AROA 3REID 2HIOC 3C1CA 1P3BD 4NFTA 3X1UB 4HGAB 1U35A 2YFVA 3AZMA 3X1SA 1TZYA 2ZY2A 1HQ3B 4CAYA 4J8VA 1KX3A 2G5IC 5CPIB 5GXQC 3AZFC 3AZKC 1BH9A 2FJ7B 4H9NA 1P3PB 1PZRA 3VH6T 5B31G 5AY8A 4WU8B 1M19B 3H0LC 2NZDC 3AZLD 2UWXA 3MGSB 4R8PB 3KWQC 1HQ3D 4EO5C 2L5AA 5GT0A 3UT9B 4LD9A 2BYMB 5B31B 1BH8B 4CSRB 2FJ7D 2Y2LA 3AZHA 1WWIA 4WU8D 1EQZB 3O62B 1M19D 5AV5C 3MGSD 4WU9C 4R8PD 5B32B 5CPKA 2ZY4A 3UT9D 1P3MB 5AVBC 1EQZD 2Y2PA 3A6NA 3RELB 4YS3D 4J8XB 2Y2NA 5B24D 3WTPB 3W97B 1P3FC 1M1AB 2AROB 5B32D 3B6FA 5B33B 2XD1A 2CV5C 3C1CB 1P3IC 1KX4B 1JFIA 2G5HC 1U35B 4XUJB 3WAAA 3B6GC 4J8XD 3VH5A 3W97D 3WTPE 1M1AD 3AL0C 5B33D 3P5JB 1KX4D 4H9NB 5BNVA 5B1LC 1P3LD 3R45B 4WZSB 3AV2A 5JA4B 5DNNC 4XUJD 3TU4C 3IP4C 3UTBC 4KGCC 3W96B 2HUEC 5CPJA 3NQJA 1H3OB 4XZQC 3MGPB 5F99D 2BG1A 5BNXA 3REHC 5JRGC 5GT3D 3REIC 4YS3B 3MVDA 5DNMA 1P3OB 1W2EA 4J8WA 1P3BC 5B40A 1F66B 2F8NA 3AYWC 4ZBJB 2F8NH 3MGPD 3W99A 3X1VB 3WAAC 3AZIB 4QLCA 3B6FB 5AV8B 5CP6B 3AFAA 1P3OD 1M18A 3AZEA 1F66D 4HGAC 3AZLC 3AN2D 3X1VD 1HQ3C 2JCHA 1WWSA 5CPIC 3AZID 4J8UA 3B0CT 3KSYA 5AV8D 5CP6D 5E5AA 1ZLAB 2FJ7C 1P3PC 4H9QA 4WNNA 4H9OB 4X23B 3LJAA 4WU8C 2RVQD 1M19C 4H9SC 3MGSC 4R8PC 5AV9A 3MGRA 4ZUXA 3AV1A 1KX5B 3KUYB 3UT9C 5B31C 1ZLAD 3VH5W 1EQZC 4KUDB 4JJNA 2F8NG 3O62C 4YS3C 5B24C 5DNND 3TU4D 1ULYA 1N1JA 5B32C 5AVCB 2PYOA 1KX5D 3WKJD 1P34A 3KUYD 2Y2JA 3X1TA 1P3KA 2F8NB 4KUDD 3RELC 4J8XC 5FUGA 4UUZB 3WTPC 3W97C 3UTAA 3EPHA 3B0BA 1M1AC 4QLCB 3KXBA 5AVCD 2DF4C 4H9RA 5B33C 1KX4C 3MNNA 3C1CC 1P3LC 3AZJB 5B2IB 1U35C 4XUJC 5KDMA 3AYWD 3H0MC 5AV6A 3MGQB 3W98B 5B2JA 2Y2IA 4AWLB 4WNNB 1P3GB 3LZ0A 3AZJD 5B2ID 5F99C 1P3AA 2XD5A 3X1UD 1S32B 5GT3C 3W96C 1AOIB 3MGQD 3LELA 3W98D 5CPID 3AZGA 5B0ZB 3NQUB 5BT1C 2HIOA 1P3GD 3LZ1B 1P3PD 2Y2GA 3REJB 3MGPC 2Y2MA 3C1BA 3AZNB 3REKB 1S32D 1N1JB 5GSUB 1AOID 4KHAB 2PYOB 3WA9A 1Q9CA 1P3OC 1T3UA 5GXQA 3AZKA 3AZFA 1ID3B 1P3KB 1F66C 2NQBB 5B31D 3LZ1D 5B1MB 4ZBJC 3AN2C 3REJD 3O62D 4G92B 3AZND 3X1VC 5C3IB 2JE5A 5B0YB 3REKD 2NZDA 3KXBB 5GSUD 3AZIC 5AV8C 3KWQA 5CP6C 5CHLB 5G49A 4E44A 1ID3D 2NQBD 2RVQC 1P3MD 2YFVB 2J8PA 3AZMB 3RELD 3X1SB 5AV5A 1TZYB 5B0YD 4CAYB 4J8VB 3WTPD 1KX3B 4WU9A 2ZM5A 2AROD 1ZLAC 1BH9B 3C1CD 4X23C 3LZ0B 5AY8B 1P3AB 5AVBA 1U35D 2W8SA 3AZMD 1TZYD 2JSSA 4J8VD 4Z66A 3FDDA 1KX3D 1KX5C 1P3FA 3WKJC 3KUYC 5GT0B 3VH5T 2Y2KA 4LD9B 1P3IA 2CV5A 4KUDC 3AZHB 5AY8D 4H9PA 3C1BB 2F8NK 3B6GA 5AVCC 3WA9B 3W96D 5CPKB 5GT0D 4LD9D 5BT1D 2Y2HA 5B1LA 3AZHD 3A6NB 4G91B 2YFWA 3UTBA 4QLCC 2Y2OA 4KGCA 2IO5B 5CPKD 5G49B 4YM6A 5BO0A 4Z5TA 3AZJC 1JFIB 5B2IC 3X1UC 4XZQA 3A6ND 3WAAB 3MGQC 3REHA 3W98C 5JRGA 3REIA 4AWLC 3B6FD 2VQRA 1R4VA 1P3GC 5BNVB 1P3BA 4DRBA 3AV2B 3AYWA 3WAAD 1S32C 1AOIC 4Z66B 3V9RA 5CPJB 5B0ZC 3NQJB 3LZ1C 4X23D 3REJC 5BS7C 3AV2D 3AZNC 3REKC 5BNXB 3AZLA 5GSUC 1HQ3A 3A1IA 3MVDB 5DNMB 5CPIA 4J8WB 1ID3C 1P3KC 2NQBC 5B40B 3B0DB 2FJ7A 5B1MC 1P3MC 4WU8A 3W99B 4G92C 1M19A 5C3IC 5B0YC 4H9SA 3MGSA 1A7WA 4R8PA 4Z2MH 2AROC 2BYKA 3AFAB 3MVDD 5DNMD 4YM6B 4J8WD 3F6TA 5BO0B 4Z5TB 3UT9A 5B40D 2BYMA 3AZEB 5B31A 1BH8A 4CSRA 2F8ND 4XZQB 1EQZA 3AZMC 3W99D 3X1SC 4YS3A 1TZYC 4J8VC 5B24A 1KX3C 4QLCD 4J8UB 5B32A 3EPKA 3AFAD 2ZY3A 5E5AB 3H0RC 1B6WA 4H9QB 3AZED 1P3BB 3LJAB 5AY8C 2FFFB 5AV9B 3MGRB 4J8XA 4ZUXB 3W97A 3AV1B 3V9RB 1M1AA 1TAFA 4J8UD 5GT0C 1KU5A 5E5AD 5B33A 4LD9C 1KX4A 3LJAD 3AZHC 1P3LA 4JJNB 3C1BC 2CWEA 4XUJA 3AZLB 5AV9D 4Z2MG 3MGRD 4ZUXD 3WA9C 3AV1D 5CPKC 1Z2CB 1P34B 3B0CW 5B0ZD 3EPLA 3X1TB 4JJND 3A6NC 3R45A 4NE6A 5F99A 4G91C 5FUGB 5JA4A 3UTAB 3KFUG 2BYKB 5GT3A 2IO5C 3W96A 3B6FC 4H9RB 2PYOD 5B32G 3MNNB 1P34D 1H3OA 3X1TD 1P3KD 5B1MD 5KDMB 3MGPA 2Y2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 B;  5B24 B;  3UTA D;  3KXB D;  5B2J B;  1B67 A;  3MNN D;  1P3O A;  1F66 A;  3AV2 C;  3AN2 A;  5AV6 D;  3X1S D;  4Z66 C;  3X1V A;  3LEL B;  1TAF B;  3AZI A;  3AZG B;  5CPJ C;  5B2J D;  5AV8 A;  5CP6 A;  2HIO B;  1P3L B;  3LZ0 D;  1P3A D;  3LEL D;  3MVD C;  5DNM C;  3AZG D;  5GXQ B;  4J8W C;  3AZK B;  3AZF B;  5B40 C;  3B0D C;  1ZLA A;  2HIO D;  4H9O A;  4X23 A;  3W99 C;  5F99 B;  3VH6 W;  3C1B D;  5DNN A;  2NZD B;  3TU4 A;  5GT3 B;  3KWQ B;  3WA9 D;  3AFA C;  4EO5 B;  4YM6 C;  1KX5 A;  5GXQ D;  3AZK D;  3KUY A;  3AZF D;  3AZE C;  4Z5T C;  1M18 C;  3WKJ A;  4KUD A;  4E45 A;  5AV5 B;  2NZD D;  4WU9 B;  4J8U C;  3KWQ D;  5AVC A;  5E5A C;  3LJA C;  1BFM A;  4WV4 B;  5AVB B;  3AN2 B;  5AV9 C;  3MGR C;  4ZUX C;  5AV5 D;  4UUZ A;  3AV1 C;  4WU9 D;  2LY8 A;  1P3F B;  1P3I B;  2CV5 B;  1F1E A;  4JJN C;  3AZJ A;  5B2I A;  4H9P B;  5AVB D;  3X1U A;  3B6G B;  4Z66 D;  3MGQ A;  2PYO C;  3W98 A;  1P3F D;  1P34 C;  5CPJ D;  3X1T C;  1P3I D;  2CV5 D;  4NE3 A;  1P3G A;  1P3P A;  5B1L B;  5DNN B;  1HTA A;  3UTA C;  3TU4 B;  2YFW B;  3UTB B;  1S32 A;  3KXB C;  3B6G D;  4M6B A;  1AOI A;  4KGC B;  4NE5 A;  2HUE B;  3MNN C;  3WKJ B;  4DRA A;  5B0Z A;  3NQU A;  3LZ1 A;  5B1L D;  3REJ A;  5BS7 A;  5AV6 C;  3O62 A;  3AZN A;  3REK A;  3REH B;  3UTB D;  5GSU A;  5JRG B;  4KGC D;  4KHA A;  5B2J C;  3REI B;  4YM6 D;  1M18 D;  4Z5T D;  3LZ0 C;  1ID3 A;  2NQB A;  1P3A C;  5B1M A;  1P3M A;  4XZQ D;  3AYW B;  3REL A;  5B0Y A;  3REH D;  3WTP A;  3LEL C;  5JRG D;  3VH6 A;  3AZG C;  2ARO A;  3REI D;  2HIO C;  3C1C A;  1P3B D;  4NFT A;  3X1U B;  4HGA B;  1U35 A;  2YFV A;  3AZM A;  3X1S A;  1TZY A;  4CAY A;  1HQ3 B;  4J8V A;  1KX3 A;  5CPI B;  5GXQ C;  3AZF C;  3AZK C;  1BH9 A;  2FJ7 B;  4H9N A;  1P3P B;  3VH6 T;  5B31 G;  5AY8 A;  4WU8 B;  1M19 B;  2NZD C;  3AZL D;  3MGS B;  4R8P B;  3KWQ C;  1HQ3 D;  4EO5 C;  2L5A A;  5GT0 A;  3UT9 B;  4LD9 A;  2BYM B;  5B31 B;  1BH8 B;  4CSR B;  2FJ7 D;  3AZH A;  1WWI A;  4WU8 D;  1EQZ B;  3O62 B;  1M19 D;  5AV5 C;  3MGS D;  4WU9 C;  4R8P D;  5B32 B;  5CPK A;  3UT9 D;  1P3M B;  5AVB C;  1EQZ D;  3A6N A;  3REL B;  4YS3 D;  4J8X B;  5B24 D;  3WTP B;  3W97 B;  1P3F C;  1M1A B;  2ARO B;  5B32 D;  3B6F A;  5B33 B;  1P3I C;  2CV5 C;  3C1C B;  1KX4 B;  1JFI A;  1U35 B;  4XUJ B;  3WAA A;  3B6G C;  4J8X D;  3VH5 A;  3W97 D;  3WTP E;  1M1A D;  5B33 D;  1KX4 D;  4H9N B;  5BNV A;  5B1L C;  1P3L D;  3R45 B;  4WZS B;  3AV2 A;  5JA4 B;  5DNN C;  4XUJ D;  3TU4 C;  3UTB C;  4KGC C;  3W96 B;  2HUE C;  5CPJ A;  3NQJ A;  1H3O B;  4XZQ C;  3MGP B;  5F99 D;  5BNX A;  3REH C;  5JRG C;  5GT3 D;  3REI C;  4YS3 B;  3MVD A;  5DNM A;  1P3O B;  4J8W A;  1P3B C;  5B40 A;  1F66 B;  2F8N A;  3AYW C;  4ZBJ B;  2F8N H;  3MGP D;  3W99 A;  3X1V B;  3WAA C;  3AZI B;  4QLC A;  3B6F B;  5AV8 B;  5CP6 B;  3AFA A;  1P3O D;  1M18 A;  3AZE A;  1F66 D;  4HGA C;  3AZL C;  3AN2 D;  3X1V D;  1HQ3 C;  1WWS A;  5CPI C;  3AZI D;  4J8U A;  3B0C T;  3KSY A;  5AV8 D;  5CP6 D;  5E5A A;  1ZLA B;  2FJ7 C;  1P3P C;  4H9Q A;  4WNN A;  4H9O B;  4X23 B;  3LJA A;  4WU8 C;  2RVQ D;  1M19 C;  4H9S C;  3MGS C;  4R8P C;  5AV9 A;  3MGR A;  4ZUX A;  3AV1 A;  1KX5 B;  3KUY B;  3UT9 C;  5B31 C;  1ZLA D;  3VH5 W;  1EQZ C;  4KUD B;  4JJN A;  2F8N G;  3O62 C;  4YS3 C;  5B24 C;  5DNN D;  3TU4 D;  1ULY A;  1N1J A;  5B32 C;  5AVC B;  2PYO A;  1KX5 D;  3WKJ D;  1P34 A;  3KUY D;  3X1T A;  1P3K A;  2F8N B;  4KUD D;  3REL C;  4J8X C;  5FUG A;  4UUZ B;  3WTP C;  3W97 C;  3UTA A;  3B0B A;  1M1A C;  4QLC B;  3KXB A;  5AVC D;  4H9R A;  5B33 C;  1KX4 C;  3MNN A;  3C1C C;  1P3L C;  3AZJ B;  5B2I B;  1U35 C;  4XUJ C;  5KDM A;  3AYW D;  5AV6 A;  3MGQ B;  3W98 B;  5B2J A;  4AWL B;  4WNN B;  1P3G B;  3LZ0 A;  3AZJ D;  5B2I D;  5F99 C;  1P3A A;  3X1U D;  1S32 B;  5GT3 C;  3W96 C;  1AOI B;  3MGQ D;  3LEL A;  3W98 D;  5CPI D;  3AZG A;  5B0Z B;  3NQU B;  5BT1 C;  2HIO A;  1P3G D;  3LZ1 B;  1P3P D;  3REJ B;  3MGP C;  3C1B A;  3AZN B;  3REK B;  1S32 D;  1N1J B;  5GSU B;  1AOI D;  4KHA B;  2PYO B;  3WA9 A;  1Q9C A;  1P3O C;  5GXQ A;  3AZK A;  3AZF A;  1ID3 B;  1P3K B;  1F66 C;  2NQB B;  5B31 D;  3LZ1 D;  5B1M B;  4ZBJ C;  3AN2 C;  3REJ D;  3O62 D;  4G92 B;  3AZN D;  3X1V C;  5C3I B;  3REK D;  5B0Y B;  2NZD A;  3KXB B;  5GSU D;  3AZI C;  5AV8 C;  3KWQ A;  5CP6 C;  5CHL B;  5G49 A;  4E44 A;  1ID3 D;  2NQB D;  2RVQ C;  1P3M D;  2YFV B;  3AZM B;  3REL D;  3X1S B;  5AV5 A;  1TZY B;  5B0Y D;  4CAY B;  4J8V B;  3WTP D;  1KX3 B;  4WU9 A;  2ARO D;  1ZLA C;  1BH9 B;  3C1C D;  4X23 C;  3LZ0 B;  5AY8 B;  1P3A B;  5AVB A;  1U35 D;  3AZM D;  1TZY D;  2JSS A;  4J8V D;  4Z66 A;  1KX3 D;  1KX5 C;  1P3F A;  3WKJ C;  3KUY C;  5GT0 B;  3VH5 T;  4LD9 B;  1P3I A;  2CV5 A;  4KUD C;  3AZH B;  5AY8 D;  4H9P A;  3C1B B;  2F8N K;  3B6G A;  5AVC C;  3WA9 B;  3W96 D;  5CPK B;  5GT0 D;  4LD9 D;  5BT1 D;  5B1L A;  3AZH D;  3A6N B;  4G91 B;  2YFW A;  3UTB A;  4QLC C;  4KGC A;  2IO5 B;  5CPK D;  5G49 B;  4YM6 A;  5BO0 A;  4Z5T A;  3AZJ C;  1JFI B;  5B2I C;  3X1U C;  4XZQ A;  3A6N D;  3WAA B;  3MGQ C;  3REH A;  3W98 C;  5JRG A;  3REI A;  4AWL C;  3B6F D;  1R4V A;  1P3G C;  5BNV B;  1P3B A;  4DRB A;  3AV2 B;  3AYW A;  3WAA D;  1S32 C;  1AOI C;  4Z66 B;  3V9R A;  5CPJ B;  5B0Z C;  3NQJ B;  3LZ1 C;  4X23 D;  3REJ C;  5BS7 C;  3AV2 D;  3AZN C;  3REK C;  5BNX B;  3AZL A;  5GSU C;  1HQ3 A;  3MVD B;  5DNM B;  5CPI A;  4J8W B;  1ID3 C;  1P3K C;  2NQB C;  5B40 B;  3B0D B;  2FJ7 A;  5B1M C;  1P3M C;  4WU8 A;  3W99 B;  4G92 C;  1M19 A;  5C3I C;  5B0Y C;  4H9S A;  3MGS A;  1A7W A;  4R8P A;  4Z2M H;  2ARO C;  2BYK A;  3AFA B;  3MVD D;  5DNM D;  4YM6 B;  4J8W D;  5BO0 B;  3UT9 A;  4Z5T B;  3AZE B;  5B40 D;  2BYM A;  1M18 B;  5B31 A;  1BH8 A;  4CSR A;  2F8N D;  4XZQ B;  1EQZ A;  3AZM C;  3W99 D;  3X1S C;  4YS3 A;  1TZY C;  4J8V C;  5B24 A;  1KX3 C;  4QLC D;  4J8U B;  5B32 A;  3AFA D;  5E5A B;  1B6W A;  4H9Q B;  3AZE D;  1P3B B;  3LJA B;  5AY8 C;  5AV9 B;  3MGR B;  4J8X A;  4ZUX B;  3W97 A;  3AV1 B;  3V9R B;  1M1A A;  1TAF A;  4J8U D;  5GT0 C;  1KU5 A;  5E5A D;  5B33 A;  4LD9 C;  1KX4 A;  3LJA D;  3AZH C;  1P3L A;  4JJN B;  3C1B C;  2CWE A;  4XUJ A;  3AZL B;  5AV9 D;  4Z2M G;  3MGR D;  4ZUX D;  3WA9 C;  3AV1 D;  5CPK C;  1P34 B;  3B0C W;  5B0Z D;  3X1T B;  4JJN D;  3A6N C;  3R45 A;  4NE6 A;  5F99 A;  4G91 C;  5FUG B;  5JA4 A;  3UTA B;  2BYK B;  5GT3 A;  2IO5 C;  3W96 A;  3B6F C;  4H9R B;  2PYO D;  5B32 G;  3MNN B;  1P34 D;  1H3O A;  3X1T D;  1P3K D;  5B1M D;  5KDM B;  3MGP A; 
#chains in the Genus database with same CATH topology
 5AV6 B;  5B24 B;  3UTA D;  3KXB D;  1M18 B;  4DQY B;  5B2J B;  1B67 A;  3MNN D;  1P3O A;  1F66 A;  3AV2 C;  2DQN C;  3AN2 A;  5AV6 D;  3X1S D;  4Z66 C;  3X1V A;  3LEL B;  1TAF B;  2RIQ A;  3AZI A;  3AZG B;  5CPJ C;  5B2J D;  5AV8 A;  5CP6 A;  2HIO B;  1P3L B;  3LZ0 D;  1P3A D;  2ZY5 A;  3LEL D;  3MVD C;  5DNM C;  3AZG D;  5GXQ B;  4J8W C;  3AZK B;  3AZF B;  5B40 C;  3B0D C;  1ZLA A;  2HIO D;  4H9O A;  4X23 A;  3W99 C;  5F99 B;  3VH6 W;  3C1B D;  5DNN A;  2NZD B;  3TU4 A;  5GT3 B;  3KWQ B;  3WA9 D;  3AFA C;  4EO5 B;  4YM6 C;  1KX5 A;  5GXQ D;  3AZK D;  3KUY A;  3AZF D;  3AZE C;  4Z5T C;  1M18 C;  3WKJ A;  3A1K A;  4KUD A;  2F2A C;  4E45 A;  5AV5 B;  2NZD D;  4WU9 B;  4J8U C;  3KWQ D;  5AVC A;  5E5A C;  3LJA C;  1BFM A;  3EPJ A;  4WV4 B;  5AVB B;  3AN2 B;  5AV9 C;  3MGR C;  4ZUX C;  5AV5 D;  4UUZ A;  3AV1 C;  4WU9 D;  4WJ3 C;  2LY8 A;  1P3F B;  1P3I B;  2CV5 B;  1F1E A;  4JJN C;  3AZJ A;  3EG5 B;  5B2I A;  4H9P B;  5AVB D;  3X1U A;  4UPK A;  3B6G B;  4Z66 D;  3MGQ A;  2PYO C;  3W98 A;  1P3F D;  1P34 C;  5CPJ D;  3X1T C;  1P3I D;  2CV5 D;  4NE3 A;  1P3G A;  1P3P A;  5B1L B;  5DNN B;  1HTA A;  3UTA C;  3TU4 B;  2YFW B;  3UTB B;  1S32 A;  3KXB C;  3B6G D;  4M6B A;  1AOI A;  4KGC B;  4NE5 A;  2HUE B;  3MNN C;  3WKJ B;  4DRA A;  5B0Z A;  3NQU A;  3LZ1 A;  5B1L D;  3REJ A;  5BS7 A;  5AV6 C;  3O62 A;  3AZN A;  3REK A;  3REH B;  3UTB D;  5GSU A;  5JRG B;  4KGC D;  4KHA A;  5B2J C;  3REI B;  4YM6 D;  1M18 D;  4Z5T D;  3LZ0 C;  1ID3 A;  2NQB A;  1P3A C;  5B1M A;  1P3M A;  4XZQ D;  3AYW B;  3REL A;  5B0Y A;  3REH D;  3WTP A;  3LEL C;  5JRG D;  3VH6 A;  3AZG C;  2ARO A;  3REI D;  2HIO C;  3C1C A;  1P3B D;  4NFT A;  3X1U B;  4HGA B;  1U35 A;  2YFV A;  3AZM A;  3X1S A;  1TZY A;  2ZY2 A;  1HQ3 B;  4CAY A;  4J8V A;  1KX3 A;  2G5I C;  5CPI B;  5GXQ C;  3AZF C;  3AZK C;  1BH9 A;  2FJ7 B;  4H9N A;  1P3P B;  1PZR A;  3VH6 T;  5B31 G;  5AY8 A;  4WU8 B;  1M19 B;  3H0L C;  2NZD C;  3AZL D;  2UWX A;  3MGS B;  4R8P B;  3KWQ C;  1HQ3 D;  4EO5 C;  2L5A A;  5GT0 A;  3UT9 B;  4LD9 A;  2BYM B;  5B31 B;  1BH8 B;  4CSR B;  2FJ7 D;  2Y2L A;  3AZH A;  1WWI A;  4WU8 D;  1EQZ B;  3O62 B;  1M19 D;  5AV5 C;  3MGS D;  4WU9 C;  4R8P D;  5B32 B;  5CPK A;  2ZY4 A;  3UT9 D;  1P3M B;  5AVB C;  1EQZ D;  2Y2P A;  3A6N A;  3REL B;  4YS3 D;  4J8X B;  2Y2N A;  5B24 D;  3WTP B;  3W97 B;  1P3F C;  1M1A B;  2ARO B;  5B32 D;  3B6F A;  5B33 B;  2XD1 A;  2CV5 C;  3C1C B;  1P3I C;  1KX4 B;  1JFI A;  2G5H C;  1U35 B;  4XUJ B;  3WAA A;  3B6G C;  4J8X D;  3VH5 A;  3W97 D;  3WTP E;  1M1A D;  3AL0 C;  5B33 D;  3P5J B;  1KX4 D;  4H9N B;  5BNV A;  5B1L C;  1P3L D;  3R45 B;  4WZS B;  3AV2 A;  5JA4 B;  5DNN C;  4XUJ D;  3TU4 C;  3IP4 C;  3UTB C;  4KGC C;  3W96 B;  2HUE C;  5CPJ A;  3NQJ A;  1H3O B;  4XZQ C;  3MGP B;  5F99 D;  2BG1 A;  5BNX A;  3REH C;  5JRG C;  5GT3 D;  3REI C;  4YS3 B;  3MVD A;  5DNM A;  1P3O B;  1W2E A;  4J8W A;  1P3B C;  5B40 A;  1F66 B;  2F8N A;  3AYW C;  4ZBJ B;  2F8N H;  3MGP D;  3W99 A;  3X1V B;  3WAA C;  3AZI B;  4QLC A;  3B6F B;  5AV8 B;  5CP6 B;  3AFA A;  1P3O D;  1M18 A;  3AZE A;  1F66 D;  4HGA C;  3AZL C;  3AN2 D;  3X1V D;  1HQ3 C;  2JCH A;  1WWS A;  5CPI C;  3AZI D;  4J8U A;  3B0C T;  3KSY A;  5AV8 D;  5CP6 D;  5E5A A;  1ZLA B;  2FJ7 C;  1P3P C;  4H9Q A;  4WNN A;  4H9O B;  4X23 B;  3LJA A;  4WU8 C;  2RVQ D;  1M19 C;  4H9S C;  3MGS C;  4R8P C;  5AV9 A;  3MGR A;  4ZUX A;  3AV1 A;  1KX5 B;  3KUY B;  3UT9 C;  5B31 C;  1ZLA D;  3VH5 W;  1EQZ C;  4KUD B;  4JJN A;  2F8N G;  3O62 C;  4YS3 C;  5B24 C;  5DNN D;  3TU4 D;  1ULY A;  1N1J A;  5B32 C;  5AVC B;  2PYO A;  1KX5 D;  3WKJ D;  1P34 A;  3KUY D;  2Y2J A;  3X1T A;  1P3K A;  2F8N B;  4KUD D;  3REL C;  4J8X C;  5FUG A;  4UUZ B;  3WTP C;  3W97 C;  3UTA A;  3EPH A;  3B0B A;  1M1A C;  4QLC B;  3KXB A;  5AVC D;  2DF4 C;  4H9R A;  5B33 C;  1KX4 C;  3MNN A;  3C1C C;  1P3L C;  3AZJ B;  5B2I B;  1U35 C;  4XUJ C;  5KDM A;  3AYW D;  3H0M C;  5AV6 A;  3MGQ B;  3W98 B;  5B2J A;  2Y2I A;  4AWL B;  4WNN B;  1P3G B;  3LZ0 A;  3AZJ D;  5B2I D;  5F99 C;  1P3A A;  2XD5 A;  3X1U D;  1S32 B;  5GT3 C;  3W96 C;  1AOI B;  3MGQ D;  3LEL A;  3W98 D;  5CPI D;  3AZG A;  5B0Z B;  3NQU B;  5BT1 C;  2HIO A;  1P3G D;  3LZ1 B;  1P3P D;  2Y2G A;  3REJ B;  3MGP C;  2Y2M A;  3C1B A;  3AZN B;  3REK B;  1S32 D;  1N1J B;  5GSU B;  1AOI D;  4KHA B;  2PYO B;  3WA9 A;  1Q9C A;  1P3O C;  1T3U A;  5GXQ A;  3AZK A;  3AZF A;  1ID3 B;  1P3K B;  1F66 C;  2NQB B;  5B31 D;  3LZ1 D;  5B1M B;  4ZBJ C;  3AN2 C;  3REJ D;  3O62 D;  4G92 B;  3AZN D;  3X1V C;  5C3I B;  2JE5 A;  5B0Y B;  3REK D;  2NZD A;  3KXB B;  5GSU D;  3AZI C;  5AV8 C;  3KWQ A;  5CP6 C;  5CHL B;  5G49 A;  4E44 A;  1ID3 D;  2NQB D;  2RVQ C;  1P3M D;  2YFV B;  2J8P A;  3AZM B;  3REL D;  3X1S B;  5AV5 A;  1TZY B;  5B0Y D;  4CAY B;  4J8V B;  3WTP D;  1KX3 B;  4WU9 A;  2ZM5 A;  2ARO D;  1ZLA C;  1BH9 B;  3C1C D;  4X23 C;  3LZ0 B;  5AY8 B;  1P3A B;  5AVB A;  1U35 D;  2W8S A;  3AZM D;  1TZY D;  2JSS A;  4J8V D;  4Z66 A;  3FDD A;  1KX3 D;  1KX5 C;  1P3F A;  3WKJ C;  3KUY C;  5GT0 B;  3VH5 T;  2Y2K A;  4LD9 B;  1P3I A;  2CV5 A;  4KUD C;  3AZH B;  5AY8 D;  4H9P A;  3C1B B;  2F8N K;  3B6G A;  5AVC C;  3WA9 B;  3W96 D;  5CPK B;  5GT0 D;  4LD9 D;  5BT1 D;  2Y2H A;  5B1L A;  3AZH D;  3A6N B;  4G91 B;  2YFW A;  3UTB A;  4QLC C;  2Y2O A;  4KGC A;  2IO5 B;  5CPK D;  5G49 B;  4YM6 A;  5BO0 A;  4Z5T A;  3AZJ C;  1JFI B;  5B2I C;  3X1U C;  4XZQ A;  3A6N D;  3WAA B;  3MGQ C;  3REH A;  3W98 C;  5JRG A;  3REI A;  4AWL C;  3B6F D;  2VQR A;  1R4V A;  1P3G C;  5BNV B;  1P3B A;  4DRB A;  3AV2 B;  3AYW A;  3WAA D;  1S32 C;  1AOI C;  4Z66 B;  3V9R A;  5CPJ B;  5B0Z C;  3NQJ B;  3LZ1 C;  4X23 D;  3REJ C;  5BS7 C;  3AV2 D;  3AZN C;  3REK C;  5BNX B;  3AZL A;  5GSU C;  1HQ3 A;  3A1I A;  3MVD B;  5DNM B;  5CPI A;  4J8W B;  1ID3 C;  1P3K C;  2NQB C;  5B40 B;  3B0D B;  2FJ7 A;  5B1M C;  1P3M C;  4WU8 A;  3W99 B;  4G92 C;  1M19 A;  5C3I C;  5B0Y C;  4H9S A;  3MGS A;  1A7W A;  4R8P A;  4Z2M H;  2ARO C;  2BYK A;  3AFA B;  3MVD D;  5DNM D;  4YM6 B;  4J8W D;  3F6T A;  5BO0 B;  4Z5T B;  3UT9 A;  5B40 D;  2BYM A;  3AZE B;  5B31 A;  1BH8 A;  4CSR A;  2F8N D;  4XZQ B;  1EQZ A;  3AZM C;  3W99 D;  3X1S C;  4YS3 A;  1TZY C;  4J8V C;  5B24 A;  1KX3 C;  4QLC D;  4J8U B;  5B32 A;  3EPK A;  3AFA D;  2ZY3 A;  5E5A B;  3H0R C;  1B6W A;  4H9Q B;  3AZE D;  1P3B B;  3LJA B;  5AY8 C;  2FFF B;  5AV9 B;  3MGR B;  4J8X A;  4ZUX B;  3W97 A;  3AV1 B;  3V9R B;  1M1A A;  1TAF A;  4J8U D;  5GT0 C;  1KU5 A;  5E5A D;  5B33 A;  4LD9 C;  1KX4 A;  3LJA D;  3AZH C;  1P3L A;  4JJN B;  3C1B C;  2CWE A;  4XUJ A;  3AZL B;  5AV9 D;  4Z2M G;  3MGR D;  4ZUX D;  3WA9 C;  3AV1 D;  5CPK C;  1Z2C B;  1P34 B;  3B0C W;  5B0Z D;  3EPL A;  3X1T B;  4JJN D;  3A6N C;  3R45 A;  4NE6 A;  5F99 A;  4G91 C;  5FUG B;  5JA4 A;  3UTA B;  3KFU G;  2BYK B;  5GT3 A;  2IO5 C;  3W96 A;  3B6F C;  4H9R B;  2PYO D;  5B32 G;  3MNN B;  1P34 D;  1H3O A;  3X1T D;  1P3K D;  5B1M D;  5KDM B;  3MGP A;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 5AV6 B;  5B24 B;  3UTA D;  3KXB D;  1M18 B;  4DQY B;  5B2J B;  1B67 A;  3MNN D;  1P3O A;  1F66 A;  3AV2 C;  2DQN C;  3AN2 A;  5AV6 D;  3X1S D;  4Z66 C;  3X1V A;  3LEL B;  1TAF B;  2RIQ A;  3AZI A;  3AZG B;  5CPJ C;  5B2J D;  5AV8 A;  5CP6 A;  2HIO B;  1P3L B;  3LZ0 D;  1P3A D;  2ZY5 A;  3LEL D;  3MVD C;  5DNM C;  3AZG D;  5GXQ B;  4J8W C;  3AZK B;  3AZF B;  5B40 C;  3B0D C;  1ZLA A;  2HIO D;  4H9O A;  4X23 A;  3W99 C;  5F99 B;  3VH6 W;  3C1B D;  5DNN A;  2NZD B;  3TU4 A;  5GT3 B;  3KWQ B;  3WA9 D;  3AFA C;  4EO5 B;  4YM6 C;  1KX5 A;  5GXQ D;  3AZK D;  3KUY A;  3AZF D;  3AZE C;  4Z5T C;  1M18 C;  3WKJ A;  3A1K A;  4KUD A;  2F2A C;  4E45 A;  5AV5 B;  2NZD D;  4WU9 B;  4J8U C;  3KWQ D;  5AVC A;  5E5A C;  3LJA C;  1BFM A;  3EPJ A;  4WV4 B;  5AVB B;  3AN2 B;  5AV9 C;  3MGR C;  4ZUX C;  5AV5 D;  4UUZ A;  3AV1 C;  4WU9 D;  4WJ3 C;  2LY8 A;  1P3F B;  1P3I B;  2CV5 B;  1F1E A;  4JJN C;  3AZJ A;  3EG5 B;  5B2I A;  4H9P B;  5AVB D;  3X1U A;  4UPK A;  3B6G B;  4Z66 D;  3MGQ A;  2PYO C;  3W98 A;  1P3F D;  1P34 C;  5CPJ D;  3X1T C;  1P3I D;  2CV5 D;  4NE3 A;  1P3G A;  1P3P A;  5B1L B;  5DNN B;  1HTA A;  3UTA C;  3TU4 B;  2YFW B;  3UTB B;  1S32 A;  3KXB C;  3B6G D;  4M6B A;  1AOI A;  4KGC B;  4NE5 A;  2HUE B;  3MNN C;  3WKJ B;  4DRA A;  5B0Z A;  3NQU A;  3LZ1 A;  5B1L D;  3REJ A;  5BS7 A;  5AV6 C;  3O62 A;  3AZN A;  3REK A;  3REH B;  3UTB D;  5GSU A;  5JRG B;  4KGC D;  4KHA A;  5B2J C;  3REI B;  4YM6 D;  1M18 D;  4Z5T D;  3LZ0 C;  1ID3 A;  2NQB A;  1P3A C;  5B1M A;  1P3M A;  4XZQ D;  3AYW B;  3REL A;  5B0Y A;  3REH D;  3WTP A;  3LEL C;  5JRG D;  3VH6 A;  3AZG C;  2ARO A;  3REI D;  2HIO C;  3C1C A;  1P3B D;  4NFT A;  3X1U B;  4HGA B;  1U35 A;  2YFV A;  3AZM A;  3X1S A;  1TZY A;  2ZY2 A;  1HQ3 B;  4CAY A;  4J8V A;  1KX3 A;  2G5I C;  5CPI B;  5GXQ C;  3AZF C;  3AZK C;  1BH9 A;  2FJ7 B;  4H9N A;  1P3P B;  1PZR A;  3VH6 T;  5B31 G;  5AY8 A;  4WU8 B;  1M19 B;  3H0L C;  2NZD C;  3AZL D;  2UWX A;  3MGS B;  4R8P B;  3KWQ C;  1HQ3 D;  4EO5 C;  2L5A A;  5GT0 A;  3UT9 B;  4LD9 A;  2BYM B;  5B31 B;  1BH8 B;  4CSR B;  2FJ7 D;  2Y2L A;  3AZH A;  1WWI A;  4WU8 D;  1EQZ B;  3O62 B;  1M19 D;  5AV5 C;  3MGS D;  4WU9 C;  4R8P D;  5B32 B;  5CPK A;  2ZY4 A;  3UT9 D;  1P3M B;  5AVB C;  1EQZ D;  2Y2P A;  3A6N A;  3REL B;  4YS3 D;  4J8X B;  2Y2N A;  5B24 D;  3WTP B;  3W97 B;  1P3F C;  1M1A B;  2ARO B;  5B32 D;  3B6F A;  5B33 B;  2XD1 A;  2CV5 C;  3C1C B;  1P3I C;  1KX4 B;  1JFI A;  2G5H C;  1U35 B;  4XUJ B;  3WAA A;  3B6G C;  4J8X D;  3VH5 A;  3W97 D;  3WTP E;  1M1A D;  3AL0 C;  5B33 D;  3P5J B;  1KX4 D;  4H9N B;  5BNV A;  5B1L C;  1P3L D;  3R45 B;  4WZS B;  3AV2 A;  5JA4 B;  5DNN C;  4XUJ D;  3TU4 C;  3IP4 C;  3UTB C;  4KGC C;  3W96 B;  2HUE C;  5CPJ A;  3NQJ A;  1H3O B;  4XZQ C;  3MGP B;  5F99 D;  2BG1 A;  5BNX A;  3REH C;  5JRG C;  5GT3 D;  3REI C;  4YS3 B;  3MVD A;  5DNM A;  1P3O B;  1W2E A;  4J8W A;  1P3B C;  5B40 A;  1F66 B;  2F8N A;  3AYW C;  4ZBJ B;  2F8N H;  3MGP D;  3W99 A;  3X1V B;  3WAA C;  3AZI B;  4QLC A;  3B6F B;  5AV8 B;  5CP6 B;  3AFA A;  1P3O D;  1M18 A;  3AZE A;  1F66 D;  4HGA C;  3AZL C;  3AN2 D;  3X1V D;  1HQ3 C;  2JCH A;  1WWS A;  5CPI C;  3AZI D;  4J8U A;  3B0C T;  3KSY A;  5AV8 D;  5CP6 D;  5E5A A;  1ZLA B;  2FJ7 C;  1P3P C;  4H9Q A;  4WNN A;  4H9O B;  4X23 B;  3LJA A;  4WU8 C;  2RVQ D;  1M19 C;  4H9S C;  3MGS C;  4R8P C;  5AV9 A;  3MGR A;  4ZUX A;  3AV1 A;  1KX5 B;  3KUY B;  3UT9 C;  5B31 C;  1ZLA D;  3VH5 W;  1EQZ C;  4KUD B;  4JJN A;  2F8N G;  3O62 C;  4YS3 C;  5B24 C;  5DNN D;  3TU4 D;  1ULY A;  1N1J A;  5B32 C;  5AVC B;  2PYO A;  1KX5 D;  3WKJ D;  1P34 A;  3KUY D;  2Y2J A;  3X1T A;  1P3K A;  2F8N B;  4KUD D;  3REL C;  4J8X C;  5FUG A;  4UUZ B;  3WTP C;  3W97 C;  3UTA A;  3EPH A;  3B0B A;  1M1A C;  4QLC B;  3KXB A;  5AVC D;  2DF4 C;  4H9R A;  5B33 C;  1KX4 C;  3MNN A;  3C1C C;  1P3L C;  3AZJ B;  5B2I B;  1U35 C;  4XUJ C;  5KDM A;  3AYW D;  3H0M C;  5AV6 A;  3MGQ B;  3W98 B;  5B2J A;  2Y2I A;  4AWL B;  4WNN B;  1P3G B;  3LZ0 A;  3AZJ D;  5B2I D;  5F99 C;  1P3A A;  2XD5 A;  3X1U D;  1S32 B;  5GT3 C;  3W96 C;  1AOI B;  3MGQ D;  3LEL A;  3W98 D;  5CPI D;  3AZG A;  5B0Z B;  3NQU B;  5BT1 C;  2HIO A;  1P3G D;  3LZ1 B;  1P3P D;  2Y2G A;  3REJ B;  3MGP C;  2Y2M A;  3C1B A;  3AZN B;  3REK B;  1S32 D;  1N1J B;  5GSU B;  1AOI D;  4KHA B;  2PYO B;  3WA9 A;  1Q9C A;  1P3O C;  1T3U A;  5GXQ A;  3AZK A;  3AZF A;  1ID3 B;  1P3K B;  1F66 C;  2NQB B;  5B31 D;  3LZ1 D;  5B1M B;  4ZBJ C;  3AN2 C;  3REJ D;  3O62 D;  4G92 B;  3AZN D;  3X1V C;  5C3I B;  2JE5 A;  5B0Y B;  3REK D;  2NZD A;  3KXB B;  5GSU D;  3AZI C;  5AV8 C;  3KWQ A;  5CP6 C;  5CHL B;  5G49 A;  4E44 A;  1ID3 D;  2NQB D;  2RVQ C;  1P3M D;  2YFV B;  2J8P A;  3AZM B;  3REL D;  3X1S B;  5AV5 A;  1TZY B;  5B0Y D;  4CAY B;  4J8V B;  3WTP D;  1KX3 B;  4WU9 A;  2ZM5 A;  2ARO D;  1ZLA C;  1BH9 B;  3C1C D;  4X23 C;  3LZ0 B;  5AY8 B;  1P3A B;  5AVB A;  1U35 D;  2W8S A;  3AZM D;  1TZY D;  2JSS A;  4J8V D;  4Z66 A;  3FDD A;  1KX3 D;  1KX5 C;  1P3F A;  3WKJ C;  3KUY C;  5GT0 B;  3VH5 T;  2Y2K A;  4LD9 B;  1P3I A;  2CV5 A;  4KUD C;  3AZH B;  5AY8 D;  4H9P A;  3C1B B;  2F8N K;  3B6G A;  5AVC C;  3WA9 B;  3W96 D;  5CPK B;  5GT0 D;  4LD9 D;  5BT1 D;  2Y2H A;  5B1L A;  3AZH D;  3A6N B;  4G91 B;  2YFW A;  3UTB A;  4QLC C;  2Y2O A;  4KGC A;  2IO5 B;  5CPK D;  5G49 B;  4YM6 A;  5BO0 A;  4Z5T A;  3AZJ C;  1JFI B;  5B2I C;  3X1U C;  4XZQ A;  3A6N D;  3WAA B;  3MGQ C;  3REH A;  3W98 C;  5JRG A;  3REI A;  4AWL C;  3B6F D;  2VQR A;  1R4V A;  1P3G C;  5BNV B;  1P3B A;  4DRB A;  3AV2 B;  3AYW A;  3WAA D;  1S32 C;  1AOI C;  4Z66 B;  3V9R A;  5CPJ B;  5B0Z C;  3NQJ B;  3LZ1 C;  4X23 D;  3REJ C;  5BS7 C;  3AV2 D;  3AZN C;  3REK C;  5BNX B;  3AZL A;  5GSU C;  1HQ3 A;  3A1I A;  3MVD B;  5DNM B;  5CPI A;  4J8W B;  1ID3 C;  1P3K C;  2NQB C;  5B40 B;  3B0D B;  2FJ7 A;  5B1M C;  1P3M C;  4WU8 A;  3W99 B;  4G92 C;  1M19 A;  5C3I C;  5B0Y C;  4H9S A;  3MGS A;  1A7W A;  4R8P A;  4Z2M H;  2ARO C;  2BYK A;  3AFA B;  3MVD D;  5DNM D;  4YM6 B;  4J8W D;  3F6T A;  5BO0 B;  4Z5T B;  3UT9 A;  5B40 D;  2BYM A;  3AZE B;  5B31 A;  1BH8 A;  4CSR A;  2F8N D;  4XZQ B;  1EQZ A;  3AZM C;  3W99 D;  3X1S C;  4YS3 A;  1TZY C;  4J8V C;  5B24 A;  1KX3 C;  4QLC D;  4J8U B;  5B32 A;  3EPK A;  3AFA D;  2ZY3 A;  5E5A B;  3H0R C;  1B6W A;  4H9Q B;  3AZE D;  1P3B B;  3LJA B;  5AY8 C;  2FFF B;  5AV9 B;  3MGR B;  4J8X A;  4ZUX B;  3W97 A;  3AV1 B;  3V9R B;  1M1A A;  1TAF A;  4J8U D;  5GT0 C;  1KU5 A;  5E5A D;  5B33 A;  4LD9 C;  1KX4 A;  3LJA D;  3AZH C;  1P3L A;  4JJN B;  3C1B C;  2CWE A;  4XUJ A;  3AZL B;  5AV9 D;  4Z2M G;  3MGR D;  4ZUX D;  3WA9 C;  3AV1 D;  5CPK C;  1Z2C B;  1P34 B;  3B0C W;  5B0Z D;  3EPL A;  3X1T B;  4JJN D;  3A6N C;  3R45 A;  4NE6 A;  5F99 A;  4G91 C;  5FUG B;  5JA4 A;  3UTA B;  3KFU G;  2BYK B;  5GT3 A;  2IO5 C;  3W96 A;  3B6F C;  4H9R B;  2PYO D;  5B32 G;  3MNN B;  1P34 D;  1H3O A;  3X1T D;  1P3K D;  5B1M D;  5KDM B;  3MGP A;  2Y2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...