3X1TB

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tB00
5JRGB 2NZDD 4J8UD 3UTBA 1P3AB 5BT1D 5B2ID 5B0ZA 4KHAA 1TZYB 5AV9C 2NQBA 3W96C 3TU4D 4YM6D 3C1CB 2RVQC 3R45A 3B0CW 1B6WA 3MGPA 5FUGB 1P3IB 3KUYA 1EQZC 1B67A 4KUDA 5AVCD 3WTPB 3KSYA 3LJAC 3REJD 2YFVA 2YFWB 5BS7C 4YS3A 1U35D 1KX4C 1P3LD 4CSRB 5CPIB 1KX5C 3MGQC 3MGRC 3C1BC 3UT9D 4ZUXD 3AZGA 1P34D 4EO5C 5GSUC 2HIOA 3AZND 5AV9A 3X1VD 3W98A 3B0CT 3B6GB 3KXBB 4H9QB 3REIA 3AZMB 5F99C 3AYWA 3REKD 3KWQD 2NZDB 2CWEA 4J8UB 5B2IB 5AV8A 5B2JA 1TAFA 3LELD 3NQUB 3MGSC 1EQZA 4R8PA 1KX3D 3AZHA 4YM6B 4Z66D 3MNNA 5CPJC 4Z2MG 3MGRA 5GT0D 1JFIA 3REJB 3AZEA 1U35B 3WAAC 5B31D 1P3LB 4LD9A 3V9RA 3B6FC 3UT9B 5CP6C 4ZUXB 1P3OA 1P34B 5B0YA 4DRBA 5E5AC 3WTPC 3AZNB 3X1VB 4AWLC 3W96D 4CAYB 1HTAA 3REKB 5JA4B 2RVQD 3KWQB 3UTBB 3AZFC 5JRGA 5BO0B 5GXQC 4KHAB 5DNNC 5B32C 3LELB 1P3AA 2F8NG 5B32G 1TZYA 3LJAD 1KX3B 1KX4D 4Z66B 3R45B 1F1EA 1KX5D 3AFAC 3C1CA 4DRAA 3REHC 3MGQD 3C1BD 3B6FA 5FUGA 3A6NC 5GT0B 5CP6A 5GSUD 5B31B 5E5AA 3WTPA 3TU4C 2YFWA 4CSRA 1M18C 5CPIA 3AZKC 5F99D 2JSSA 2CV5C 5AVCC 5GXQA 5AV9B 4WZSB 4Z2MH 3MGSD 5G49A 4JJNC 3W96B 3B6GA 1HQ3C 1P3BD 4HGAC 2PYOC 5CPJD 1TAFB 2NZDA 4J8UA 3REHA 2HUEC 5B2IA 1AOIC 1EQZB 3NQUA 3LJAB 3AV1C 3WAAD 1KX4B 4Z5TC 3TU4A 1KX5B 5C3IC 4YM6A 4H9NA 1M18A 3MGQB 3MGRB 3C1BB 1WWIA 3B6FD 3X1SC 5CP6D 1JFIB 4NFTA 4EO5B 4H9SA 5GSUB 5AVCA 3LZ1C 3V9RB 1U35A 5B1MC 2F8NH 1P3LA 3W99C 5F99B 3B0DC 3UT9A 2PYOA 4QLCD 3AZFD 2F8ND 5DNND 5GXQD 5B32D 1P3FC 4NE6A 1P34A 3AZID 3MGSB 3AZNA 3X1VA 3VH6A 1P3BB 1F66C 4CAYA 5AVBD 4ZBJC 1BH9A 5CPJB 3AFAD 3REKA 5JA4A 3KWQA 3REHD 5BO0A 3A6ND 3LELA 1S32C 3MVDC 2IO5C 3WAAB 4J8WC 1KX3A 4Z66A 1M18D 3B6FB 3AZKD 5CP6B 3RELC 2CV5D 5GT0A 5E5AB 5B31A 4JJND 4AWLB 1HQ3D 4XZQC 1R4VA 2PYOD 3AZFB 2F8NB 5DNNB 5GXQB 5B32B 4J8XC 3AZLC 1AOID 3UTAC 5G49B 5B40C 1P3GC 3AV1D 3W96A 4Z5TD 4J8WA 4KGCD 3AFAB 3AV2C 3REHB 3X1SD 3A6NB 5AY8C 1ULYA 3LZ1D 3LJAA 3TU4B 1M1AC 5BS7A 5B1LC 1P3BC 5B1MD 1KX4A 5DNMC 4H9NB 1M18B 3WKJC 1KX5A 3AZKB 3W99D 4XZQA 3MGQA 3C1BA 2CV5B 5AVCB 1P3FD 2BYMB 5GSUA 4JJNB 1P3KC 1HQ3B 1F66D 4WU9C 4HGAB 2PYOB 5F99A 4NE5A 5AV6C 2HUEB 1AOIB 3MGSA 1S32D 3AV1B 3MVDD 4Z5TB 4J8WD 1BH9B 5C3IB 1N1JB 1P3BA 2FJ7C 5B33C 4QLCC 5CPJA 3X1SB 3AZIC 3RELD 3LZ1B 5B1MB 3WAAA 5AVBC 3X1TC 1P3PD 3W99B 4XZQD 3B0DB 4WU9A 3VH6W 1P3FB 4J8XD 3AZLD 3UTAD 5B40D 1ZLAC 1P3GD 1F66B 3W97C 4ZBJB 5CPKC 3AV2D 1M19C 4QLCA 4X23C 3AZFA 2F8NA 4NE3A 5DNNA 5B32A 5AY8D 3AZIA 1S32B 3MVDB 2IO5B 4J8WB 1M1AD 3VH6T 5B1LD 4XUJC 3AN2C 5DNMD 5B24C 5AVBA 3WKJD 3AFAA 3RELB 3WA9C 3A6NA 1ID3C 4H9RB 4KGCC 1P3KD 1P3PB 4XZQB 4WU9D 3W97A 3AZKA 4J8XB 5AV6D 2CV5A 3AZLB 3AZJC 3UTAB 2BYMA 5B40B 1P3GB 4JJNA 4G91C 5GT3C 1HQ3A 2FJ7D 4XUJA 3AV2B 3O62C 5B33D 5B24A 2AROC 5CHLB 5AY8B 1AOIA 1M1AB 3AV1A 5B1LB 4Z5TA 5DNMB 3X1TD 3WKJB 4KGCA 1N1JA 5B0ZC 5BNXB 1P3ID 2NQBC 3X1SA 1P3MC 3VH5A 3NQJB 4E44A 4H9OB 3LZ1A 1ZLAD 1P3KB 5B1MA 3MGPC 4WU9B 3KUYC 3W97D 3W99A 5CPKD 4KUDC 1M19D 5AV6B 4X23D 4YS3C 1P3FA 3KXBD 1P3PC 3AZMD 4XUJD 3AN2D 3AZGC 1F66A 2FJ7B 5B33B 5B24D 4QLCB 2HIOC 2BYKA 3AZIB 3W98C 3WA9D 1P3MA 1S32A 1ID3D 3REIC 4H9PB 3AYWC 3MVDA 5AVBB 3X1TB 5AV8C 5B2JC 4G92C 3RELA 4R8PC 3AZJD 3AZHC 4J8VC 1ZLAB 3MNNC 4H9RA 1H3OB 3LZ0C 5GT3D 3W97B 1P3PA 1BH8B 5CPKB 3WTPE 3O62D 1M19B 3AZEC 2AROD 4X23B 3X1UD 4J8XA 4LD9C 3AZLA 1WWSA 1KU5A 4WNNB 3UTAA 5B40A 1P3GA 4XUJB 3B0BA 3AN2B 1P3OC 5B24B 3UTBD 5B0YC 5B0ZD 3AV2A 2NQBD 3WA9B 1P3MD 5AY8A 4WU8C 1ID3B 5AV5C 1M1AA 4KGCB 4J8VA 5B1LA 5BNVA 5JRGC 3MGPD 5DNMA 5KDMB 3WKJA 3LZ0A 3KUYD 1P3AC 5BNXA 1TZYC 4KUDD 3AZJB 4YS3D 3NQJA 3C1CC 4H9OA 4G91B 5GT3B 1P3KA 4UUZB 1P3IC 3AZGD 3O62B 2AROB 4E45A 3X1UB 2HIOD 5AV9D 5AV6A 3W98D 5CPIC 4WU8A 3REID 3AYWD 5AV5A 3VH5W 5B0ZB 5AV8D 5B2JD 2FJ7A 5B33A 2BYKB 2NQBB 1EQZD 1P3MB 4R8PD 3B6GC 3KXBC 3AZHD 4M6BA 4J8VD 3AZMC 4H9PA 3MNND 3MGPB 2NZDC 4J8UC 3LZ0D 3KUYB 5BT1C 5B2IC 4WV4B 3MGRD 3X1TA 1P3IA 4KUDB 2F8NK 3AZED 2YFVB 4YS3B 4LD9D 3VH5T 4YM6C 1ZLAA 1H3OA 3AZGB 1P3OD 1BH8A 5B0YD 5CPKA 4H9SC 2HIOB 1M19A 3REJC 3W98B 4X23A 1U35C 1P3LC 2L5AA 4WNNA 3REIB 4WU8D 3KXBA 4H9QA 3AYWB 5AV5D 3UT9C 3AZMA 4ZUXC 5AV8B 5JRGD 5B2JB 3AN2A 1P34C 1P3AD 3X1UC 3AZNC 1TZYD 3X1VC 1BFMA 1Q9CA 4G92B 4R8PB 3WA9A 3AZHB 1ID3A 4J8VB 3MNNB 5BNVB 3C1CD 3REKC 3KWQC 3UTBC 3LZ0B 1A7WA 5KDMA 3LELC 3AZEB 5E5AD 3WTPD 1KX3C 3REJA 4LD9B 3AZJA 4Z66C 5CPID 2LY8A 5GT3A 1P3OB 4UUZA 5GT0C 4ZUXA 5B0YB 3O62A 2AROA 5B31C 3X1UA 4WU8B 3B6GD 5B31G 5AV5B
chains in the Genus database with same CATH superfamily
5JRGB 2NZDD 4J8UD 3UTBA 1P3AB 5BT1D 5B2ID 5B0ZA 4KHAA 1TZYB 5AV9C 2NQBA 3W96C 2JCHA 3TU4D 4YM6D 2FFFB 3H0MC 3C1CB 2RVQC 3R45A 3B0CW 1B6WA 3MGPA 5FUGB 1P3IB 3KUYA 2W8SA 1B67A 1EQZC 4KUDA 5AVCD 3WTPB 3KSYA 3LJAC 3REJD 2YFVA 2YFWB 5BS7C 4YS3A 1U35D 1KX4C 1P3LD 4CSRB 5CPIB 1KX5C 3MGQC 3MGRC 3C1BC 3UT9D 4ZUXD 3AZGA 2XD1A 1P34D 4EO5C 5GSUC 2HIOA 3AZND 5AV9A 3X1VD 3W98A 3B0CT 3B6GB 3KXBB 4H9QB 3REIA 3AZMB 5F99C 3AYWA 3REKD 2Y2PA 3KWQD 2CWEA 4J8UB 2NZDB 5B2IB 5AV8A 5B2JA 1TAFA 3LELD 3NQUB 3MGSC 1EQZA 4R8PA 1KX3D 3AZHA 4YM6B 4Z66D 3MNNA 5CPJC 4Z2MG 3MGRA 5GT0D 1JFIA 3REJB 3AZEA 1U35B 3WAAC 5B31D 1P3LB 4LD9A 3V9RA 2VQRA 3B6FC 3UT9B 5CP6C 4ZUXB 1P3OA 1P34B 5B0YA 4DRBA 5E5AC 3WTPC 3AZNB 3X1VB 4AWLC 3W96D 4CAYB 1HTAA 3REKB 5JA4B 2RVQD 3KWQB 3UTBB 3AZFC 5JRGA 5BO0B 5GXQC 4KHAB 5B32C 5DNNC 3LELB 1P3AA 2F8NG 5B32G 1TZYA 3LJAD 1KX3B 1KX4D 4Z66B 3R45B 1F1EA 1KX5D 3AFAC 3C1CA 4DRAA 3REHC 3MGQD 3C1BD 3B6FA 5FUGA 3A6NC 5GT0B 5CP6A 2Y2JA 5GSUD 5B31B 5E5AA 3WTPA 3TU4C 2YFWA 4CSRA 1M18C 5CPIA 3AZKC 2Y2KA 5F99D 2JSSA 2CV5C 5AVCC 5GXQA 5AV9B 4WZSB 4Z2MH 3MGSD 5G49A 4JJNC 3W96B 3B6GA 3EPKA 1HQ3C 1P3BD 4HGAC 2PYOC 5CPJD 1TAFB 2NZDA 4J8UA 3REHA 2HUEC 5B2IA 1AOIC 1EQZB 3NQUA 3LJAB 3AV1C 3WAAD 1KX4B 4Z5TC 3TU4A 1KX5B 5C3IC 4YM6A 4H9NA 1M18A 3MGQB 3MGRB 3C1BB 1WWIA 3B6FD 3X1SC 5CP6D 2UWXA 1JFIB 4NFTA 4EO5B 4DQYB 4H9SA 5GSUB 5AVCA 3LZ1C 3V9RB 1U35A 5B1MC 2Y2MA 2F8NH 1P3LA 3KFUG 3W99C 5F99B 3B0DC 3UT9A 2PYOA 4QLCD 3AZFD 2F8ND 5DNND 5GXQD 5B32D 1P3FC 4NE6A 1P34A 3AZID 3MGSB 3AZNA 3X1VA 3VH6A 1P3BB 1F66C 4CAYA 5AVBD 4ZBJC 1BH9A 5CPJB 3AFAD 3REKA 5JA4A 3KWQA 3REHD 5BO0A 3A6ND 3LELA 1S32C 3MVDC 2IO5C 3WAAB 4J8WC 1KX3A 4Z66A 1M18D 3B6FB 3AZKD 5CP6B 3A1IA 3RELC 2CV5D 5GT0A 5E5AB 5B31A 4JJND 4AWLB 1HQ3D 4XZQC 1R4VA 2PYOD 3AZFB 2F8NB 5DNNB 5GXQB 5B32B 4J8XC 3AZLC 1AOID 3UTAC 1Z2CB 5G49B 5B40C 1P3GC 3AV1D 3W96A 4Z5TD 4J8WA 3P5JB 4KGCD 3AFAB 3AV2C 3REHB 3X1SD 3A6NB 5AY8C 1ULYA 3LZ1D 3LJAA 3TU4B 1M1AC 5BS7A 2DF4C 5B1LC 1P3BC 5B1MD 1KX4A 5DNMC 4H9NB 1M18B 3WKJC 2G5HC 1KX5A 3AZKB 3W99D 4XZQA 3MGQA 3C1BA 2CV5B 5AVCB 1P3FD 2BYMB 5GSUA 4JJNB 2Y2OA 1P3KC 1HQ3B 1F66D 4WU9C 4HGAB 2PYOB 5F99A 4NE5A 5AV6C 2HUEB 1AOIB 1PZRA 3MGSA 1S32D 3AV1B 2ZY4A 3MVDD 4Z5TB 4J8WD 1BH9B 5C3IB 1N1JB 1P3BA 2FJ7C 3EPHA 5B33C 4QLCC 5CPJA 3FDDA 3X1SB 3AZIC 3A1KA 3RELD 3LZ1B 5B1MB 3WAAA 5AVBC 3X1TC 1P3PD 3W99B 4XZQD 3B0DB 4WU9A 3VH6W 1P3FB 4J8XD 3AZLD 3UTAD 5B40D 1ZLAC 2ZY3A 1P3GD 1F66B 3W97C 4ZBJB 5CPKC 3AV2D 1M19C 4QLCA 4X23C 3AZFA 2F8NA 4NE3A 5DNNA 5B32A 5AY8D 3AZIA 4UPKA 1S32B 3MVDB 2IO5B 4J8WB 1M1AD 3VH6T 5B1LD 4XUJC 3AN2C 5DNMD 5B24C 5AVBA 3WKJD 3AFAA 3RELB 3WA9C 3A6NA 1ID3C 4H9RB 4KGCC 1P3KD 1P3PB 4XZQB 4WU9D 2BG1A 3W97A 3AZKA 2RIQA 4J8XB 5AV6D 2CV5A 3AZLB 3AZJC 3UTAB 2BYMA 5B40B 1T3UA 1P3GB 4JJNA 4G91C 5GT3C 1HQ3A 2FJ7D 3EG5B 4XUJA 3AV2B 3O62C 5B33D 5B24A 2AROC 5CHLB 5AY8B 1AOIA 2Y2NA 2Y2QA 1M1AB 3AV1A 5B1LB 4Z5TA 5DNMB 3X1TD 3WKJB 4KGCA 1N1JA 5B0ZC 5BNXB 1P3ID 2NQBC 3X1SA 1P3MC 3VH5A 3NQJB 4E44A 4H9OB 3LZ1A 1ZLAD 1P3KB 5B1MA 3MGPC 4WU9B 3KUYC 3W97D 2Y2IA 3W99A 5CPKD 4KUDC 1M19D 5AV6B 4X23D 4YS3C 1P3FA 3KXBD 1P3PC 3AZMD 4XUJD 3AN2D 3AZGC 1F66A 2FJ7B 2Y2GA 5B33B 5B24D 4QLCB 2HIOC 2BYKA 3AZIB 3W98C 2Y2HA 3WA9D 3H0RC 1P3MA 1S32A 1ID3D 3REIC 4H9PB 3AYWC 3MVDA 5AVBB 3X1TB 5AV8C 5B2JC 4G92C 3RELA 4R8PC 3AZJD 3AZHC 4J8VC 2ZY5A 3MNNC 1ZLAB 4H9RA 1H3OB 3LZ0C 5GT3D 3EPJA 3W97B 1P3PA 1BH8B 5CPKB 3WTPE 3O62D 1M19B 3AZEC 2AROD 4X23B 3X1UD 4J8XA 4LD9C 3AZLA 1WWSA 1KU5A 4WNNB 3UTAA 5B40A 1P3GA 4XUJB 3B0BA 3AN2B 1P3OC 5B24B 3UTBD 5B0YC 5B0ZD 3AV2A 2NQBD 2JE5A 3WA9B 1P3MD 3H0LC 5AY8A 4WU8C 1ID3B 5AV5C 1M1AA 4KGCB 4J8VA 5B1LA 5BNVA 5JRGC 3MGPD 5DNMA 5KDMB 3F6TA 3WKJA 1W2EA 3LZ0A 3KUYD 1P3AC 5BNXA 1TZYC 4KUDD 3AZJB 4YS3D 3NQJA 3C1CC 4H9OA 4G91B 2F2AC 5GT3B 1P3KA 4UUZB 1P3IC 3AZGD 3O62B 2AROB 4E45A 3X1UB 2HIOD 5AV9D 5AV6A 3W98D 3AL0C 5CPIC 4WJ3C 4WU8A 3REID 3AYWD 5AV5A 3EPLA 3VH5W 5B0ZB 5AV8D 5B2JD 2FJ7A 5B33A 2BYKB 2NQBB 1EQZD 2G5IC 1P3MB 4R8PD 3B6GC 3KXBC 3AZHD 4M6BA 4J8VD 3AZMC 4H9PA 3MNND 3MGPB 2Y2LA 2NZDC 4J8UC 3LZ0D 3KUYB 5BT1C 5B2IC 4WV4B 3MGRD 3X1TA 1P3IA 2J8PA 4KUDB 2F8NK 3AZED 2YFVB 4YS3B 4LD9D 3VH5T 4YM6C 2ZM5A 1ZLAA 1H3OA 3AZGB 1P3OD 1BH8A 5B0YD 5CPKA 4H9SC 2HIOB 1M19A 3REJC 3W98B 4X23A 1U35C 1P3LC 2L5AA 4WNNA 3REIB 4WU8D 3KXBA 4H9QA 3AYWB 5AV5D 3UT9C 3AZMA 4ZUXC 5AV8B 5JRGD 5B2JB 3AN2A 1P34C 1P3AD 3X1UC 3AZNC 1TZYD 3X1VC 1BFMA 1Q9CA 4G92B 4R8PB 3WA9A 3AZHB 2DQNC 1ID3A 4J8VB 3MNNB 5BNVB 3C1CD 3REKC 3KWQC 3UTBC 3LZ0B 1A7WA 2XD5A 5KDMA 3LELC 3AZEB 3IP4C 5E5AD 3WTPD 1KX3C 3REJA 4LD9B 3AZJA 2ZY2A 4Z66C 5CPID 2LY8A 5GT3A 1P3OB 4UUZA 5GT0C 4ZUXA 5B0YB 3O62A 2AROA 5B31C 3X1UA 4WU8B 3B6GD 5B31G 5AV5B
chains in the Genus database with same CATH topology
5JRGB 2NZDD 4J8UD 3UTBA 1P3AB 5BT1D 5B2ID 5B0ZA 4KHAA 1TZYB 5AV9C 2NQBA 3W96C 2JCHA 3TU4D 4YM6D 2FFFB 3H0MC 3C1CB 2RVQC 3R45A 3B0CW 1B6WA 3MGPA 5FUGB 1P3IB 3KUYA 2W8SA 1B67A 1EQZC 4KUDA 5AVCD 3WTPB 3KSYA 3LJAC 3REJD 2YFVA 2YFWB 5BS7C 4YS3A 1U35D 1KX4C 1P3LD 4CSRB 5CPIB 1KX5C 3MGQC 3MGRC 3C1BC 3UT9D 4ZUXD 3AZGA 2XD1A 1P34D 4EO5C 5GSUC 2HIOA 3AZND 5AV9A 3X1VD 3W98A 3B0CT 3B6GB 3KXBB 4H9QB 3REIA 3AZMB 5F99C 3AYWA 3REKD 2Y2PA 3KWQD 2CWEA 4J8UB 2NZDB 5B2IB 5AV8A 5B2JA 1TAFA 3LELD 3NQUB 3MGSC 1EQZA 4R8PA 1KX3D 3AZHA 4YM6B 4Z66D 3MNNA 5CPJC 4Z2MG 3MGRA 5GT0D 1JFIA 3REJB 3AZEA 1U35B 3WAAC 5B31D 1P3LB 4LD9A 3V9RA 2VQRA 3B6FC 3UT9B 5CP6C 4ZUXB 1P3OA 1P34B 5B0YA 4DRBA 5E5AC 3WTPC 3AZNB 3X1VB 4AWLC 3W96D 4CAYB 1HTAA 3REKB 5JA4B 2RVQD 3KWQB 3UTBB 3AZFC 5JRGA 5BO0B 5GXQC 4KHAB 5B32C 5DNNC 3LELB 1P3AA 2F8NG 5B32G 1TZYA 3LJAD 1KX3B 1KX4D 4Z66B 3R45B 1F1EA 1KX5D 3AFAC 3C1CA 4DRAA 3REHC 3MGQD 3C1BD 3B6FA 5FUGA 3A6NC 5GT0B 5CP6A 2Y2JA 5GSUD 5B31B 5E5AA 3WTPA 3TU4C 2YFWA 4CSRA 1M18C 5CPIA 3AZKC 2Y2KA 5F99D 2JSSA 2CV5C 5AVCC 5GXQA 5AV9B 4WZSB 4Z2MH 3MGSD 5G49A 4JJNC 3W96B 3B6GA 3EPKA 1HQ3C 1P3BD 4HGAC 2PYOC 5CPJD 1TAFB 2NZDA 4J8UA 3REHA 2HUEC 5B2IA 1AOIC 1EQZB 3NQUA 3LJAB 3AV1C 3WAAD 1KX4B 4Z5TC 3TU4A 1KX5B 5C3IC 4YM6A 4H9NA 1M18A 3MGQB 3MGRB 3C1BB 1WWIA 3B6FD 3X1SC 5CP6D 2UWXA 1JFIB 4NFTA 4EO5B 4DQYB 4H9SA 5GSUB 5AVCA 3LZ1C 3V9RB 1U35A 5B1MC 2Y2MA 2F8NH 1P3LA 3KFUG 3W99C 5F99B 3B0DC 3UT9A 2PYOA 4QLCD 3AZFD 2F8ND 5DNND 5GXQD 5B32D 1P3FC 4NE6A 1P34A 3AZID 3MGSB 3AZNA 3X1VA 3VH6A 1P3BB 1F66C 4CAYA 5AVBD 4ZBJC 1BH9A 5CPJB 3AFAD 3REKA 5JA4A 3KWQA 3REHD 5BO0A 3A6ND 3LELA 1S32C 3MVDC 2IO5C 3WAAB 4J8WC 1KX3A 4Z66A 1M18D 3B6FB 3AZKD 5CP6B 3A1IA 3RELC 2CV5D 5GT0A 5E5AB 5B31A 4JJND 4AWLB 1HQ3D 4XZQC 1R4VA 2PYOD 3AZFB 2F8NB 5DNNB 5GXQB 5B32B 4J8XC 3AZLC 1AOID 3UTAC 1Z2CB 5G49B 5B40C 1P3GC 3AV1D 3W96A 4Z5TD 4J8WA 3P5JB 4KGCD 3AFAB 3AV2C 3REHB 3X1SD 3A6NB 5AY8C 1ULYA 3LZ1D 3LJAA 3TU4B 1M1AC 5BS7A 2DF4C 5B1LC 1P3BC 5B1MD 1KX4A 5DNMC 4H9NB 1M18B 3WKJC 2G5HC 1KX5A 3AZKB 3W99D 4XZQA 3MGQA 3C1BA 2CV5B 5AVCB 1P3FD 2BYMB 5GSUA 4JJNB 2Y2OA 1P3KC 1HQ3B 1F66D 4WU9C 4HGAB 2PYOB 5F99A 4NE5A 5AV6C 2HUEB 1AOIB 1PZRA 3MGSA 1S32D 3AV1B 2ZY4A 3MVDD 4Z5TB 4J8WD 1BH9B 5C3IB 1N1JB 1P3BA 2FJ7C 3EPHA 5B33C 4QLCC 5CPJA 3FDDA 3X1SB 3AZIC 3A1KA 3RELD 3LZ1B 5B1MB 3WAAA 5AVBC 3X1TC 1P3PD 3W99B 4XZQD 3B0DB 4WU9A 3VH6W 1P3FB 4J8XD 3AZLD 3UTAD 5B40D 1ZLAC 2ZY3A 1P3GD 1F66B 3W97C 4ZBJB 5CPKC 3AV2D 1M19C 4QLCA 4X23C 3AZFA 2F8NA 4NE3A 5DNNA 5B32A 5AY8D 3AZIA 4UPKA 1S32B 3MVDB 2IO5B 4J8WB 1M1AD 3VH6T 5B1LD 4XUJC 3AN2C 5DNMD 5B24C 5AVBA 3WKJD 3AFAA 3RELB 3WA9C 3A6NA 1ID3C 4H9RB 4KGCC 1P3KD 1P3PB 4XZQB 4WU9D 2BG1A 3W97A 3AZKA 2RIQA 4J8XB 5AV6D 2CV5A 3AZLB 3AZJC 3UTAB 2BYMA 5B40B 1T3UA 1P3GB 4JJNA 4G91C 5GT3C 1HQ3A 2FJ7D 3EG5B 4XUJA 3AV2B 3O62C 5B33D 5B24A 2AROC 5CHLB 5AY8B 1AOIA 2Y2NA 2Y2QA 1M1AB 3AV1A 5B1LB 4Z5TA 5DNMB 3X1TD 3WKJB 4KGCA 1N1JA 5B0ZC 5BNXB 1P3ID 2NQBC 3X1SA 1P3MC 3VH5A 3NQJB 4E44A 4H9OB 3LZ1A 1ZLAD 1P3KB 5B1MA 3MGPC 4WU9B 3KUYC 3W97D 2Y2IA 3W99A 5CPKD 4KUDC 1M19D 5AV6B 4X23D 4YS3C 1P3FA 3KXBD 1P3PC 3AZMD 4XUJD 3AN2D 3AZGC 1F66A 2FJ7B 2Y2GA 5B33B 5B24D 4QLCB 2HIOC 2BYKA 3AZIB 3W98C 2Y2HA 3WA9D 3H0RC 1P3MA 1S32A 1ID3D 3REIC 4H9PB 3AYWC 3MVDA 5AVBB 3X1TB 5AV8C 5B2JC 4G92C 3RELA 4R8PC 3AZJD 3AZHC 4J8VC 2ZY5A 3MNNC 1ZLAB 4H9RA 1H3OB 3LZ0C 5GT3D 3EPJA 3W97B 1P3PA 1BH8B 5CPKB 3WTPE 3O62D 1M19B 3AZEC 2AROD 4X23B 3X1UD 4J8XA 4LD9C 3AZLA 1WWSA 1KU5A 4WNNB 3UTAA 5B40A 1P3GA 4XUJB 3B0BA 3AN2B 1P3OC 5B24B 3UTBD 5B0YC 5B0ZD 3AV2A 2NQBD 2JE5A 3WA9B 1P3MD 3H0LC 5AY8A 4WU8C 1ID3B 5AV5C 1M1AA 4KGCB 4J8VA 5B1LA 5BNVA 5JRGC 3MGPD 5DNMA 5KDMB 3F6TA 3WKJA 1W2EA 3LZ0A 3KUYD 1P3AC 5BNXA 1TZYC 4KUDD 3AZJB 4YS3D 3NQJA 3C1CC 4H9OA 4G91B 2F2AC 5GT3B 1P3KA 4UUZB 1P3IC 3AZGD 3O62B 2AROB 4E45A 3X1UB 2HIOD 5AV9D 5AV6A 3W98D 3AL0C 5CPIC 4WJ3C 4WU8A 3REID 3AYWD 5AV5A 3EPLA 3VH5W 5B0ZB 5AV8D 5B2JD 2FJ7A 5B33A 2BYKB 2NQBB 1EQZD 2G5IC 1P3MB 4R8PD 3B6GC 3KXBC 3AZHD 4M6BA 4J8VD 3AZMC 4H9PA 3MNND 3MGPB 2Y2LA 2NZDC 4J8UC 3LZ0D 3KUYB 5BT1C 5B2IC 4WV4B 3MGRD 3X1TA 1P3IA 2J8PA 4KUDB 2F8NK 3AZED 2YFVB 4YS3B 4LD9D 3VH5T 4YM6C 2ZM5A 1ZLAA 1H3OA 3AZGB 1P3OD 1BH8A 5B0YD 5CPKA 4H9SC 2HIOB 1M19A 3REJC 3W98B 4X23A 1U35C 1P3LC 2L5AA 4WNNA 3REIB 4WU8D 3KXBA 4H9QA 3AYWB 5AV5D 3UT9C 3AZMA 4ZUXC 5AV8B 5JRGD 5B2JB 3AN2A 1P34C 1P3AD 3X1UC 3AZNC 1TZYD 3X1VC 1BFMA 1Q9CA 4G92B 4R8PB 3WA9A 3AZHB 2DQNC 1ID3A 4J8VB 3MNNB 5BNVB 3C1CD 3REKC 3KWQC 3UTBC 3LZ0B 1A7WA 2XD5A 5KDMA 3LELC 3AZEB 3IP4C 5E5AD 3WTPD 1KX3C 3REJA 4LD9B 3AZJA 2ZY2A 4Z66C 5CPID 2LY8A 5GT3A 1P3OB 4UUZA 5GT0C 4ZUXA 5B0YB 3O62A 2AROA 5B31C 3X1UA 4WU8B 3B6GD 5B31G 5AV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG B;  2NZD D;  4J8U D;  3UTB A;  1P3A B;  5BT1 D;  5B2I D;  5B0Z A;  4KHA A;  1TZY B;  5AV9 C;  2NQB A;  3W96 C;  3TU4 D;  4YM6 D;  3C1C B;  2RVQ C;  3R45 A;  3B0C W;  1B6W A;  3MGP A;  5FUG B;  1P3I B;  3KUY A;  1EQZ C;  1B67 A;  4KUD A;  5AVC D;  3WTP B;  3KSY A;  3LJA C;  3REJ D;  2YFV A;  2YFW B;  5BS7 C;  4YS3 A;  1U35 D;  1KX4 C;  1P3L D;  4CSR B;  5CPI B;  1KX5 C;  3MGQ C;  3MGR C;  3C1B C;  3UT9 D;  4ZUX D;  3AZG A;  1P34 D;  4EO5 C;  5GSU C;  2HIO A;  3AZN D;  5AV9 A;  3X1V D;  3W98 A;  3B0C T;  3B6G B;  3KXB B;  4H9Q B;  3REI A;  3AZM B;  5F99 C;  3AYW A;  3REK D;  3KWQ D;  2NZD B;  2CWE A;  4J8U B;  5B2I B;  5AV8 A;  5B2J A;  1TAF A;  3LEL D;  3NQU B;  3MGS C;  1EQZ A;  4R8P A;  1KX3 D;  3AZH A;  4YM6 B;  4Z66 D;  3MNN A;  5CPJ C;  4Z2M G;  3MGR A;  5GT0 D;  1JFI A;  3REJ B;  3AZE A;  1U35 B;  3WAA C;  5B31 D;  1P3L B;  4LD9 A;  3V9R A;  3B6F C;  3UT9 B;  5CP6 C;  4ZUX B;  1P3O A;  1P34 B;  5B0Y A;  4DRB A;  5E5A C;  3WTP C;  3AZN B;  3X1V B;  4AWL C;  3W96 D;  4CAY B;  1HTA A;  3REK B;  5JA4 B;  2RVQ D;  3KWQ B;  3UTB B;  3AZF C;  5JRG A;  5BO0 B;  5GXQ C;  4KHA B;  5DNN C;  5B32 C;  3LEL B;  1P3A A;  2F8N G;  5B32 G;  1TZY A;  3LJA D;  1KX3 B;  1KX4 D;  4Z66 B;  3R45 B;  1F1E A;  1KX5 D;  3AFA C;  3C1C A;  4DRA A;  3REH C;  3MGQ D;  3C1B D;  3B6F A;  5FUG A;  3A6N C;  5GT0 B;  5CP6 A;  5GSU D;  5B31 B;  5E5A A;  3WTP A;  3TU4 C;  2YFW A;  4CSR A;  1M18 C;  5CPI A;  3AZK C;  5F99 D;  2JSS A;  2CV5 C;  5AVC C;  5GXQ A;  5AV9 B;  4WZS B;  4Z2M H;  3MGS D;  5G49 A;  4JJN C;  3W96 B;  3B6G A;  1HQ3 C;  1P3B D;  4HGA C;  2PYO C;  5CPJ D;  1TAF B;  2NZD A;  4J8U A;  3REH A;  2HUE C;  5B2I A;  1AOI C;  1EQZ B;  3NQU A;  3LJA B;  3AV1 C;  3WAA D;  1KX4 B;  4Z5T C;  3TU4 A;  1KX5 B;  5C3I C;  4YM6 A;  4H9N A;  1M18 A;  3MGQ B;  3MGR B;  3C1B B;  1WWI A;  3B6F D;  3X1S C;  5CP6 D;  1JFI B;  4NFT A;  4EO5 B;  4H9S A;  5GSU B;  5AVC A;  3LZ1 C;  3V9R B;  1U35 A;  5B1M C;  2F8N H;  1P3L A;  3W99 C;  5F99 B;  3B0D C;  3UT9 A;  2PYO A;  4QLC D;  3AZF D;  2F8N D;  5DNN D;  5GXQ D;  5B32 D;  1P3F C;  4NE6 A;  1P34 A;  3AZI D;  3MGS B;  3AZN A;  3X1V A;  3VH6 A;  1P3B B;  1F66 C;  4CAY A;  5AVB D;  4ZBJ C;  1BH9 A;  5CPJ B;  3AFA D;  3REK A;  5JA4 A;  3KWQ A;  3REH D;  5BO0 A;  3A6N D;  3LEL A;  1S32 C;  3MVD C;  2IO5 C;  3WAA B;  4J8W C;  1KX3 A;  4Z66 A;  1M18 D;  3B6F B;  3AZK D;  5CP6 B;  3REL C;  2CV5 D;  5GT0 A;  5E5A B;  5B31 A;  4JJN D;  4AWL B;  1HQ3 D;  4XZQ C;  1R4V A;  2PYO D;  3AZF B;  2F8N B;  5DNN B;  5GXQ B;  5B32 B;  4J8X C;  3AZL C;  1AOI D;  3UTA C;  5G49 B;  5B40 C;  1P3G C;  3AV1 D;  3W96 A;  4Z5T D;  4J8W A;  4KGC D;  3AFA B;  3AV2 C;  3REH B;  3X1S D;  3A6N B;  5AY8 C;  1ULY A;  3LZ1 D;  3LJA A;  3TU4 B;  1M1A C;  5BS7 A;  5B1L C;  1P3B C;  5B1M D;  1KX4 A;  5DNM C;  4H9N B;  1M18 B;  3WKJ C;  1KX5 A;  3AZK B;  3W99 D;  4XZQ A;  3MGQ A;  3C1B A;  2CV5 B;  5AVC B;  1P3F D;  2BYM B;  5GSU A;  4JJN B;  1P3K C;  1HQ3 B;  1F66 D;  4WU9 C;  4HGA B;  2PYO B;  5F99 A;  4NE5 A;  5AV6 C;  2HUE B;  1AOI B;  3MGS A;  1S32 D;  3AV1 B;  3MVD D;  4Z5T B;  4J8W D;  1BH9 B;  5C3I B;  1N1J B;  1P3B A;  2FJ7 C;  5B33 C;  4QLC C;  5CPJ A;  3X1S B;  3AZI C;  3REL D;  3LZ1 B;  5B1M B;  3WAA A;  5AVB C;  3X1T C;  1P3P D;  3W99 B;  4XZQ D;  3B0D B;  4WU9 A;  3VH6 W;  1P3F B;  4J8X D;  3AZL D;  3UTA D;  5B40 D;  1ZLA C;  1P3G D;  1F66 B;  3W97 C;  4ZBJ B;  5CPK C;  3AV2 D;  1M19 C;  4QLC A;  4X23 C;  3AZF A;  2F8N A;  4NE3 A;  5DNN A;  5B32 A;  5AY8 D;  3AZI A;  1S32 B;  3MVD B;  2IO5 B;  4J8W B;  1M1A D;  3VH6 T;  5B1L D;  4XUJ C;  3AN2 C;  5DNM D;  5B24 C;  5AVB A;  3WKJ D;  3AFA A;  3REL B;  3WA9 C;  3A6N A;  1ID3 C;  4H9R B;  4KGC C;  1P3K D;  1P3P B;  4XZQ B;  4WU9 D;  3W97 A;  3AZK A;  4J8X B;  5AV6 D;  2CV5 A;  3AZL B;  3AZJ C;  3UTA B;  2BYM A;  5B40 B;  1P3G B;  4JJN A;  4G91 C;  5GT3 C;  1HQ3 A;  2FJ7 D;  4XUJ A;  3AV2 B;  3O62 C;  5B33 D;  5B24 A;  2ARO C;  5CHL B;  5AY8 B;  1AOI A;  1M1A B;  3AV1 A;  5B1L B;  4Z5T A;  5DNM B;  3X1T D;  3WKJ B;  4KGC A;  1N1J A;  5B0Z C;  5BNX B;  1P3I D;  2NQB C;  3X1S A;  1P3M C;  3VH5 A;  3NQJ B;  4E44 A;  4H9O B;  3LZ1 A;  1ZLA D;  1P3K B;  5B1M A;  3MGP C;  4WU9 B;  3KUY C;  3W97 D;  3W99 A;  5CPK D;  4KUD C;  1M19 D;  5AV6 B;  4X23 D;  4YS3 C;  1P3F A;  3KXB D;  1P3P C;  3AZM D;  4XUJ D;  3AN2 D;  3AZG C;  1F66 A;  2FJ7 B;  5B33 B;  5B24 D;  4QLC B;  2HIO C;  2BYK A;  3AZI B;  3W98 C;  3WA9 D;  1P3M A;  1S32 A;  1ID3 D;  3REI C;  4H9P B;  3AYW C;  3MVD A;  5AVB B;  3X1T B;  5AV8 C;  5B2J C;  4G92 C;  3REL A;  4R8P C;  3AZJ D;  3AZH C;  4J8V C;  1ZLA B;  3MNN C;  4H9R A;  1H3O B;  3LZ0 C;  5GT3 D;  3W97 B;  1P3P A;  1BH8 B;  5CPK B;  3WTP E;  3O62 D;  1M19 B;  3AZE C;  2ARO D;  4X23 B;  3X1U D;  4J8X A;  4LD9 C;  3AZL A;  1WWS A;  1KU5 A;  4WNN B;  3UTA A;  5B40 A;  1P3G A;  4XUJ B;  3B0B A;  3AN2 B;  1P3O C;  5B24 B;  3UTB D;  5B0Y C;  5B0Z D;  3AV2 A;  2NQB D;  3WA9 B;  1P3M D;  5AY8 A;  4WU8 C;  1ID3 B;  5AV5 C;  1M1A A;  4KGC B;  4J8V A;  5B1L A;  5BNV A;  5JRG C;  3MGP D;  5DNM A;  5KDM B;  3WKJ A;  3LZ0 A;  3KUY D;  1P3A C;  5BNX A;  1TZY C;  4KUD D;  3AZJ B;  4YS3 D;  3NQJ A;  3C1C C;  4H9O A;  4G91 B;  5GT3 B;  1P3K A;  4UUZ B;  1P3I C;  3AZG D;  3O62 B;  2ARO B;  4E45 A;  3X1U B;  2HIO D;  5AV9 D;  5AV6 A;  3W98 D;  5CPI C;  4WU8 A;  3REI D;  3AYW D;  5AV5 A;  3VH5 W;  5B0Z B;  5AV8 D;  5B2J D;  2FJ7 A;  5B33 A;  2BYK B;  2NQB B;  1EQZ D;  1P3M B;  4R8P D;  3B6G C;  3KXB C;  3AZH D;  4M6B A;  4J8V D;  3AZM C;  4H9P A;  3MNN D;  3MGP B;  2NZD C;  4J8U C;  3LZ0 D;  3KUY B;  5BT1 C;  5B2I C;  4WV4 B;  3MGR D;  3X1T A;  1P3I A;  4KUD B;  2F8N K;  3AZE D;  2YFV B;  4YS3 B;  4LD9 D;  3VH5 T;  4YM6 C;  1ZLA A;  1H3O A;  3AZG B;  1P3O D;  1BH8 A;  5B0Y D;  5CPK A;  4H9S C;  2HIO B;  1M19 A;  3REJ C;  3W98 B;  4X23 A;  1U35 C;  1P3L C;  2L5A A;  4WNN A;  3REI B;  4WU8 D;  3KXB A;  4H9Q A;  3AYW B;  5AV5 D;  3UT9 C;  3AZM A;  4ZUX C;  5AV8 B;  5JRG D;  5B2J B;  3AN2 A;  1P34 C;  1P3A D;  3X1U C;  3AZN C;  1TZY D;  3X1V C;  1BFM A;  1Q9C A;  4G92 B;  4R8P B;  3WA9 A;  3AZH B;  1ID3 A;  4J8V B;  3MNN B;  5BNV B;  3C1C D;  3REK C;  3KWQ C;  3UTB C;  3LZ0 B;  1A7W A;  5KDM A;  3LEL C;  3AZE B;  5E5A D;  3WTP D;  1KX3 C;  3REJ A;  4LD9 B;  3AZJ A;  4Z66 C;  5CPI D;  2LY8 A;  5GT3 A;  1P3O B;  4UUZ A;  5GT0 C;  4ZUX A;  5B0Y B;  3O62 A;  2ARO A;  5B31 C;  3X1U A;  4WU8 B;  3B6G D;  5B31 G;  5AV5 B; 
#chains in the Genus database with same CATH topology
 5JRG B;  2NZD D;  4J8U D;  3UTB A;  1P3A B;  5BT1 D;  5B2I D;  5B0Z A;  4KHA A;  1TZY B;  5AV9 C;  2NQB A;  3W96 C;  2JCH A;  3TU4 D;  4YM6 D;  2FFF B;  3H0M C;  3C1C B;  2RVQ C;  3R45 A;  3B0C W;  1B6W A;  3MGP A;  5FUG B;  1P3I B;  3KUY A;  2W8S A;  1B67 A;  1EQZ C;  4KUD A;  5AVC D;  3WTP B;  3KSY A;  3LJA C;  3REJ D;  2YFV A;  2YFW B;  5BS7 C;  4YS3 A;  1U35 D;  1KX4 C;  1P3L D;  4CSR B;  5CPI B;  1KX5 C;  3MGQ C;  3MGR C;  3C1B C;  3UT9 D;  4ZUX D;  3AZG A;  2XD1 A;  1P34 D;  4EO5 C;  5GSU C;  2HIO A;  3AZN D;  5AV9 A;  3X1V D;  3W98 A;  3B0C T;  3B6G B;  3KXB B;  4H9Q B;  3REI A;  3AZM B;  5F99 C;  3AYW A;  3REK D;  2Y2P A;  3KWQ D;  2CWE A;  4J8U B;  2NZD B;  5B2I B;  5AV8 A;  5B2J A;  1TAF A;  3LEL D;  3NQU B;  3MGS C;  1EQZ A;  4R8P A;  1KX3 D;  3AZH A;  4YM6 B;  4Z66 D;  3MNN A;  5CPJ C;  4Z2M G;  3MGR A;  5GT0 D;  1JFI A;  3REJ B;  3AZE A;  1U35 B;  3WAA C;  5B31 D;  1P3L B;  4LD9 A;  3V9R A;  2VQR A;  3B6F C;  3UT9 B;  5CP6 C;  4ZUX B;  1P3O A;  1P34 B;  5B0Y A;  4DRB A;  5E5A C;  3WTP C;  3AZN B;  3X1V B;  4AWL C;  3W96 D;  4CAY B;  1HTA A;  3REK B;  5JA4 B;  2RVQ D;  3KWQ B;  3UTB B;  3AZF C;  5JRG A;  5BO0 B;  5GXQ C;  4KHA B;  5B32 C;  5DNN C;  3LEL B;  1P3A A;  2F8N G;  5B32 G;  1TZY A;  3LJA D;  1KX3 B;  1KX4 D;  4Z66 B;  3R45 B;  1F1E A;  1KX5 D;  3AFA C;  3C1C A;  4DRA A;  3REH C;  3MGQ D;  3C1B D;  3B6F A;  5FUG A;  3A6N C;  5GT0 B;  5CP6 A;  2Y2J A;  5GSU D;  5B31 B;  5E5A A;  3WTP A;  3TU4 C;  2YFW A;  4CSR A;  1M18 C;  5CPI A;  3AZK C;  2Y2K A;  5F99 D;  2JSS A;  2CV5 C;  5AVC C;  5GXQ A;  5AV9 B;  4WZS B;  4Z2M H;  3MGS D;  5G49 A;  4JJN C;  3W96 B;  3B6G A;  3EPK A;  1HQ3 C;  1P3B D;  4HGA C;  2PYO C;  5CPJ D;  1TAF B;  2NZD A;  4J8U A;  3REH A;  2HUE C;  5B2I A;  1AOI C;  1EQZ B;  3NQU A;  3LJA B;  3AV1 C;  3WAA D;  1KX4 B;  4Z5T C;  3TU4 A;  1KX5 B;  5C3I C;  4YM6 A;  4H9N A;  1M18 A;  3MGQ B;  3MGR B;  3C1B B;  1WWI A;  3B6F D;  3X1S C;  5CP6 D;  2UWX A;  1JFI B;  4NFT A;  4EO5 B;  4DQY B;  4H9S A;  5GSU B;  5AVC A;  3LZ1 C;  3V9R B;  1U35 A;  5B1M C;  2Y2M A;  2F8N H;  1P3L A;  3KFU G;  3W99 C;  5F99 B;  3B0D C;  3UT9 A;  2PYO A;  4QLC D;  3AZF D;  2F8N D;  5DNN D;  5GXQ D;  5B32 D;  1P3F C;  4NE6 A;  1P34 A;  3AZI D;  3MGS B;  3AZN A;  3X1V A;  3VH6 A;  1P3B B;  1F66 C;  4CAY A;  5AVB D;  4ZBJ C;  1BH9 A;  5CPJ B;  3AFA D;  3REK A;  5JA4 A;  3KWQ A;  3REH D;  5BO0 A;  3A6N D;  3LEL A;  1S32 C;  3MVD C;  2IO5 C;  3WAA B;  4J8W C;  1KX3 A;  4Z66 A;  1M18 D;  3B6F B;  3AZK D;  5CP6 B;  3A1I A;  3REL C;  2CV5 D;  5GT0 A;  5E5A B;  5B31 A;  4JJN D;  4AWL B;  1HQ3 D;  4XZQ C;  1R4V A;  2PYO D;  3AZF B;  2F8N B;  5DNN B;  5GXQ B;  5B32 B;  4J8X C;  3AZL C;  1AOI D;  3UTA C;  1Z2C B;  5G49 B;  5B40 C;  1P3G C;  3AV1 D;  3W96 A;  4Z5T D;  4J8W A;  3P5J B;  4KGC D;  3AFA B;  3AV2 C;  3REH B;  3X1S D;  3A6N B;  5AY8 C;  1ULY A;  3LZ1 D;  3LJA A;  3TU4 B;  1M1A C;  5BS7 A;  2DF4 C;  5B1L C;  1P3B C;  5B1M D;  1KX4 A;  5DNM C;  4H9N B;  1M18 B;  3WKJ C;  2G5H C;  1KX5 A;  3AZK B;  3W99 D;  4XZQ A;  3MGQ A;  3C1B A;  2CV5 B;  5AVC B;  1P3F D;  2BYM B;  5GSU A;  4JJN B;  2Y2O A;  1P3K C;  1HQ3 B;  1F66 D;  4WU9 C;  4HGA B;  2PYO B;  5F99 A;  4NE5 A;  5AV6 C;  2HUE B;  1AOI B;  1PZR A;  3MGS A;  1S32 D;  3AV1 B;  2ZY4 A;  3MVD D;  4Z5T B;  4J8W D;  1BH9 B;  5C3I B;  1N1J B;  1P3B A;  2FJ7 C;  3EPH A;  5B33 C;  4QLC C;  5CPJ A;  3FDD A;  3X1S B;  3AZI C;  3A1K A;  3REL D;  3LZ1 B;  5B1M B;  3WAA A;  5AVB C;  3X1T C;  1P3P D;  3W99 B;  4XZQ D;  3B0D B;  4WU9 A;  3VH6 W;  1P3F B;  4J8X D;  3AZL D;  3UTA D;  5B40 D;  1ZLA C;  2ZY3 A;  1P3G D;  1F66 B;  3W97 C;  4ZBJ B;  5CPK C;  3AV2 D;  1M19 C;  4QLC A;  4X23 C;  3AZF A;  2F8N A;  4NE3 A;  5DNN A;  5B32 A;  5AY8 D;  3AZI A;  4UPK A;  1S32 B;  3MVD B;  2IO5 B;  4J8W B;  1M1A D;  3VH6 T;  5B1L D;  4XUJ C;  3AN2 C;  5DNM D;  5B24 C;  5AVB A;  3WKJ D;  3AFA A;  3REL B;  3WA9 C;  3A6N A;  1ID3 C;  4H9R B;  4KGC C;  1P3K D;  1P3P B;  4XZQ B;  4WU9 D;  2BG1 A;  3W97 A;  3AZK A;  2RIQ A;  4J8X B;  5AV6 D;  2CV5 A;  3AZL B;  3AZJ C;  3UTA B;  2BYM A;  5B40 B;  1T3U A;  1P3G B;  4JJN A;  4G91 C;  5GT3 C;  1HQ3 A;  2FJ7 D;  3EG5 B;  4XUJ A;  3AV2 B;  3O62 C;  5B33 D;  5B24 A;  2ARO C;  5CHL B;  5AY8 B;  1AOI A;  2Y2N A;  2Y2Q A;  1M1A B;  3AV1 A;  5B1L B;  4Z5T A;  5DNM B;  3X1T D;  3WKJ B;  4KGC A;  1N1J A;  5B0Z C;  5BNX B;  1P3I D;  2NQB C;  3X1S A;  1P3M C;  3VH5 A;  3NQJ B;  4E44 A;  4H9O B;  3LZ1 A;  1ZLA D;  1P3K B;  5B1M A;  3MGP C;  4WU9 B;  3KUY C;  3W97 D;  2Y2I A;  3W99 A;  5CPK D;  4KUD C;  1M19 D;  5AV6 B;  4X23 D;  4YS3 C;  1P3F A;  3KXB D;  1P3P C;  3AZM D;  4XUJ D;  3AN2 D;  3AZG C;  1F66 A;  2FJ7 B;  2Y2G A;  5B33 B;  5B24 D;  4QLC B;  2HIO C;  2BYK A;  3AZI B;  3W98 C;  2Y2H A;  3WA9 D;  3H0R C;  1P3M A;  1S32 A;  1ID3 D;  3REI C;  4H9P B;  3AYW C;  3MVD A;  5AVB B;  3X1T B;  5AV8 C;  5B2J C;  4G92 C;  3REL A;  4R8P C;  3AZJ D;  3AZH C;  4J8V C;  2ZY5 A;  3MNN C;  1ZLA B;  4H9R A;  1H3O B;  3LZ0 C;  5GT3 D;  3EPJ A;  3W97 B;  1P3P A;  1BH8 B;  5CPK B;  3WTP E;  3O62 D;  1M19 B;  3AZE C;  2ARO D;  4X23 B;  3X1U D;  4J8X A;  4LD9 C;  3AZL A;  1WWS A;  1KU5 A;  4WNN B;  3UTA A;  5B40 A;  1P3G A;  4XUJ B;  3B0B A;  3AN2 B;  1P3O C;  5B24 B;  3UTB D;  5B0Y C;  5B0Z D;  3AV2 A;  2NQB D;  2JE5 A;  3WA9 B;  1P3M D;  3H0L C;  5AY8 A;  4WU8 C;  1ID3 B;  5AV5 C;  1M1A A;  4KGC B;  4J8V A;  5B1L A;  5BNV A;  5JRG C;  3MGP D;  5DNM A;  5KDM B;  3F6T A;  3WKJ A;  1W2E A;  3LZ0 A;  3KUY D;  1P3A C;  5BNX A;  1TZY C;  4KUD D;  3AZJ B;  4YS3 D;  3NQJ A;  3C1C C;  4H9O A;  4G91 B;  2F2A C;  5GT3 B;  1P3K A;  4UUZ B;  1P3I C;  3AZG D;  3O62 B;  2ARO B;  4E45 A;  3X1U B;  2HIO D;  5AV9 D;  5AV6 A;  3W98 D;  3AL0 C;  5CPI C;  4WJ3 C;  4WU8 A;  3REI D;  3AYW D;  5AV5 A;  3EPL A;  3VH5 W;  5B0Z B;  5AV8 D;  5B2J D;  2FJ7 A;  5B33 A;  2BYK B;  2NQB B;  1EQZ D;  2G5I C;  1P3M B;  4R8P D;  3B6G C;  3KXB C;  3AZH D;  4M6B A;  4J8V D;  3AZM C;  4H9P A;  3MNN D;  3MGP B;  2Y2L A;  2NZD C;  4J8U C;  3LZ0 D;  3KUY B;  5BT1 C;  5B2I C;  4WV4 B;  3MGR D;  3X1T A;  1P3I A;  2J8P A;  4KUD B;  2F8N K;  3AZE D;  2YFV B;  4YS3 B;  4LD9 D;  3VH5 T;  4YM6 C;  2ZM5 A;  1ZLA A;  1H3O A;  3AZG B;  1P3O D;  1BH8 A;  5B0Y D;  5CPK A;  4H9S C;  2HIO B;  1M19 A;  3REJ C;  3W98 B;  4X23 A;  1U35 C;  1P3L C;  2L5A A;  4WNN A;  3REI B;  4WU8 D;  3KXB A;  4H9Q A;  3AYW B;  5AV5 D;  3UT9 C;  3AZM A;  4ZUX C;  5AV8 B;  5JRG D;  5B2J B;  3AN2 A;  1P34 C;  1P3A D;  3X1U C;  3AZN C;  1TZY D;  3X1V C;  1BFM A;  1Q9C A;  4G92 B;  4R8P B;  3WA9 A;  3AZH B;  2DQN C;  1ID3 A;  4J8V B;  3MNN B;  5BNV B;  3C1C D;  3REK C;  3KWQ C;  3UTB C;  3LZ0 B;  1A7W A;  2XD5 A;  5KDM A;  3LEL C;  3AZE B;  3IP4 C;  5E5A D;  3WTP D;  1KX3 C;  3REJ A;  4LD9 B;  3AZJ A;  2ZY2 A;  4Z66 C;  5CPI D;  2LY8 A;  5GT3 A;  1P3O B;  4UUZ A;  5GT0 C;  4ZUX A;  5B0Y B;  3O62 A;  2ARO A;  5B31 C;  3X1U A;  4WU8 B;  3B6G D;  5B31 G;  5AV5 B; 
#chains in the Genus database with same CATH homology
 5JRG B;  2NZD D;  4J8U D;  3UTB A;  1P3A B;  5BT1 D;  5B2I D;  5B0Z A;  4KHA A;  1TZY B;  5AV9 C;  2NQB A;  3W96 C;  2JCH A;  3TU4 D;  4YM6 D;  2FFF B;  3H0M C;  3C1C B;  2RVQ C;  3R45 A;  3B0C W;  1B6W A;  3MGP A;  5FUG B;  1P3I B;  3KUY A;  2W8S A;  1B67 A;  1EQZ C;  4KUD A;  5AVC D;  3WTP B;  3KSY A;  3LJA C;  3REJ D;  2YFV A;  2YFW B;  5BS7 C;  4YS3 A;  1U35 D;  1KX4 C;  1P3L D;  4CSR B;  5CPI B;  1KX5 C;  3MGQ C;  3MGR C;  3C1B C;  3UT9 D;  4ZUX D;  3AZG A;  2XD1 A;  1P34 D;  4EO5 C;  5GSU C;  2HIO A;  3AZN D;  5AV9 A;  3X1V D;  3W98 A;  3B0C T;  3B6G B;  3KXB B;  4H9Q B;  3REI A;  3AZM B;  5F99 C;  3AYW A;  3REK D;  2Y2P A;  3KWQ D;  2CWE A;  4J8U B;  2NZD B;  5B2I B;  5AV8 A;  5B2J A;  1TAF A;  3LEL D;  3NQU B;  3MGS C;  1EQZ A;  4R8P A;  1KX3 D;  3AZH A;  4YM6 B;  4Z66 D;  3MNN A;  5CPJ C;  4Z2M G;  3MGR A;  5GT0 D;  1JFI A;  3REJ B;  3AZE A;  1U35 B;  3WAA C;  5B31 D;  1P3L B;  4LD9 A;  3V9R A;  2VQR A;  3B6F C;  3UT9 B;  5CP6 C;  4ZUX B;  1P3O A;  1P34 B;  5B0Y A;  4DRB A;  5E5A C;  3WTP C;  3AZN B;  3X1V B;  4AWL C;  3W96 D;  4CAY B;  1HTA A;  3REK B;  5JA4 B;  2RVQ D;  3KWQ B;  3UTB B;  3AZF C;  5JRG A;  5BO0 B;  5GXQ C;  4KHA B;  5B32 C;  5DNN C;  3LEL B;  1P3A A;  2F8N G;  5B32 G;  1TZY A;  3LJA D;  1KX3 B;  1KX4 D;  4Z66 B;  3R45 B;  1F1E A;  1KX5 D;  3AFA C;  3C1C A;  4DRA A;  3REH C;  3MGQ D;  3C1B D;  3B6F A;  5FUG A;  3A6N C;  5GT0 B;  5CP6 A;  2Y2J A;  5GSU D;  5B31 B;  5E5A A;  3WTP A;  3TU4 C;  2YFW A;  4CSR A;  1M18 C;  5CPI A;  3AZK C;  2Y2K A;  5F99 D;  2JSS A;  2CV5 C;  5AVC C;  5GXQ A;  5AV9 B;  4WZS B;  4Z2M H;  3MGS D;  5G49 A;  4JJN C;  3W96 B;  3B6G A;  3EPK A;  1HQ3 C;  1P3B D;  4HGA C;  2PYO C;  5CPJ D;  1TAF B;  2NZD A;  4J8U A;  3REH A;  2HUE C;  5B2I A;  1AOI C;  1EQZ B;  3NQU A;  3LJA B;  3AV1 C;  3WAA D;  1KX4 B;  4Z5T C;  3TU4 A;  1KX5 B;  5C3I C;  4YM6 A;  4H9N A;  1M18 A;  3MGQ B;  3MGR B;  3C1B B;  1WWI A;  3B6F D;  3X1S C;  5CP6 D;  2UWX A;  1JFI B;  4NFT A;  4EO5 B;  4DQY B;  4H9S A;  5GSU B;  5AVC A;  3LZ1 C;  3V9R B;  1U35 A;  5B1M C;  2Y2M A;  2F8N H;  1P3L A;  3KFU G;  3W99 C;  5F99 B;  3B0D C;  3UT9 A;  2PYO A;  4QLC D;  3AZF D;  2F8N D;  5DNN D;  5GXQ D;  5B32 D;  1P3F C;  4NE6 A;  1P34 A;  3AZI D;  3MGS B;  3AZN A;  3X1V A;  3VH6 A;  1P3B B;  1F66 C;  4CAY A;  5AVB D;  4ZBJ C;  1BH9 A;  5CPJ B;  3AFA D;  3REK A;  5JA4 A;  3KWQ A;  3REH D;  5BO0 A;  3A6N D;  3LEL A;  1S32 C;  3MVD C;  2IO5 C;  3WAA B;  4J8W C;  1KX3 A;  4Z66 A;  1M18 D;  3B6F B;  3AZK D;  5CP6 B;  3A1I A;  3REL C;  2CV5 D;  5GT0 A;  5E5A B;  5B31 A;  4JJN D;  4AWL B;  1HQ3 D;  4XZQ C;  1R4V A;  2PYO D;  3AZF B;  2F8N B;  5DNN B;  5GXQ B;  5B32 B;  4J8X C;  3AZL C;  1AOI D;  3UTA C;  1Z2C B;  5G49 B;  5B40 C;  1P3G C;  3AV1 D;  3W96 A;  4Z5T D;  4J8W A;  3P5J B;  4KGC D;  3AFA B;  3AV2 C;  3REH B;  3X1S D;  3A6N B;  5AY8 C;  1ULY A;  3LZ1 D;  3LJA A;  3TU4 B;  1M1A C;  5BS7 A;  2DF4 C;  5B1L C;  1P3B C;  5B1M D;  1KX4 A;  5DNM C;  4H9N B;  1M18 B;  3WKJ C;  2G5H C;  1KX5 A;  3AZK B;  3W99 D;  4XZQ A;  3MGQ A;  3C1B A;  2CV5 B;  5AVC B;  1P3F D;  2BYM B;  5GSU A;  4JJN B;  2Y2O A;  1P3K C;  1HQ3 B;  1F66 D;  4WU9 C;  4HGA B;  2PYO B;  5F99 A;  4NE5 A;  5AV6 C;  2HUE B;  1AOI B;  1PZR A;  3MGS A;  1S32 D;  3AV1 B;  2ZY4 A;  3MVD D;  4Z5T B;  4J8W D;  1BH9 B;  5C3I B;  1N1J B;  1P3B A;  2FJ7 C;  3EPH A;  5B33 C;  4QLC C;  5CPJ A;  3FDD A;  3X1S B;  3AZI C;  3A1K A;  3REL D;  3LZ1 B;  5B1M B;  3WAA A;  5AVB C;  3X1T C;  1P3P D;  3W99 B;  4XZQ D;  3B0D B;  4WU9 A;  3VH6 W;  1P3F B;  4J8X D;  3AZL D;  3UTA D;  5B40 D;  1ZLA C;  2ZY3 A;  1P3G D;  1F66 B;  3W97 C;  4ZBJ B;  5CPK C;  3AV2 D;  1M19 C;  4QLC A;  4X23 C;  3AZF A;  2F8N A;  4NE3 A;  5DNN A;  5B32 A;  5AY8 D;  3AZI A;  4UPK A;  1S32 B;  3MVD B;  2IO5 B;  4J8W B;  1M1A D;  3VH6 T;  5B1L D;  4XUJ C;  3AN2 C;  5DNM D;  5B24 C;  5AVB A;  3WKJ D;  3AFA A;  3REL B;  3WA9 C;  3A6N A;  1ID3 C;  4H9R B;  4KGC C;  1P3K D;  1P3P B;  4XZQ B;  4WU9 D;  2BG1 A;  3W97 A;  3AZK A;  2RIQ A;  4J8X B;  5AV6 D;  2CV5 A;  3AZL B;  3AZJ C;  3UTA B;  2BYM A;  5B40 B;  1T3U A;  1P3G B;  4JJN A;  4G91 C;  5GT3 C;  1HQ3 A;  2FJ7 D;  3EG5 B;  4XUJ A;  3AV2 B;  3O62 C;  5B33 D;  5B24 A;  2ARO C;  5CHL B;  5AY8 B;  1AOI A;  2Y2N A;  2Y2Q A;  1M1A B;  3AV1 A;  5B1L B;  4Z5T A;  5DNM B;  3X1T D;  3WKJ B;  4KGC A;  1N1J A;  5B0Z C;  5BNX B;  1P3I D;  2NQB C;  3X1S A;  1P3M C;  3VH5 A;  3NQJ B;  4E44 A;  4H9O B;  3LZ1 A;  1ZLA D;  1P3K B;  5B1M A;  3MGP C;  4WU9 B;  3KUY C;  3W97 D;  2Y2I A;  3W99 A;  5CPK D;  4KUD C;  1M19 D;  5AV6 B;  4X23 D;  4YS3 C;  1P3F A;  3KXB D;  1P3P C;  3AZM D;  4XUJ D;  3AN2 D;  3AZG C;  1F66 A;  2FJ7 B;  2Y2G A;  5B33 B;  5B24 D;  4QLC B;  2HIO C;  2BYK A;  3AZI B;  3W98 C;  2Y2H A;  3WA9 D;  3H0R C;  1P3M A;  1S32 A;  1ID3 D;  3REI C;  4H9P B;  3AYW C;  3MVD A;  5AVB B;  3X1T B;  5AV8 C;  5B2J C;  4G92 C;  3REL A;  4R8P C;  3AZJ D;  3AZH C;  4J8V C;  2ZY5 A;  3MNN C;  1ZLA B;  4H9R A;  1H3O B;  3LZ0 C;  5GT3 D;  3EPJ A;  3W97 B;  1P3P A;  1BH8 B;  5CPK B;  3WTP E;  3O62 D;  1M19 B;  3AZE C;  2ARO D;  4X23 B;  3X1U D;  4J8X A;  4LD9 C;  3AZL A;  1WWS A;  1KU5 A;  4WNN B;  3UTA A;  5B40 A;  1P3G A;  4XUJ B;  3B0B A;  3AN2 B;  1P3O C;  5B24 B;  3UTB D;  5B0Y C;  5B0Z D;  3AV2 A;  2NQB D;  2JE5 A;  3WA9 B;  1P3M D;  3H0L C;  5AY8 A;  4WU8 C;  1ID3 B;  5AV5 C;  1M1A A;  4KGC B;  4J8V A;  5B1L A;  5BNV A;  5JRG C;  3MGP D;  5DNM A;  5KDM B;  3F6T A;  3WKJ A;  1W2E A;  3LZ0 A;  3KUY D;  1P3A C;  5BNX A;  1TZY C;  4KUD D;  3AZJ B;  4YS3 D;  3NQJ A;  3C1C C;  4H9O A;  4G91 B;  2F2A C;  5GT3 B;  1P3K A;  4UUZ B;  1P3I C;  3AZG D;  3O62 B;  2ARO B;  4E45 A;  3X1U B;  2HIO D;  5AV9 D;  5AV6 A;  3W98 D;  3AL0 C;  5CPI C;  4WJ3 C;  4WU8 A;  3REI D;  3AYW D;  5AV5 A;  3EPL A;  3VH5 W;  5B0Z B;  5AV8 D;  5B2J D;  2FJ7 A;  5B33 A;  2BYK B;  2NQB B;  1EQZ D;  2G5I C;  1P3M B;  4R8P D;  3B6G C;  3KXB C;  3AZH D;  4M6B A;  4J8V D;  3AZM C;  4H9P A;  3MNN D;  3MGP B;  2Y2L A;  2NZD C;  4J8U C;  3LZ0 D;  3KUY B;  5BT1 C;  5B2I C;  4WV4 B;  3MGR D;  3X1T A;  1P3I A;  2J8P A;  4KUD B;  2F8N K;  3AZE D;  2YFV B;  4YS3 B;  4LD9 D;  3VH5 T;  4YM6 C;  2ZM5 A;  1ZLA A;  1H3O A;  3AZG B;  1P3O D;  1BH8 A;  5B0Y D;  5CPK A;  4H9S C;  2HIO B;  1M19 A;  3REJ C;  3W98 B;  4X23 A;  1U35 C;  1P3L C;  2L5A A;  4WNN A;  3REI B;  4WU8 D;  3KXB A;  4H9Q A;  3AYW B;  5AV5 D;  3UT9 C;  3AZM A;  4ZUX C;  5AV8 B;  5JRG D;  5B2J B;  3AN2 A;  1P34 C;  1P3A D;  3X1U C;  3AZN C;  1TZY D;  3X1V C;  1BFM A;  1Q9C A;  4G92 B;  4R8P B;  3WA9 A;  3AZH B;  2DQN C;  1ID3 A;  4J8V B;  3MNN B;  5BNV B;  3C1C D;  3REK C;  3KWQ C;  3UTB C;  3LZ0 B;  1A7W A;  2XD5 A;  5KDM A;  3LEL C;  3AZE B;  3IP4 C;  5E5A D;  3WTP D;  1KX3 C;  3REJ A;  4LD9 B;  3AZJ A;  2ZY2 A;  4Z66 C;  5CPI D;  2LY8 A;  5GT3 A;  1P3O B;  4UUZ A;  5GT0 C;  4ZUX A;  5B0Y B;  3O62 A;  2ARO A;  5B31 C;  3X1U A;  4WU8 B;  3B6G D;  5B31 G;  5AV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...