3X1TB

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tB00
3WAAA 5F99A 3O62D 5B32A 3MGSC 3MGQC 3O62C 3KWQB 3X1TB 4WU8B 5DNNB 4QLCA 4J8WA 4G92B 3VH5A 1P3BD 1P3FB 4EO5B 4G91B 5AV6A 3AZGA 4AWLC 5B2JB 3AZHD 3W97B 3VH6A 5G49B 3AZHC 3MVDA 5CPJB 1AOIA 2YFVB 1TZYA 4WU9D 1P3AB 1M18B 4WU9C 1ID3A 4JJNB 1P34C 1H3OA 4XUJD 3MGPB 5GSUD 5CP6B 1TAFA 5B31B 4XUJC 4CSRB 3KXBD 5B1LA 5GSUC 5KDMA 5F99B 5B32B 3WTPA 3WAAB 3KXBC 4EO5C 4YS3D 2NQBD 5JRGD 2F8NH 4YS3C 2NQBC 5JRGC 1EQZD 4UUZA 1EQZC 4QLCB 5CPJD 5AV5A 4J8WB 5CPJC 3RELA 3REKA 4ZUXD 5AV6B 3AZGB 4ZUXC 5AVBA 3AFAA 1BH8B 5B31D 3MVDB 3WAAD 5F99D 5B31C 3WAAC 3X1VA 5F99C 3LELB 1M19A 1F66D 5GXQD 1ID3B 3UTBD 1F66C 5GXQC 1P3OA 1P3GD 3UTBC 1H3OB 3MGQA 3A6NA 1P3GC 2JSSA 3O62A 5B1LB 5KDMB 3WTPB 3WA9D 1N1JA 3LZ1D 3WA9C 4H9NA 3LZ1C 4UUZB 1HQ3A 4R8PD 4ZBJC 1AOID 5C3IC 2FJ7A 1TZYD 3W98A 4R8PC 5AV5B 1AOIC 1P3MD 3RELB 3REKB 1TZYC 3AZIA 1P3MC 5CPID 3B0DB 3W96D 5AVBB 5CPIC 4H9PA 3AZHA 3AFAB 3W96C 3AZLD 3AYWC 3AZLC 5B1LD 2IO5B 3W99A 3WTPD 3MGRB 2HUEC 5B1LC 3X1VB 3WTPC 4WU9A 5GT3D 4KHAA 1M19B 5AVCD 5GT3C 1P34A 1KX3B 5AV5D 5AVCC 1P3OB 4XUJA 3REKD 5AV5C 5GSUA 1KX4C 1WWIA 3MGSB 3MGQB 3MNNA 3KXBA 2LY8A 3A6NB 3LZ0D 2F8NG 3O62B 3UTAD 4YS3A 3LZ0C 3B0DC 3AFAD 2NQBA 1N1JB 3UTAC 1P3LD 3AN2A 3AFAC 4H9NB 4NE5A 1P3LC 1HQ3B 4KUDA 2FJ7B 4H9RA 3W98B 3AV2A 3AZIB 4AWLB 4ZUXA 5BNXA 1P3OD 3AZHB 4H9PB 4KGCC 3X1SA 5B0ZA 5B24D 1P3OC 3A6ND 5B24C 3A6NC 5BT1D 4H9SA 5BT1C 3AZMA 4WU9B 1F66A 1HQ3D 4KHAB 5GXQA 2HIOA 4CAYA 3B0CT 1P34B 3UTBA 2FJ7D 1HQ3C 3W98D 5B2IA 1P3GA 4XUJB 2FJ7C 3W98C 5GSUB 3AZID 3MNNB 3KXBB 4LD9D 3AZIC 3WA9A 4YS3B 2NQBB 5JRGB 4LD9C 3LZ1A 1EQZB 3W99D 4R8PA 4KUDB 3W99C 4H9RB 4XZQD 3AV2B 1P3MA 4Z2MG 4XZQC 4ZUXB 5CPIA 1P34D 1F1EA 3W96A 5BNXB 3AZKA 1U35A 3AYWA 4H9QA 3AZLA 4H9OA 3MNND 4Z66D 3B0CW 3AZED 3MNNC 4Z66C 3TU4D 1KX5A 5B1MA 3AZEC 3B6GC 3AZMB 3AN2D 3TU4C 5GT3A 2BYKA 1F66B 5GXQB 3AN2C 5AVCA 4KUDD 4CAYB 3X1UD 3UTBB 4Z5TD 1KX4A 3AV2D 4KUDC 5FUGA 3X1UC 1P3GB 4Z5TC 3R45A 3AV2C 3REIA 3LZ0A 4E45A 3UTAA 3WA9B 3LJAD 5B0ZD 3X1SD 3LZ1B 1P3LA 4ZBJB 3LJAC 5B0ZC 3X1SC 5C3IB 4R8PB 4HGAC 5CPKA 1AOIB 1TZYB 1ULYA 4NFTA 3AZMD 1A7WA 3VH5T 1P3MB 4H9SC 3AZMC 5GT0A 2HIOD 4WV4B 5B33D 2F8ND 5CPIB 3W96B 4KGCA 5B33C 2HIOC 5B2ID 3AYWB 3REHA 4H9QB 3VH6T 3AZLB 5B24A 5B2IC 2AROA 1TAFB 4H9OB 2HUEB 3AV1A 2RVQD 1KX5B 1JFIA 2RVQC 5GT3B 2F8NK 5AVCB 3KSYA 5E5AD 1KX4B 3MGSD 5FUGB 5E5AC 5BS7C 5AV9C 3WTPE 3R45B 3REIB 3LZ0B 4LD9A 3UTAB 3AZKD 1U35D 3AYWD 4M6BA 3VH5W 3AZKC 1U35C 1P3LB 3B0BA 3WKJA 1S32D 1S32C 1KX5D 5B1MD 4X23A 5CPKB 3VH6W 4XZQA 1KX5C 5B1MC 5GT0B 1KX4D 4KGCB 3REHB 5B24B 3C1BA 3REID 2AROB 4Z66A 3AZEA 3REIC 1P3ID 3B6GA 3TU4A 1P3IC 4YM6D 1JFIB 1BH9A 4YM6C 3REJA 3X1UA 5AY8A 5CPKD 4Z5TA 3UT9D 5B31G 5CPKC 4WU8A 3UT9C 5B32G 5GT0D 3AZFD 4LD9B 4KGCD 5GT0C 3AZFC 1P3KD 3C1CC 3REHD 3LJAA 2AROD 1P3KC 3WKJB 3REHC 3W99B 2AROC 3AV1D 4J8VD 4X23B 4XZQB 5DNMD 3AV1C 4J8VC 5DNMC 5B33A 2F8NA 5B40A 5AV8D 2CV5C 3AZND 5AV8C 4J8UD 4NE6A 1ZLAC 3C1BB 3AZNC 4Z66B 4J8UC 3AZEB 3B6GB 3B6FA 1M1AA 3KUYD 3MGPA 3TU4B 3WKJD 3AN2B 4CSRA 1BH9B 3KUYC 2NZDD 4J8XC 3WKJC 3REJB 5E5AA 5BS7A 3X1UB 5AY8B 5AV9A 4X23D 4Z5TB 2NZDC 2YFWA 4X23C 3AZJD 1Q9CA 5B0YD 2PYOD 3LJAB 5B0ZB 3X1SB 3C1BD 3AZJC 5B0YC 1S32A 1HTAA 4HGAB 2PYOC 3C1BC 1P3BC 2CWEA 3B6GD 1BH8A 1P3PA 1WWSA 5B33B 2HIOB 3REJD 2F8NB 5AY8D 5B40B 3REJC 5B2IB 3KWQD 3X1TD 3LELA 5AY8C 4WU8D 5DNND 3KWQC 3X1TC 1B6WA 4WU8C 5DNNC 1P3IA 3B6FB 1M1AB 1P3FD 4YM6A 4G92C 1P3FC 5B2JD 5E5AB 4G91C 5AV9B 3UT9A 3W97D 5B2JC 5BNVA 2YFWB 4DRAA 3W97C 3AZFA 3C1CA 5B40D 3AZKB 1U35B 1P3AD 1P3KA 1M18D 5B40C 1P3AC 4E44A 1M18C 1S32B 3NQUA 4JJND 3B6FD 1M1AD 4J8VA 4DRBA 3MGPD 5B1MB 4JJNC 5CP6D 5DNMA 3B6FC 1M1AC 3MGPC 1P3PB 2BYKB 5CP6C 5B32D 2CV5A 3MGRA 5AV9D 5AV8A 4WNNA 5B32C 1ZLAA 3AZNA 4J8UA 4QLCD 1KX3A 2BYMA 1P3IB 4QLCC 4J8WD 3KUYA 4J8XA 4J8WC 3MGSA 4YM6B 2NZDA 5AV6D 3AZGD 5AV6C 3AZGC 3UT9B 5BNVB 5BO0A 5JA4A 1P3PD 3MVDD 3NQJA 3AZFB 1P3PC 3MVDC 3C1CB 3V9RA 3LELD 1R4VA 3AZJA 1P3KB 5B0YA 2PYOA 3LELC 1P3BA 1ID3D 3NQUB 1ID3C 3AV1B 1B67A 4J8VB 4Z2MH 4WZSB 5DNMB 2CV5B 4WNNB 5AV8B 3KWQA 3X1TA 1ZLAB 3AZNB 2L5AA 5DNNA 4J8UB 3C1CD 5CHLB 2BYMB 4NE3A 3RELD 3KUYB 1P3FA 4J8XB 3RELC 3REKC 2NZDB 1BFMA 5B2JA 5AVBD 5JRGA 1KU5A 3W97A 5AVBC 5G49A 5BO0B 1EQZA 5JA4B 2CV5D 3NQJB 5CPJA 3MGRD 2IO5C 2YFVA 3V9RB 3X1VD 1P3AA 1ZLAD 1M18A 3MGRC 3AZJB 3X1VC 5B0YB 2PYOB 1M19D 1P3BB 1KX3D 1M19C 4JJNA 1KX3C 4J8XD 5CP6A 5B31A 3MGQD
chains in the Genus database with same CATH superfamily
3WAAA 5F99A 3O62D 5B32A 3MGSC 3MGQC 2XD1A 3O62C 3KWQB 3X1TB 4WU8B 5DNNB 4QLCA 4J8WA 4G92B 3VH5A 1P3BD 1P3FB 4EO5B 4G91B 5AV6A 3AZGA 4AWLC 5B2JB 3AZHD 2G5HC 3W97B 3VH6A 5G49B 3AZHC 3MVDA 5CPJB 2ZY5A 1AOIA 2YFVB 1TZYA 4WU9D 1P3AB 1M18B 2RIQA 3EPLA 4WU9C 1ID3A 4JJNB 1P34C 2XD5A 1H3OA 4XUJD 3MGPB 5GSUD 5CP6B 1TAFA 5B31B 4XUJC 4CSRB 3KXBD 5B1LA 5GSUC 5KDMA 5F99B 5B32B 3WTPA 3WAAB 3KXBC 4EO5C 4YS3D 2NQBD 5JRGD 2F8NH 4YS3C 2NQBC 5JRGC 1EQZD 4UUZA 1EQZC 4QLCB 5CPJD 5AV5A 4J8WB 5CPJC 3RELA 3REKA 4ZUXD 5AV6B 3AZGB 4ZUXC 5AVBA 3AFAA 1BH8B 5B31D 3MVDB 3WAAD 5F99D 5B31C 3WAAC 3X1VA 5F99C 3LELB 2Y2PA 1M19A 1F66D 2Y2GA 5GXQD 1ID3B 3UTBD 1F66C 5GXQC 1P3OA 1P3GD 3UTBC 1H3OB 3MGQA 3A6NA 1P3GC 2JSSA 3O62A 5B1LB 5KDMB 3WTPB 3WA9D 1N1JA 3LZ1D 3WA9C 4H9NA 3LZ1C 4UUZB 1HQ3A 4R8PD 4ZBJC 1AOID 5C3IC 2FJ7A 1TZYD 3W98A 4R8PC 5AV5B 1AOIC 1P3MD 3RELB 3REKB 1TZYC 3AZIA 4DQYB 5CPID 1P3MC 2ZY3A 3B0DB 3W96D 5AVBB 5CPIC 4H9PA 4UPKA 3AFAB 3W96C 3AZLD 3AZHA 3AYWC 3AZLC 5B1LD 2IO5B 3W99A 3WTPD 3MGRB 2HUEC 5B1LC 3X1VB 3WTPC 4WU9A 5GT3D 4KHAA 1M19B 5AVCD 5GT3C 1P34A 1KX3B 5AV5D 5AVCC 1P3OB 4XUJA 3REKD 5AV5C 5GSUA 1KX4C 1WWIA 2Y2QA 3MGSB 3MNNA 3KXBA 2LY8A 3A6NB 3LZ0D 3MGQB 2F8NG 3O62B 3UTAD 4YS3A 3LZ0C 3B0DC 3AFAD 2NQBA 1N1JB 3UTAC 1P3LD 3AN2A 3AFAC 4H9NB 4NE5A 1P3LC 1HQ3B 4KUDA 2FJ7B 4H9RA 3W98B 3AV2A 3AZIB 4AWLB 4ZUXA 5BNXA 1P3OD 3AZHB 4H9PB 3P5JB 4KGCC 3X1SA 5B0ZA 5B24D 1P3OC 3A6ND 5B24C 2Y2IA 3A6NC 5BT1D 4H9SA 5BT1C 3AZMA 4WU9B 2JE5A 1F66A 1HQ3D 4KHAB 5GXQA 2HIOA 4CAYA 3B0CT 1P34B 3UTBA 2FJ7D 1HQ3C 3W98D 5B2IA 1P3GA 2F2AC 4XUJB 2FJ7C 3W98C 5GSUB 3AZID 3MNNB 3KXBB 4LD9D 3AZIC 3WA9A 2Y2OA 4YS3B 2NQBB 5JRGB 4LD9C 3LZ1A 1EQZB 3W99D 2FFFB 4R8PA 4KUDB 3W99C 4H9RB 4XZQD 3AV2B 1P3MA 4Z2MG 4XZQC 2Y2NA 4ZUXB 5CPIA 1P34D 3FDDA 1F1EA 3EG5B 3W96A 5BNXB 3AZKA 1U35A 3AYWA 4H9QA 3AZLA 3EPJA 4H9OA 3MNND 4Z66D 3B0CW 3AZED 3MNNC 2J8PA 4Z66C 3TU4D 1KX5A 5B1MA 3AZEC 3B6GC 3AZMB 3AN2D 3TU4C 5GT3A 2BYKA 1F66B 5GXQB 3AN2C 5AVCA 4KUDD 4CAYB 3X1UD 3UTBB 4Z5TD 1KX4A 3AV2D 4KUDC 5FUGA 3X1UC 1P3GB 4Z5TC 3R45A 3AV2C 3REIA 3F6TA 3LZ0A 4E45A 3UTAA 3WA9B 3LJAD 5B0ZD 3X1SD 3LZ1B 1P3LA 4ZBJB 3LJAC 5B0ZC 3X1SC 5C3IB 4R8PB 4HGAC 5CPKA 1AOIB 1TZYB 1ULYA 4NFTA 3AZMD 1A7WA 3VH5T 1P3MB 1Z2CB 4H9SC 3AZMC 5GT0A 2HIOD 4WV4B 5B33D 2F8ND 3H0MC 5CPIB 3W96B 4KGCA 5B33C 2HIOC 5B2ID 3AYWB 3REHA 4H9QB 3VH6T 3AZLB 5B24A 5B2IC 2AROA 1TAFB 4H9OB 2DF4C 1W2EA 2HUEB 3AV1A 2RVQD 1KX5B 3H0LC 1JFIA 2RVQC 5GT3B 2F8NK 5AVCB 3KSYA 5E5AD 1KX4B 3MGSD 5FUGB 5E5AC 5BS7C 5AV9C 3WTPE 3R45B 3REIB 3LZ0B 4LD9A 3UTAB 3AZKD 1U35D 3AYWD 4M6BA 3VH5W 3AZKC 1U35C 1P3LB 3B0BA 3WKJA 3IP4C 1S32D 1S32C 1KX5D 5B1MD 4X23A 5CPKB 3VH6W 4XZQA 1KX5C 5B1MC 5GT0B 1KX4D 4KGCB 3REHB 5B24B 3C1BA 3REID 2AROB 4Z66A 3AZEA 3REIC 1P3ID 3B6GA 3TU4A 1P3IC 4YM6D 1JFIB 1BH9A 4YM6C 3REJA 3X1UA 5AY8A 5CPKD 4Z5TA 2Y2HA 3UT9D 5B31G 5CPKC 4WU8A 3EPKA 3UT9C 5B32G 5GT0D 3AZFD 2DQNC 4LD9B 4KGCD 5GT0C 3AZFC 1P3KD 3C1CC 3REHD 3LJAA 2AROD 1P3KC 3WKJB 3REHC 3W99B 2AROC 3AV1D 4J8VD 4X23B 4XZQB 5DNMD 3AV1C 4J8VC 5DNMC 5B33A 2F8NA 5B40A 5AV8D 2CV5C 3AZND 2ZM5A 5AV8C 4J8UD 4NE6A 3A1IA 2UWXA 3C1BB 3AZNC 1ZLAC 4Z66B 4J8UC 3AZEB 3B6GB 3B6FA 1M1AA 3KUYD 3MGPA 3TU4B 3WKJD 3AN2B 4CSRA 1BH9B 3KUYC 2NZDD 4J8XC 3WKJC 3REJB 5E5AA 5BS7A 3X1UB 5AY8B 5AV9A 4X23D 4Z5TB 2NZDC 4WJ3C 2YFWA 4X23C 2Y2MA 1Q9CA 3AZJD 5B0YD 2PYOD 3LJAB 5B0ZB 3X1SB 3C1BD 3AZJC 5B0YC 1S32A 1HTAA 4HGAB 2PYOC 3C1BC 1P3BC 2CWEA 3B6GD 1BH8A 1P3PA 1WWSA 2G5IC 5B33B 2HIOB 3REJD 2F8NB 5AY8D 2Y2LA 5B40B 2W8SA 5B2IB 3KWQD 3X1TD 3LELA 3REJC 5AY8C 4WU8D 5DNND 3KWQC 3X1TC 1B6WA 4WU8C 2BG1A 5DNNC 1P3IA 3B6FB 1M1AB 1P3FD 4YM6A 1T3UA 4G92C 2JCHA 1P3FC 5B2JD 3KFUG 2Y2KA 4G91C 5E5AB 3A1KA 5AV9B 3UT9A 3W97D 5B2JC 5BNVA 3AL0C 2YFWB 4DRAA 3W97C 3AZFA 3C1CA 5B40D 3AZKB 1U35B 1P3AD 1P3KA 1M18D 5B40C 1P3AC 4E44A 1M18C 1S32B 3NQUA 4JJND 3B6FD 1M1AD 4J8VA 2Y2JA 4DRBA 3MGPD 5B1MB 4JJNC 5CP6D 5DNMA 3B6FC 1M1AC 3MGPC 1P3PB 2BYKB 5CP6C 5B32D 2CV5A 3MGRA 5AV9D 5AV8A 4WNNA 5B32C 1ZLAA 3AZNA 4J8UA 4QLCD 1KX3A 2BYMA 1P3IB 4QLCC 4J8WD 3KUYA 4J8XA 4J8WC 3MGSA 4YM6B 2NZDA 2ZY2A 5AV6D 3AZGD 5AV6C 3AZGC 3UT9B 5BNVB 5BO0A 5JA4A 1P3PD 3MVDD 3NQJA 3AZFB 1P3PC 3MVDC 3C1CB 3V9RA 3LELD 1R4VA 3AZJA 1P3KB 5B0YA 2ZY4A 2PYOA 3LELC 1P3BA 1ID3D 3NQUB 1ID3C 3AV1B 1B67A 4J8VB 4Z2MH 4WZSB 5DNMB 2CV5B 4WNNB 5AV8B 3KWQA 3X1TA 1ZLAB 3AZNB 2L5AA 5DNNA 4J8UB 3C1CD 5CHLB 2BYMB 4NE3A 3RELD 3KUYB 1P3FA 4J8XB 1PZRA 3REKC 3RELC 2NZDB 1BFMA 5B2JA 5AVBD 5JRGA 1KU5A 3W97A 3EPHA 5AVBC 5G49A 5BO0B 1EQZA 5JA4B 3H0RC 2CV5D 3NQJB 5CPJA 3MGRD 2IO5C 2YFVA 3V9RB 3X1VD 1P3AA 1ZLAD 2VQRA 3MGRC 3AZJB 1M18A 3X1VC 5B0YB 2PYOB 1M19D 1P3BB 1KX3D 1M19C 4JJNA 1KX3C 4J8XD 5CP6A 5B31A 3MGQD
chains in the Genus database with same CATH topology
3WAAA 5F99A 3O62D 5B32A 3MGSC 3MGQC 2XD1A 3O62C 3KWQB 3X1TB 4WU8B 5DNNB 4QLCA 4J8WA 4G92B 3VH5A 1P3BD 1P3FB 4EO5B 4G91B 5AV6A 3AZGA 4AWLC 5B2JB 3AZHD 2G5HC 3W97B 3VH6A 5G49B 3AZHC 3MVDA 5CPJB 2ZY5A 1AOIA 2YFVB 1TZYA 4WU9D 1P3AB 1M18B 2RIQA 3EPLA 4WU9C 1ID3A 4JJNB 1P34C 2XD5A 1H3OA 4XUJD 3MGPB 5GSUD 5CP6B 1TAFA 5B31B 4XUJC 4CSRB 3KXBD 5B1LA 5GSUC 5KDMA 5F99B 5B32B 3WTPA 3WAAB 3KXBC 4EO5C 4YS3D 2NQBD 5JRGD 2F8NH 4YS3C 2NQBC 5JRGC 1EQZD 4UUZA 1EQZC 4QLCB 5CPJD 5AV5A 4J8WB 5CPJC 3RELA 3REKA 4ZUXD 5AV6B 3AZGB 4ZUXC 5AVBA 3AFAA 1BH8B 5B31D 3MVDB 3WAAD 5F99D 5B31C 3WAAC 3X1VA 5F99C 3LELB 2Y2PA 1M19A 1F66D 2Y2GA 5GXQD 1ID3B 3UTBD 1F66C 5GXQC 1P3OA 1P3GD 3UTBC 1H3OB 3MGQA 3A6NA 1P3GC 2JSSA 3O62A 5B1LB 5KDMB 3WTPB 3WA9D 1N1JA 3LZ1D 3WA9C 4H9NA 3LZ1C 4UUZB 1HQ3A 4R8PD 4ZBJC 1AOID 5C3IC 2FJ7A 1TZYD 3W98A 4R8PC 5AV5B 1AOIC 1P3MD 3RELB 3REKB 1TZYC 3AZIA 4DQYB 5CPID 1P3MC 2ZY3A 3B0DB 3W96D 5AVBB 5CPIC 4H9PA 4UPKA 3AFAB 3W96C 3AZLD 3AZHA 3AYWC 3AZLC 5B1LD 2IO5B 3W99A 3WTPD 3MGRB 2HUEC 5B1LC 3X1VB 3WTPC 4WU9A 5GT3D 4KHAA 1M19B 5AVCD 5GT3C 1P34A 1KX3B 5AV5D 5AVCC 1P3OB 4XUJA 3REKD 5AV5C 5GSUA 1KX4C 1WWIA 2Y2QA 3MGSB 3MNNA 3KXBA 2LY8A 3A6NB 3LZ0D 3MGQB 2F8NG 3O62B 3UTAD 4YS3A 3LZ0C 3B0DC 3AFAD 2NQBA 1N1JB 3UTAC 1P3LD 3AN2A 3AFAC 4H9NB 4NE5A 1P3LC 1HQ3B 4KUDA 2FJ7B 4H9RA 3W98B 3AV2A 3AZIB 4AWLB 4ZUXA 5BNXA 1P3OD 3AZHB 4H9PB 3P5JB 4KGCC 3X1SA 5B0ZA 5B24D 1P3OC 3A6ND 5B24C 2Y2IA 3A6NC 5BT1D 4H9SA 5BT1C 3AZMA 4WU9B 2JE5A 1F66A 1HQ3D 4KHAB 5GXQA 2HIOA 4CAYA 3B0CT 1P34B 3UTBA 2FJ7D 1HQ3C 3W98D 5B2IA 1P3GA 2F2AC 4XUJB 2FJ7C 3W98C 5GSUB 3AZID 3MNNB 3KXBB 4LD9D 3AZIC 3WA9A 2Y2OA 4YS3B 2NQBB 5JRGB 4LD9C 3LZ1A 1EQZB 3W99D 2FFFB 4R8PA 4KUDB 3W99C 4H9RB 4XZQD 3AV2B 1P3MA 4Z2MG 4XZQC 2Y2NA 4ZUXB 5CPIA 1P34D 3FDDA 1F1EA 3EG5B 3W96A 5BNXB 3AZKA 1U35A 3AYWA 4H9QA 3AZLA 3EPJA 4H9OA 3MNND 4Z66D 3B0CW 3AZED 3MNNC 2J8PA 4Z66C 3TU4D 1KX5A 5B1MA 3AZEC 3B6GC 3AZMB 3AN2D 3TU4C 5GT3A 2BYKA 1F66B 5GXQB 3AN2C 5AVCA 4KUDD 4CAYB 3X1UD 3UTBB 4Z5TD 1KX4A 3AV2D 4KUDC 5FUGA 3X1UC 1P3GB 4Z5TC 3R45A 3AV2C 3REIA 3F6TA 3LZ0A 4E45A 3UTAA 3WA9B 3LJAD 5B0ZD 3X1SD 3LZ1B 1P3LA 4ZBJB 3LJAC 5B0ZC 3X1SC 5C3IB 4R8PB 4HGAC 5CPKA 1AOIB 1TZYB 1ULYA 4NFTA 3AZMD 1A7WA 3VH5T 1P3MB 1Z2CB 4H9SC 3AZMC 5GT0A 2HIOD 4WV4B 5B33D 2F8ND 3H0MC 5CPIB 3W96B 4KGCA 5B33C 2HIOC 5B2ID 3AYWB 3REHA 4H9QB 3VH6T 3AZLB 5B24A 5B2IC 2AROA 1TAFB 4H9OB 2DF4C 1W2EA 2HUEB 3AV1A 2RVQD 1KX5B 3H0LC 1JFIA 2RVQC 5GT3B 2F8NK 5AVCB 3KSYA 5E5AD 1KX4B 3MGSD 5FUGB 5E5AC 5BS7C 5AV9C 3WTPE 3R45B 3REIB 3LZ0B 4LD9A 3UTAB 3AZKD 1U35D 3AYWD 4M6BA 3VH5W 3AZKC 1U35C 1P3LB 3B0BA 3WKJA 3IP4C 1S32D 1S32C 1KX5D 5B1MD 4X23A 5CPKB 3VH6W 4XZQA 1KX5C 5B1MC 5GT0B 1KX4D 4KGCB 3REHB 5B24B 3C1BA 3REID 2AROB 4Z66A 3AZEA 3REIC 1P3ID 3B6GA 3TU4A 1P3IC 4YM6D 1JFIB 1BH9A 4YM6C 3REJA 3X1UA 5AY8A 5CPKD 4Z5TA 2Y2HA 3UT9D 5B31G 5CPKC 4WU8A 3EPKA 3UT9C 5B32G 5GT0D 3AZFD 2DQNC 4LD9B 4KGCD 5GT0C 3AZFC 1P3KD 3C1CC 3REHD 3LJAA 2AROD 1P3KC 3WKJB 3REHC 3W99B 2AROC 3AV1D 4J8VD 4X23B 4XZQB 5DNMD 3AV1C 4J8VC 5DNMC 5B33A 2F8NA 5B40A 5AV8D 2CV5C 3AZND 2ZM5A 5AV8C 4J8UD 4NE6A 3A1IA 2UWXA 3C1BB 3AZNC 1ZLAC 4Z66B 4J8UC 3AZEB 3B6GB 3B6FA 1M1AA 3KUYD 3MGPA 3TU4B 3WKJD 3AN2B 4CSRA 1BH9B 3KUYC 2NZDD 4J8XC 3WKJC 3REJB 5E5AA 5BS7A 3X1UB 5AY8B 5AV9A 4X23D 4Z5TB 2NZDC 4WJ3C 2YFWA 4X23C 2Y2MA 1Q9CA 3AZJD 5B0YD 2PYOD 3LJAB 5B0ZB 3X1SB 3C1BD 3AZJC 5B0YC 1S32A 1HTAA 4HGAB 2PYOC 3C1BC 1P3BC 2CWEA 3B6GD 1BH8A 1P3PA 1WWSA 2G5IC 5B33B 2HIOB 3REJD 2F8NB 5AY8D 2Y2LA 5B40B 2W8SA 5B2IB 3KWQD 3X1TD 3LELA 3REJC 5AY8C 4WU8D 5DNND 3KWQC 3X1TC 1B6WA 4WU8C 2BG1A 5DNNC 1P3IA 3B6FB 1M1AB 1P3FD 4YM6A 1T3UA 4G92C 2JCHA 1P3FC 5B2JD 3KFUG 2Y2KA 4G91C 5E5AB 3A1KA 5AV9B 3UT9A 3W97D 5B2JC 5BNVA 3AL0C 2YFWB 4DRAA 3W97C 3AZFA 3C1CA 5B40D 3AZKB 1U35B 1P3AD 1P3KA 1M18D 5B40C 1P3AC 4E44A 1M18C 1S32B 3NQUA 4JJND 3B6FD 1M1AD 4J8VA 2Y2JA 4DRBA 3MGPD 5B1MB 4JJNC 5CP6D 5DNMA 3B6FC 1M1AC 3MGPC 1P3PB 2BYKB 5CP6C 5B32D 2CV5A 3MGRA 5AV9D 5AV8A 4WNNA 5B32C 1ZLAA 3AZNA 4J8UA 4QLCD 1KX3A 2BYMA 1P3IB 4QLCC 4J8WD 3KUYA 4J8XA 4J8WC 3MGSA 4YM6B 2NZDA 2ZY2A 5AV6D 3AZGD 5AV6C 3AZGC 3UT9B 5BNVB 5BO0A 5JA4A 1P3PD 3MVDD 3NQJA 3AZFB 1P3PC 3MVDC 3C1CB 3V9RA 3LELD 1R4VA 3AZJA 1P3KB 5B0YA 2ZY4A 2PYOA 3LELC 1P3BA 1ID3D 3NQUB 1ID3C 3AV1B 1B67A 4J8VB 4Z2MH 4WZSB 5DNMB 2CV5B 4WNNB 5AV8B 3KWQA 3X1TA 1ZLAB 3AZNB 2L5AA 5DNNA 4J8UB 3C1CD 5CHLB 2BYMB 4NE3A 3RELD 3KUYB 1P3FA 4J8XB 1PZRA 3REKC 3RELC 2NZDB 1BFMA 5B2JA 5AVBD 5JRGA 1KU5A 3W97A 3EPHA 5AVBC 5G49A 5BO0B 1EQZA 5JA4B 3H0RC 2CV5D 3NQJB 5CPJA 3MGRD 2IO5C 2YFVA 3V9RB 3X1VD 1P3AA 1ZLAD 2VQRA 3MGRC 3AZJB 1M18A 3X1VC 5B0YB 2PYOB 1M19D 1P3BB 1KX3D 1M19C 4JJNA 1KX3C 4J8XD 5CP6A 5B31A 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAA A;  5F99 A;  3O62 D;  5B32 A;  3MGS C;  3MGQ C;  3O62 C;  3KWQ B;  3X1T B;  4WU8 B;  5DNN B;  4QLC A;  4J8W A;  4G92 B;  3VH5 A;  1P3B D;  1P3F B;  4EO5 B;  4G91 B;  5AV6 A;  3AZG A;  4AWL C;  5B2J B;  3AZH D;  3W97 B;  3VH6 A;  5G49 B;  3AZH C;  3MVD A;  5CPJ B;  1AOI A;  2YFV B;  1TZY A;  4WU9 D;  1P3A B;  1M18 B;  4WU9 C;  1ID3 A;  4JJN B;  1P34 C;  1H3O A;  4XUJ D;  3MGP B;  5GSU D;  5CP6 B;  1TAF A;  5B31 B;  4XUJ C;  4CSR B;  3KXB D;  5B1L A;  5GSU C;  5KDM A;  5F99 B;  5B32 B;  3WTP A;  3WAA B;  3KXB C;  4EO5 C;  4YS3 D;  2NQB D;  5JRG D;  2F8N H;  4YS3 C;  2NQB C;  5JRG C;  1EQZ D;  4UUZ A;  1EQZ C;  4QLC B;  5CPJ D;  5AV5 A;  4J8W B;  5CPJ C;  3REL A;  3REK A;  4ZUX D;  5AV6 B;  3AZG B;  4ZUX C;  5AVB A;  3AFA A;  1BH8 B;  5B31 D;  3MVD B;  3WAA D;  5F99 D;  5B31 C;  3WAA C;  3X1V A;  5F99 C;  3LEL B;  1M19 A;  1F66 D;  5GXQ D;  1ID3 B;  3UTB D;  1F66 C;  5GXQ C;  1P3O A;  1P3G D;  3UTB C;  1H3O B;  3MGQ A;  3A6N A;  1P3G C;  2JSS A;  3O62 A;  5B1L B;  5KDM B;  3WTP B;  3WA9 D;  1N1J A;  3LZ1 D;  3WA9 C;  4H9N A;  3LZ1 C;  4UUZ B;  1HQ3 A;  4R8P D;  4ZBJ C;  1AOI D;  5C3I C;  2FJ7 A;  1TZY D;  3W98 A;  4R8P C;  5AV5 B;  1AOI C;  1P3M D;  3REL B;  3REK B;  1TZY C;  3AZI A;  1P3M C;  5CPI D;  3B0D B;  3W96 D;  5AVB B;  5CPI C;  4H9P A;  3AZH A;  3AFA B;  3W96 C;  3AZL D;  3AYW C;  3AZL C;  5B1L D;  2IO5 B;  3W99 A;  3WTP D;  3MGR B;  2HUE C;  5B1L C;  3X1V B;  3WTP C;  4WU9 A;  5GT3 D;  4KHA A;  1M19 B;  5AVC D;  5GT3 C;  1P34 A;  1KX3 B;  5AV5 D;  5AVC C;  1P3O B;  4XUJ A;  3REK D;  5AV5 C;  5GSU A;  1KX4 C;  1WWI A;  3MGS B;  3MGQ B;  3MNN A;  3KXB A;  2LY8 A;  3A6N B;  3LZ0 D;  2F8N G;  3O62 B;  3UTA D;  4YS3 A;  3LZ0 C;  3B0D C;  3AFA D;  2NQB A;  1N1J B;  3UTA C;  1P3L D;  3AN2 A;  3AFA C;  4H9N B;  4NE5 A;  1P3L C;  1HQ3 B;  4KUD A;  2FJ7 B;  4H9R A;  3W98 B;  3AV2 A;  3AZI B;  4AWL B;  4ZUX A;  5BNX A;  1P3O D;  3AZH B;  4H9P B;  4KGC C;  3X1S A;  5B0Z A;  5B24 D;  1P3O C;  3A6N D;  5B24 C;  3A6N C;  5BT1 D;  4H9S A;  5BT1 C;  3AZM A;  4WU9 B;  1F66 A;  1HQ3 D;  4KHA B;  5GXQ A;  2HIO A;  4CAY A;  3B0C T;  1P34 B;  3UTB A;  2FJ7 D;  1HQ3 C;  3W98 D;  5B2I A;  1P3G A;  4XUJ B;  2FJ7 C;  3W98 C;  5GSU B;  3AZI D;  3MNN B;  3KXB B;  4LD9 D;  3AZI C;  3WA9 A;  4YS3 B;  2NQB B;  5JRG B;  4LD9 C;  3LZ1 A;  1EQZ B;  3W99 D;  4R8P A;  4KUD B;  3W99 C;  4H9R B;  4XZQ D;  3AV2 B;  1P3M A;  4Z2M G;  4XZQ C;  4ZUX B;  5CPI A;  1P34 D;  1F1E A;  3W96 A;  5BNX B;  3AZK A;  1U35 A;  3AYW A;  4H9Q A;  3AZL A;  4H9O A;  3MNN D;  4Z66 D;  3B0C W;  3AZE D;  3MNN C;  4Z66 C;  3TU4 D;  1KX5 A;  5B1M A;  3AZE C;  3B6G C;  3AZM B;  3AN2 D;  3TU4 C;  5GT3 A;  2BYK A;  1F66 B;  5GXQ B;  3AN2 C;  5AVC A;  4KUD D;  4CAY B;  3X1U D;  3UTB B;  4Z5T D;  1KX4 A;  3AV2 D;  4KUD C;  5FUG A;  3X1U C;  1P3G B;  4Z5T C;  3R45 A;  3AV2 C;  3REI A;  3LZ0 A;  4E45 A;  3UTA A;  3WA9 B;  3LJA D;  5B0Z D;  3X1S D;  3LZ1 B;  1P3L A;  4ZBJ B;  3LJA C;  5B0Z C;  3X1S C;  5C3I B;  4R8P B;  4HGA C;  5CPK A;  1AOI B;  1TZY B;  1ULY A;  4NFT A;  3AZM D;  1A7W A;  3VH5 T;  1P3M B;  4H9S C;  3AZM C;  5GT0 A;  2HIO D;  4WV4 B;  5B33 D;  2F8N D;  5CPI B;  3W96 B;  4KGC A;  5B33 C;  2HIO C;  5B2I D;  3AYW B;  3REH A;  4H9Q B;  3VH6 T;  3AZL B;  5B24 A;  5B2I C;  2ARO A;  1TAF B;  4H9O B;  2HUE B;  3AV1 A;  2RVQ D;  1KX5 B;  1JFI A;  2RVQ C;  5GT3 B;  2F8N K;  5AVC B;  3KSY A;  5E5A D;  1KX4 B;  3MGS D;  5FUG B;  5E5A C;  5BS7 C;  5AV9 C;  3WTP E;  3R45 B;  3REI B;  3LZ0 B;  4LD9 A;  3UTA B;  3AZK D;  1U35 D;  3AYW D;  4M6B A;  3VH5 W;  3AZK C;  1U35 C;  1P3L B;  3B0B A;  3WKJ A;  1S32 D;  1S32 C;  1KX5 D;  5B1M D;  4X23 A;  5CPK B;  3VH6 W;  4XZQ A;  1KX5 C;  5B1M C;  5GT0 B;  1KX4 D;  4KGC B;  3REH B;  5B24 B;  3C1B A;  3REI D;  2ARO B;  4Z66 A;  3AZE A;  3REI C;  1P3I D;  3B6G A;  3TU4 A;  1P3I C;  4YM6 D;  1JFI B;  1BH9 A;  4YM6 C;  3REJ A;  3X1U A;  5AY8 A;  5CPK D;  4Z5T A;  3UT9 D;  5B31 G;  5CPK C;  4WU8 A;  3UT9 C;  5B32 G;  5GT0 D;  3AZF D;  4LD9 B;  4KGC D;  5GT0 C;  3AZF C;  1P3K D;  3C1C C;  3REH D;  3LJA A;  2ARO D;  1P3K C;  3WKJ B;  3REH C;  3W99 B;  2ARO C;  3AV1 D;  4J8V D;  4X23 B;  4XZQ B;  5DNM D;  3AV1 C;  4J8V C;  5DNM C;  5B33 A;  2F8N A;  5B40 A;  5AV8 D;  2CV5 C;  3AZN D;  5AV8 C;  4J8U D;  4NE6 A;  1ZLA C;  3C1B B;  3AZN C;  4Z66 B;  4J8U C;  3AZE B;  3B6G B;  3B6F A;  1M1A A;  3KUY D;  3MGP A;  3TU4 B;  3WKJ D;  3AN2 B;  4CSR A;  1BH9 B;  3KUY C;  2NZD D;  4J8X C;  3WKJ C;  3REJ B;  5E5A A;  5BS7 A;  3X1U B;  5AY8 B;  5AV9 A;  4X23 D;  4Z5T B;  2NZD C;  2YFW A;  4X23 C;  3AZJ D;  1Q9C A;  5B0Y D;  2PYO D;  3LJA B;  5B0Z B;  3X1S B;  3C1B D;  3AZJ C;  5B0Y C;  1S32 A;  1HTA A;  4HGA B;  2PYO C;  3C1B C;  1P3B C;  2CWE A;  3B6G D;  1BH8 A;  1P3P A;  1WWS A;  5B33 B;  2HIO B;  3REJ D;  2F8N B;  5AY8 D;  5B40 B;  3REJ C;  5B2I B;  3KWQ D;  3X1T D;  3LEL A;  5AY8 C;  4WU8 D;  5DNN D;  3KWQ C;  3X1T C;  1B6W A;  4WU8 C;  5DNN C;  1P3I A;  3B6F B;  1M1A B;  1P3F D;  4YM6 A;  4G92 C;  1P3F C;  5B2J D;  5E5A B;  4G91 C;  5AV9 B;  3UT9 A;  3W97 D;  5B2J C;  5BNV A;  2YFW B;  4DRA A;  3W97 C;  3AZF A;  3C1C A;  5B40 D;  3AZK B;  1U35 B;  1P3A D;  1P3K A;  1M18 D;  5B40 C;  1P3A C;  4E44 A;  1M18 C;  1S32 B;  3NQU A;  4JJN D;  3B6F D;  1M1A D;  4J8V A;  4DRB A;  3MGP D;  5B1M B;  4JJN C;  5CP6 D;  5DNM A;  3B6F C;  1M1A C;  3MGP C;  1P3P B;  2BYK B;  5CP6 C;  5B32 D;  2CV5 A;  3MGR A;  5AV9 D;  5AV8 A;  4WNN A;  5B32 C;  1ZLA A;  3AZN A;  4J8U A;  4QLC D;  1KX3 A;  2BYM A;  1P3I B;  4QLC C;  4J8W D;  3KUY A;  4J8X A;  4J8W C;  3MGS A;  4YM6 B;  2NZD A;  5AV6 D;  3AZG D;  5AV6 C;  3AZG C;  3UT9 B;  5BNV B;  5BO0 A;  5JA4 A;  1P3P D;  3MVD D;  3NQJ A;  3AZF B;  1P3P C;  3MVD C;  3C1C B;  3V9R A;  3LEL D;  1R4V A;  3AZJ A;  1P3K B;  5B0Y A;  2PYO A;  3LEL C;  1P3B A;  1ID3 D;  3NQU B;  1ID3 C;  3AV1 B;  1B67 A;  4J8V B;  4Z2M H;  4WZS B;  5DNM B;  2CV5 B;  4WNN B;  5AV8 B;  3KWQ A;  3X1T A;  1ZLA B;  3AZN B;  2L5A A;  5DNN A;  4J8U B;  3C1C D;  5CHL B;  2BYM B;  4NE3 A;  3REL D;  3KUY B;  1P3F A;  4J8X B;  3REL C;  3REK C;  2NZD B;  1BFM A;  5B2J A;  5AVB D;  5JRG A;  1KU5 A;  3W97 A;  5AVB C;  5G49 A;  5BO0 B;  1EQZ A;  5JA4 B;  2CV5 D;  3NQJ B;  5CPJ A;  3MGR D;  2IO5 C;  2YFV A;  3V9R B;  3X1V D;  1P3A A;  1ZLA D;  1M18 A;  3MGR C;  3AZJ B;  3X1V C;  5B0Y B;  2PYO B;  1M19 D;  1P3B B;  1KX3 D;  1M19 C;  4JJN A;  1KX3 C;  4J8X D;  5CP6 A;  5B31 A;  3MGQ D; 
#chains in the Genus database with same CATH topology
 3WAA A;  5F99 A;  3O62 D;  5B32 A;  3MGS C;  3MGQ C;  2XD1 A;  3O62 C;  3KWQ B;  3X1T B;  4WU8 B;  5DNN B;  4QLC A;  4J8W A;  4G92 B;  3VH5 A;  1P3B D;  1P3F B;  4EO5 B;  4G91 B;  5AV6 A;  3AZG A;  4AWL C;  5B2J B;  3AZH D;  2G5H C;  3W97 B;  3VH6 A;  5G49 B;  3AZH C;  3MVD A;  5CPJ B;  2ZY5 A;  1AOI A;  2YFV B;  1TZY A;  4WU9 D;  1P3A B;  1M18 B;  2RIQ A;  3EPL A;  4WU9 C;  1ID3 A;  4JJN B;  1P34 C;  2XD5 A;  1H3O A;  4XUJ D;  3MGP B;  5GSU D;  5CP6 B;  1TAF A;  5B31 B;  4XUJ C;  4CSR B;  3KXB D;  5B1L A;  5GSU C;  5KDM A;  5F99 B;  5B32 B;  3WTP A;  3WAA B;  3KXB C;  4EO5 C;  4YS3 D;  2NQB D;  5JRG D;  2F8N H;  4YS3 C;  2NQB C;  5JRG C;  1EQZ D;  4UUZ A;  1EQZ C;  4QLC B;  5CPJ D;  5AV5 A;  4J8W B;  5CPJ C;  3REL A;  3REK A;  4ZUX D;  5AV6 B;  3AZG B;  4ZUX C;  5AVB A;  3AFA A;  1BH8 B;  5B31 D;  3MVD B;  3WAA D;  5F99 D;  5B31 C;  3WAA C;  3X1V A;  5F99 C;  3LEL B;  2Y2P A;  1M19 A;  1F66 D;  2Y2G A;  5GXQ D;  1ID3 B;  3UTB D;  1F66 C;  5GXQ C;  1P3O A;  1P3G D;  3UTB C;  1H3O B;  3MGQ A;  3A6N A;  1P3G C;  2JSS A;  3O62 A;  5B1L B;  5KDM B;  3WTP B;  3WA9 D;  1N1J A;  3LZ1 D;  3WA9 C;  4H9N A;  3LZ1 C;  4UUZ B;  1HQ3 A;  4R8P D;  4ZBJ C;  1AOI D;  5C3I C;  2FJ7 A;  1TZY D;  3W98 A;  4R8P C;  5AV5 B;  1AOI C;  1P3M D;  3REL B;  3REK B;  1TZY C;  3AZI A;  4DQY B;  5CPI D;  1P3M C;  2ZY3 A;  3B0D B;  3W96 D;  5AVB B;  5CPI C;  4H9P A;  4UPK A;  3AFA B;  3W96 C;  3AZL D;  3AZH A;  3AYW C;  3AZL C;  5B1L D;  2IO5 B;  3W99 A;  3WTP D;  3MGR B;  2HUE C;  5B1L C;  3X1V B;  3WTP C;  4WU9 A;  5GT3 D;  4KHA A;  1M19 B;  5AVC D;  5GT3 C;  1P34 A;  1KX3 B;  5AV5 D;  5AVC C;  1P3O B;  4XUJ A;  3REK D;  5AV5 C;  5GSU A;  1KX4 C;  1WWI A;  2Y2Q A;  3MGS B;  3MNN A;  3KXB A;  2LY8 A;  3A6N B;  3LZ0 D;  3MGQ B;  2F8N G;  3O62 B;  3UTA D;  4YS3 A;  3LZ0 C;  3B0D C;  3AFA D;  2NQB A;  1N1J B;  3UTA C;  1P3L D;  3AN2 A;  3AFA C;  4H9N B;  4NE5 A;  1P3L C;  1HQ3 B;  4KUD A;  2FJ7 B;  4H9R A;  3W98 B;  3AV2 A;  3AZI B;  4AWL B;  4ZUX A;  5BNX A;  1P3O D;  3AZH B;  4H9P B;  3P5J B;  4KGC C;  3X1S A;  5B0Z A;  5B24 D;  1P3O C;  3A6N D;  5B24 C;  2Y2I A;  3A6N C;  5BT1 D;  4H9S A;  5BT1 C;  3AZM A;  4WU9 B;  2JE5 A;  1F66 A;  1HQ3 D;  4KHA B;  5GXQ A;  2HIO A;  4CAY A;  3B0C T;  1P34 B;  3UTB A;  2FJ7 D;  1HQ3 C;  3W98 D;  5B2I A;  1P3G A;  2F2A C;  4XUJ B;  2FJ7 C;  3W98 C;  5GSU B;  3AZI D;  3MNN B;  3KXB B;  4LD9 D;  3AZI C;  3WA9 A;  2Y2O A;  4YS3 B;  2NQB B;  5JRG B;  4LD9 C;  3LZ1 A;  1EQZ B;  3W99 D;  2FFF B;  4R8P A;  4KUD B;  3W99 C;  4H9R B;  4XZQ D;  3AV2 B;  1P3M A;  4Z2M G;  4XZQ C;  2Y2N A;  4ZUX B;  5CPI A;  1P34 D;  3FDD A;  1F1E A;  3EG5 B;  3W96 A;  5BNX B;  3AZK A;  1U35 A;  3AYW A;  4H9Q A;  3AZL A;  3EPJ A;  4H9O A;  3MNN D;  4Z66 D;  3B0C W;  3AZE D;  3MNN C;  2J8P A;  4Z66 C;  3TU4 D;  1KX5 A;  5B1M A;  3AZE C;  3B6G C;  3AZM B;  3AN2 D;  3TU4 C;  5GT3 A;  2BYK A;  1F66 B;  5GXQ B;  3AN2 C;  5AVC A;  4KUD D;  4CAY B;  3X1U D;  3UTB B;  4Z5T D;  1KX4 A;  3AV2 D;  4KUD C;  5FUG A;  3X1U C;  1P3G B;  4Z5T C;  3R45 A;  3AV2 C;  3REI A;  3F6T A;  3LZ0 A;  4E45 A;  3UTA A;  3WA9 B;  3LJA D;  5B0Z D;  3X1S D;  3LZ1 B;  1P3L A;  4ZBJ B;  3LJA C;  5B0Z C;  3X1S C;  5C3I B;  4R8P B;  4HGA C;  5CPK A;  1AOI B;  1TZY B;  1ULY A;  4NFT A;  3AZM D;  1A7W A;  3VH5 T;  1P3M B;  1Z2C B;  4H9S C;  3AZM C;  5GT0 A;  2HIO D;  4WV4 B;  5B33 D;  2F8N D;  3H0M C;  5CPI B;  3W96 B;  4KGC A;  5B33 C;  2HIO C;  5B2I D;  3AYW B;  3REH A;  4H9Q B;  3VH6 T;  3AZL B;  5B24 A;  5B2I C;  2ARO A;  1TAF B;  4H9O B;  2DF4 C;  1W2E A;  2HUE B;  3AV1 A;  2RVQ D;  1KX5 B;  3H0L C;  1JFI A;  2RVQ C;  5GT3 B;  2F8N K;  5AVC B;  3KSY A;  5E5A D;  1KX4 B;  3MGS D;  5FUG B;  5E5A C;  5BS7 C;  5AV9 C;  3WTP E;  3R45 B;  3REI B;  3LZ0 B;  4LD9 A;  3UTA B;  3AZK D;  1U35 D;  3AYW D;  4M6B A;  3VH5 W;  3AZK C;  1U35 C;  1P3L B;  3B0B A;  3WKJ A;  3IP4 C;  1S32 D;  1S32 C;  1KX5 D;  5B1M D;  4X23 A;  5CPK B;  3VH6 W;  4XZQ A;  1KX5 C;  5B1M C;  5GT0 B;  1KX4 D;  4KGC B;  3REH B;  5B24 B;  3C1B A;  3REI D;  2ARO B;  4Z66 A;  3AZE A;  3REI C;  1P3I D;  3B6G A;  3TU4 A;  1P3I C;  4YM6 D;  1JFI B;  1BH9 A;  4YM6 C;  3REJ A;  3X1U A;  5AY8 A;  5CPK D;  4Z5T A;  2Y2H A;  3UT9 D;  5B31 G;  5CPK C;  4WU8 A;  3EPK A;  3UT9 C;  5B32 G;  5GT0 D;  3AZF D;  2DQN C;  4LD9 B;  4KGC D;  5GT0 C;  3AZF C;  1P3K D;  3C1C C;  3REH D;  3LJA A;  2ARO D;  1P3K C;  3WKJ B;  3REH C;  3W99 B;  2ARO C;  3AV1 D;  4J8V D;  4X23 B;  4XZQ B;  5DNM D;  3AV1 C;  4J8V C;  5DNM C;  5B33 A;  2F8N A;  5B40 A;  5AV8 D;  2CV5 C;  3AZN D;  2ZM5 A;  5AV8 C;  4J8U D;  4NE6 A;  3A1I A;  2UWX A;  3C1B B;  3AZN C;  1ZLA C;  4Z66 B;  4J8U C;  3AZE B;  3B6G B;  3B6F A;  1M1A A;  3KUY D;  3MGP A;  3TU4 B;  3WKJ D;  3AN2 B;  4CSR A;  1BH9 B;  3KUY C;  2NZD D;  4J8X C;  3WKJ C;  3REJ B;  5E5A A;  5BS7 A;  3X1U B;  5AY8 B;  5AV9 A;  4X23 D;  4Z5T B;  2NZD C;  4WJ3 C;  2YFW A;  4X23 C;  2Y2M A;  1Q9C A;  3AZJ D;  5B0Y D;  2PYO D;  3LJA B;  5B0Z B;  3X1S B;  3C1B D;  3AZJ C;  5B0Y C;  1S32 A;  1HTA A;  4HGA B;  2PYO C;  3C1B C;  1P3B C;  2CWE A;  3B6G D;  1BH8 A;  1P3P A;  1WWS A;  2G5I C;  5B33 B;  2HIO B;  3REJ D;  2F8N B;  5AY8 D;  2Y2L A;  5B40 B;  2W8S A;  5B2I B;  3KWQ D;  3X1T D;  3LEL A;  3REJ C;  5AY8 C;  4WU8 D;  5DNN D;  3KWQ C;  3X1T C;  1B6W A;  4WU8 C;  2BG1 A;  5DNN C;  1P3I A;  3B6F B;  1M1A B;  1P3F D;  4YM6 A;  1T3U A;  4G92 C;  2JCH A;  1P3F C;  5B2J D;  3KFU G;  2Y2K A;  4G91 C;  5E5A B;  3A1K A;  5AV9 B;  3UT9 A;  3W97 D;  5B2J C;  5BNV A;  3AL0 C;  2YFW B;  4DRA A;  3W97 C;  3AZF A;  3C1C A;  5B40 D;  3AZK B;  1U35 B;  1P3A D;  1P3K A;  1M18 D;  5B40 C;  1P3A C;  4E44 A;  1M18 C;  1S32 B;  3NQU A;  4JJN D;  3B6F D;  1M1A D;  4J8V A;  2Y2J A;  4DRB A;  3MGP D;  5B1M B;  4JJN C;  5CP6 D;  5DNM A;  3B6F C;  1M1A C;  3MGP C;  1P3P B;  2BYK B;  5CP6 C;  5B32 D;  2CV5 A;  3MGR A;  5AV9 D;  5AV8 A;  4WNN A;  5B32 C;  1ZLA A;  3AZN A;  4J8U A;  4QLC D;  1KX3 A;  2BYM A;  1P3I B;  4QLC C;  4J8W D;  3KUY A;  4J8X A;  4J8W C;  3MGS A;  4YM6 B;  2NZD A;  2ZY2 A;  5AV6 D;  3AZG D;  5AV6 C;  3AZG C;  3UT9 B;  5BNV B;  5BO0 A;  5JA4 A;  1P3P D;  3MVD D;  3NQJ A;  3AZF B;  1P3P C;  3MVD C;  3C1C B;  3V9R A;  3LEL D;  1R4V A;  3AZJ A;  1P3K B;  5B0Y A;  2ZY4 A;  2PYO A;  3LEL C;  1P3B A;  1ID3 D;  3NQU B;  1ID3 C;  3AV1 B;  1B67 A;  4J8V B;  4Z2M H;  4WZS B;  5DNM B;  2CV5 B;  4WNN B;  5AV8 B;  3KWQ A;  3X1T A;  1ZLA B;  3AZN B;  2L5A A;  5DNN A;  4J8U B;  3C1C D;  5CHL B;  2BYM B;  4NE3 A;  3REL D;  3KUY B;  1P3F A;  4J8X B;  1PZR A;  3REK C;  3REL C;  2NZD B;  1BFM A;  5B2J A;  5AVB D;  5JRG A;  1KU5 A;  3W97 A;  3EPH A;  5AVB C;  5G49 A;  5BO0 B;  1EQZ A;  5JA4 B;  3H0R C;  2CV5 D;  3NQJ B;  5CPJ A;  3MGR D;  2IO5 C;  2YFV A;  3V9R B;  3X1V D;  1P3A A;  1ZLA D;  2VQR A;  3MGR C;  3AZJ B;  1M18 A;  3X1V C;  5B0Y B;  2PYO B;  1M19 D;  1P3B B;  1KX3 D;  1M19 C;  4JJN A;  1KX3 C;  4J8X D;  5CP6 A;  5B31 A;  3MGQ D; 
#chains in the Genus database with same CATH homology
 3WAA A;  5F99 A;  3O62 D;  5B32 A;  3MGS C;  3MGQ C;  2XD1 A;  3O62 C;  3KWQ B;  3X1T B;  4WU8 B;  5DNN B;  4QLC A;  4J8W A;  4G92 B;  3VH5 A;  1P3B D;  1P3F B;  4EO5 B;  4G91 B;  5AV6 A;  3AZG A;  4AWL C;  5B2J B;  3AZH D;  2G5H C;  3W97 B;  3VH6 A;  5G49 B;  3AZH C;  3MVD A;  5CPJ B;  2ZY5 A;  1AOI A;  2YFV B;  1TZY A;  4WU9 D;  1P3A B;  1M18 B;  2RIQ A;  3EPL A;  4WU9 C;  1ID3 A;  4JJN B;  1P34 C;  2XD5 A;  1H3O A;  4XUJ D;  3MGP B;  5GSU D;  5CP6 B;  1TAF A;  5B31 B;  4XUJ C;  4CSR B;  3KXB D;  5B1L A;  5GSU C;  5KDM A;  5F99 B;  5B32 B;  3WTP A;  3WAA B;  3KXB C;  4EO5 C;  4YS3 D;  2NQB D;  5JRG D;  2F8N H;  4YS3 C;  2NQB C;  5JRG C;  1EQZ D;  4UUZ A;  1EQZ C;  4QLC B;  5CPJ D;  5AV5 A;  4J8W B;  5CPJ C;  3REL A;  3REK A;  4ZUX D;  5AV6 B;  3AZG B;  4ZUX C;  5AVB A;  3AFA A;  1BH8 B;  5B31 D;  3MVD B;  3WAA D;  5F99 D;  5B31 C;  3WAA C;  3X1V A;  5F99 C;  3LEL B;  2Y2P A;  1M19 A;  1F66 D;  2Y2G A;  5GXQ D;  1ID3 B;  3UTB D;  1F66 C;  5GXQ C;  1P3O A;  1P3G D;  3UTB C;  1H3O B;  3MGQ A;  3A6N A;  1P3G C;  2JSS A;  3O62 A;  5B1L B;  5KDM B;  3WTP B;  3WA9 D;  1N1J A;  3LZ1 D;  3WA9 C;  4H9N A;  3LZ1 C;  4UUZ B;  1HQ3 A;  4R8P D;  4ZBJ C;  1AOI D;  5C3I C;  2FJ7 A;  1TZY D;  3W98 A;  4R8P C;  5AV5 B;  1AOI C;  1P3M D;  3REL B;  3REK B;  1TZY C;  3AZI A;  4DQY B;  5CPI D;  1P3M C;  2ZY3 A;  3B0D B;  3W96 D;  5AVB B;  5CPI C;  4H9P A;  4UPK A;  3AFA B;  3W96 C;  3AZL D;  3AZH A;  3AYW C;  3AZL C;  5B1L D;  2IO5 B;  3W99 A;  3WTP D;  3MGR B;  2HUE C;  5B1L C;  3X1V B;  3WTP C;  4WU9 A;  5GT3 D;  4KHA A;  1M19 B;  5AVC D;  5GT3 C;  1P34 A;  1KX3 B;  5AV5 D;  5AVC C;  1P3O B;  4XUJ A;  3REK D;  5AV5 C;  5GSU A;  1KX4 C;  1WWI A;  2Y2Q A;  3MGS B;  3MNN A;  3KXB A;  2LY8 A;  3A6N B;  3LZ0 D;  3MGQ B;  2F8N G;  3O62 B;  3UTA D;  4YS3 A;  3LZ0 C;  3B0D C;  3AFA D;  2NQB A;  1N1J B;  3UTA C;  1P3L D;  3AN2 A;  3AFA C;  4H9N B;  4NE5 A;  1P3L C;  1HQ3 B;  4KUD A;  2FJ7 B;  4H9R A;  3W98 B;  3AV2 A;  3AZI B;  4AWL B;  4ZUX A;  5BNX A;  1P3O D;  3AZH B;  4H9P B;  3P5J B;  4KGC C;  3X1S A;  5B0Z A;  5B24 D;  1P3O C;  3A6N D;  5B24 C;  2Y2I A;  3A6N C;  5BT1 D;  4H9S A;  5BT1 C;  3AZM A;  4WU9 B;  2JE5 A;  1F66 A;  1HQ3 D;  4KHA B;  5GXQ A;  2HIO A;  4CAY A;  3B0C T;  1P34 B;  3UTB A;  2FJ7 D;  1HQ3 C;  3W98 D;  5B2I A;  1P3G A;  2F2A C;  4XUJ B;  2FJ7 C;  3W98 C;  5GSU B;  3AZI D;  3MNN B;  3KXB B;  4LD9 D;  3AZI C;  3WA9 A;  2Y2O A;  4YS3 B;  2NQB B;  5JRG B;  4LD9 C;  3LZ1 A;  1EQZ B;  3W99 D;  2FFF B;  4R8P A;  4KUD B;  3W99 C;  4H9R B;  4XZQ D;  3AV2 B;  1P3M A;  4Z2M G;  4XZQ C;  2Y2N A;  4ZUX B;  5CPI A;  1P34 D;  3FDD A;  1F1E A;  3EG5 B;  3W96 A;  5BNX B;  3AZK A;  1U35 A;  3AYW A;  4H9Q A;  3AZL A;  3EPJ A;  4H9O A;  3MNN D;  4Z66 D;  3B0C W;  3AZE D;  3MNN C;  2J8P A;  4Z66 C;  3TU4 D;  1KX5 A;  5B1M A;  3AZE C;  3B6G C;  3AZM B;  3AN2 D;  3TU4 C;  5GT3 A;  2BYK A;  1F66 B;  5GXQ B;  3AN2 C;  5AVC A;  4KUD D;  4CAY B;  3X1U D;  3UTB B;  4Z5T D;  1KX4 A;  3AV2 D;  4KUD C;  5FUG A;  3X1U C;  1P3G B;  4Z5T C;  3R45 A;  3AV2 C;  3REI A;  3F6T A;  3LZ0 A;  4E45 A;  3UTA A;  3WA9 B;  3LJA D;  5B0Z D;  3X1S D;  3LZ1 B;  1P3L A;  4ZBJ B;  3LJA C;  5B0Z C;  3X1S C;  5C3I B;  4R8P B;  4HGA C;  5CPK A;  1AOI B;  1TZY B;  1ULY A;  4NFT A;  3AZM D;  1A7W A;  3VH5 T;  1P3M B;  1Z2C B;  4H9S C;  3AZM C;  5GT0 A;  2HIO D;  4WV4 B;  5B33 D;  2F8N D;  3H0M C;  5CPI B;  3W96 B;  4KGC A;  5B33 C;  2HIO C;  5B2I D;  3AYW B;  3REH A;  4H9Q B;  3VH6 T;  3AZL B;  5B24 A;  5B2I C;  2ARO A;  1TAF B;  4H9O B;  2DF4 C;  1W2E A;  2HUE B;  3AV1 A;  2RVQ D;  1KX5 B;  3H0L C;  1JFI A;  2RVQ C;  5GT3 B;  2F8N K;  5AVC B;  3KSY A;  5E5A D;  1KX4 B;  3MGS D;  5FUG B;  5E5A C;  5BS7 C;  5AV9 C;  3WTP E;  3R45 B;  3REI B;  3LZ0 B;  4LD9 A;  3UTA B;  3AZK D;  1U35 D;  3AYW D;  4M6B A;  3VH5 W;  3AZK C;  1U35 C;  1P3L B;  3B0B A;  3WKJ A;  3IP4 C;  1S32 D;  1S32 C;  1KX5 D;  5B1M D;  4X23 A;  5CPK B;  3VH6 W;  4XZQ A;  1KX5 C;  5B1M C;  5GT0 B;  1KX4 D;  4KGC B;  3REH B;  5B24 B;  3C1B A;  3REI D;  2ARO B;  4Z66 A;  3AZE A;  3REI C;  1P3I D;  3B6G A;  3TU4 A;  1P3I C;  4YM6 D;  1JFI B;  1BH9 A;  4YM6 C;  3REJ A;  3X1U A;  5AY8 A;  5CPK D;  4Z5T A;  2Y2H A;  3UT9 D;  5B31 G;  5CPK C;  4WU8 A;  3EPK A;  3UT9 C;  5B32 G;  5GT0 D;  3AZF D;  2DQN C;  4LD9 B;  4KGC D;  5GT0 C;  3AZF C;  1P3K D;  3C1C C;  3REH D;  3LJA A;  2ARO D;  1P3K C;  3WKJ B;  3REH C;  3W99 B;  2ARO C;  3AV1 D;  4J8V D;  4X23 B;  4XZQ B;  5DNM D;  3AV1 C;  4J8V C;  5DNM C;  5B33 A;  2F8N A;  5B40 A;  5AV8 D;  2CV5 C;  3AZN D;  2ZM5 A;  5AV8 C;  4J8U D;  4NE6 A;  3A1I A;  2UWX A;  3C1B B;  3AZN C;  1ZLA C;  4Z66 B;  4J8U C;  3AZE B;  3B6G B;  3B6F A;  1M1A A;  3KUY D;  3MGP A;  3TU4 B;  3WKJ D;  3AN2 B;  4CSR A;  1BH9 B;  3KUY C;  2NZD D;  4J8X C;  3WKJ C;  3REJ B;  5E5A A;  5BS7 A;  3X1U B;  5AY8 B;  5AV9 A;  4X23 D;  4Z5T B;  2NZD C;  4WJ3 C;  2YFW A;  4X23 C;  2Y2M A;  1Q9C A;  3AZJ D;  5B0Y D;  2PYO D;  3LJA B;  5B0Z B;  3X1S B;  3C1B D;  3AZJ C;  5B0Y C;  1S32 A;  1HTA A;  4HGA B;  2PYO C;  3C1B C;  1P3B C;  2CWE A;  3B6G D;  1BH8 A;  1P3P A;  1WWS A;  2G5I C;  5B33 B;  2HIO B;  3REJ D;  2F8N B;  5AY8 D;  2Y2L A;  5B40 B;  2W8S A;  5B2I B;  3KWQ D;  3X1T D;  3LEL A;  3REJ C;  5AY8 C;  4WU8 D;  5DNN D;  3KWQ C;  3X1T C;  1B6W A;  4WU8 C;  2BG1 A;  5DNN C;  1P3I A;  3B6F B;  1M1A B;  1P3F D;  4YM6 A;  1T3U A;  4G92 C;  2JCH A;  1P3F C;  5B2J D;  3KFU G;  2Y2K A;  4G91 C;  5E5A B;  3A1K A;  5AV9 B;  3UT9 A;  3W97 D;  5B2J C;  5BNV A;  3AL0 C;  2YFW B;  4DRA A;  3W97 C;  3AZF A;  3C1C A;  5B40 D;  3AZK B;  1U35 B;  1P3A D;  1P3K A;  1M18 D;  5B40 C;  1P3A C;  4E44 A;  1M18 C;  1S32 B;  3NQU A;  4JJN D;  3B6F D;  1M1A D;  4J8V A;  2Y2J A;  4DRB A;  3MGP D;  5B1M B;  4JJN C;  5CP6 D;  5DNM A;  3B6F C;  1M1A C;  3MGP C;  1P3P B;  2BYK B;  5CP6 C;  5B32 D;  2CV5 A;  3MGR A;  5AV9 D;  5AV8 A;  4WNN A;  5B32 C;  1ZLA A;  3AZN A;  4J8U A;  4QLC D;  1KX3 A;  2BYM A;  1P3I B;  4QLC C;  4J8W D;  3KUY A;  4J8X A;  4J8W C;  3MGS A;  4YM6 B;  2NZD A;  2ZY2 A;  5AV6 D;  3AZG D;  5AV6 C;  3AZG C;  3UT9 B;  5BNV B;  5BO0 A;  5JA4 A;  1P3P D;  3MVD D;  3NQJ A;  3AZF B;  1P3P C;  3MVD C;  3C1C B;  3V9R A;  3LEL D;  1R4V A;  3AZJ A;  1P3K B;  5B0Y A;  2ZY4 A;  2PYO A;  3LEL C;  1P3B A;  1ID3 D;  3NQU B;  1ID3 C;  3AV1 B;  1B67 A;  4J8V B;  4Z2M H;  4WZS B;  5DNM B;  2CV5 B;  4WNN B;  5AV8 B;  3KWQ A;  3X1T A;  1ZLA B;  3AZN B;  2L5A A;  5DNN A;  4J8U B;  3C1C D;  5CHL B;  2BYM B;  4NE3 A;  3REL D;  3KUY B;  1P3F A;  4J8X B;  1PZR A;  3REK C;  3REL C;  2NZD B;  1BFM A;  5B2J A;  5AVB D;  5JRG A;  1KU5 A;  3W97 A;  3EPH A;  5AVB C;  5G49 A;  5BO0 B;  1EQZ A;  5JA4 B;  3H0R C;  2CV5 D;  3NQJ B;  5CPJ A;  3MGR D;  2IO5 C;  2YFV A;  3V9R B;  3X1V D;  1P3A A;  1ZLA D;  2VQR A;  3MGR C;  3AZJ B;  1M18 A;  3X1V C;  5B0Y B;  2PYO B;  1M19 D;  1P3B B;  1KX3 D;  1M19 C;  4JJN A;  1KX3 C;  4J8X D;  5CP6 A;  5B31 A;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...