5AV6D

Human nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6D00
3VH5A 3V9RB 2LY8A 1P3AB 3W98C 2CWEA 5G49B 4R8PA 4ZUXD 1P34C 5GT0A 1P3FB 5B31C 3MGPC 4E44A 3LZ0B 1BFMA 4J8VD 1BH9B 1TZYC 2AROD 5F99B 4H9OB 3AZIB 5GXQB 2JSSA 4XZQA 3X1SD 1EQZB 5B2JA 5DNND 1P34D 5AV9D 3UT9B 5E5AC 3AYWD 3B6GA 3W97A 2FJ7B 3WAAA 3REKB 5B2IB 5CP6D 1F66C 2HIOB 4KHAA 3LJAB 5B0YD 3A6NA 1U35B 4J8UD 3AFAC 1M19C 4Z2MG 4NE6A 3UTBD 3MNNA 3C1BD 1P3ID 5AVCB 5B32B 4YM6B 3X1VA 3AZED 5BNXB 4Z5TD 3REJB 2PYOD 2YFWA 3AV2C 2HUEB 4JJNC 5JRGA 5AVBC 3AZKD 4KUDD 5AV9B 1AOIA 1JFIB 2NQBB 3AYWB 5KDMA 1HQ3C 3AZMB 3AZJB 5AV6A 3RELB 1P3BA 4Z66A 4H9QA 3KWQC 1ULYA 4NE5A 5AVBD 4R8PD 2CV5C 2F8NB 4H9PA 5GT0D 1P3LB 5B33B 4WU8A 5B1MC 4H9RB 3KXBB 3O62B 1KX3B 5AV8C 3AZEB 3WKJA 3B6GD 3X1TC 3W97D 3MGRA 5B32G 4WNNB 1M1AB 1P3MC 5CPKA 5GT3D 3A6ND 3R45B 4J8WB 4E45A 3WA9A 3MNND 3KUYC 3REIC 3VH6W 1S32C 5AY8B 3MGSA 1ID3B 3MGQB 1H3OA 3X1VD 5B24B 4R8PB 1ZLAC 5GT0B 3LELB 1KX4A 3REID 2F8NG 4XZQB 5JRGD 4LD9A 5B0ZC 4EO5C 5B2JB 3AZFC 3AZHC 3AZLA 5B1LB 5CPIB 1AOID 4J8XB 3C1CC 3WAAB 3W98A 5AV6D 2F8NK 4UUZB 5DNNA 4KHAB 4Z66D 3TU4B 1P34A 3A6NB 4KGCC 2BYKA 5B31A 1TZYA 4DRBA 5BNVB 4WU8D 1A7WA 2NZDC 5DNMB 3AN2C 3WTPC 1M18B 3X1VB 5E5AA 3MVDB 5C3IC 3WKJD 3UTBA 3MGRD 5CPJC 1F66A 1P3AC 3B0DB 3AFAA 4Z5TA 1M19A 3WA9D 4DRAA 5KDMB 3AZIC 5GXQC 1P3GB 4QLCB 3AZNC 1EQZC 1R4VA 3UT9C 1P3BB 2BYMB 2IO5B 2FJ7C 1HTAA 3REKC 1KX4D 3AV2A 3UTAC 2HIOC 4JJNA 4WU8B 4KUDA 3AV1B 3LJAC 4LD9D 1P3KB 5AVBA 3AZLD 4H9NA 4G92B 4WU9B 4YS3B 1HQ3A 3W98D 5AVCC 1BH8A 5B32C 4YM6C 5CPKB 3KWQA 2CV5A 5B31D 3MGPD 3REJC 1TZYD 3W96B 5B1MA 5GT3A 3MGSB 3X1UB 5GSUB 3W99B 1H3OB 5E5AD 5AV8A 5FUGB 3X1TA 5AV5B 3B0BA 5BT1C 2NQBC 1P3PB 1F66D 3AZMC 4G91B 3AZJC 1P3MA 3VH6T 1WWIA 3AFAD 3RELC 1M19D 5JA4B 4LD9B 4ZUXB 4CSRB 1F1EA 3KUYA 4J8VB 2AROB 3REIA 1P3LC 3W98B 1WWSA 3X1SB 3KXBC 3O62C 2RVQC 1KX3C 5DNNB 1P34B 1ZLAA 4NFTA 3AV2D 1TZYB 1M1AC 5CP6B 4JJND 3WTPE 5B0ZA 5B0YB 3AZFA 4J8UB 4J8WC 1N1JA 3C1CA 1HQ3D 3UTBB 5BS7C 3C1BB 1P3IB 5AY8C 2YFVA 1ID3C 3MGQC 4WZSB 4ZBJB 3KWQD 2CV5D 4KGCA 5B24C 4Z5TB 1KX5C 4X23C 3LELC 5B1MD 1TAFA 2PYOB 2NZDA 3AZGC 3AN2A 3WTPA 4XZQC 3NQJA 5AV8D 1P3OC 3X1TD 1KX5D 5B1LC 5CPIC 3AZKB 5CPJA 4KUDB 4J8XC 4NE3A 3NQUB 3WAAC 1P3AA 1P3MD 3AV2B 3B6FC 5G49A 3LZ1C 3TU4C 1Q9CA 5AVBB 4HGAB 5B40C 4H9NB 1BH9A 4H9OA 3KUYD 1S32D 3AZIA 5GXQA 3VH5W 1EQZA 3AZNA 5DNMC 1BH8B 1M18C 3UT9A 5BO0A 3MVDC 3KWQB 1ZLAD 2FJ7A 1KU5A 3REKA 3B6GB 3W97B 3UTAA 2HIOA 4XUJC 3LJAA 5GT3B 5B0ZD 3B0DC 3AZFD 3AZHD 3MGPA 3C1CD 3MNNB 4M6BA 3REHC 5AVCA 5B32A 4YM6A 1P3GC 4QLCC 4KGCD 1P3BC 3REJA 2IO5C 2YFWB 2NZDD 3REIB 3AN2D 3WTPD 3AV1C 1P3KC 5JRGB 1P3FC 4G92C 5CPJD 3LZ0C 1JFIA 2NQBA 1ZLAB 5F99C 4WU9C 1AOIB 4YS3C 3AZMA 1P3AD 3AZJA 3RELA 5AV6B 5CPKC 2F8NA 4Z66B 4H9QB 3AZFB 4H9PB 5F99D 5B2IC 3W96C 1P3LA 1N1JB 3AZID 5GXQD 4H9RA 1EQZD 3AZND 3KXBA 1U35C 3O62A 3X1UC 3MGSC 2YFVB 5GSUC 3W99C 4H9SC 3UT9D 1KX3A 4KGCB 2FJ7D 5AV5C 3REKD 5B2ID 3WKJB 4WNNA 3VH6A 3MGRB 3UTAD 2HIOD 1P3PC 1M1AA 4G91C 1TAFB 3LJAD 1U35D 4ZUXC 3WA9B 5BS7A 4AWLB 5CPJB 2HUEC 4J8VC 2AROC 5AY8A 5AVCD 1ID3A 5B32D 4YM6D 3MGQA 4Z2MH 3B0CW 3X1SC 5B24A 1KX5A 5DNNC 4X23A 3REJD 5AV9C 3AYWC 3LELA 1KX4B 5CP6C 3AZGA 1P3OA 3AZNB 5B0YC 5B1LA 5CPIA 4WV4B 4J8UC 5BO0B 5BT1D 3AZLB 2NQBD 4CAYA 4J8XA 1S32A 3AZMD 3UTBC 5B33C 3C1BC 3AZJD 3B6FA 1P3IC 3UTAB 3VH5T 4UUZA 3RELD 3LZ1A 4ZBJC 3TU4A 2F8ND 3AZEC 5B40A 4Z5TC 2BYKB 5B31B 3MGPB 5BNVA 1P3LD 5B33D 2PYOC 5DNMA 3KXBD 3O62D 2RVQD 1B67A 1M18A 3AZHA 1KX3D 3MVDA 5E5AB 3AZKC 1M1AD 4KUDC 4XUJA 1F66B 2L5AA 3AFAB 4J8WD 1M19B 4R8PC 4HGAC 5GT0C 3REHA 5AY8D 1ID3D 1P3GA 3MGQD 4QLCA 5B2JC 5B24D 4X23D 3KSYA 2BYMA 3V9RA 3LELD 3B6GC 3W97C 3AZGD 3AV1A 4XZQD 4JJNB 5B31G 1P3KA 1P3OD 5GT3C 5B2JD 3A6NC 5B1LD 5CPID 1P3FA 3LZ0A 5F99A 4J8XD 4WU9A 4YS3A 3WAAD 3MNNC 2F8NH 3B6FD 1HQ3B 3LZ1D 3TU4D 3X1VC 2CV5B 5B40D 5B2IA 3W96A 5B1MB 1U35A 5DNMD 3X1UA 5GSUA 1M18D 3W99A 4H9SA 3MVDD 5FUGA 5JRGC 5AV5A 5AV8B 3X1TB 1KX5B 4X23B 1P3PA 1AOIC 4XUJD 1P3MB 3AZGB 5BNXA 5AV6C 3B0CT 5JA4A 4Z66C 1P3OB 4ZUXA 4CSRA 4J8VA 2AROA 4CAYB 3REHD 3KUYB 1S32B 1P3GD 3B6FB 4WU8C 5CHLB 4QLCD 3X1SA 1P3BD 3LZ1B 5AV9A 3AYWA 3WKJC 5B40B 3MGRC 5CP6A 3AV1D 1P3KD 5B0YA 5B0ZB 4EO5B 4J8UA 3AZHB 3LZ0D 1P3FD 4WU9D 4YS3D 3WA9C 3C1CB 5B33A 3C1BA 4AWLC 1P3IA 4XUJB 5CPKD 3AZEA 1B6WA 3W96D 2PYOA 1KX4C 3REHB 3R45A 3MGSD 3X1UD 2NZDB 5GSUD 3W99D 3AN2B 3WTPB 4J8WA 3NQJB 5C3IB 5AV5D 4LD9C 3AZLC 3AZKA 1P3PD 3NQUA
chains in the Genus database with same CATH superfamily
3VH5A 3V9RB 2LY8A 1P3AB 3W98C 2CWEA 5G49B 4R8PA 4ZUXD 1P34C 5GT0A 1P3FB 5B31C 3MGPC 4E44A 3LZ0B 1BFMA 4J8VD 1BH9B 1TZYC 2AROD 5F99B 4H9OB 3AZIB 5GXQB 2JSSA 4XZQA 3X1SD 1EQZB 5B2JA 5DNND 1P34D 5AV9D 3UT9B 5E5AC 3AYWD 3B6GA 3W97A 2FJ7B 3WAAA 3REKB 5B2IB 5CP6D 1F66C 2HIOB 4KHAA 3LJAB 5B0YD 3A6NA 1U35B 3H0RC 4J8UD 3AFAC 1M19C 4Z2MG 4NE6A 3UTBD 3MNNA 3C1BD 1P3ID 2Y2GA 5AVCB 5B32B 4YM6B 3X1VA 3AZED 5BNXB 4Z5TD 3EPHA 3REJB 2PYOD 2YFWA 3AV2C 2HUEB 4JJNC 1PZRA 5JRGA 5AVBC 3AZKD 4KUDD 5AV9B 1AOIA 1JFIB 2NQBB 3AYWB 5KDMA 1HQ3C 3AZMB 3AZJB 5AV6A 3RELB 1P3BA 4Z66A 4H9QA 3KWQC 1ULYA 4NE5A 5AVBD 4R8PD 2CV5C 2F8NB 4H9PA 5GT0D 1P3LB 5B33B 4WU8A 5B1MC 4H9RB 3KXBB 3O62B 1KX3B 5AV8C 3AZEB 3WKJA 3B6GD 3X1TC 3W97D 2BG1A 3MGRA 5B32G 4WNNB 1M1AB 2G5HC 1P3MC 5CPKA 5GT3D 3A6ND 3R45B 4J8WB 3EPJA 4E45A 3WA9A 3MNND 3KUYC 3REIC 3VH6W 1S32C 5AY8B 3MGSA 1ID3B 3MGQB 1H3OA 3X1VD 5B24B 4R8PB 1ZLAC 5GT0B 3LELB 1KX4A 3REID 4UPKA 2F8NG 4XZQB 5JRGD 4LD9A 2XD5A 5B0ZC 4EO5C 5B2JB 3AZFC 3AZHC 3AZLA 5B1LB 5CPIB 1AOID 4J8XB 3C1CC 3WAAB 4DQYB 3W98A 5AV6D 2F8NK 4UUZB 5DNNA 4KHAB 4Z66D 3TU4B 1P34A 2Y2OA 3A6NB 4KGCC 2BYKA 5B31A 1TZYA 4DRBA 5BNVB 4WU8D 1A7WA 2NZDC 5DNMB 3AN2C 3WTPC 1M18B 3X1VB 5E5AA 3MVDB 5C3IC 3WKJD 3UTBA 3MGRD 5CPJC 3H0MC 1F66A 3P5JB 1P3AC 2Y2JA 3B0DB 3AFAA 4Z5TA 1M19A 3WA9D 4DRAA 5KDMB 3AZIC 2RIQA 5GXQC 1P3GB 4QLCB 3AZNC 1EQZC 1R4VA 3UT9C 1P3BB 2BYMB 2IO5B 2FJ7C 1HTAA 3REKC 1KX4D 3AV2A 3UTAC 2HIOC 4JJNA 4WU8B 4KUDA 3AV1B 3LJAC 4LD9D 1P3KB 5AVBA 3AZLD 4H9NA 4G92B 4WU9B 2DF4C 4YS3B 1HQ3A 3W98D 5AVCC 1BH8A 5B32C 4YM6C 5CPKB 3KWQA 2CV5A 5B31D 3MGPD 3REJC 1TZYD 3W96B 5B1MA 5GT3A 3MGSB 3X1UB 5GSUB 3W99B 1H3OB 5E5AD 5AV8A 5FUGB 3X1TA 5AV5B 3B0BA 5BT1C 2NQBC 1P3PB 1F66D 3AZMC 4G91B 3AZJC 1P3MA 3VH6T 1WWIA 3AFAD 3RELC 1M19D 5JA4B 4LD9B 4ZUXB 4CSRB 2Y2QA 1F1EA 3KUYA 4J8VB 2AROB 3REIA 1P3LC 3W98B 1WWSA 3X1SB 3KXBC 3O62C 2RVQC 1KX3C 5DNNB 1P34B 1ZLAA 4NFTA 2JE5A 3AV2D 1TZYB 1M1AC 5CP6B 4JJND 3WTPE 5B0ZA 5B0YB 3AZFA 4J8UB 4J8WC 1N1JA 3C1CA 1HQ3D 3UTBB 5BS7C 3C1BB 1P3IB 5AY8C 2YFVA 1ID3C 3MGQC 4WZSB 4ZBJB 3KWQD 2CV5D 4KGCA 5B24C 4Z5TB 1KX5C 4X23C 2Y2NA 3LELC 5B1MD 1TAFA 2PYOB 2XD1A 2NZDA 3AZGC 3AN2A 3WTPA 4XZQC 3NQJA 5AV8D 1P3OC 3X1TD 1KX5D 5B1LC 5CPIC 3H0LC 2Y2KA 3AZKB 5CPJA 4KUDB 4J8XC 4NE3A 3NQUB 3WAAC 1P3AA 1P3MD 3AV2B 3B6FC 3KFUG 5G49A 3LZ1C 3TU4C 1Q9CA 3IP4C 5AVBB 4HGAB 5B40C 4H9NB 1BH9A 2DQNC 4H9OA 3KUYD 1S32D 3AZIA 5GXQA 3VH5W 1EQZA 3AZNA 5DNMC 1BH8B 1M18C 3UT9A 5BO0A 3MVDC 3KWQB 1ZLAD 2FJ7A 3F6TA 1KU5A 2JCHA 3REKA 3B6GB 3W97B 3UTAA 2HIOA 4XUJC 3LJAA 2G5IC 5GT3B 5B0ZD 3B0DC 3AZFD 3AZHD 3MGPA 3C1CD 3MNNB 4M6BA 2ZM5A 3REHC 5AVCA 5B32A 4YM6A 1P3GC 4QLCC 4KGCD 1P3BC 3REJA 2IO5C 2YFWB 2NZDD 3REIB 3AN2D 3WTPD 3AV1C 1P3KC 5JRGB 1P3FC 4G92C 5CPJD 3LZ0C 1JFIA 2NQBA 1ZLAB 5F99C 4WU9C 1AOIB 4YS3C 3AZMA 1P3AD 3AZJA 3RELA 5AV6B 5CPKC 2F8NA 4Z66B 4H9QB 3AZFB 4H9PB 1W2EA 5F99D 5B2IC 3W96C 1P3LA 1N1JB 2Y2MA 3AZID 5GXQD 2Y2LA 4H9RA 1EQZD 3AZND 3KXBA 1U35C 3O62A 3X1UC 3MGSC 2YFVB 5GSUC 3W99C 4H9SC 3UT9D 1KX3A 2Y2HA 4KGCB 2FJ7D 5AV5C 3REKD 5B2ID 3WKJB 3EPLA 4WNNA 3VH6A 3MGRB 3UTAD 2HIOD 1P3PC 1M1AA 4G91C 1TAFB 3LJAD 1U35D 3AL0C 2ZY4A 4ZUXC 3WA9B 5BS7A 4AWLB 5CPJB 2HUEC 4J8VC 2AROC 5AY8A 5AVCD 1ID3A 5B32D 4YM6D 3MGQA 4Z2MH 3B0CW 3X1SC 2J8PA 2Y2IA 5B24A 1KX5A 5DNNC 4X23A 3EPKA 3REJD 5AV9C 3AYWC 3LELA 3A1KA 1KX4B 5CP6C 3AZGA 1P3OA 3AZNB 5B0YC 1T3UA 5B1LA 5CPIA 4WV4B 4J8UC 5BO0B 5BT1D 3AZLB 2NQBD 4CAYA 4J8XA 2F2AC 1S32A 3AZMD 3UTBC 5B33C 3C1BC 3AZJD 3B6FA 1P3IC 3UTAB 3VH5T 4UUZA 3RELD 3LZ1A 4ZBJC 3TU4A 2F8ND 3AZEC 5B40A 4Z5TC 2BYKB 5B31B 3MGPB 5BNVA 1P3LD 5B33D 2PYOC 2ZY5A 5DNMA 3KXBD 3O62D 2RVQD 1B67A 1M18A 3AZHA 1KX3D 3MVDA 5E5AB 3AZKC 1M1AD 3FDDA 4KUDC 4XUJA 1F66B 2ZY2A 2W8SA 2L5AA 3AFAB 4J8WD 1M19B 2UWXA 4R8PC 4HGAC 5GT0C 3REHA 5AY8D 1ID3D 1P3GA 3MGQD 4QLCA 5B2JC 5B24D 4X23D 3KSYA 2BYMA 3V9RA 3LELD 3B6GC 3W97C 3AZGD 3AV1A 4XZQD 4JJNB 5B31G 1P3KA 1P3OD 5GT3C 5B2JD 3A6NC 5B1LD 5CPID 1P3FA 3LZ0A 5F99A 4J8XD 4WU9A 4YS3A 3WAAD 3MNNC 2F8NH 3B6FD 1HQ3B 3LZ1D 3TU4D 3X1VC 2CV5B 5B40D 5B2IA 3W96A 2VQRA 5B1MB 1U35A 5DNMD 3X1UA 5GSUA 1M18D 3W99A 4H9SA 3MVDD 5FUGA 5JRGC 5AV5A 5AV8B 3X1TB 1KX5B 4X23B 1P3PA 1AOIC 4XUJD 1P3MB 3AZGB 5BNXA 5AV6C 3B0CT 4WJ3C 5JA4A 4Z66C 1P3OB 4ZUXA 4CSRA 4J8VA 2AROA 4CAYB 3REHD 3KUYB 1S32B 1P3GD 3B6FB 4WU8C 5CHLB 4QLCD 3X1SA 1P3BD 3LZ1B 5AV9A 3AYWA 3WKJC 5B40B 2ZY3A 3MGRC 1Z2CB 5CP6A 3AV1D 1P3KD 5B0YA 5B0ZB 4EO5B 4J8UA 3AZHB 3LZ0D 1P3FD 4WU9D 4YS3D 3WA9C 3C1CB 5B33A 3C1BA 4AWLC 1P3IA 4XUJB 5CPKD 3AZEA 1B6WA 3W96D 2PYOA 1KX4C 3REHB 3R45A 3MGSD 3X1UD 2NZDB 5GSUD 3W99D 3AN2B 3WTPB 2Y2PA 3EG5B 4J8WA 3NQJB 2FFFB 5C3IB 5AV5D 4LD9C 3AZLC 3AZKA 3A1IA 1P3PD 3NQUA
chains in the Genus database with same CATH topology
3VH5A 3V9RB 2LY8A 1P3AB 3W98C 2CWEA 5G49B 4R8PA 4ZUXD 1P34C 5GT0A 1P3FB 5B31C 3MGPC 4E44A 3LZ0B 1BFMA 4J8VD 1BH9B 1TZYC 2AROD 5F99B 4H9OB 3AZIB 5GXQB 2JSSA 4XZQA 3X1SD 1EQZB 5B2JA 5DNND 1P34D 5AV9D 3UT9B 5E5AC 3AYWD 3B6GA 3W97A 2FJ7B 3WAAA 3REKB 5B2IB 5CP6D 1F66C 2HIOB 4KHAA 3LJAB 5B0YD 3A6NA 1U35B 3H0RC 4J8UD 3AFAC 1M19C 4Z2MG 4NE6A 3UTBD 3MNNA 3C1BD 1P3ID 2Y2GA 5AVCB 5B32B 4YM6B 3X1VA 3AZED 5BNXB 4Z5TD 3EPHA 3REJB 2PYOD 2YFWA 3AV2C 2HUEB 4JJNC 1PZRA 5JRGA 5AVBC 3AZKD 4KUDD 5AV9B 1AOIA 1JFIB 2NQBB 3AYWB 5KDMA 1HQ3C 3AZMB 3AZJB 5AV6A 3RELB 1P3BA 4Z66A 4H9QA 3KWQC 1ULYA 4NE5A 5AVBD 4R8PD 2CV5C 2F8NB 4H9PA 5GT0D 1P3LB 5B33B 4WU8A 5B1MC 4H9RB 3KXBB 3O62B 1KX3B 5AV8C 3AZEB 3WKJA 3B6GD 3X1TC 3W97D 2BG1A 3MGRA 5B32G 4WNNB 1M1AB 2G5HC 1P3MC 5CPKA 5GT3D 3A6ND 3R45B 4J8WB 3EPJA 4E45A 3WA9A 3MNND 3KUYC 3REIC 3VH6W 1S32C 5AY8B 3MGSA 1ID3B 3MGQB 1H3OA 3X1VD 5B24B 4R8PB 1ZLAC 5GT0B 3LELB 1KX4A 3REID 4UPKA 2F8NG 4XZQB 5JRGD 4LD9A 2XD5A 5B0ZC 4EO5C 5B2JB 3AZFC 3AZHC 3AZLA 5B1LB 5CPIB 1AOID 4J8XB 3C1CC 3WAAB 4DQYB 3W98A 5AV6D 2F8NK 4UUZB 5DNNA 4KHAB 4Z66D 3TU4B 1P34A 2Y2OA 3A6NB 4KGCC 2BYKA 5B31A 1TZYA 4DRBA 5BNVB 4WU8D 1A7WA 2NZDC 5DNMB 3AN2C 3WTPC 1M18B 3X1VB 5E5AA 3MVDB 5C3IC 3WKJD 3UTBA 3MGRD 5CPJC 3H0MC 1F66A 3P5JB 1P3AC 2Y2JA 3B0DB 3AFAA 4Z5TA 1M19A 3WA9D 4DRAA 5KDMB 3AZIC 2RIQA 5GXQC 1P3GB 4QLCB 3AZNC 1EQZC 1R4VA 3UT9C 1P3BB 2BYMB 2IO5B 2FJ7C 1HTAA 3REKC 1KX4D 3AV2A 3UTAC 2HIOC 4JJNA 4WU8B 4KUDA 3AV1B 3LJAC 4LD9D 1P3KB 5AVBA 3AZLD 4H9NA 4G92B 4WU9B 2DF4C 4YS3B 1HQ3A 3W98D 5AVCC 1BH8A 5B32C 4YM6C 5CPKB 3KWQA 2CV5A 5B31D 3MGPD 3REJC 1TZYD 3W96B 5B1MA 5GT3A 3MGSB 3X1UB 5GSUB 3W99B 1H3OB 5E5AD 5AV8A 5FUGB 3X1TA 5AV5B 3B0BA 5BT1C 2NQBC 1P3PB 1F66D 3AZMC 4G91B 3AZJC 1P3MA 3VH6T 1WWIA 3AFAD 3RELC 1M19D 5JA4B 4LD9B 4ZUXB 4CSRB 2Y2QA 1F1EA 3KUYA 4J8VB 2AROB 3REIA 1P3LC 3W98B 1WWSA 3X1SB 3KXBC 3O62C 2RVQC 1KX3C 5DNNB 1P34B 1ZLAA 4NFTA 2JE5A 3AV2D 1TZYB 1M1AC 5CP6B 4JJND 3WTPE 5B0ZA 5B0YB 3AZFA 4J8UB 4J8WC 1N1JA 3C1CA 1HQ3D 3UTBB 5BS7C 3C1BB 1P3IB 5AY8C 2YFVA 1ID3C 3MGQC 4WZSB 4ZBJB 3KWQD 2CV5D 4KGCA 5B24C 4Z5TB 1KX5C 4X23C 2Y2NA 3LELC 5B1MD 1TAFA 2PYOB 2XD1A 2NZDA 3AZGC 3AN2A 3WTPA 4XZQC 3NQJA 5AV8D 1P3OC 3X1TD 1KX5D 5B1LC 5CPIC 3H0LC 2Y2KA 3AZKB 5CPJA 4KUDB 4J8XC 4NE3A 3NQUB 3WAAC 1P3AA 1P3MD 3AV2B 3B6FC 3KFUG 5G49A 3LZ1C 3TU4C 1Q9CA 3IP4C 5AVBB 4HGAB 5B40C 4H9NB 1BH9A 2DQNC 4H9OA 3KUYD 1S32D 3AZIA 5GXQA 3VH5W 1EQZA 3AZNA 5DNMC 1BH8B 1M18C 3UT9A 5BO0A 3MVDC 3KWQB 1ZLAD 2FJ7A 3F6TA 1KU5A 2JCHA 3REKA 3B6GB 3W97B 3UTAA 2HIOA 4XUJC 3LJAA 2G5IC 5GT3B 5B0ZD 3B0DC 3AZFD 3AZHD 3MGPA 3C1CD 3MNNB 4M6BA 2ZM5A 3REHC 5AVCA 5B32A 4YM6A 1P3GC 4QLCC 4KGCD 1P3BC 3REJA 2IO5C 2YFWB 2NZDD 3REIB 3AN2D 3WTPD 3AV1C 1P3KC 5JRGB 1P3FC 4G92C 5CPJD 3LZ0C 1JFIA 2NQBA 1ZLAB 5F99C 4WU9C 1AOIB 4YS3C 3AZMA 1P3AD 3AZJA 3RELA 5AV6B 5CPKC 2F8NA 4Z66B 4H9QB 3AZFB 4H9PB 1W2EA 5F99D 5B2IC 3W96C 1P3LA 1N1JB 2Y2MA 3AZID 5GXQD 2Y2LA 4H9RA 1EQZD 3AZND 3KXBA 1U35C 3O62A 3X1UC 3MGSC 2YFVB 5GSUC 3W99C 4H9SC 3UT9D 1KX3A 2Y2HA 4KGCB 2FJ7D 5AV5C 3REKD 5B2ID 3WKJB 3EPLA 4WNNA 3VH6A 3MGRB 3UTAD 2HIOD 1P3PC 1M1AA 4G91C 1TAFB 3LJAD 1U35D 3AL0C 2ZY4A 4ZUXC 3WA9B 5BS7A 4AWLB 5CPJB 2HUEC 4J8VC 2AROC 5AY8A 5AVCD 1ID3A 5B32D 4YM6D 3MGQA 4Z2MH 3B0CW 3X1SC 2J8PA 2Y2IA 5B24A 1KX5A 5DNNC 4X23A 3EPKA 3REJD 5AV9C 3AYWC 3LELA 3A1KA 1KX4B 5CP6C 3AZGA 1P3OA 3AZNB 5B0YC 1T3UA 5B1LA 5CPIA 4WV4B 4J8UC 5BO0B 5BT1D 3AZLB 2NQBD 4CAYA 4J8XA 2F2AC 1S32A 3AZMD 3UTBC 5B33C 3C1BC 3AZJD 3B6FA 1P3IC 3UTAB 3VH5T 4UUZA 3RELD 3LZ1A 4ZBJC 3TU4A 2F8ND 3AZEC 5B40A 4Z5TC 2BYKB 5B31B 3MGPB 5BNVA 1P3LD 5B33D 2PYOC 2ZY5A 5DNMA 3KXBD 3O62D 2RVQD 1B67A 1M18A 3AZHA 1KX3D 3MVDA 5E5AB 3AZKC 1M1AD 3FDDA 4KUDC 4XUJA 1F66B 2ZY2A 2W8SA 2L5AA 3AFAB 4J8WD 1M19B 2UWXA 4R8PC 4HGAC 5GT0C 3REHA 5AY8D 1ID3D 1P3GA 3MGQD 4QLCA 5B2JC 5B24D 4X23D 3KSYA 2BYMA 3V9RA 3LELD 3B6GC 3W97C 3AZGD 3AV1A 4XZQD 4JJNB 5B31G 1P3KA 1P3OD 5GT3C 5B2JD 3A6NC 5B1LD 5CPID 1P3FA 3LZ0A 5F99A 4J8XD 4WU9A 4YS3A 3WAAD 3MNNC 2F8NH 3B6FD 1HQ3B 3LZ1D 3TU4D 3X1VC 2CV5B 5B40D 5B2IA 3W96A 2VQRA 5B1MB 1U35A 5DNMD 3X1UA 5GSUA 1M18D 3W99A 4H9SA 3MVDD 5FUGA 5JRGC 5AV5A 5AV8B 3X1TB 1KX5B 4X23B 1P3PA 1AOIC 4XUJD 1P3MB 3AZGB 5BNXA 5AV6C 3B0CT 4WJ3C 5JA4A 4Z66C 1P3OB 4ZUXA 4CSRA 4J8VA 2AROA 4CAYB 3REHD 3KUYB 1S32B 1P3GD 3B6FB 4WU8C 5CHLB 4QLCD 3X1SA 1P3BD 3LZ1B 5AV9A 3AYWA 3WKJC 5B40B 2ZY3A 3MGRC 1Z2CB 5CP6A 3AV1D 1P3KD 5B0YA 5B0ZB 4EO5B 4J8UA 3AZHB 3LZ0D 1P3FD 4WU9D 4YS3D 3WA9C 3C1CB 5B33A 3C1BA 4AWLC 1P3IA 4XUJB 5CPKD 3AZEA 1B6WA 3W96D 2PYOA 1KX4C 3REHB 3R45A 3MGSD 3X1UD 2NZDB 5GSUD 3W99D 3AN2B 3WTPB 2Y2PA 3EG5B 4J8WA 3NQJB 2FFFB 5C3IB 5AV5D 4LD9C 3AZLC 3AZKA 3A1IA 1P3PD 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 A;  3V9R B;  2LY8 A;  1P3A B;  3W98 C;  2CWE A;  5G49 B;  4R8P A;  4ZUX D;  1P34 C;  5GT0 A;  1P3F B;  5B31 C;  3MGP C;  4E44 A;  3LZ0 B;  1BFM A;  4J8V D;  1BH9 B;  1TZY C;  2ARO D;  5F99 B;  4H9O B;  3AZI B;  5GXQ B;  2JSS A;  4XZQ A;  3X1S D;  1EQZ B;  5B2J A;  5DNN D;  1P34 D;  5AV9 D;  3UT9 B;  5E5A C;  3AYW D;  3B6G A;  3W97 A;  2FJ7 B;  3WAA A;  3REK B;  5B2I B;  5CP6 D;  1F66 C;  2HIO B;  4KHA A;  3LJA B;  5B0Y D;  3A6N A;  1U35 B;  4J8U D;  3AFA C;  1M19 C;  4Z2M G;  4NE6 A;  3UTB D;  3MNN A;  3C1B D;  1P3I D;  5AVC B;  5B32 B;  4YM6 B;  3X1V A;  3AZE D;  5BNX B;  4Z5T D;  3REJ B;  2PYO D;  2YFW A;  3AV2 C;  2HUE B;  4JJN C;  5JRG A;  5AVB C;  3AZK D;  4KUD D;  5AV9 B;  1AOI A;  1JFI B;  2NQB B;  3AYW B;  5KDM A;  1HQ3 C;  3AZM B;  3AZJ B;  5AV6 A;  3REL B;  1P3B A;  4Z66 A;  4H9Q A;  3KWQ C;  1ULY A;  4NE5 A;  5AVB D;  4R8P D;  2CV5 C;  2F8N B;  4H9P A;  5GT0 D;  1P3L B;  5B33 B;  4WU8 A;  5B1M C;  4H9R B;  3KXB B;  3O62 B;  1KX3 B;  5AV8 C;  3AZE B;  3WKJ A;  3B6G D;  3X1T C;  3W97 D;  3MGR A;  5B32 G;  4WNN B;  1M1A B;  1P3M C;  5CPK A;  5GT3 D;  3A6N D;  3R45 B;  4J8W B;  4E45 A;  3WA9 A;  3MNN D;  3KUY C;  3REI C;  3VH6 W;  1S32 C;  5AY8 B;  3MGS A;  1ID3 B;  3MGQ B;  1H3O A;  3X1V D;  5B24 B;  4R8P B;  1ZLA C;  5GT0 B;  3LEL B;  1KX4 A;  3REI D;  2F8N G;  4XZQ B;  5JRG D;  4LD9 A;  5B0Z C;  4EO5 C;  5B2J B;  3AZF C;  3AZH C;  3AZL A;  5B1L B;  5CPI B;  1AOI D;  4J8X B;  3C1C C;  3WAA B;  3W98 A;  5AV6 D;  2F8N K;  4UUZ B;  5DNN A;  4KHA B;  4Z66 D;  3TU4 B;  1P34 A;  3A6N B;  4KGC C;  2BYK A;  5B31 A;  1TZY A;  4DRB A;  5BNV B;  4WU8 D;  1A7W A;  2NZD C;  5DNM B;  3AN2 C;  3WTP C;  1M18 B;  3X1V B;  5E5A A;  3MVD B;  5C3I C;  3WKJ D;  3UTB A;  3MGR D;  5CPJ C;  1F66 A;  1P3A C;  3B0D B;  3AFA A;  4Z5T A;  1M19 A;  3WA9 D;  4DRA A;  5KDM B;  3AZI C;  5GXQ C;  1P3G B;  4QLC B;  3AZN C;  1EQZ C;  1R4V A;  3UT9 C;  1P3B B;  2BYM B;  2IO5 B;  2FJ7 C;  1HTA A;  3REK C;  1KX4 D;  3AV2 A;  3UTA C;  2HIO C;  4JJN A;  4WU8 B;  4KUD A;  3AV1 B;  3LJA C;  4LD9 D;  1P3K B;  5AVB A;  3AZL D;  4H9N A;  4G92 B;  4WU9 B;  4YS3 B;  1HQ3 A;  3W98 D;  5AVC C;  1BH8 A;  5B32 C;  4YM6 C;  5CPK B;  3KWQ A;  2CV5 A;  5B31 D;  3MGP D;  3REJ C;  1TZY D;  3W96 B;  5B1M A;  5GT3 A;  3MGS B;  3X1U B;  5GSU B;  3W99 B;  1H3O B;  5E5A D;  5AV8 A;  5FUG B;  3X1T A;  5AV5 B;  3B0B A;  5BT1 C;  2NQB C;  1P3P B;  1F66 D;  3AZM C;  4G91 B;  3AZJ C;  1P3M A;  3VH6 T;  1WWI A;  3AFA D;  3REL C;  1M19 D;  5JA4 B;  4LD9 B;  4ZUX B;  4CSR B;  1F1E A;  3KUY A;  4J8V B;  2ARO B;  3REI A;  1P3L C;  3W98 B;  1WWS A;  3X1S B;  3KXB C;  3O62 C;  2RVQ C;  1KX3 C;  5DNN B;  1P34 B;  1ZLA A;  4NFT A;  3AV2 D;  1TZY B;  1M1A C;  5CP6 B;  4JJN D;  3WTP E;  5B0Z A;  5B0Y B;  3AZF A;  4J8U B;  4J8W C;  1N1J A;  3C1C A;  1HQ3 D;  3UTB B;  5BS7 C;  3C1B B;  1P3I B;  5AY8 C;  2YFV A;  1ID3 C;  3MGQ C;  4WZS B;  4ZBJ B;  3KWQ D;  2CV5 D;  4KGC A;  5B24 C;  4Z5T B;  1KX5 C;  4X23 C;  3LEL C;  5B1M D;  1TAF A;  2PYO B;  2NZD A;  3AZG C;  3AN2 A;  3WTP A;  4XZQ C;  3NQJ A;  5AV8 D;  1P3O C;  3X1T D;  1KX5 D;  5B1L C;  5CPI C;  3AZK B;  5CPJ A;  4KUD B;  4J8X C;  4NE3 A;  3NQU B;  3WAA C;  1P3A A;  1P3M D;  3AV2 B;  3B6F C;  5G49 A;  3LZ1 C;  3TU4 C;  1Q9C A;  5AVB B;  4HGA B;  5B40 C;  4H9N B;  1BH9 A;  4H9O A;  3KUY D;  1S32 D;  3AZI A;  5GXQ A;  3VH5 W;  1EQZ A;  3AZN A;  5DNM C;  1BH8 B;  1M18 C;  3UT9 A;  5BO0 A;  3MVD C;  3KWQ B;  1ZLA D;  2FJ7 A;  1KU5 A;  3REK A;  3B6G B;  3W97 B;  3UTA A;  2HIO A;  4XUJ C;  3LJA A;  5GT3 B;  5B0Z D;  3B0D C;  3AZF D;  3AZH D;  3MGP A;  3C1C D;  3MNN B;  4M6B A;  3REH C;  5AVC A;  5B32 A;  4YM6 A;  1P3G C;  4QLC C;  4KGC D;  1P3B C;  3REJ A;  2IO5 C;  2YFW B;  2NZD D;  3REI B;  3AN2 D;  3WTP D;  3AV1 C;  1P3K C;  5JRG B;  1P3F C;  4G92 C;  5CPJ D;  3LZ0 C;  1JFI A;  2NQB A;  1ZLA B;  5F99 C;  4WU9 C;  1AOI B;  4YS3 C;  3AZM A;  1P3A D;  3AZJ A;  3REL A;  5AV6 B;  5CPK C;  2F8N A;  4Z66 B;  4H9Q B;  3AZF B;  4H9P B;  5F99 D;  5B2I C;  3W96 C;  1P3L A;  1N1J B;  3AZI D;  5GXQ D;  4H9R A;  1EQZ D;  3AZN D;  3KXB A;  1U35 C;  3O62 A;  3X1U C;  3MGS C;  2YFV B;  5GSU C;  3W99 C;  4H9S C;  3UT9 D;  1KX3 A;  4KGC B;  2FJ7 D;  5AV5 C;  3REK D;  5B2I D;  3WKJ B;  4WNN A;  3VH6 A;  3MGR B;  3UTA D;  2HIO D;  1P3P C;  1M1A A;  4G91 C;  1TAF B;  3LJA D;  1U35 D;  4ZUX C;  3WA9 B;  5BS7 A;  4AWL B;  5CPJ B;  2HUE C;  4J8V C;  2ARO C;  5AY8 A;  5AVC D;  1ID3 A;  5B32 D;  4YM6 D;  3MGQ A;  4Z2M H;  3B0C W;  3X1S C;  5B24 A;  1KX5 A;  5DNN C;  4X23 A;  3REJ D;  5AV9 C;  3AYW C;  3LEL A;  1KX4 B;  5CP6 C;  3AZG A;  1P3O A;  3AZN B;  5B0Y C;  5B1L A;  5CPI A;  4WV4 B;  4J8U C;  5BO0 B;  5BT1 D;  3AZL B;  2NQB D;  4CAY A;  4J8X A;  1S32 A;  3AZM D;  3UTB C;  5B33 C;  3C1B C;  3AZJ D;  3B6F A;  1P3I C;  3UTA B;  3VH5 T;  4UUZ A;  3REL D;  3LZ1 A;  4ZBJ C;  3TU4 A;  2F8N D;  3AZE C;  5B40 A;  4Z5T C;  2BYK B;  5B31 B;  3MGP B;  5BNV A;  1P3L D;  5B33 D;  2PYO C;  5DNM A;  3KXB D;  3O62 D;  2RVQ D;  1B67 A;  1M18 A;  3AZH A;  1KX3 D;  3MVD A;  5E5A B;  3AZK C;  1M1A D;  4KUD C;  4XUJ A;  1F66 B;  2L5A A;  3AFA B;  4J8W D;  1M19 B;  4R8P C;  4HGA C;  5GT0 C;  3REH A;  5AY8 D;  1ID3 D;  1P3G A;  3MGQ D;  4QLC A;  5B2J C;  5B24 D;  4X23 D;  3KSY A;  2BYM A;  3V9R A;  3LEL D;  3B6G C;  3W97 C;  3AZG D;  3AV1 A;  4XZQ D;  4JJN B;  5B31 G;  1P3K A;  1P3O D;  5GT3 C;  5B2J D;  3A6N C;  5B1L D;  5CPI D;  1P3F A;  3LZ0 A;  5F99 A;  4J8X D;  4WU9 A;  4YS3 A;  3WAA D;  3MNN C;  2F8N H;  3B6F D;  1HQ3 B;  3LZ1 D;  3TU4 D;  3X1V C;  2CV5 B;  5B40 D;  5B2I A;  3W96 A;  5B1M B;  1U35 A;  5DNM D;  3X1U A;  5GSU A;  1M18 D;  3W99 A;  4H9S A;  3MVD D;  5FUG A;  5JRG C;  5AV5 A;  5AV8 B;  3X1T B;  1KX5 B;  4X23 B;  1P3P A;  1AOI C;  4XUJ D;  1P3M B;  3AZG B;  5BNX A;  5AV6 C;  3B0C T;  5JA4 A;  4Z66 C;  1P3O B;  4ZUX A;  4CSR A;  4J8V A;  2ARO A;  4CAY B;  3REH D;  3KUY B;  1S32 B;  1P3G D;  3B6F B;  4WU8 C;  5CHL B;  4QLC D;  3X1S A;  1P3B D;  3LZ1 B;  5AV9 A;  3AYW A;  3WKJ C;  5B40 B;  3MGR C;  5CP6 A;  3AV1 D;  1P3K D;  5B0Y A;  5B0Z B;  4EO5 B;  4J8U A;  3AZH B;  3LZ0 D;  1P3F D;  4WU9 D;  4YS3 D;  3WA9 C;  3C1C B;  5B33 A;  3C1B A;  4AWL C;  1P3I A;  4XUJ B;  5CPK D;  3AZE A;  1B6W A;  3W96 D;  2PYO A;  1KX4 C;  3REH B;  3R45 A;  3MGS D;  3X1U D;  2NZD B;  5GSU D;  3W99 D;  3AN2 B;  3WTP B;  4J8W A;  3NQJ B;  5C3I B;  5AV5 D;  4LD9 C;  3AZL C;  3AZK A;  1P3P D;  3NQU A; 
#chains in the Genus database with same CATH topology
 3VH5 A;  3V9R B;  2LY8 A;  1P3A B;  3W98 C;  2CWE A;  5G49 B;  4R8P A;  4ZUX D;  1P34 C;  5GT0 A;  1P3F B;  5B31 C;  3MGP C;  4E44 A;  3LZ0 B;  1BFM A;  4J8V D;  1BH9 B;  1TZY C;  2ARO D;  5F99 B;  4H9O B;  3AZI B;  5GXQ B;  2JSS A;  4XZQ A;  3X1S D;  1EQZ B;  5B2J A;  5DNN D;  1P34 D;  5AV9 D;  3UT9 B;  5E5A C;  3AYW D;  3B6G A;  3W97 A;  2FJ7 B;  3WAA A;  3REK B;  5B2I B;  5CP6 D;  1F66 C;  2HIO B;  4KHA A;  3LJA B;  5B0Y D;  3A6N A;  1U35 B;  3H0R C;  4J8U D;  3AFA C;  1M19 C;  4Z2M G;  4NE6 A;  3UTB D;  3MNN A;  3C1B D;  1P3I D;  2Y2G A;  5AVC B;  5B32 B;  4YM6 B;  3X1V A;  3AZE D;  5BNX B;  4Z5T D;  3EPH A;  3REJ B;  2PYO D;  2YFW A;  3AV2 C;  2HUE B;  4JJN C;  1PZR A;  5JRG A;  5AVB C;  3AZK D;  4KUD D;  5AV9 B;  1AOI A;  1JFI B;  2NQB B;  3AYW B;  5KDM A;  1HQ3 C;  3AZM B;  3AZJ B;  5AV6 A;  3REL B;  1P3B A;  4Z66 A;  4H9Q A;  3KWQ C;  1ULY A;  4NE5 A;  5AVB D;  4R8P D;  2CV5 C;  2F8N B;  4H9P A;  5GT0 D;  1P3L B;  5B33 B;  4WU8 A;  5B1M C;  4H9R B;  3KXB B;  3O62 B;  1KX3 B;  5AV8 C;  3AZE B;  3WKJ A;  3B6G D;  3X1T C;  3W97 D;  2BG1 A;  3MGR A;  5B32 G;  4WNN B;  1M1A B;  2G5H C;  1P3M C;  5CPK A;  5GT3 D;  3A6N D;  3R45 B;  4J8W B;  3EPJ A;  4E45 A;  3WA9 A;  3MNN D;  3KUY C;  3REI C;  3VH6 W;  1S32 C;  5AY8 B;  3MGS A;  1ID3 B;  3MGQ B;  1H3O A;  3X1V D;  5B24 B;  4R8P B;  1ZLA C;  5GT0 B;  3LEL B;  1KX4 A;  3REI D;  4UPK A;  2F8N G;  4XZQ B;  5JRG D;  4LD9 A;  2XD5 A;  5B0Z C;  4EO5 C;  5B2J B;  3AZF C;  3AZH C;  3AZL A;  5B1L B;  5CPI B;  1AOI D;  4J8X B;  3C1C C;  3WAA B;  4DQY B;  3W98 A;  5AV6 D;  2F8N K;  4UUZ B;  5DNN A;  4KHA B;  4Z66 D;  3TU4 B;  1P34 A;  2Y2O A;  3A6N B;  4KGC C;  2BYK A;  5B31 A;  1TZY A;  4DRB A;  5BNV B;  4WU8 D;  1A7W A;  2NZD C;  5DNM B;  3AN2 C;  3WTP C;  1M18 B;  3X1V B;  5E5A A;  3MVD B;  5C3I C;  3WKJ D;  3UTB A;  3MGR D;  5CPJ C;  3H0M C;  1F66 A;  3P5J B;  1P3A C;  2Y2J A;  3B0D B;  3AFA A;  4Z5T A;  1M19 A;  3WA9 D;  4DRA A;  5KDM B;  3AZI C;  2RIQ A;  5GXQ C;  1P3G B;  4QLC B;  3AZN C;  1EQZ C;  1R4V A;  3UT9 C;  1P3B B;  2BYM B;  2IO5 B;  2FJ7 C;  1HTA A;  3REK C;  1KX4 D;  3AV2 A;  3UTA C;  2HIO C;  4JJN A;  4WU8 B;  4KUD A;  3AV1 B;  3LJA C;  4LD9 D;  1P3K B;  5AVB A;  3AZL D;  4H9N A;  4G92 B;  4WU9 B;  2DF4 C;  4YS3 B;  1HQ3 A;  3W98 D;  5AVC C;  1BH8 A;  5B32 C;  4YM6 C;  5CPK B;  3KWQ A;  2CV5 A;  5B31 D;  3MGP D;  3REJ C;  1TZY D;  3W96 B;  5B1M A;  5GT3 A;  3MGS B;  3X1U B;  5GSU B;  3W99 B;  1H3O B;  5E5A D;  5AV8 A;  5FUG B;  3X1T A;  5AV5 B;  3B0B A;  5BT1 C;  2NQB C;  1P3P B;  1F66 D;  3AZM C;  4G91 B;  3AZJ C;  1P3M A;  3VH6 T;  1WWI A;  3AFA D;  3REL C;  1M19 D;  5JA4 B;  4LD9 B;  4ZUX B;  4CSR B;  2Y2Q A;  1F1E A;  3KUY A;  4J8V B;  2ARO B;  3REI A;  1P3L C;  3W98 B;  1WWS A;  3X1S B;  3KXB C;  3O62 C;  2RVQ C;  1KX3 C;  5DNN B;  1P34 B;  1ZLA A;  4NFT A;  2JE5 A;  3AV2 D;  1TZY B;  1M1A C;  5CP6 B;  4JJN D;  3WTP E;  5B0Z A;  5B0Y B;  3AZF A;  4J8U B;  4J8W C;  1N1J A;  3C1C A;  1HQ3 D;  3UTB B;  5BS7 C;  3C1B B;  1P3I B;  5AY8 C;  2YFV A;  1ID3 C;  3MGQ C;  4WZS B;  4ZBJ B;  3KWQ D;  2CV5 D;  4KGC A;  5B24 C;  4Z5T B;  1KX5 C;  4X23 C;  2Y2N A;  3LEL C;  5B1M D;  1TAF A;  2PYO B;  2XD1 A;  2NZD A;  3AZG C;  3AN2 A;  3WTP A;  4XZQ C;  3NQJ A;  5AV8 D;  1P3O C;  3X1T D;  1KX5 D;  5B1L C;  5CPI C;  3H0L C;  2Y2K A;  3AZK B;  5CPJ A;  4KUD B;  4J8X C;  4NE3 A;  3NQU B;  3WAA C;  1P3A A;  1P3M D;  3AV2 B;  3B6F C;  3KFU G;  5G49 A;  3LZ1 C;  3TU4 C;  1Q9C A;  3IP4 C;  5AVB B;  4HGA B;  5B40 C;  4H9N B;  1BH9 A;  2DQN C;  4H9O A;  3KUY D;  1S32 D;  3AZI A;  5GXQ A;  3VH5 W;  1EQZ A;  3AZN A;  5DNM C;  1BH8 B;  1M18 C;  3UT9 A;  5BO0 A;  3MVD C;  3KWQ B;  1ZLA D;  2FJ7 A;  3F6T A;  1KU5 A;  2JCH A;  3REK A;  3B6G B;  3W97 B;  3UTA A;  2HIO A;  4XUJ C;  3LJA A;  2G5I C;  5GT3 B;  5B0Z D;  3B0D C;  3AZF D;  3AZH D;  3MGP A;  3C1C D;  3MNN B;  4M6B A;  2ZM5 A;  3REH C;  5AVC A;  5B32 A;  4YM6 A;  1P3G C;  4QLC C;  4KGC D;  1P3B C;  3REJ A;  2IO5 C;  2YFW B;  2NZD D;  3REI B;  3AN2 D;  3WTP D;  3AV1 C;  1P3K C;  5JRG B;  1P3F C;  4G92 C;  5CPJ D;  3LZ0 C;  1JFI A;  2NQB A;  1ZLA B;  5F99 C;  4WU9 C;  1AOI B;  4YS3 C;  3AZM A;  1P3A D;  3AZJ A;  3REL A;  5AV6 B;  5CPK C;  2F8N A;  4Z66 B;  4H9Q B;  3AZF B;  4H9P B;  1W2E A;  5F99 D;  5B2I C;  3W96 C;  1P3L A;  1N1J B;  2Y2M A;  3AZI D;  5GXQ D;  2Y2L A;  4H9R A;  1EQZ D;  3AZN D;  3KXB A;  1U35 C;  3O62 A;  3X1U C;  3MGS C;  2YFV B;  5GSU C;  3W99 C;  4H9S C;  3UT9 D;  1KX3 A;  2Y2H A;  4KGC B;  2FJ7 D;  5AV5 C;  3REK D;  5B2I D;  3WKJ B;  3EPL A;  4WNN A;  3VH6 A;  3MGR B;  3UTA D;  2HIO D;  1P3P C;  1M1A A;  4G91 C;  1TAF B;  3LJA D;  1U35 D;  3AL0 C;  2ZY4 A;  4ZUX C;  3WA9 B;  5BS7 A;  4AWL B;  5CPJ B;  2HUE C;  4J8V C;  2ARO C;  5AY8 A;  5AVC D;  1ID3 A;  5B32 D;  4YM6 D;  3MGQ A;  4Z2M H;  3B0C W;  3X1S C;  2J8P A;  2Y2I A;  5B24 A;  1KX5 A;  5DNN C;  4X23 A;  3EPK A;  3REJ D;  5AV9 C;  3AYW C;  3LEL A;  3A1K A;  1KX4 B;  5CP6 C;  3AZG A;  1P3O A;  3AZN B;  5B0Y C;  1T3U A;  5B1L A;  5CPI A;  4WV4 B;  4J8U C;  5BO0 B;  5BT1 D;  3AZL B;  2NQB D;  4CAY A;  4J8X A;  2F2A C;  1S32 A;  3AZM D;  3UTB C;  5B33 C;  3C1B C;  3AZJ D;  3B6F A;  1P3I C;  3UTA B;  3VH5 T;  4UUZ A;  3REL D;  3LZ1 A;  4ZBJ C;  3TU4 A;  2F8N D;  3AZE C;  5B40 A;  4Z5T C;  2BYK B;  5B31 B;  3MGP B;  5BNV A;  1P3L D;  5B33 D;  2PYO C;  2ZY5 A;  5DNM A;  3KXB D;  3O62 D;  2RVQ D;  1B67 A;  1M18 A;  3AZH A;  1KX3 D;  3MVD A;  5E5A B;  3AZK C;  1M1A D;  3FDD A;  4KUD C;  4XUJ A;  1F66 B;  2ZY2 A;  2W8S A;  2L5A A;  3AFA B;  4J8W D;  1M19 B;  2UWX A;  4R8P C;  4HGA C;  5GT0 C;  3REH A;  5AY8 D;  1ID3 D;  1P3G A;  3MGQ D;  4QLC A;  5B2J C;  5B24 D;  4X23 D;  3KSY A;  2BYM A;  3V9R A;  3LEL D;  3B6G C;  3W97 C;  3AZG D;  3AV1 A;  4XZQ D;  4JJN B;  5B31 G;  1P3K A;  1P3O D;  5GT3 C;  5B2J D;  3A6N C;  5B1L D;  5CPI D;  1P3F A;  3LZ0 A;  5F99 A;  4J8X D;  4WU9 A;  4YS3 A;  3WAA D;  3MNN C;  2F8N H;  3B6F D;  1HQ3 B;  3LZ1 D;  3TU4 D;  3X1V C;  2CV5 B;  5B40 D;  5B2I A;  3W96 A;  2VQR A;  5B1M B;  1U35 A;  5DNM D;  3X1U A;  5GSU A;  1M18 D;  3W99 A;  4H9S A;  3MVD D;  5FUG A;  5JRG C;  5AV5 A;  5AV8 B;  3X1T B;  1KX5 B;  4X23 B;  1P3P A;  1AOI C;  4XUJ D;  1P3M B;  3AZG B;  5BNX A;  5AV6 C;  3B0C T;  4WJ3 C;  5JA4 A;  4Z66 C;  1P3O B;  4ZUX A;  4CSR A;  4J8V A;  2ARO A;  4CAY B;  3REH D;  3KUY B;  1S32 B;  1P3G D;  3B6F B;  4WU8 C;  5CHL B;  4QLC D;  3X1S A;  1P3B D;  3LZ1 B;  5AV9 A;  3AYW A;  3WKJ C;  5B40 B;  2ZY3 A;  3MGR C;  1Z2C B;  5CP6 A;  3AV1 D;  1P3K D;  5B0Y A;  5B0Z B;  4EO5 B;  4J8U A;  3AZH B;  3LZ0 D;  1P3F D;  4WU9 D;  4YS3 D;  3WA9 C;  3C1C B;  5B33 A;  3C1B A;  4AWL C;  1P3I A;  4XUJ B;  5CPK D;  3AZE A;  1B6W A;  3W96 D;  2PYO A;  1KX4 C;  3REH B;  3R45 A;  3MGS D;  3X1U D;  2NZD B;  5GSU D;  3W99 D;  3AN2 B;  3WTP B;  2Y2P A;  3EG5 B;  4J8W A;  3NQJ B;  2FFF B;  5C3I B;  5AV5 D;  4LD9 C;  3AZL C;  3AZK A;  3A1I A;  1P3P D;  3NQU A; 
#chains in the Genus database with same CATH homology
 3VH5 A;  3V9R B;  2LY8 A;  1P3A B;  3W98 C;  2CWE A;  5G49 B;  4R8P A;  4ZUX D;  1P34 C;  5GT0 A;  1P3F B;  5B31 C;  3MGP C;  4E44 A;  3LZ0 B;  1BFM A;  4J8V D;  1BH9 B;  1TZY C;  2ARO D;  5F99 B;  4H9O B;  3AZI B;  5GXQ B;  2JSS A;  4XZQ A;  3X1S D;  1EQZ B;  5B2J A;  5DNN D;  1P34 D;  5AV9 D;  3UT9 B;  5E5A C;  3AYW D;  3B6G A;  3W97 A;  2FJ7 B;  3WAA A;  3REK B;  5B2I B;  5CP6 D;  1F66 C;  2HIO B;  4KHA A;  3LJA B;  5B0Y D;  3A6N A;  1U35 B;  3H0R C;  4J8U D;  3AFA C;  1M19 C;  4Z2M G;  4NE6 A;  3UTB D;  3MNN A;  3C1B D;  1P3I D;  2Y2G A;  5AVC B;  5B32 B;  4YM6 B;  3X1V A;  3AZE D;  5BNX B;  4Z5T D;  3EPH A;  3REJ B;  2PYO D;  2YFW A;  3AV2 C;  2HUE B;  4JJN C;  1PZR A;  5JRG A;  5AVB C;  3AZK D;  4KUD D;  5AV9 B;  1AOI A;  1JFI B;  2NQB B;  3AYW B;  5KDM A;  1HQ3 C;  3AZM B;  3AZJ B;  5AV6 A;  3REL B;  1P3B A;  4Z66 A;  4H9Q A;  3KWQ C;  1ULY A;  4NE5 A;  5AVB D;  4R8P D;  2CV5 C;  2F8N B;  4H9P A;  5GT0 D;  1P3L B;  5B33 B;  4WU8 A;  5B1M C;  4H9R B;  3KXB B;  3O62 B;  1KX3 B;  5AV8 C;  3AZE B;  3WKJ A;  3B6G D;  3X1T C;  3W97 D;  2BG1 A;  3MGR A;  5B32 G;  4WNN B;  1M1A B;  2G5H C;  1P3M C;  5CPK A;  5GT3 D;  3A6N D;  3R45 B;  4J8W B;  3EPJ A;  4E45 A;  3WA9 A;  3MNN D;  3KUY C;  3REI C;  3VH6 W;  1S32 C;  5AY8 B;  3MGS A;  1ID3 B;  3MGQ B;  1H3O A;  3X1V D;  5B24 B;  4R8P B;  1ZLA C;  5GT0 B;  3LEL B;  1KX4 A;  3REI D;  4UPK A;  2F8N G;  4XZQ B;  5JRG D;  4LD9 A;  2XD5 A;  5B0Z C;  4EO5 C;  5B2J B;  3AZF C;  3AZH C;  3AZL A;  5B1L B;  5CPI B;  1AOI D;  4J8X B;  3C1C C;  3WAA B;  4DQY B;  3W98 A;  5AV6 D;  2F8N K;  4UUZ B;  5DNN A;  4KHA B;  4Z66 D;  3TU4 B;  1P34 A;  2Y2O A;  3A6N B;  4KGC C;  2BYK A;  5B31 A;  1TZY A;  4DRB A;  5BNV B;  4WU8 D;  1A7W A;  2NZD C;  5DNM B;  3AN2 C;  3WTP C;  1M18 B;  3X1V B;  5E5A A;  3MVD B;  5C3I C;  3WKJ D;  3UTB A;  3MGR D;  5CPJ C;  3H0M C;  1F66 A;  3P5J B;  1P3A C;  2Y2J A;  3B0D B;  3AFA A;  4Z5T A;  1M19 A;  3WA9 D;  4DRA A;  5KDM B;  3AZI C;  2RIQ A;  5GXQ C;  1P3G B;  4QLC B;  3AZN C;  1EQZ C;  1R4V A;  3UT9 C;  1P3B B;  2BYM B;  2IO5 B;  2FJ7 C;  1HTA A;  3REK C;  1KX4 D;  3AV2 A;  3UTA C;  2HIO C;  4JJN A;  4WU8 B;  4KUD A;  3AV1 B;  3LJA C;  4LD9 D;  1P3K B;  5AVB A;  3AZL D;  4H9N A;  4G92 B;  4WU9 B;  2DF4 C;  4YS3 B;  1HQ3 A;  3W98 D;  5AVC C;  1BH8 A;  5B32 C;  4YM6 C;  5CPK B;  3KWQ A;  2CV5 A;  5B31 D;  3MGP D;  3REJ C;  1TZY D;  3W96 B;  5B1M A;  5GT3 A;  3MGS B;  3X1U B;  5GSU B;  3W99 B;  1H3O B;  5E5A D;  5AV8 A;  5FUG B;  3X1T A;  5AV5 B;  3B0B A;  5BT1 C;  2NQB C;  1P3P B;  1F66 D;  3AZM C;  4G91 B;  3AZJ C;  1P3M A;  3VH6 T;  1WWI A;  3AFA D;  3REL C;  1M19 D;  5JA4 B;  4LD9 B;  4ZUX B;  4CSR B;  2Y2Q A;  1F1E A;  3KUY A;  4J8V B;  2ARO B;  3REI A;  1P3L C;  3W98 B;  1WWS A;  3X1S B;  3KXB C;  3O62 C;  2RVQ C;  1KX3 C;  5DNN B;  1P34 B;  1ZLA A;  4NFT A;  2JE5 A;  3AV2 D;  1TZY B;  1M1A C;  5CP6 B;  4JJN D;  3WTP E;  5B0Z A;  5B0Y B;  3AZF A;  4J8U B;  4J8W C;  1N1J A;  3C1C A;  1HQ3 D;  3UTB B;  5BS7 C;  3C1B B;  1P3I B;  5AY8 C;  2YFV A;  1ID3 C;  3MGQ C;  4WZS B;  4ZBJ B;  3KWQ D;  2CV5 D;  4KGC A;  5B24 C;  4Z5T B;  1KX5 C;  4X23 C;  2Y2N A;  3LEL C;  5B1M D;  1TAF A;  2PYO B;  2XD1 A;  2NZD A;  3AZG C;  3AN2 A;  3WTP A;  4XZQ C;  3NQJ A;  5AV8 D;  1P3O C;  3X1T D;  1KX5 D;  5B1L C;  5CPI C;  3H0L C;  2Y2K A;  3AZK B;  5CPJ A;  4KUD B;  4J8X C;  4NE3 A;  3NQU B;  3WAA C;  1P3A A;  1P3M D;  3AV2 B;  3B6F C;  3KFU G;  5G49 A;  3LZ1 C;  3TU4 C;  1Q9C A;  3IP4 C;  5AVB B;  4HGA B;  5B40 C;  4H9N B;  1BH9 A;  2DQN C;  4H9O A;  3KUY D;  1S32 D;  3AZI A;  5GXQ A;  3VH5 W;  1EQZ A;  3AZN A;  5DNM C;  1BH8 B;  1M18 C;  3UT9 A;  5BO0 A;  3MVD C;  3KWQ B;  1ZLA D;  2FJ7 A;  3F6T A;  1KU5 A;  2JCH A;  3REK A;  3B6G B;  3W97 B;  3UTA A;  2HIO A;  4XUJ C;  3LJA A;  2G5I C;  5GT3 B;  5B0Z D;  3B0D C;  3AZF D;  3AZH D;  3MGP A;  3C1C D;  3MNN B;  4M6B A;  2ZM5 A;  3REH C;  5AVC A;  5B32 A;  4YM6 A;  1P3G C;  4QLC C;  4KGC D;  1P3B C;  3REJ A;  2IO5 C;  2YFW B;  2NZD D;  3REI B;  3AN2 D;  3WTP D;  3AV1 C;  1P3K C;  5JRG B;  1P3F C;  4G92 C;  5CPJ D;  3LZ0 C;  1JFI A;  2NQB A;  1ZLA B;  5F99 C;  4WU9 C;  1AOI B;  4YS3 C;  3AZM A;  1P3A D;  3AZJ A;  3REL A;  5AV6 B;  5CPK C;  2F8N A;  4Z66 B;  4H9Q B;  3AZF B;  4H9P B;  1W2E A;  5F99 D;  5B2I C;  3W96 C;  1P3L A;  1N1J B;  2Y2M A;  3AZI D;  5GXQ D;  2Y2L A;  4H9R A;  1EQZ D;  3AZN D;  3KXB A;  1U35 C;  3O62 A;  3X1U C;  3MGS C;  2YFV B;  5GSU C;  3W99 C;  4H9S C;  3UT9 D;  1KX3 A;  2Y2H A;  4KGC B;  2FJ7 D;  5AV5 C;  3REK D;  5B2I D;  3WKJ B;  3EPL A;  4WNN A;  3VH6 A;  3MGR B;  3UTA D;  2HIO D;  1P3P C;  1M1A A;  4G91 C;  1TAF B;  3LJA D;  1U35 D;  3AL0 C;  2ZY4 A;  4ZUX C;  3WA9 B;  5BS7 A;  4AWL B;  5CPJ B;  2HUE C;  4J8V C;  2ARO C;  5AY8 A;  5AVC D;  1ID3 A;  5B32 D;  4YM6 D;  3MGQ A;  4Z2M H;  3B0C W;  3X1S C;  2J8P A;  2Y2I A;  5B24 A;  1KX5 A;  5DNN C;  4X23 A;  3EPK A;  3REJ D;  5AV9 C;  3AYW C;  3LEL A;  3A1K A;  1KX4 B;  5CP6 C;  3AZG A;  1P3O A;  3AZN B;  5B0Y C;  1T3U A;  5B1L A;  5CPI A;  4WV4 B;  4J8U C;  5BO0 B;  5BT1 D;  3AZL B;  2NQB D;  4CAY A;  4J8X A;  2F2A C;  1S32 A;  3AZM D;  3UTB C;  5B33 C;  3C1B C;  3AZJ D;  3B6F A;  1P3I C;  3UTA B;  3VH5 T;  4UUZ A;  3REL D;  3LZ1 A;  4ZBJ C;  3TU4 A;  2F8N D;  3AZE C;  5B40 A;  4Z5T C;  2BYK B;  5B31 B;  3MGP B;  5BNV A;  1P3L D;  5B33 D;  2PYO C;  2ZY5 A;  5DNM A;  3KXB D;  3O62 D;  2RVQ D;  1B67 A;  1M18 A;  3AZH A;  1KX3 D;  3MVD A;  5E5A B;  3AZK C;  1M1A D;  3FDD A;  4KUD C;  4XUJ A;  1F66 B;  2ZY2 A;  2W8S A;  2L5A A;  3AFA B;  4J8W D;  1M19 B;  2UWX A;  4R8P C;  4HGA C;  5GT0 C;  3REH A;  5AY8 D;  1ID3 D;  1P3G A;  3MGQ D;  4QLC A;  5B2J C;  5B24 D;  4X23 D;  3KSY A;  2BYM A;  3V9R A;  3LEL D;  3B6G C;  3W97 C;  3AZG D;  3AV1 A;  4XZQ D;  4JJN B;  5B31 G;  1P3K A;  1P3O D;  5GT3 C;  5B2J D;  3A6N C;  5B1L D;  5CPI D;  1P3F A;  3LZ0 A;  5F99 A;  4J8X D;  4WU9 A;  4YS3 A;  3WAA D;  3MNN C;  2F8N H;  3B6F D;  1HQ3 B;  3LZ1 D;  3TU4 D;  3X1V C;  2CV5 B;  5B40 D;  5B2I A;  3W96 A;  2VQR A;  5B1M B;  1U35 A;  5DNM D;  3X1U A;  5GSU A;  1M18 D;  3W99 A;  4H9S A;  3MVD D;  5FUG A;  5JRG C;  5AV5 A;  5AV8 B;  3X1T B;  1KX5 B;  4X23 B;  1P3P A;  1AOI C;  4XUJ D;  1P3M B;  3AZG B;  5BNX A;  5AV6 C;  3B0C T;  4WJ3 C;  5JA4 A;  4Z66 C;  1P3O B;  4ZUX A;  4CSR A;  4J8V A;  2ARO A;  4CAY B;  3REH D;  3KUY B;  1S32 B;  1P3G D;  3B6F B;  4WU8 C;  5CHL B;  4QLC D;  3X1S A;  1P3B D;  3LZ1 B;  5AV9 A;  3AYW A;  3WKJ C;  5B40 B;  2ZY3 A;  3MGR C;  1Z2C B;  5CP6 A;  3AV1 D;  1P3K D;  5B0Y A;  5B0Z B;  4EO5 B;  4J8U A;  3AZH B;  3LZ0 D;  1P3F D;  4WU9 D;  4YS3 D;  3WA9 C;  3C1C B;  5B33 A;  3C1B A;  4AWL C;  1P3I A;  4XUJ B;  5CPK D;  3AZE A;  1B6W A;  3W96 D;  2PYO A;  1KX4 C;  3REH B;  3R45 A;  3MGS D;  3X1U D;  2NZD B;  5GSU D;  3W99 D;  3AN2 B;  3WTP B;  2Y2P A;  3EG5 B;  4J8W A;  3NQJ B;  2FFF B;  5C3I B;  5AV5 D;  4LD9 C;  3AZL C;  3AZK A;  3A1I A;  1P3P D;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...