5CHLB

Structural basis of h2a.z recognition by yl1 histone chaperone component of srcap/swr1 chromatin remodeling complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Vacuolar protein sorting-associated protein 72 homolog
publication title Structural basis of H2A.Z recognition by SRCAP chromatin-remodeling subunit YL1
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 69
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5chlB00
3UTAC 5AVBB 2JSSA 2CV5B 4JJNA 4NE6A 1Q9CA 5AVCA 5GT0D 3X1UA 4H9PA 3REHC 3W96A 3MVDA 4NE3A 5AV8D 2FJ7B 3WKJC 3AZHD 4ZUXD 3AYWA 3KWQA 1JFIA 2PYOA 2AROB 1F1EA 4YS3A 4J8XB 1ZLAC 5AVBA 2CV5A 2NZDB 2IO5C 4YM6D 3AZJD 5BS7C 1P3KD 3X1SB 3A6NC 5B0ZA 5CP6C 2BYKB 2F8ND 4EO5C 1P3MC 1TZYD 5B32B 2FJ7A 3B0DB 5C3IC 5AV5D 5AV6B 1U35A 5BT1C 1P3PB 5AVCC 2YFVB 4XUJA 5B24B 3X1UC 3KUYC 3MGQB 1M1AB 3W97A 4DRAA 3W96C 4KGCB 4KUDD 3B0CW 3X1SA 4R8PC 5CPJD 3AFAB 3B6FB 3O62B 3AZMB 5AY8D 3W99A 1S32D 1P3GA 2BYKA 4WU9B 1P3AB 4Z66B 5B2ID 1P3BC 3LZ0C 4E45A 4J8WD 1P3FC 1P3PA 2YFVA 5B0ZC 3LZ1B 5DNMD 3MGQA 5GT0C 5GT3D 1WWIA 4KGCA 3REJD 3AZFB 1U35C 3AFAA 5B33B 5AV8C 3LELB 3B6FA 3O62A 3AZMA 4XUJC 3WTPA 4WU9A 1P3AA 1P3ID 4Z66A 4ZUXC 3AZHC 3W97C 3MGPB 3MGRA 1M19B 1KX3A 3UTAB 4YM6C 1AOID 4WNNA 1P3KC 1P3GC 3REHB 5FUGB 1KX5D 1TZYC 1HQ3D 3LELA 3LJAA 3WKJB 3WAAD 5AV5C 3AZED 2F8NG 3AV1D 1ZLAB 3B0CT 4KUDC 2IO5B 4Z5TD 4WZSB 5CPJC 3A6NB 5CP6B 1S32C 3REHA 4J8UD 5B2IC 5FUGA 3MGRC 4EO5B 3C1CD 1KX3C 3KXBD 5DNNA 3AZID 3X1VD 1P3OD 5C3IB 4J8WC 3WKJA 5KDMB 5AVCB 3MNNC 1BH9A 3VH6W 3X1UB 4H9PB 5DNMC 4WU8D 1ZLAA 5GT3C 3W96B 5CPID 5BS7A 3REJC 1N1JB 4G91C 4R8PB 5B2JD 3A6NA 1ID3D 3AN2D 5CP6A 4JJND 3TU4D 5CPKD 1P3BB 1P3MA 1KX4D 2RVQD 1P3FB 3B6GD 5KDMA 3NQUB 4CAYB 3WA9D 1AOIC 5B0ZB 1B67A 5B31D 3UTBA 3KUYA 5GT0B 4KHAB 3AZND 5DNNC 3AYWD 1N1JA 1U35B 1P3LD 4R8PA 5AV8B 1HQ3C 4XUJB 4H9RB 5AVBD 3AV2C 4ZBJC 2BYMB 4ZUXB 3AZHB 5AV9A 3AZEC 3W97B 1P3BA 3LZ0A 1P34D 3AV1C 3X1TD 3REIC 3RELC 1P3FA 1H3OB 3NQUA 4CAYA 3UT9D 4YM6B 1M18C 3REKD 4Z5TC 1P3KB 1P3GB 3W99B 4XZQD 5GT0A 4KHAA 2F8NB 3C1CC 5B0YD 3KXBC 1TZYB 3AZLD 5AV8A 2AROD 3UTBC 4J8XD 4H9RA 4J8VD 2NZDD 2BYMA 4ZUXA 3AZHA 3VH6T 3AZKD 1F66D 5F99D 2F8NH 5JA4A 4WU8C 1H3OA 5CHLB 1HTAA 4KUDB 4YM6A 3AZJA 1P3KA 3WTPB 5B32D 5CPJB 5B2JC 3VH5W 5AV9C 4QLCD 1ID3C 3AN2C 5AV6D 2F8NA 5B2IB 3MGRB 5B24D 3TU4C 1KX3B 5CPKC 1TZYA 1KX4C 4WNNB 2RVQC 3AZGD 1M1AD 3B6GC 5AV5A 4CSRA 3W98D 3WA9C 5B31C 3MNNB 4Z2MG 1EQZD 5DNMB 4WU9D 5GT3B 3AZNC 4KUDA 3LJAB 3REJB 1P3LC 4G91B 5CPJA 4H9OB 5AY8A 5B31G 1S32A 2NQBD 5B2IA 3LZ1D 1BFMA 5B40D 4DRBA 1P34C 5BNXB 3AZJC 4J8WA 3X1TC 4LD9D 4X23D 3UT9C 1AOIB 3AZFD 4NE5A 3MNNA 3REKC 3B0BA 5B33D 5DNMA 4XZQC 5GSUD 5GT3A 1A7WA 5DNNB 3REJA 3MGPD 5B0YC 3AZLC 1HQ3B 4H9OA 1BH9B 1M19D 3UTAD 3AV2B 4J8VC 4ZBJB 1P3IA 5GXQD 3AZKC 3AZEB 1F66C 5JRGD 5BNXA 5F99C 4UUZB 3C1BD 3AV1B 5B1MD 3REIB 3RELB 3REHD 1AOIA 1M18B 4G92C 4Z5TB 5AY8C 3NQJB 3VH5T 5B32C 3R45A 4QLCC 1P3MB 1KX5A 1HQ3A 3AZGC 1M1AC 2HIOD 3UTBB 3AV2A 3W98C 5B32G 3KUYB 3AZEA 5E5AD 5B1LD 1EQZC 3AV1A 4UUZA 3REIA 3RELA 4WU8B 3MGSD 1M18A 4Z5TA 3NQJA 5B2JB 1P3IC 4NFTA 1ID3B 5AV9B 3AN2B 2NQBC 5BT1D 3LZ0B 5AVCD 4J8UA 3C1CA 4HGAC 3TU4B 3X1UD 5B40C 5CPKB 3KXBA 3AZIA 3X1VA 1P3OA 3B6GB 3W96D 3MVDD 4X23C 4LD9C 2HUEC 5B31B 1KX5C 4WU8A 5GSUC 3AZNB 3KWQD 2PYOD 4YS3D 3WAAC 3MGPC 1P3LB 2CV5D 5B2JA 1ID3A 3AN2A 5BO0A 5GXQC 5B0ZD 5JA4B 3TU4A 5CPKA 1P34B 5JRGC 1KX4A 3AZJB 3C1BC 3X1TB 5B1MC 3B6GA 2FJ7D 3UT9B 3WA9A 5B31A 3REKB 1U35D 4J8UC 4XZQB 4XUJD 5G49B 3AZNA 3AZIC 2YFWB 3X1VC 1P3OC 3W97D 4CSRB 5AV5B 1P3LA 5B0YB 3AZLB 3KSYA 3X1SD 4H9SC 2HIOC 4J8VB 4AWLC 3AZKB 3W99D 1F66B 5E5AC 1P3GD 5B1LC 5F99B 5CPIC 1P34A 3X1TA 4H9NB 3MGSC 3UT9A 4G92B 3REKA 5AY8B 1S32B 2L5AA 4M6BA 1P3PD 4XZQA 4JJNC 4QLCB 5G49A 3MGQD 2YFWA 4J8WB 5B0YA 4KGCD 3AZLA 2AROA 3AZGB 4H9QB 3AFAD 4J8XA 4J8VA 3MVDC 3W98B 2NZDA 3B6FD 3O62D 3AZKA 3AZMD 3WTPD 1F66A 1P3AD 1EQZB 5F99A 4Z66D 3AYWC 5BNVB 4H9NA 3KWQC 2PYOC 3MGRD 4YS3C 1KX3D 5AVBC 5B32A 2CV5C 1P3IB 3WTPE 4QLCA 2NQBB 5AV6A 3VH6A 3MNND 4HGAB 5B24A 5B40B 1WWSA 3AZGA 1M1AA 4H9QA 3W98A 4X23B 2FJ7C 4LD9B 2HUEB 3LJAD 3LELD 3R45B 1EQZA 1KX5B 5BNVA 5GSUB 2AROC 3V9RB 3WAAB 4J8XC 2NZDC 1ULYA 3X1SC 2NQBA 5GXQB 3LZ1A 3W99C 5B40A 5JRGB 3C1BB 5B1MB 2F8NK 4LD9A 4X23A 5DNND 3B0DC 3WKJD 3AZFA 1TAFB 5AV6C 5B33A 1P3PC 1KU5A 4J8UB 3C1CB 5GSUA 5B24C 3AV2D 3KXBB 4E44A 3AZIB 3MGQC 3X1VB 1P3OB 3V9RA 3WAAA 3MGPA 1ZLAD 4KGCC 3REID 3RELD 2HIOB 1M19A 3AFAC 3UTAA 4AWLB 3A6ND 5GXQA 1M18D 3O62C 3B6FC 3AZMC 3WTPC 5E5AB 5CP6D 4WU9C 1P3AC 5B1LB 5CPIB 1R4VA 4Z66C 1BH8B 5JRGA 3C1BA 5B1MA 1P3MD 3MGSB 1TAFA 2CWEA 5BO0B 3LZ1C 4JJNB 3UTBD 1KX4B 3KUYD 3WA9B 2LY8A 3AZFC 4H9SA 1B6WA 2HIOA 4R8PD 3MVDB 5B33C 4Z2MH 3LJAC 3LELC 5E5AA 5B1LA 3VH5A 5CPIA 1BH8A 5AV9D 3AYWB 1P3BD 3LZ0D 3KWQB 3MGSA 1JFIB 2PYOB 1P3FD 4YS3B 4WV4B 1M19C
chains in the Genus database with same CATH superfamily
3UTAC 5AVBB 2JSSA 2CV5B 4JJNA 4NE6A 1Q9CA 5AVCA 5GT0D 3X1UA 4H9PA 3REHC 3W96A 3MVDA 4NE3A 5AV8D 2FJ7B 3WKJC 3H0LC 3P5JB 4ZUXD 3AZHD 3AYWA 3KWQA 1JFIA 2PYOA 2AROB 1F1EA 4YS3A 2F2AC 4J8XB 1ZLAC 5AVBA 2CV5A 2NZDB 2IO5C 4YM6D 3AZJD 5BS7C 1P3KD 3X1SB 3A6NC 5B0ZA 2UWXA 2Y2PA 2ZY3A 5CP6C 2BYKB 2F8ND 2JE5A 4EO5C 4UPKA 1P3MC 1TZYD 5B32B 2FJ7A 3B0DB 5C3IC 5AV5D 5AV6B 1U35A 5BT1C 1P3PB 5AVCC 2YFVB 4XUJA 5B24B 3X1UC 3KUYC 3MGQB 1M1AB 3W97A 4DRAA 3W96C 4KGCB 4KUDD 3B0CW 3X1SA 4R8PC 5CPJD 3AFAB 2Y2GA 3B6FB 3O62B 3AZMB 5AY8D 3W99A 1S32D 1P3GA 2BYKA 4WU9B 1P3AB 4Z66B 5B2ID 1P3BC 3LZ0C 4E45A 4J8WD 2Y2NA 1P3FC 2RIQA 1P3PA 2YFVA 5B0ZC 3LZ1B 5DNMD 3MGQA 5GT0C 5GT3D 1WWIA 4KGCA 1PZRA 3REJD 3AZFB 1U35C 3AFAA 5B33B 5AV8C 3LELB 3B6FA 3O62A 3AZMA 4XUJC 3WTPA 4WU9A 1P3AA 1P3ID 4Z66A 4ZUXC 3AZHC 3W97C 3MGPB 3MGRA 1M19B 1KX3A 3UTAB 4YM6C 1AOID 4WNNA 1P3KC 1P3GC 3REHB 4WJ3C 5FUGB 1KX5D 1TZYC 1HQ3D 3LELA 3LJAA 3WKJB 3WAAD 5AV5C 3AZED 2F8NG 3AV1D 2Y2MA 1ZLAB 3B0CT 4KUDC 2IO5B 4Z5TD 4WZSB 5CPJC 3KFUG 2XD1A 3A6NB 3EPLA 5CP6B 1S32C 3REHA 4J8UD 5B2IC 5FUGA 3MGRC 4EO5B 3C1CD 1KX3C 3KXBD 3H0RC 5DNNA 3AZID 3X1VD 1P3OD 5C3IB 4J8WC 3WKJA 5KDMB 5AVCB 2W8SA 3MNNC 1BH9A 3VH6W 3X1UB 4H9PB 5DNMC 2XD5A 4WU8D 1ZLAA 5GT3C 3W96B 5CPID 5BS7A 3REJC 1N1JB 4G91C 4R8PB 5B2JD 3A6NA 1ID3D 3AN2D 5CP6A 4JJND 3TU4D 5CPKD 1P3BB 1P3MA 1KX4D 2RVQD 1P3FB 3B6GD 5KDMA 3NQUB 4CAYB 3WA9D 1AOIC 5B0ZB 1B67A 5B31D 3EPJA 3UTBA 3KUYA 5GT0B 4KHAB 3AZND 5DNNC 3AYWD 1N1JA 1U35B 1P3LD 4R8PA 5AV8B 1HQ3C 4XUJB 4H9RB 5AVBD 3AV2C 4ZBJC 2BYMB 4ZUXB 3AZHB 5AV9A 3AZEC 3W97B 1P3BA 3LZ0A 1P34D 3AV1C 2Y2HA 3X1TD 3REIC 3RELC 1P3FA 1H3OB 3NQUA 4CAYA 3UT9D 4YM6B 1M18C 3REKD 4Z5TC 1P3KB 1P3GB 3W99B 4XZQD 2DF4C 5GT0A 4KHAA 2F8NB 2Y2IA 3C1CC 5B0YD 3KXBC 1TZYB 3AZLD 5AV8A 2AROD 3UTBC 4J8XD 4H9RA 4J8VD 2NZDD 2BYMA 4ZUXA 3AZHA 3VH6T 3AZKD 1F66D 5F99D 2F8NH 5JA4A 4WU8C 1H3OA 5CHLB 1HTAA 4KUDB 4YM6A 3AZJA 1P3KA 3WTPB 5B32D 5CPJB 5B2JC 3VH5W 3H0MC 4QLCD 5AV9C 1ID3C 3AN2C 5AV6D 2F8NA 5B2IB 3MGRB 5B24D 3TU4C 1KX3B 5CPKC 1TZYA 1KX4C 4WNNB 2RVQC 3AZGD 1M1AD 3B6GC 5AV5A 4CSRA 3W98D 1W2EA 3WA9C 5B31C 3MNNB 4Z2MG 1EQZD 5DNMB 2Y2QA 5GT3B 4WU9D 3AZNC 4KUDA 2FFFB 3LJAB 3REJB 1P3LC 4G91B 5CPJA 4H9OB 2Y2KA 5AY8A 5B31G 1S32A 2NQBD 5B2IA 3LZ1D 1BFMA 5B40D 4DRBA 1P34C 5BNXB 3AZJC 4J8WA 3X1TC 4LD9D 4X23D 3UT9C 1AOIB 3AZFD 4NE5A 3MNNA 3REKC 3B0BA 5B33D 5DNMA 4XZQC 5GSUD 5GT3A 1A7WA 5DNNB 3REJA 3MGPD 5B0YC 3AZLC 1HQ3B 4H9OA 2VQRA 1BH9B 1M19D 3UTAD 3AV2B 4J8VC 4ZBJB 1P3IA 5GXQD 3AZKC 3AZEB 1F66C 5JRGD 5BNXA 5F99C 4UUZB 3C1BD 3AV1B 5B1MD 2J8PA 3REIB 3RELB 3REHD 1AOIA 1M18B 4G92C 4Z5TB 5AY8C 3NQJB 3VH5T 5B32C 3R45A 4QLCC 1P3MB 1KX5A 1HQ3A 3AZGC 1M1AC 2HIOD 3UTBB 3AV2A 3W98C 5B32G 3KUYB 2DQNC 5E5AD 3AZEA 5B1LD 1EQZC 3AV1A 4UUZA 3REIA 3RELA 4WU8B 2G5IC 3MGSD 1M18A 4Z5TA 3NQJA 5B2JB 1P3IC 4NFTA 1ID3B 5AV9B 3AN2B 2NQBC 5BT1D 3LZ0B 2ZM5A 3A1IA 5AVCD 4J8UA 3C1CA 4HGAC 3TU4B 3X1UD 5B40C 5CPKB 3KXBA 3AZIA 3X1VA 1P3OA 3B6GB 3W96D 2ZY4A 4X23C 3MVDD 4LD9C 2HUEC 5B31B 1KX5C 4WU8A 5GSUC 3AZNB 4DQYB 3KWQD 2PYOD 4YS3D 3WAAC 3MGPC 2ZY2A 1P3LB 2CV5D 5B2JA 1ID3A 3AN2A 5BO0A 5GXQC 5B0ZD 5JA4B 3TU4A 5CPKA 1P34B 5JRGC 1KX4A 3AZJB 3C1BC 3X1TB 5B1MC 3B6GA 2FJ7D 2G5HC 3UT9B 3WA9A 5B31A 3REKB 1U35D 4J8UC 4XZQB 4XUJD 5G49B 3AZNA 3AZIC 2YFWB 3X1VC 1P3OC 3W97D 4CSRB 5AV5B 1P3LA 5B0YB 3AZLB 3KSYA 3X1SD 4H9SC 2HIOC 4J8VB 4AWLC 3AZKB 3W99D 1F66B 5E5AC 1P3GD 5B1LC 5CPIC 5F99B 1P34A 3X1TA 4H9NB 3MGSC 3UT9A 4G92B 3REKA 5AY8B 1S32B 2L5AA 4M6BA 1P3PD 2Y2LA 3A1KA 4XZQA 4JJNC 4QLCB 5G49A 3MGQD 2YFWA 4J8WB 5B0YA 4KGCD 3AZLA 2JCHA 2AROA 3AZGB 4H9QB 3AFAD 4J8XA 4J8VA 3MVDC 3W98B 2NZDA 3B6FD 3O62D 3AZKA 3AZMD 3WTPD 3EG5B 1F66A 3EPHA 1P3AD 1EQZB 5F99A 4Z66D 3AYWC 5BNVB 4H9NA 3KWQC 2PYOC 3MGRD 4YS3C 1KX3D 5AVBC 5B32A 2CV5C 1P3IB 3WTPE 4QLCA 2NQBB 5AV6A 3VH6A 3MNND 4HGAB 5B24A 5B40B 1WWSA 3AZGA 1M1AA 4H9QA 3W98A 4X23B 2FJ7C 4LD9B 2HUEB 3LJAD 3LELD 3R45B 2Y2JA 1EQZA 1KX5B 5BNVA 5GSUB 2AROC 3V9RB 3WAAB 4J8XC 2NZDC 1ULYA 3X1SC 2NQBA 3FDDA 5GXQB 3LZ1A 3W99C 3IP4C 1T3UA 5B40A 5JRGB 3C1BB 5B1MB 3F6TA 2F8NK 4LD9A 4X23A 5DNND 3B0DC 3WKJD 3AZFA 1TAFB 5AV6C 5B33A 1P3PC 1KU5A 4J8UB 3C1CB 3AL0C 5GSUA 5B24C 3AV2D 3KXBB 4E44A 3AZIB 3MGQC 3X1VB 1P3OB 3V9RA 3WAAA 3MGPA 1ZLAD 4KGCC 3REID 3RELD 2HIOB 1M19A 3AFAC 3UTAA 4AWLB 3A6ND 5GXQA 3EPKA 3O62C 1M18D 3AZMC 3WTPC 5E5AB 5CP6D 3B6FC 4WU9C 1P3AC 5B1LB 5CPIB 1R4VA 4Z66C 1BH8B 5JRGA 2BG1A 3C1BA 5B1MA 1P3MD 3MGSB 1TAFA 2CWEA 5BO0B 3LZ1C 1Z2CB 4JJNB 3UTBD 1KX4B 3KUYD 2ZY5A 3WA9B 2LY8A 3AZFC 4H9SA 1B6WA 2HIOA 4R8PD 3MVDB 5B33C 4Z2MH 3LJAC 3LELC 2Y2OA 5E5AA 5B1LA 3VH5A 5CPIA 1BH8A 5AV9D 3AYWB 1P3BD 3LZ0D 3KWQB 3MGSA 1JFIB 2PYOB 1P3FD 4YS3B 4WV4B 1M19C
chains in the Genus database with same CATH topology
3UTAC 5AVBB 2JSSA 2CV5B 4JJNA 4NE6A 1Q9CA 5AVCA 5GT0D 3X1UA 4H9PA 3REHC 3W96A 3MVDA 4NE3A 5AV8D 2FJ7B 3WKJC 3H0LC 3P5JB 4ZUXD 3AZHD 3AYWA 3KWQA 1JFIA 2PYOA 2AROB 1F1EA 4YS3A 2F2AC 4J8XB 1ZLAC 5AVBA 2CV5A 2NZDB 2IO5C 4YM6D 3AZJD 5BS7C 1P3KD 3X1SB 3A6NC 5B0ZA 2UWXA 2Y2PA 2ZY3A 5CP6C 2BYKB 2F8ND 2JE5A 4EO5C 4UPKA 1P3MC 1TZYD 5B32B 2FJ7A 3B0DB 5C3IC 5AV5D 5AV6B 1U35A 5BT1C 1P3PB 5AVCC 2YFVB 4XUJA 5B24B 3X1UC 3KUYC 3MGQB 1M1AB 3W97A 4DRAA 3W96C 4KGCB 4KUDD 3B0CW 3X1SA 4R8PC 5CPJD 3AFAB 2Y2GA 3B6FB 3O62B 3AZMB 5AY8D 3W99A 1S32D 1P3GA 2BYKA 4WU9B 1P3AB 4Z66B 5B2ID 1P3BC 3LZ0C 4E45A 4J8WD 2Y2NA 1P3FC 2RIQA 1P3PA 2YFVA 5B0ZC 3LZ1B 5DNMD 3MGQA 5GT0C 5GT3D 1WWIA 4KGCA 1PZRA 3REJD 3AZFB 1U35C 3AFAA 5B33B 5AV8C 3LELB 3B6FA 3O62A 3AZMA 4XUJC 3WTPA 4WU9A 1P3AA 1P3ID 4Z66A 4ZUXC 3AZHC 3W97C 3MGPB 3MGRA 1M19B 1KX3A 3UTAB 4YM6C 1AOID 4WNNA 1P3KC 1P3GC 3REHB 4WJ3C 5FUGB 1KX5D 1TZYC 1HQ3D 3LELA 3LJAA 3WKJB 3WAAD 5AV5C 3AZED 2F8NG 3AV1D 2Y2MA 1ZLAB 3B0CT 4KUDC 2IO5B 4Z5TD 4WZSB 5CPJC 3KFUG 2XD1A 3A6NB 3EPLA 5CP6B 1S32C 3REHA 4J8UD 5B2IC 5FUGA 3MGRC 4EO5B 3C1CD 1KX3C 3KXBD 3H0RC 5DNNA 3AZID 3X1VD 1P3OD 5C3IB 4J8WC 3WKJA 5KDMB 5AVCB 2W8SA 3MNNC 1BH9A 3VH6W 3X1UB 4H9PB 5DNMC 2XD5A 4WU8D 1ZLAA 5GT3C 3W96B 5CPID 5BS7A 3REJC 1N1JB 4G91C 4R8PB 5B2JD 3A6NA 1ID3D 3AN2D 5CP6A 4JJND 3TU4D 5CPKD 1P3BB 1P3MA 1KX4D 2RVQD 1P3FB 3B6GD 5KDMA 3NQUB 4CAYB 3WA9D 1AOIC 5B0ZB 1B67A 5B31D 3EPJA 3UTBA 3KUYA 5GT0B 4KHAB 3AZND 5DNNC 3AYWD 1N1JA 1U35B 1P3LD 4R8PA 5AV8B 1HQ3C 4XUJB 4H9RB 5AVBD 3AV2C 4ZBJC 2BYMB 4ZUXB 3AZHB 5AV9A 3AZEC 3W97B 1P3BA 3LZ0A 1P34D 3AV1C 2Y2HA 3X1TD 3REIC 3RELC 1P3FA 1H3OB 3NQUA 4CAYA 3UT9D 4YM6B 1M18C 3REKD 4Z5TC 1P3KB 1P3GB 3W99B 4XZQD 2DF4C 5GT0A 4KHAA 2F8NB 2Y2IA 3C1CC 5B0YD 3KXBC 1TZYB 3AZLD 5AV8A 2AROD 3UTBC 4J8XD 4H9RA 4J8VD 2NZDD 2BYMA 4ZUXA 3AZHA 3VH6T 3AZKD 1F66D 5F99D 2F8NH 5JA4A 4WU8C 1H3OA 5CHLB 1HTAA 4KUDB 4YM6A 3AZJA 1P3KA 3WTPB 5B32D 5CPJB 5B2JC 3VH5W 3H0MC 4QLCD 5AV9C 1ID3C 3AN2C 5AV6D 2F8NA 5B2IB 3MGRB 5B24D 3TU4C 1KX3B 5CPKC 1TZYA 1KX4C 4WNNB 2RVQC 3AZGD 1M1AD 3B6GC 5AV5A 4CSRA 3W98D 1W2EA 3WA9C 5B31C 3MNNB 4Z2MG 1EQZD 5DNMB 2Y2QA 5GT3B 4WU9D 3AZNC 4KUDA 2FFFB 3LJAB 3REJB 1P3LC 4G91B 5CPJA 4H9OB 2Y2KA 5AY8A 5B31G 1S32A 2NQBD 5B2IA 3LZ1D 1BFMA 5B40D 4DRBA 1P34C 5BNXB 3AZJC 4J8WA 3X1TC 4LD9D 4X23D 3UT9C 1AOIB 3AZFD 4NE5A 3MNNA 3REKC 3B0BA 5B33D 5DNMA 4XZQC 5GSUD 5GT3A 1A7WA 5DNNB 3REJA 3MGPD 5B0YC 3AZLC 1HQ3B 4H9OA 2VQRA 1BH9B 1M19D 3UTAD 3AV2B 4J8VC 4ZBJB 1P3IA 5GXQD 3AZKC 3AZEB 1F66C 5JRGD 5BNXA 5F99C 4UUZB 3C1BD 3AV1B 5B1MD 2J8PA 3REIB 3RELB 3REHD 1AOIA 1M18B 4G92C 4Z5TB 5AY8C 3NQJB 3VH5T 5B32C 3R45A 4QLCC 1P3MB 1KX5A 1HQ3A 3AZGC 1M1AC 2HIOD 3UTBB 3AV2A 3W98C 5B32G 3KUYB 2DQNC 5E5AD 3AZEA 5B1LD 1EQZC 3AV1A 4UUZA 3REIA 3RELA 4WU8B 2G5IC 3MGSD 1M18A 4Z5TA 3NQJA 5B2JB 1P3IC 4NFTA 1ID3B 5AV9B 3AN2B 2NQBC 5BT1D 3LZ0B 2ZM5A 3A1IA 5AVCD 4J8UA 3C1CA 4HGAC 3TU4B 3X1UD 5B40C 5CPKB 3KXBA 3AZIA 3X1VA 1P3OA 3B6GB 3W96D 2ZY4A 4X23C 3MVDD 4LD9C 2HUEC 5B31B 1KX5C 4WU8A 5GSUC 3AZNB 4DQYB 3KWQD 2PYOD 4YS3D 3WAAC 3MGPC 2ZY2A 1P3LB 2CV5D 5B2JA 1ID3A 3AN2A 5BO0A 5GXQC 5B0ZD 5JA4B 3TU4A 5CPKA 1P34B 5JRGC 1KX4A 3AZJB 3C1BC 3X1TB 5B1MC 3B6GA 2FJ7D 2G5HC 3UT9B 3WA9A 5B31A 3REKB 1U35D 4J8UC 4XZQB 4XUJD 5G49B 3AZNA 3AZIC 2YFWB 3X1VC 1P3OC 3W97D 4CSRB 5AV5B 1P3LA 5B0YB 3AZLB 3KSYA 3X1SD 4H9SC 2HIOC 4J8VB 4AWLC 3AZKB 3W99D 1F66B 5E5AC 1P3GD 5B1LC 5CPIC 5F99B 1P34A 3X1TA 4H9NB 3MGSC 3UT9A 4G92B 3REKA 5AY8B 1S32B 2L5AA 4M6BA 1P3PD 2Y2LA 3A1KA 4XZQA 4JJNC 4QLCB 5G49A 3MGQD 2YFWA 4J8WB 5B0YA 4KGCD 3AZLA 2JCHA 2AROA 3AZGB 4H9QB 3AFAD 4J8XA 4J8VA 3MVDC 3W98B 2NZDA 3B6FD 3O62D 3AZKA 3AZMD 3WTPD 3EG5B 1F66A 3EPHA 1P3AD 1EQZB 5F99A 4Z66D 3AYWC 5BNVB 4H9NA 3KWQC 2PYOC 3MGRD 4YS3C 1KX3D 5AVBC 5B32A 2CV5C 1P3IB 3WTPE 4QLCA 2NQBB 5AV6A 3VH6A 3MNND 4HGAB 5B24A 5B40B 1WWSA 3AZGA 1M1AA 4H9QA 3W98A 4X23B 2FJ7C 4LD9B 2HUEB 3LJAD 3LELD 3R45B 2Y2JA 1EQZA 1KX5B 5BNVA 5GSUB 2AROC 3V9RB 3WAAB 4J8XC 2NZDC 1ULYA 3X1SC 2NQBA 3FDDA 5GXQB 3LZ1A 3W99C 3IP4C 1T3UA 5B40A 5JRGB 3C1BB 5B1MB 3F6TA 2F8NK 4LD9A 4X23A 5DNND 3B0DC 3WKJD 3AZFA 1TAFB 5AV6C 5B33A 1P3PC 1KU5A 4J8UB 3C1CB 3AL0C 5GSUA 5B24C 3AV2D 3KXBB 4E44A 3AZIB 3MGQC 3X1VB 1P3OB 3V9RA 3WAAA 3MGPA 1ZLAD 4KGCC 3REID 3RELD 2HIOB 1M19A 3AFAC 3UTAA 4AWLB 3A6ND 5GXQA 3EPKA 3O62C 1M18D 3AZMC 3WTPC 5E5AB 5CP6D 3B6FC 4WU9C 1P3AC 5B1LB 5CPIB 1R4VA 4Z66C 1BH8B 5JRGA 2BG1A 3C1BA 5B1MA 1P3MD 3MGSB 1TAFA 2CWEA 5BO0B 3LZ1C 1Z2CB 4JJNB 3UTBD 1KX4B 3KUYD 2ZY5A 3WA9B 2LY8A 3AZFC 4H9SA 1B6WA 2HIOA 4R8PD 3MVDB 5B33C 4Z2MH 3LJAC 3LELC 2Y2OA 5E5AA 5B1LA 3VH5A 5CPIA 1BH8A 5AV9D 3AYWB 1P3BD 3LZ0D 3KWQB 3MGSA 1JFIB 2PYOB 1P3FD 4YS3B 4WV4B 1M19C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA C;  5AVB B;  2JSS A;  2CV5 B;  4JJN A;  4NE6 A;  1Q9C A;  5AVC A;  5GT0 D;  3X1U A;  4H9P A;  3REH C;  3W96 A;  3MVD A;  4NE3 A;  5AV8 D;  2FJ7 B;  3WKJ C;  3AZH D;  4ZUX D;  3AYW A;  3KWQ A;  1JFI A;  2PYO A;  2ARO B;  1F1E A;  4YS3 A;  4J8X B;  1ZLA C;  5AVB A;  2CV5 A;  2NZD B;  2IO5 C;  4YM6 D;  3AZJ D;  5BS7 C;  1P3K D;  3X1S B;  3A6N C;  5B0Z A;  5CP6 C;  2BYK B;  2F8N D;  4EO5 C;  1P3M C;  1TZY D;  5B32 B;  2FJ7 A;  3B0D B;  5C3I C;  5AV5 D;  5AV6 B;  1U35 A;  5BT1 C;  1P3P B;  5AVC C;  2YFV B;  4XUJ A;  5B24 B;  3X1U C;  3KUY C;  3MGQ B;  1M1A B;  3W97 A;  4DRA A;  3W96 C;  4KGC B;  4KUD D;  3B0C W;  3X1S A;  4R8P C;  5CPJ D;  3AFA B;  3B6F B;  3O62 B;  3AZM B;  5AY8 D;  3W99 A;  1S32 D;  1P3G A;  2BYK A;  4WU9 B;  1P3A B;  4Z66 B;  5B2I D;  1P3B C;  3LZ0 C;  4E45 A;  4J8W D;  1P3F C;  1P3P A;  2YFV A;  5B0Z C;  3LZ1 B;  5DNM D;  3MGQ A;  5GT0 C;  5GT3 D;  1WWI A;  4KGC A;  3REJ D;  3AZF B;  1U35 C;  3AFA A;  5B33 B;  5AV8 C;  3LEL B;  3B6F A;  3O62 A;  3AZM A;  4XUJ C;  3WTP A;  4WU9 A;  1P3A A;  1P3I D;  4Z66 A;  4ZUX C;  3AZH C;  3W97 C;  3MGP B;  3MGR A;  1M19 B;  1KX3 A;  3UTA B;  4YM6 C;  1AOI D;  4WNN A;  1P3K C;  1P3G C;  3REH B;  5FUG B;  1KX5 D;  1TZY C;  1HQ3 D;  3LEL A;  3LJA A;  3WKJ B;  3WAA D;  5AV5 C;  3AZE D;  2F8N G;  3AV1 D;  1ZLA B;  3B0C T;  4KUD C;  2IO5 B;  4Z5T D;  4WZS B;  5CPJ C;  3A6N B;  5CP6 B;  1S32 C;  3REH A;  4J8U D;  5B2I C;  5FUG A;  3MGR C;  4EO5 B;  3C1C D;  1KX3 C;  3KXB D;  5DNN A;  3AZI D;  3X1V D;  1P3O D;  5C3I B;  4J8W C;  3WKJ A;  5KDM B;  5AVC B;  3MNN C;  1BH9 A;  3VH6 W;  3X1U B;  4H9P B;  5DNM C;  4WU8 D;  1ZLA A;  5GT3 C;  3W96 B;  5CPI D;  5BS7 A;  3REJ C;  1N1J B;  4G91 C;  4R8P B;  5B2J D;  3A6N A;  1ID3 D;  3AN2 D;  5CP6 A;  4JJN D;  3TU4 D;  5CPK D;  1P3B B;  1P3M A;  1KX4 D;  2RVQ D;  1P3F B;  3B6G D;  5KDM A;  3NQU B;  4CAY B;  3WA9 D;  1AOI C;  5B0Z B;  1B67 A;  5B31 D;  3UTB A;  3KUY A;  5GT0 B;  4KHA B;  3AZN D;  5DNN C;  3AYW D;  1N1J A;  1U35 B;  1P3L D;  4R8P A;  5AV8 B;  1HQ3 C;  4XUJ B;  4H9R B;  5AVB D;  3AV2 C;  4ZBJ C;  2BYM B;  4ZUX B;  3AZH B;  5AV9 A;  3AZE C;  3W97 B;  1P3B A;  3LZ0 A;  1P34 D;  3AV1 C;  3X1T D;  3REI C;  3REL C;  1P3F A;  1H3O B;  3NQU A;  4CAY A;  3UT9 D;  4YM6 B;  1M18 C;  3REK D;  4Z5T C;  1P3K B;  1P3G B;  3W99 B;  4XZQ D;  5GT0 A;  4KHA A;  2F8N B;  3C1C C;  5B0Y D;  3KXB C;  1TZY B;  3AZL D;  5AV8 A;  2ARO D;  3UTB C;  4J8X D;  4H9R A;  4J8V D;  2NZD D;  2BYM A;  4ZUX A;  3AZH A;  3VH6 T;  3AZK D;  1F66 D;  5F99 D;  2F8N H;  5JA4 A;  4WU8 C;  1H3O A;  5CHL B;  1HTA A;  4KUD B;  4YM6 A;  3AZJ A;  1P3K A;  3WTP B;  5B32 D;  5CPJ B;  5B2J C;  3VH5 W;  5AV9 C;  4QLC D;  1ID3 C;  3AN2 C;  5AV6 D;  2F8N A;  5B2I B;  3MGR B;  5B24 D;  3TU4 C;  1KX3 B;  5CPK C;  1TZY A;  1KX4 C;  4WNN B;  2RVQ C;  3AZG D;  1M1A D;  3B6G C;  5AV5 A;  4CSR A;  3W98 D;  3WA9 C;  5B31 C;  3MNN B;  4Z2M G;  1EQZ D;  5DNM B;  4WU9 D;  5GT3 B;  3AZN C;  4KUD A;  3LJA B;  3REJ B;  1P3L C;  4G91 B;  5CPJ A;  4H9O B;  5AY8 A;  5B31 G;  1S32 A;  2NQB D;  5B2I A;  3LZ1 D;  1BFM A;  5B40 D;  4DRB A;  1P34 C;  5BNX B;  3AZJ C;  4J8W A;  3X1T C;  4LD9 D;  4X23 D;  3UT9 C;  1AOI B;  3AZF D;  4NE5 A;  3MNN A;  3REK C;  3B0B A;  5B33 D;  5DNM A;  4XZQ C;  5GSU D;  5GT3 A;  1A7W A;  5DNN B;  3REJ A;  3MGP D;  5B0Y C;  3AZL C;  1HQ3 B;  4H9O A;  1BH9 B;  1M19 D;  3UTA D;  3AV2 B;  4J8V C;  4ZBJ B;  1P3I A;  5GXQ D;  3AZK C;  3AZE B;  1F66 C;  5JRG D;  5BNX A;  5F99 C;  4UUZ B;  3C1B D;  3AV1 B;  5B1M D;  3REI B;  3REL B;  3REH D;  1AOI A;  1M18 B;  4G92 C;  4Z5T B;  5AY8 C;  3NQJ B;  3VH5 T;  5B32 C;  3R45 A;  4QLC C;  1P3M B;  1KX5 A;  1HQ3 A;  3AZG C;  1M1A C;  2HIO D;  3UTB B;  3AV2 A;  3W98 C;  5B32 G;  3KUY B;  3AZE A;  5E5A D;  5B1L D;  1EQZ C;  3AV1 A;  4UUZ A;  3REI A;  3REL A;  4WU8 B;  3MGS D;  1M18 A;  4Z5T A;  3NQJ A;  5B2J B;  1P3I C;  4NFT A;  1ID3 B;  5AV9 B;  3AN2 B;  2NQB C;  5BT1 D;  3LZ0 B;  5AVC D;  4J8U A;  3C1C A;  4HGA C;  3TU4 B;  3X1U D;  5B40 C;  5CPK B;  3KXB A;  3AZI A;  3X1V A;  1P3O A;  3B6G B;  3W96 D;  3MVD D;  4X23 C;  4LD9 C;  2HUE C;  5B31 B;  1KX5 C;  4WU8 A;  5GSU C;  3AZN B;  3KWQ D;  2PYO D;  4YS3 D;  3WAA C;  3MGP C;  1P3L B;  2CV5 D;  5B2J A;  1ID3 A;  3AN2 A;  5BO0 A;  5GXQ C;  5B0Z D;  5JA4 B;  3TU4 A;  5CPK A;  1P34 B;  5JRG C;  1KX4 A;  3AZJ B;  3C1B C;  3X1T B;  5B1M C;  3B6G A;  2FJ7 D;  3UT9 B;  3WA9 A;  5B31 A;  3REK B;  1U35 D;  4J8U C;  4XZQ B;  4XUJ D;  5G49 B;  3AZN A;  3AZI C;  2YFW B;  3X1V C;  1P3O C;  3W97 D;  4CSR B;  5AV5 B;  1P3L A;  5B0Y B;  3AZL B;  3KSY A;  3X1S D;  4H9S C;  2HIO C;  4J8V B;  4AWL C;  3AZK B;  3W99 D;  1F66 B;  5E5A C;  1P3G D;  5B1L C;  5F99 B;  5CPI C;  1P34 A;  3X1T A;  4H9N B;  3MGS C;  3UT9 A;  4G92 B;  3REK A;  5AY8 B;  1S32 B;  2L5A A;  4M6B A;  1P3P D;  4XZQ A;  4JJN C;  4QLC B;  5G49 A;  3MGQ D;  2YFW A;  4J8W B;  5B0Y A;  4KGC D;  3AZL A;  2ARO A;  3AZG B;  4H9Q B;  3AFA D;  4J8X A;  4J8V A;  3MVD C;  3W98 B;  2NZD A;  3B6F D;  3O62 D;  3AZK A;  3AZM D;  3WTP D;  1F66 A;  1P3A D;  1EQZ B;  5F99 A;  4Z66 D;  3AYW C;  5BNV B;  4H9N A;  3KWQ C;  2PYO C;  3MGR D;  4YS3 C;  1KX3 D;  5AVB C;  5B32 A;  2CV5 C;  1P3I B;  3WTP E;  4QLC A;  2NQB B;  5AV6 A;  3VH6 A;  3MNN D;  4HGA B;  5B24 A;  5B40 B;  1WWS A;  3AZG A;  1M1A A;  4H9Q A;  3W98 A;  4X23 B;  2FJ7 C;  4LD9 B;  2HUE B;  3LJA D;  3LEL D;  3R45 B;  1EQZ A;  1KX5 B;  5BNV A;  5GSU B;  2ARO C;  3V9R B;  3WAA B;  4J8X C;  2NZD C;  1ULY A;  3X1S C;  2NQB A;  5GXQ B;  3LZ1 A;  3W99 C;  5B40 A;  5JRG B;  3C1B B;  5B1M B;  2F8N K;  4LD9 A;  4X23 A;  5DNN D;  3B0D C;  3WKJ D;  3AZF A;  1TAF B;  5AV6 C;  5B33 A;  1P3P C;  1KU5 A;  4J8U B;  3C1C B;  5GSU A;  5B24 C;  3AV2 D;  3KXB B;  4E44 A;  3AZI B;  3MGQ C;  3X1V B;  1P3O B;  3V9R A;  3WAA A;  3MGP A;  1ZLA D;  4KGC C;  3REI D;  3REL D;  2HIO B;  1M19 A;  3AFA C;  3UTA A;  4AWL B;  3A6N D;  5GXQ A;  1M18 D;  3O62 C;  3B6F C;  3AZM C;  3WTP C;  5E5A B;  5CP6 D;  4WU9 C;  1P3A C;  5B1L B;  5CPI B;  1R4V A;  4Z66 C;  1BH8 B;  5JRG A;  3C1B A;  5B1M A;  1P3M D;  3MGS B;  1TAF A;  2CWE A;  5BO0 B;  3LZ1 C;  4JJN B;  3UTB D;  1KX4 B;  3KUY D;  3WA9 B;  2LY8 A;  3AZF C;  4H9S A;  1B6W A;  2HIO A;  4R8P D;  3MVD B;  5B33 C;  4Z2M H;  3LJA C;  3LEL C;  5E5A A;  5B1L A;  3VH5 A;  5CPI A;  1BH8 A;  5AV9 D;  3AYW B;  1P3B D;  3LZ0 D;  3KWQ B;  3MGS A;  1JFI B;  2PYO B;  1P3F D;  4YS3 B;  4WV4 B;  1M19 C; 
#chains in the Genus database with same CATH topology
 3UTA C;  5AVB B;  2JSS A;  2CV5 B;  4JJN A;  4NE6 A;  1Q9C A;  5AVC A;  5GT0 D;  3X1U A;  4H9P A;  3REH C;  3W96 A;  3MVD A;  4NE3 A;  5AV8 D;  2FJ7 B;  3WKJ C;  3H0L C;  3P5J B;  4ZUX D;  3AZH D;  3AYW A;  3KWQ A;  1JFI A;  2PYO A;  2ARO B;  1F1E A;  4YS3 A;  2F2A C;  4J8X B;  1ZLA C;  5AVB A;  2CV5 A;  2NZD B;  2IO5 C;  4YM6 D;  3AZJ D;  5BS7 C;  1P3K D;  3X1S B;  3A6N C;  5B0Z A;  2UWX A;  2Y2P A;  2ZY3 A;  5CP6 C;  2BYK B;  2F8N D;  2JE5 A;  4EO5 C;  4UPK A;  1P3M C;  1TZY D;  5B32 B;  2FJ7 A;  3B0D B;  5C3I C;  5AV5 D;  5AV6 B;  1U35 A;  5BT1 C;  1P3P B;  5AVC C;  2YFV B;  4XUJ A;  5B24 B;  3X1U C;  3KUY C;  3MGQ B;  1M1A B;  3W97 A;  4DRA A;  3W96 C;  4KGC B;  4KUD D;  3B0C W;  3X1S A;  4R8P C;  5CPJ D;  3AFA B;  2Y2G A;  3B6F B;  3O62 B;  3AZM B;  5AY8 D;  3W99 A;  1S32 D;  1P3G A;  2BYK A;  4WU9 B;  1P3A B;  4Z66 B;  5B2I D;  1P3B C;  3LZ0 C;  4E45 A;  4J8W D;  2Y2N A;  1P3F C;  2RIQ A;  1P3P A;  2YFV A;  5B0Z C;  3LZ1 B;  5DNM D;  3MGQ A;  5GT0 C;  5GT3 D;  1WWI A;  4KGC A;  1PZR A;  3REJ D;  3AZF B;  1U35 C;  3AFA A;  5B33 B;  5AV8 C;  3LEL B;  3B6F A;  3O62 A;  3AZM A;  4XUJ C;  3WTP A;  4WU9 A;  1P3A A;  1P3I D;  4Z66 A;  4ZUX C;  3AZH C;  3W97 C;  3MGP B;  3MGR A;  1M19 B;  1KX3 A;  3UTA B;  4YM6 C;  1AOI D;  4WNN A;  1P3K C;  1P3G C;  3REH B;  4WJ3 C;  5FUG B;  1KX5 D;  1TZY C;  1HQ3 D;  3LEL A;  3LJA A;  3WKJ B;  3WAA D;  5AV5 C;  3AZE D;  2F8N G;  3AV1 D;  2Y2M A;  1ZLA B;  3B0C T;  4KUD C;  2IO5 B;  4Z5T D;  4WZS B;  5CPJ C;  3KFU G;  2XD1 A;  3A6N B;  3EPL A;  5CP6 B;  1S32 C;  3REH A;  4J8U D;  5B2I C;  5FUG A;  3MGR C;  4EO5 B;  3C1C D;  1KX3 C;  3KXB D;  3H0R C;  5DNN A;  3AZI D;  3X1V D;  1P3O D;  5C3I B;  4J8W C;  3WKJ A;  5KDM B;  5AVC B;  2W8S A;  3MNN C;  1BH9 A;  3VH6 W;  3X1U B;  4H9P B;  5DNM C;  2XD5 A;  4WU8 D;  1ZLA A;  5GT3 C;  3W96 B;  5CPI D;  5BS7 A;  3REJ C;  1N1J B;  4G91 C;  4R8P B;  5B2J D;  3A6N A;  1ID3 D;  3AN2 D;  5CP6 A;  4JJN D;  3TU4 D;  5CPK D;  1P3B B;  1P3M A;  1KX4 D;  2RVQ D;  1P3F B;  3B6G D;  5KDM A;  3NQU B;  4CAY B;  3WA9 D;  1AOI C;  5B0Z B;  1B67 A;  5B31 D;  3EPJ A;  3UTB A;  3KUY A;  5GT0 B;  4KHA B;  3AZN D;  5DNN C;  3AYW D;  1N1J A;  1U35 B;  1P3L D;  4R8P A;  5AV8 B;  1HQ3 C;  4XUJ B;  4H9R B;  5AVB D;  3AV2 C;  4ZBJ C;  2BYM B;  4ZUX B;  3AZH B;  5AV9 A;  3AZE C;  3W97 B;  1P3B A;  3LZ0 A;  1P34 D;  3AV1 C;  2Y2H A;  3X1T D;  3REI C;  3REL C;  1P3F A;  1H3O B;  3NQU A;  4CAY A;  3UT9 D;  4YM6 B;  1M18 C;  3REK D;  4Z5T C;  1P3K B;  1P3G B;  3W99 B;  4XZQ D;  2DF4 C;  5GT0 A;  4KHA A;  2F8N B;  2Y2I A;  3C1C C;  5B0Y D;  3KXB C;  1TZY B;  3AZL D;  5AV8 A;  2ARO D;  3UTB C;  4J8X D;  4H9R A;  4J8V D;  2NZD D;  2BYM A;  4ZUX A;  3AZH A;  3VH6 T;  3AZK D;  1F66 D;  5F99 D;  2F8N H;  5JA4 A;  4WU8 C;  1H3O A;  5CHL B;  1HTA A;  4KUD B;  4YM6 A;  3AZJ A;  1P3K A;  3WTP B;  5B32 D;  5CPJ B;  5B2J C;  3VH5 W;  3H0M C;  4QLC D;  5AV9 C;  1ID3 C;  3AN2 C;  5AV6 D;  2F8N A;  5B2I B;  3MGR B;  5B24 D;  3TU4 C;  1KX3 B;  5CPK C;  1TZY A;  1KX4 C;  4WNN B;  2RVQ C;  3AZG D;  1M1A D;  3B6G C;  5AV5 A;  4CSR A;  3W98 D;  1W2E A;  3WA9 C;  5B31 C;  3MNN B;  4Z2M G;  1EQZ D;  5DNM B;  2Y2Q A;  5GT3 B;  4WU9 D;  3AZN C;  4KUD A;  2FFF B;  3LJA B;  3REJ B;  1P3L C;  4G91 B;  5CPJ A;  4H9O B;  2Y2K A;  5AY8 A;  5B31 G;  1S32 A;  2NQB D;  5B2I A;  3LZ1 D;  1BFM A;  5B40 D;  4DRB A;  1P34 C;  5BNX B;  3AZJ C;  4J8W A;  3X1T C;  4LD9 D;  4X23 D;  3UT9 C;  1AOI B;  3AZF D;  4NE5 A;  3MNN A;  3REK C;  3B0B A;  5B33 D;  5DNM A;  4XZQ C;  5GSU D;  5GT3 A;  1A7W A;  5DNN B;  3REJ A;  3MGP D;  5B0Y C;  3AZL C;  1HQ3 B;  4H9O A;  2VQR A;  1BH9 B;  1M19 D;  3UTA D;  3AV2 B;  4J8V C;  4ZBJ B;  1P3I A;  5GXQ D;  3AZK C;  3AZE B;  1F66 C;  5JRG D;  5BNX A;  5F99 C;  4UUZ B;  3C1B D;  3AV1 B;  5B1M D;  2J8P A;  3REI B;  3REL B;  3REH D;  1AOI A;  1M18 B;  4G92 C;  4Z5T B;  5AY8 C;  3NQJ B;  3VH5 T;  5B32 C;  3R45 A;  4QLC C;  1P3M B;  1KX5 A;  1HQ3 A;  3AZG C;  1M1A C;  2HIO D;  3UTB B;  3AV2 A;  3W98 C;  5B32 G;  3KUY B;  2DQN C;  5E5A D;  3AZE A;  5B1L D;  1EQZ C;  3AV1 A;  4UUZ A;  3REI A;  3REL A;  4WU8 B;  2G5I C;  3MGS D;  1M18 A;  4Z5T A;  3NQJ A;  5B2J B;  1P3I C;  4NFT A;  1ID3 B;  5AV9 B;  3AN2 B;  2NQB C;  5BT1 D;  3LZ0 B;  2ZM5 A;  3A1I A;  5AVC D;  4J8U A;  3C1C A;  4HGA C;  3TU4 B;  3X1U D;  5B40 C;  5CPK B;  3KXB A;  3AZI A;  3X1V A;  1P3O A;  3B6G B;  3W96 D;  2ZY4 A;  4X23 C;  3MVD D;  4LD9 C;  2HUE C;  5B31 B;  1KX5 C;  4WU8 A;  5GSU C;  3AZN B;  4DQY B;  3KWQ D;  2PYO D;  4YS3 D;  3WAA C;  3MGP C;  2ZY2 A;  1P3L B;  2CV5 D;  5B2J A;  1ID3 A;  3AN2 A;  5BO0 A;  5GXQ C;  5B0Z D;  5JA4 B;  3TU4 A;  5CPK A;  1P34 B;  5JRG C;  1KX4 A;  3AZJ B;  3C1B C;  3X1T B;  5B1M C;  3B6G A;  2FJ7 D;  2G5H C;  3UT9 B;  3WA9 A;  5B31 A;  3REK B;  1U35 D;  4J8U C;  4XZQ B;  4XUJ D;  5G49 B;  3AZN A;  3AZI C;  2YFW B;  3X1V C;  1P3O C;  3W97 D;  4CSR B;  5AV5 B;  1P3L A;  5B0Y B;  3AZL B;  3KSY A;  3X1S D;  4H9S C;  2HIO C;  4J8V B;  4AWL C;  3AZK B;  3W99 D;  1F66 B;  5E5A C;  1P3G D;  5B1L C;  5CPI C;  5F99 B;  1P34 A;  3X1T A;  4H9N B;  3MGS C;  3UT9 A;  4G92 B;  3REK A;  5AY8 B;  1S32 B;  2L5A A;  4M6B A;  1P3P D;  2Y2L A;  3A1K A;  4XZQ A;  4JJN C;  4QLC B;  5G49 A;  3MGQ D;  2YFW A;  4J8W B;  5B0Y A;  4KGC D;  3AZL A;  2JCH A;  2ARO A;  3AZG B;  4H9Q B;  3AFA D;  4J8X A;  4J8V A;  3MVD C;  3W98 B;  2NZD A;  3B6F D;  3O62 D;  3AZK A;  3AZM D;  3WTP D;  3EG5 B;  1F66 A;  3EPH A;  1P3A D;  1EQZ B;  5F99 A;  4Z66 D;  3AYW C;  5BNV B;  4H9N A;  3KWQ C;  2PYO C;  3MGR D;  4YS3 C;  1KX3 D;  5AVB C;  5B32 A;  2CV5 C;  1P3I B;  3WTP E;  4QLC A;  2NQB B;  5AV6 A;  3VH6 A;  3MNN D;  4HGA B;  5B24 A;  5B40 B;  1WWS A;  3AZG A;  1M1A A;  4H9Q A;  3W98 A;  4X23 B;  2FJ7 C;  4LD9 B;  2HUE B;  3LJA D;  3LEL D;  3R45 B;  2Y2J A;  1EQZ A;  1KX5 B;  5BNV A;  5GSU B;  2ARO C;  3V9R B;  3WAA B;  4J8X C;  2NZD C;  1ULY A;  3X1S C;  2NQB A;  3FDD A;  5GXQ B;  3LZ1 A;  3W99 C;  3IP4 C;  1T3U A;  5B40 A;  5JRG B;  3C1B B;  5B1M B;  3F6T A;  2F8N K;  4LD9 A;  4X23 A;  5DNN D;  3B0D C;  3WKJ D;  3AZF A;  1TAF B;  5AV6 C;  5B33 A;  1P3P C;  1KU5 A;  4J8U B;  3C1C B;  3AL0 C;  5GSU A;  5B24 C;  3AV2 D;  3KXB B;  4E44 A;  3AZI B;  3MGQ C;  3X1V B;  1P3O B;  3V9R A;  3WAA A;  3MGP A;  1ZLA D;  4KGC C;  3REI D;  3REL D;  2HIO B;  1M19 A;  3AFA C;  3UTA A;  4AWL B;  3A6N D;  5GXQ A;  3EPK A;  3O62 C;  1M18 D;  3AZM C;  3WTP C;  5E5A B;  5CP6 D;  3B6F C;  4WU9 C;  1P3A C;  5B1L B;  5CPI B;  1R4V A;  4Z66 C;  1BH8 B;  5JRG A;  2BG1 A;  3C1B A;  5B1M A;  1P3M D;  3MGS B;  1TAF A;  2CWE A;  5BO0 B;  3LZ1 C;  1Z2C B;  4JJN B;  3UTB D;  1KX4 B;  3KUY D;  2ZY5 A;  3WA9 B;  2LY8 A;  3AZF C;  4H9S A;  1B6W A;  2HIO A;  4R8P D;  3MVD B;  5B33 C;  4Z2M H;  3LJA C;  3LEL C;  2Y2O A;  5E5A A;  5B1L A;  3VH5 A;  5CPI A;  1BH8 A;  5AV9 D;  3AYW B;  1P3B D;  3LZ0 D;  3KWQ B;  3MGS A;  1JFI B;  2PYO B;  1P3F D;  4YS3 B;  4WV4 B;  1M19 C; 
#chains in the Genus database with same CATH homology
 3UTA C;  5AVB B;  2JSS A;  2CV5 B;  4JJN A;  4NE6 A;  1Q9C A;  5AVC A;  5GT0 D;  3X1U A;  4H9P A;  3REH C;  3W96 A;  3MVD A;  4NE3 A;  5AV8 D;  2FJ7 B;  3WKJ C;  3H0L C;  3P5J B;  4ZUX D;  3AZH D;  3AYW A;  3KWQ A;  1JFI A;  2PYO A;  2ARO B;  1F1E A;  4YS3 A;  2F2A C;  4J8X B;  1ZLA C;  5AVB A;  2CV5 A;  2NZD B;  2IO5 C;  4YM6 D;  3AZJ D;  5BS7 C;  1P3K D;  3X1S B;  3A6N C;  5B0Z A;  2UWX A;  2Y2P A;  2ZY3 A;  5CP6 C;  2BYK B;  2F8N D;  2JE5 A;  4EO5 C;  4UPK A;  1P3M C;  1TZY D;  5B32 B;  2FJ7 A;  3B0D B;  5C3I C;  5AV5 D;  5AV6 B;  1U35 A;  5BT1 C;  1P3P B;  5AVC C;  2YFV B;  4XUJ A;  5B24 B;  3X1U C;  3KUY C;  3MGQ B;  1M1A B;  3W97 A;  4DRA A;  3W96 C;  4KGC B;  4KUD D;  3B0C W;  3X1S A;  4R8P C;  5CPJ D;  3AFA B;  2Y2G A;  3B6F B;  3O62 B;  3AZM B;  5AY8 D;  3W99 A;  1S32 D;  1P3G A;  2BYK A;  4WU9 B;  1P3A B;  4Z66 B;  5B2I D;  1P3B C;  3LZ0 C;  4E45 A;  4J8W D;  2Y2N A;  1P3F C;  2RIQ A;  1P3P A;  2YFV A;  5B0Z C;  3LZ1 B;  5DNM D;  3MGQ A;  5GT0 C;  5GT3 D;  1WWI A;  4KGC A;  1PZR A;  3REJ D;  3AZF B;  1U35 C;  3AFA A;  5B33 B;  5AV8 C;  3LEL B;  3B6F A;  3O62 A;  3AZM A;  4XUJ C;  3WTP A;  4WU9 A;  1P3A A;  1P3I D;  4Z66 A;  4ZUX C;  3AZH C;  3W97 C;  3MGP B;  3MGR A;  1M19 B;  1KX3 A;  3UTA B;  4YM6 C;  1AOI D;  4WNN A;  1P3K C;  1P3G C;  3REH B;  4WJ3 C;  5FUG B;  1KX5 D;  1TZY C;  1HQ3 D;  3LEL A;  3LJA A;  3WKJ B;  3WAA D;  5AV5 C;  3AZE D;  2F8N G;  3AV1 D;  2Y2M A;  1ZLA B;  3B0C T;  4KUD C;  2IO5 B;  4Z5T D;  4WZS B;  5CPJ C;  3KFU G;  2XD1 A;  3A6N B;  3EPL A;  5CP6 B;  1S32 C;  3REH A;  4J8U D;  5B2I C;  5FUG A;  3MGR C;  4EO5 B;  3C1C D;  1KX3 C;  3KXB D;  3H0R C;  5DNN A;  3AZI D;  3X1V D;  1P3O D;  5C3I B;  4J8W C;  3WKJ A;  5KDM B;  5AVC B;  2W8S A;  3MNN C;  1BH9 A;  3VH6 W;  3X1U B;  4H9P B;  5DNM C;  2XD5 A;  4WU8 D;  1ZLA A;  5GT3 C;  3W96 B;  5CPI D;  5BS7 A;  3REJ C;  1N1J B;  4G91 C;  4R8P B;  5B2J D;  3A6N A;  1ID3 D;  3AN2 D;  5CP6 A;  4JJN D;  3TU4 D;  5CPK D;  1P3B B;  1P3M A;  1KX4 D;  2RVQ D;  1P3F B;  3B6G D;  5KDM A;  3NQU B;  4CAY B;  3WA9 D;  1AOI C;  5B0Z B;  1B67 A;  5B31 D;  3EPJ A;  3UTB A;  3KUY A;  5GT0 B;  4KHA B;  3AZN D;  5DNN C;  3AYW D;  1N1J A;  1U35 B;  1P3L D;  4R8P A;  5AV8 B;  1HQ3 C;  4XUJ B;  4H9R B;  5AVB D;  3AV2 C;  4ZBJ C;  2BYM B;  4ZUX B;  3AZH B;  5AV9 A;  3AZE C;  3W97 B;  1P3B A;  3LZ0 A;  1P34 D;  3AV1 C;  2Y2H A;  3X1T D;  3REI C;  3REL C;  1P3F A;  1H3O B;  3NQU A;  4CAY A;  3UT9 D;  4YM6 B;  1M18 C;  3REK D;  4Z5T C;  1P3K B;  1P3G B;  3W99 B;  4XZQ D;  2DF4 C;  5GT0 A;  4KHA A;  2F8N B;  2Y2I A;  3C1C C;  5B0Y D;  3KXB C;  1TZY B;  3AZL D;  5AV8 A;  2ARO D;  3UTB C;  4J8X D;  4H9R A;  4J8V D;  2NZD D;  2BYM A;  4ZUX A;  3AZH A;  3VH6 T;  3AZK D;  1F66 D;  5F99 D;  2F8N H;  5JA4 A;  4WU8 C;  1H3O A;  5CHL B;  1HTA A;  4KUD B;  4YM6 A;  3AZJ A;  1P3K A;  3WTP B;  5B32 D;  5CPJ B;  5B2J C;  3VH5 W;  3H0M C;  4QLC D;  5AV9 C;  1ID3 C;  3AN2 C;  5AV6 D;  2F8N A;  5B2I B;  3MGR B;  5B24 D;  3TU4 C;  1KX3 B;  5CPK C;  1TZY A;  1KX4 C;  4WNN B;  2RVQ C;  3AZG D;  1M1A D;  3B6G C;  5AV5 A;  4CSR A;  3W98 D;  1W2E A;  3WA9 C;  5B31 C;  3MNN B;  4Z2M G;  1EQZ D;  5DNM B;  2Y2Q A;  5GT3 B;  4WU9 D;  3AZN C;  4KUD A;  2FFF B;  3LJA B;  3REJ B;  1P3L C;  4G91 B;  5CPJ A;  4H9O B;  2Y2K A;  5AY8 A;  5B31 G;  1S32 A;  2NQB D;  5B2I A;  3LZ1 D;  1BFM A;  5B40 D;  4DRB A;  1P34 C;  5BNX B;  3AZJ C;  4J8W A;  3X1T C;  4LD9 D;  4X23 D;  3UT9 C;  1AOI B;  3AZF D;  4NE5 A;  3MNN A;  3REK C;  3B0B A;  5B33 D;  5DNM A;  4XZQ C;  5GSU D;  5GT3 A;  1A7W A;  5DNN B;  3REJ A;  3MGP D;  5B0Y C;  3AZL C;  1HQ3 B;  4H9O A;  2VQR A;  1BH9 B;  1M19 D;  3UTA D;  3AV2 B;  4J8V C;  4ZBJ B;  1P3I A;  5GXQ D;  3AZK C;  3AZE B;  1F66 C;  5JRG D;  5BNX A;  5F99 C;  4UUZ B;  3C1B D;  3AV1 B;  5B1M D;  2J8P A;  3REI B;  3REL B;  3REH D;  1AOI A;  1M18 B;  4G92 C;  4Z5T B;  5AY8 C;  3NQJ B;  3VH5 T;  5B32 C;  3R45 A;  4QLC C;  1P3M B;  1KX5 A;  1HQ3 A;  3AZG C;  1M1A C;  2HIO D;  3UTB B;  3AV2 A;  3W98 C;  5B32 G;  3KUY B;  2DQN C;  5E5A D;  3AZE A;  5B1L D;  1EQZ C;  3AV1 A;  4UUZ A;  3REI A;  3REL A;  4WU8 B;  2G5I C;  3MGS D;  1M18 A;  4Z5T A;  3NQJ A;  5B2J B;  1P3I C;  4NFT A;  1ID3 B;  5AV9 B;  3AN2 B;  2NQB C;  5BT1 D;  3LZ0 B;  2ZM5 A;  3A1I A;  5AVC D;  4J8U A;  3C1C A;  4HGA C;  3TU4 B;  3X1U D;  5B40 C;  5CPK B;  3KXB A;  3AZI A;  3X1V A;  1P3O A;  3B6G B;  3W96 D;  2ZY4 A;  4X23 C;  3MVD D;  4LD9 C;  2HUE C;  5B31 B;  1KX5 C;  4WU8 A;  5GSU C;  3AZN B;  4DQY B;  3KWQ D;  2PYO D;  4YS3 D;  3WAA C;  3MGP C;  2ZY2 A;  1P3L B;  2CV5 D;  5B2J A;  1ID3 A;  3AN2 A;  5BO0 A;  5GXQ C;  5B0Z D;  5JA4 B;  3TU4 A;  5CPK A;  1P34 B;  5JRG C;  1KX4 A;  3AZJ B;  3C1B C;  3X1T B;  5B1M C;  3B6G A;  2FJ7 D;  2G5H C;  3UT9 B;  3WA9 A;  5B31 A;  3REK B;  1U35 D;  4J8U C;  4XZQ B;  4XUJ D;  5G49 B;  3AZN A;  3AZI C;  2YFW B;  3X1V C;  1P3O C;  3W97 D;  4CSR B;  5AV5 B;  1P3L A;  5B0Y B;  3AZL B;  3KSY A;  3X1S D;  4H9S C;  2HIO C;  4J8V B;  4AWL C;  3AZK B;  3W99 D;  1F66 B;  5E5A C;  1P3G D;  5B1L C;  5CPI C;  5F99 B;  1P34 A;  3X1T A;  4H9N B;  3MGS C;  3UT9 A;  4G92 B;  3REK A;  5AY8 B;  1S32 B;  2L5A A;  4M6B A;  1P3P D;  2Y2L A;  3A1K A;  4XZQ A;  4JJN C;  4QLC B;  5G49 A;  3MGQ D;  2YFW A;  4J8W B;  5B0Y A;  4KGC D;  3AZL A;  2JCH A;  2ARO A;  3AZG B;  4H9Q B;  3AFA D;  4J8X A;  4J8V A;  3MVD C;  3W98 B;  2NZD A;  3B6F D;  3O62 D;  3AZK A;  3AZM D;  3WTP D;  3EG5 B;  1F66 A;  3EPH A;  1P3A D;  1EQZ B;  5F99 A;  4Z66 D;  3AYW C;  5BNV B;  4H9N A;  3KWQ C;  2PYO C;  3MGR D;  4YS3 C;  1KX3 D;  5AVB C;  5B32 A;  2CV5 C;  1P3I B;  3WTP E;  4QLC A;  2NQB B;  5AV6 A;  3VH6 A;  3MNN D;  4HGA B;  5B24 A;  5B40 B;  1WWS A;  3AZG A;  1M1A A;  4H9Q A;  3W98 A;  4X23 B;  2FJ7 C;  4LD9 B;  2HUE B;  3LJA D;  3LEL D;  3R45 B;  2Y2J A;  1EQZ A;  1KX5 B;  5BNV A;  5GSU B;  2ARO C;  3V9R B;  3WAA B;  4J8X C;  2NZD C;  1ULY A;  3X1S C;  2NQB A;  3FDD A;  5GXQ B;  3LZ1 A;  3W99 C;  3IP4 C;  1T3U A;  5B40 A;  5JRG B;  3C1B B;  5B1M B;  3F6T A;  2F8N K;  4LD9 A;  4X23 A;  5DNN D;  3B0D C;  3WKJ D;  3AZF A;  1TAF B;  5AV6 C;  5B33 A;  1P3P C;  1KU5 A;  4J8U B;  3C1C B;  3AL0 C;  5GSU A;  5B24 C;  3AV2 D;  3KXB B;  4E44 A;  3AZI B;  3MGQ C;  3X1V B;  1P3O B;  3V9R A;  3WAA A;  3MGP A;  1ZLA D;  4KGC C;  3REI D;  3REL D;  2HIO B;  1M19 A;  3AFA C;  3UTA A;  4AWL B;  3A6N D;  5GXQ A;  3EPK A;  3O62 C;  1M18 D;  3AZM C;  3WTP C;  5E5A B;  5CP6 D;  3B6F C;  4WU9 C;  1P3A C;  5B1L B;  5CPI B;  1R4V A;  4Z66 C;  1BH8 B;  5JRG A;  2BG1 A;  3C1B A;  5B1M A;  1P3M D;  3MGS B;  1TAF A;  2CWE A;  5BO0 B;  3LZ1 C;  1Z2C B;  4JJN B;  3UTB D;  1KX4 B;  3KUY D;  2ZY5 A;  3WA9 B;  2LY8 A;  3AZF C;  4H9S A;  1B6W A;  2HIO A;  4R8P D;  3MVD B;  5B33 C;  4Z2M H;  3LJA C;  3LEL C;  2Y2O A;  5E5A A;  5B1L A;  3VH5 A;  5CPI A;  1BH8 A;  5AV9 D;  3AYW B;  1P3B D;  3LZ0 D;  3KWQ B;  3MGS A;  1JFI B;  2PYO B;  1P3F D;  4YS3 B;  4WV4 B;  1M19 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...