5CHLB

Structural basis of h2a.z recognition by yl1 histone chaperone component of srcap/swr1 chromatin remodeling complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 72 homolog
publication title Structural basis of H2A.Z recognition by SRCAP chromatin-remodeling subunit YL1
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 69
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5chlB00
5B32D 2NQBB 3B0CT 3AZLD 5AVCA 3AZJA 5FUGB 5CP6D 3C1BD 3AZNB 5B1LB 3LZ0A 4J8VD 1TZYA 1KX4D 4JJND 3WTPC 2BYMA 5AV5C 3AZEC 2YFWB 5GT0D 1R4VA 3A6NA 5B0ZA 3UT9B 3O62C 3X1VA 3MGRC 1P3FB 1KX3D 3B6FB 4J8WC 5B2ID 5DNNA 3AZGA 3AYWD 3R45B 1TAFB 4XUJD 3W97A 1P3IA 4J8XC 3WA9D 2CWEA 3B0BA 5BS7A 1F66C 3WTPB 2F8ND 5AV5B 3RELD 1ZLAD 1B6WA 3LJAC 3VH5W 4LD9A 3O62B 4H9QA 4M6BA 3MGRB 4J8WB 3MNNA 1P3KC 3AZJC 5B1MA 3REIA 5BNVB 4X23B 4J8XB 1TZYC 1M18A 5AV8D 1F66B 3AZIA 4H9OA 5B0ZC 3LJAB 3AFAA 4NFTA 1M19D 5BO0A 4WNNB 1S32D 5B32C 3AZLC 1AOIA 4WU8D 5DNNC 3C1BC 3TU4A 3AZGC 1P3KB 2BYKA 1P3PA 3AZJB 1KX4C 4JJNC 1BH9A 3UTAD 5DNMD 3REKA 3W97C 5BNXB 4YS3C 3WKJD 1TZYB 4XZQD 5GT3D 5BS7C 2BYMB 4H9PA 5JA4A 3X1SD 4H9SA 5B0ZB 4LD9C 4EO5C 1P3MA 4H9RA 1M1AD 4ZBJC 4DRAA 5B32B 3AV1A 3AZLB 5B0YC 5DNNB 3MNNC 3C1BB 3KSYA 3AZGB 5B24D 4QLCA 2HUEC 3WA9C 2NZDA 4AWLC 1KX4B 4JJNB 5B33D 1KX5A 3W97B 3W99A 1ZLAC 4YS3B 1M18C 5FUGA 1P34D 3AZIC 3AN2D 5B1LA 4LD9B 4EO5B 5AVBD 4H9QB 4ZBJB 2YFWA 3TU4C 5B0YB 3AZFD 3MNNB 3UT9A 2FJ7A 4Z66C 2HUEB 3AV2D 1P3FA 3WA9B 4AWLB 3WTPE 3REKC 2PYOD 3RELB 1ZLAB 3R45A 1M18B 1TAFA 4H9SC 3AZIB 5AY8A 3MGPD 5BO0B 3WTPA 3AV1C 4KUDD 1ID3D 3REJD 3TU4B 3UTBD 4Z66B 3C1CA 2NZDC 2JSSA 4XZQC 5GT3C 4J8WA 3W99C 1KX5C 3REKB 3X1SC 5AV9D 4X23A 4E44A 5G49B 4J8XA 4H9RB 3MGSC 4WU9A 4Z2MG 3AV1B 2FJ7C 3AZKD 1B67A 4WNNA 3W96D 4H9NA 2NZDB 2F8NK 2F8NG 4XZQB 5GT3B 1KX5B 3W99B 3X1SB 1P3KA 3X1UD 5B31D 5BT1C 3WAAD 5AVBC 5AY8C 3REHA 5BNXA 5GXQD 3MGSB 5CHLB 1P3LD 5AVCD 1F1EA 3LZ1A 3AV2C 5F99D 5CPJD 2FJ7B 5E5AD 5B40D 1P3AD 3C1CC 4G91C 5B32A 3VH5A 3AZHD 3AZLA 3C1BA 3X1TC 1P3OD 1EQZD 1ULYA 4J8VA 3X1VD 1KX4A 1P3GD 5AVBB 4JJNA 5AY8B 2RVQD 4X23C 5GT0A 5GSUD 4YS3A 1ID3C 3REJC 4WU9C 4YM6D 3AV2B 4Z5TD 1Q9CA 4G92C 5B2JD 3C1CB 4G91B 4ZUXD 5B0YA 3X1TB 1P3BD 5JRGD 3WA9A 5AV6D 1U35D 4J8UD 1HQ3C 3REHC 2F8NA 3RELA 2HIOD 1ZLAA 2F8NH 4KGCD 2CV5D 1ID3B 3REJB 4WU9B 5CPID 4WZSB 3LZ1C 4G92B 1N1JA 4KHAB 4H9NB 1JFIA 3WAAC 5CP6C 4NE5A 4Z66A 4UUZA 4J8VC 3MGQD 5GXQC 1P3LC 1HQ3B 4WV4B 3REHB 5GT0C 1WWIA 5F99C 5CPJC 3MVDD 5CPKD 3LZ1B 1S32A 1KX3C 3KXBD 2LY8A 5B2IC 5G49A 3AYWC 1EQZC 4XUJC 5CP6B 3KUYD 3WAAB 3UTAA 5DNMA 4R8PD 3KWQD 3AZMD 5GSUC 4J8VB 1P3MD 4XZQA 5GT3A 5GXQB 1P3LB 3X1SA 3RELC 5GT0B 4YM6C 5F99B 4Z5TC 5CPJB 4QLCD 4ZUXC 1KX3B 2L5AA 3B6GD 5B2IB 3MGSA 2NQBD 3AYWB 1KU5A 5B24A 1P3OB 1EQZB 5JRGC 3AZND 5B1LD 4XUJB 5B33A 3VH5T 5GSUB 4KGCC 3B0CW 5AV8C 2F8NB 3AN2A 3VH6A 4YM6B 4Z5TB 1M19C 3W98D 5AVBA 1P3FD 1S32C 3B6FD 4ZUXB 4WU8C 1N1JB 5B31G 1JFIB 5JRGB 3AV2A 2IO5C 3UTAC 5DNMC 2PYOA 4UUZB 3WKJC 1H3OB 4KGCB 3WTPD 5AV8B 3MVDC 5AV5D 3AZED 3X1TA 3MGPA 3O62D 1M19B 3LELD 3MGRD 1M1AC 1S32B 4WU8B 1ID3A 3REJA 3UTBA 5B24C 2IO5B 5B33C 3UTAB 2AROD 5DNMB 4KHAA 5AV9A 3WKJB 1F66D 3MVDB 1P34C 3AN2C 3LJAD 1HQ3A 1M1AB 1A7WA 5KDMB 3AZFC 3KUYB 5B24B 3W96A 3AZJD 5B33B 2PYOC 3LZ0D 1TZYD 5B31A 4NE3A 1P34B 3W98C 5CP6A 3AN2B 3WAAA 3MGPC 3A6ND 5B0ZD 3V9RA 5GXQA 1P3LA 4KUDC 5DNND 5F99A 5CPJA 3AZGD 3AZFB 3UTBC 5E5AA 5B40A 1P3AA 1KX3A 3AZHA 5B2IA 3W97D 1P3ID 2PYOB 5AV9C 4YS3D 3AYWA 1P3OA 1EQZA 2YFVA 3NQUB 3LELC 3W98B 4XUJA 4Z2MH 1P3GA 3MGPB 4LD9D 5GSUA 3VH6T 1BH8B 4KUDB 5B0YD 4YM6A 3MNND 4Z5TA 3UTBB 3AZKC 2AROC 3NQJB 5B2JA 3W96C 5B1MD 4ZUXA 3REID 3AZEB 5AV9B 1M18D 1P3BA 1WWSA 5B31C 3X1UC 5JRGA 5AV6A 3AZID 4J8UA 3LELB 1U35A 3AFAD 1H3OA 2HIOA 4KGCA 2CV5A 5AV8A 5CPIA 1AOID 5AVCC 1HTAA 3TU4D 5E5AC 4CSRA 5B40C 1P3AC 4Z66D 2AROB 3LZ0C 3AZKB 1P3PD 1M19A 3W96B 3AZHC 4WU8A 3REKD 3A6NC 1P3OC 3X1UB 5B31B 3MGQA 3X1VC 1P3GC 2RVQC 3WKJA 3V9RB 4CAYB 3MVDA 3AV1D 5CPKA 5AVCB 3KXBA 5E5AB 1P3IC 5B40B 1P3AB 5B2JC 3LZ0B 2NZDD 1M1AA 3AZHB 3W99D 5KDMA 1KX5D 3KUYA 1P3BC 3A6NB 4R8PA 3KWQA 2YFVB 3AZMA 5AV6C 1U35C 4J8UC 3X1VB 1P3GB 2HIOC 2CV5C 3MGSD 5CPIC 5C3IC 1P34A 5B1MC 3REIC 2FJ7D 3UT9D 3B6GA 1P3IB 5B2JB 2NQBA 4E45A 3AZNA 3AZFA 1P3BB 3AFAC 5BT1D 3MGQC 5AV6B 1U35B 5AY8D 4J8UB 1AOIC 2HIOB 4HGAC 2CV5B 5CPIB 1P3PC 3B0DC 5C3IB 3NQUA 5CPKC 3W98A 5B1MB 3KXBC 3REIB 3B6FA 4CSRB 3C1CD 1BH8A 4J8WD 4KUDA 3X1TD 4H9OB 3KUYC 4DRBA 3NQJA 4R8PC 3KWQC 3AFAB 3AZMC 5B32G 3MGQB 1P3MC 4X23D 5AV5A 4J8XD 3AZEA 1AOIB 4WU9D 4HGAB 2BYKB 3B0DB 4QLCC 3O62A 3LELA 5CPKB 3MGRA 3VH6W 1P3PB 3KXBB 1BFMA 3B6GC 1BH9B 2NQBC 4H9PB 5JA4B 4NE6A 3AZNC 5B1LC 5BNVA 1P3KD 3AZKA 2AROA 4R8PB 3KWQB 3AZMB 1P3MB 1HQ3D 3REHD 1F66A 3LJAA 3UT9C 3X1UA 4QLCB 3LZ1D 1P3FC 3B6FC 3B6GB 4CAYA
chains in the Genus database with same CATH superfamily
5B32D 2NQBB 3B0CT 2Y2NA 3AZLD 5AVCA 3AZJA 5FUGB 5CP6D 3C1BD 3AZNB 3KFUG 5B1LB 4DQYB 3LZ0A 4J8VD 1TZYA 1KX4D 4JJND 3WTPC 2BYMA 5AV5C 3AZEC 2YFWB 5GT0D 1R4VA 3A6NA 5B0ZA 3UT9B 3O62C 3X1VA 3MGRC 1P3FB 1KX3D 3B6FB 4J8WC 5B2ID 5DNNA 3AZGA 3AYWD 3R45B 1TAFB 4XUJD 3W97A 1P3IA 4J8XC 3WA9D 2CWEA 3B0BA 5BS7A 1F66C 3WTPB 2F8ND 5AV5B 3RELD 1ZLAD 3AL0C 1B6WA 3LJAC 3EG5B 3VH5W 4LD9A 3O62B 4H9QA 4M6BA 3MGRB 4J8WB 3MNNA 1P3KC 3AZJC 5B1MA 3REIA 5BNVB 4X23B 4J8XB 1TZYC 1M18A 5AV8D 1F66B 3AZIA 4H9OA 5B0ZC 3LJAB 3AFAA 4NFTA 1M19D 5BO0A 4WNNB 1S32D 5B32C 3AZLC 1AOIA 4WU8D 5DNNC 3C1BC 3TU4A 3AZGC 2XD5A 1P3KB 2BYKA 1P3PA 2Y2GA 3AZJB 1KX4C 4JJNC 1BH9A 3UTAD 5DNMD 3REKA 3W97C 5BNXB 4YS3C 3WKJD 1TZYB 3IP4C 5GT3D 4XZQD 5BS7C 2BYMB 4H9PA 5JA4A 3P5JB 3X1SD 4H9SA 5B0ZB 4LD9C 4EO5C 1P3MA 4H9RA 1M1AD 4ZBJC 4DRAA 5B32B 3AV1A 3AZLB 5B0YC 5DNNB 3MNNC 3C1BB 3KSYA 3AZGB 5B24D 4QLCA 2HUEC 3WA9C 2NZDA 4AWLC 1KX4B 4JJNB 5B33D 1KX5A 3W97B 3W99A 1ZLAC 4YS3B 1M18C 2FFFB 3H0RC 5FUGA 1P34D 3AZIC 3AN2D 5B1LA 4LD9B 4EO5B 5AVBD 4H9QB 2W8SA 4ZBJB 2YFWA 3TU4C 5B0YB 3AZFD 3MNNB 3UT9A 2FJ7A 4Z66C 2HUEB 3AV2D 1P3FA 3WA9B 4AWLB 3WTPE 3REKC 2PYOD 3RELB 1ZLAB 2Y2JA 3R45A 1M18B 3EPJA 1TAFA 4H9SC 3AZIB 5AY8A 3MGPD 5BO0B 3WTPA 3AV1C 4KUDD 1ID3D 3REJD 3TU4B 3UTBD 4Z66B 3C1CA 2NZDC 2JSSA 4XZQC 5GT3C 4J8WA 3W99C 1KX5C 3REKB 3X1SC 5AV9D 2Y2MA 2G5IC 2RIQA 4X23A 4E44A 5G49B 4J8XA 4H9RB 3MGSC 4WU9A 4Z2MG 3AV1B 2FJ7C 3AZKD 1B67A 4WNNA 3W96D 4H9NA 2NZDB 2F8NK 2F8NG 1W2EA 4XZQB 5GT3B 1KX5B 3W99B 3X1SB 1P3KA 3X1UD 5B31D 5BT1C 3WAAD 5AVBC 5AY8C 3REHA 5BNXA 2F2AC 5GXQD 3MGSB 5CHLB 1P3LD 5AVCD 1F1EA 3LZ1A 3AV2C 5F99D 5CPJD 3EPKA 2FJ7B 5E5AD 3A1KA 5B40D 1P3AD 3C1CC 4G91C 5B32A 3VH5A 3AZHD 3AZLA 3C1BA 3X1TC 1P3OD 1EQZD 1ULYA 4J8VA 3X1VD 1KX4A 1P3GD 5AVBB 4JJNA 5AY8B 2RVQD 4X23C 5GT0A 5GSUD 4YS3A 1ID3C 3REJC 4WU9C 4YM6D 3AV2B 4Z5TD 2Y2KA 1Q9CA 4G92C 5B2JD 3C1CB 4G91B 4ZUXD 5B0YA 3X1TB 1P3BD 5JRGD 3WA9A 5AV6D 1U35D 4J8UD 1HQ3C 3REHC 2F8NA 3RELA 2HIOD 1ZLAA 2F8NH 4KGCD 2CV5D 1ID3B 3REJB 4WU9B 5CPID 4WZSB 3LZ1C 2ZY3A 4G92B 1N1JA 4KHAB 4H9NB 1JFIA 3WAAC 5CP6C 4NE5A 4Z66A 4UUZA 4J8VC 3MGQD 5GXQC 1P3LC 1HQ3B 4WV4B 3REHB 2DQNC 5GT0C 1WWIA 5F99C 5CPJC 3MVDD 5CPKD 3LZ1B 2G5HC 1S32A 1KX3C 3KXBD 2LY8A 5B2IC 5G49A 3AYWC 1EQZC 1T3UA 4XUJC 5CP6B 3KUYD 3WAAB 3UTAA 5DNMA 4R8PD 3KWQD 3AZMD 5GSUC 4J8VB 1P3MD 4XZQA 5GT3A 5GXQB 1P3LB 3X1SA 3RELC 5GT0B 4YM6C 5F99B 4Z5TC 5CPJB 1Z2CB 2JCHA 4QLCD 4ZUXC 1KX3B 2L5AA 3B6GD 5B2IB 2Y2PA 3MGSA 2NQBD 3AYWB 1KU5A 5B24A 1P3OB 1EQZB 5JRGC 3AZND 5B1LD 4XUJB 5B33A 3VH5T 5GSUB 4KGCC 3B0CW 5AV8C 2F8NB 3AN2A 3VH6A 4YM6B 4Z5TB 2ZY4A 1M19C 3W98D 5AVBA 1P3FD 1S32C 3B6FD 4ZUXB 4WU8C 1N1JB 5B31G 1JFIB 5JRGB 3AV2A 2IO5C 3UTAC 5DNMC 2PYOA 4UUZB 3WKJC 1H3OB 4KGCB 3WTPD 5AV8B 3MVDC 5AV5D 3AZED 3X1TA 3MGPA 2ZY5A 2Y2IA 3O62D 1M19B 3LELD 3MGRD 1M1AC 1S32B 4WU8B 1ID3A 3REJA 3UTBA 5B24C 2IO5B 5B33C 3UTAB 2AROD 2XD1A 4KHAA 5DNMB 5AV9A 3WKJB 1F66D 3MVDB 1P34C 3AN2C 3LJAD 1HQ3A 2ZY2A 1M1AB 1A7WA 5KDMB 3AZFC 3KUYB 5B24B 3W96A 3AZJD 2JE5A 5B33B 2PYOC 3LZ0D 1TZYD 1PZRA 4WJ3C 5B31A 4NE3A 1P34B 3W98C 5CP6A 3AN2B 3WAAA 3MGPC 3A6ND 5B0ZD 3V9RA 5GXQA 1P3LA 4KUDC 5DNND 2Y2QA 5F99A 5CPJA 3AZGD 3AZFB 3UTBC 5E5AA 5B40A 1P3AA 1KX3A 3AZHA 5B2IA 3W97D 1P3ID 2PYOB 5AV9C 4YS3D 3AYWA 1P3OA 1EQZA 2YFVA 3NQUB 3LELC 3W98B 4XUJA 4Z2MH 1P3GA 3MGPB 4LD9D 5GSUA 3VH6T 1BH8B 4KUDB 2VQRA 5B0YD 3H0MC 4YM6A 3MNND 4Z5TA 3UTBB 3AZKC 2AROC 3NQJB 2BG1A 5B2JA 3W96C 5B1MD 4ZUXA 3REID 3FDDA 3AZEB 5AV9B 1M18D 2Y2OA 1P3BA 1WWSA 5B31C 3X1UC 5JRGA 5AV6A 3AZID 4J8UA 3LELB 1U35A 3AFAD 1H3OA 2HIOA 4KGCA 2CV5A 5AV8A 5CPIA 1AOID 5AVCC 1HTAA 3TU4D 3F6TA 5E5AC 4CSRA 5B40C 1P3AC 4Z66D 2AROB 3LZ0C 3AZKB 1P3PD 1M19A 3W96B 3AZHC 4WU8A 3REKD 3A6NC 1P3OC 3X1UB 5B31B 3MGQA 3X1VC 1P3GC 2RVQC 3WKJA 3V9RB 4CAYB 3MVDA 3AV1D 2UWXA 5CPKA 5AVCB 3KXBA 5E5AB 1P3IC 5B40B 1P3AB 5B2JC 3LZ0B 2NZDD 1M1AA 3AZHB 3W99D 5KDMA 1KX5D 3KUYA 1P3BC 3A6NB 4R8PA 3KWQA 2YFVB 3AZMA 5AV6C 1U35C 4J8UC 3X1VB 1P3GB 2HIOC 2CV5C 3MGSD 5CPIC 5C3IC 1P34A 5B1MC 3REIC 2ZM5A 2FJ7D 3UT9D 3B6GA 1P3IB 5B2JB 2NQBA 4E45A 2Y2HA 3AZNA 3AZFA 1P3BB 3AFAC 2J8PA 5BT1D 3MGQC 5AV6B 1U35B 5AY8D 4J8UB 3EPLA 1AOIC 2HIOB 2DF4C 4HGAC 2CV5B 5CPIB 1P3PC 3B0DC 5C3IB 3NQUA 5CPKC 3W98A 2Y2LA 5B1MB 3KXBC 3REIB 3B6FA 4CSRB 3C1CD 1BH8A 4J8WD 4KUDA 3X1TD 4H9OB 3KUYC 4DRBA 3NQJA 4R8PC 3KWQC 3AFAB 3AZMC 5B32G 3MGQB 1P3MC 4X23D 5AV5A 4J8XD 3AZEA 1AOIB 4WU9D 4HGAB 2BYKB 3B0DB 4QLCC 3O62A 3LELA 5CPKB 3MGRA 3VH6W 1P3PB 3KXBB 1BFMA 3B6GC 1BH9B 2NQBC 4UPKA 4H9PB 5JA4B 4NE6A 3AZNC 3H0LC 5B1LC 5BNVA 1P3KD 3AZKA 2AROA 3A1IA 4R8PB 3KWQB 3AZMB 1P3MB 1HQ3D 3REHD 1F66A 3LJAA 3UT9C 3X1UA 3EPHA 4QLCB 3LZ1D 1P3FC 3B6FC 3B6GB 4CAYA
chains in the Genus database with same CATH topology
5B32D 2NQBB 3B0CT 2Y2NA 3AZLD 5AVCA 3AZJA 5FUGB 5CP6D 3C1BD 3AZNB 3KFUG 5B1LB 4DQYB 3LZ0A 4J8VD 1TZYA 1KX4D 4JJND 3WTPC 2BYMA 5AV5C 3AZEC 2YFWB 5GT0D 1R4VA 3A6NA 5B0ZA 3UT9B 3O62C 3X1VA 3MGRC 1P3FB 1KX3D 3B6FB 4J8WC 5B2ID 5DNNA 3AZGA 3AYWD 3R45B 1TAFB 4XUJD 3W97A 1P3IA 4J8XC 3WA9D 2CWEA 3B0BA 5BS7A 1F66C 3WTPB 2F8ND 5AV5B 3RELD 1ZLAD 3AL0C 1B6WA 3LJAC 3EG5B 3VH5W 4LD9A 3O62B 4H9QA 4M6BA 3MGRB 4J8WB 3MNNA 1P3KC 3AZJC 5B1MA 3REIA 5BNVB 4X23B 4J8XB 1TZYC 1M18A 5AV8D 1F66B 3AZIA 4H9OA 5B0ZC 3LJAB 3AFAA 4NFTA 1M19D 5BO0A 4WNNB 1S32D 5B32C 3AZLC 1AOIA 4WU8D 5DNNC 3C1BC 3TU4A 3AZGC 2XD5A 1P3KB 2BYKA 1P3PA 2Y2GA 3AZJB 1KX4C 4JJNC 1BH9A 3UTAD 5DNMD 3REKA 3W97C 5BNXB 4YS3C 3WKJD 1TZYB 3IP4C 5GT3D 4XZQD 5BS7C 2BYMB 4H9PA 5JA4A 3P5JB 3X1SD 4H9SA 5B0ZB 4LD9C 4EO5C 1P3MA 4H9RA 1M1AD 4ZBJC 4DRAA 5B32B 3AV1A 3AZLB 5B0YC 5DNNB 3MNNC 3C1BB 3KSYA 3AZGB 5B24D 4QLCA 2HUEC 3WA9C 2NZDA 4AWLC 1KX4B 4JJNB 5B33D 1KX5A 3W97B 3W99A 1ZLAC 4YS3B 1M18C 2FFFB 3H0RC 5FUGA 1P34D 3AZIC 3AN2D 5B1LA 4LD9B 4EO5B 5AVBD 4H9QB 2W8SA 4ZBJB 2YFWA 3TU4C 5B0YB 3AZFD 3MNNB 3UT9A 2FJ7A 4Z66C 2HUEB 3AV2D 1P3FA 3WA9B 4AWLB 3WTPE 3REKC 2PYOD 3RELB 1ZLAB 2Y2JA 3R45A 1M18B 3EPJA 1TAFA 4H9SC 3AZIB 5AY8A 3MGPD 5BO0B 3WTPA 3AV1C 4KUDD 1ID3D 3REJD 3TU4B 3UTBD 4Z66B 3C1CA 2NZDC 2JSSA 4XZQC 5GT3C 4J8WA 3W99C 1KX5C 3REKB 3X1SC 5AV9D 2Y2MA 2G5IC 2RIQA 4X23A 4E44A 5G49B 4J8XA 4H9RB 3MGSC 4WU9A 4Z2MG 3AV1B 2FJ7C 3AZKD 1B67A 4WNNA 3W96D 4H9NA 2NZDB 2F8NK 2F8NG 1W2EA 4XZQB 5GT3B 1KX5B 3W99B 3X1SB 1P3KA 3X1UD 5B31D 5BT1C 3WAAD 5AVBC 5AY8C 3REHA 5BNXA 2F2AC 5GXQD 3MGSB 5CHLB 1P3LD 5AVCD 1F1EA 3LZ1A 3AV2C 5F99D 5CPJD 3EPKA 2FJ7B 5E5AD 3A1KA 5B40D 1P3AD 3C1CC 4G91C 5B32A 3VH5A 3AZHD 3AZLA 3C1BA 3X1TC 1P3OD 1EQZD 1ULYA 4J8VA 3X1VD 1KX4A 1P3GD 5AVBB 4JJNA 5AY8B 2RVQD 4X23C 5GT0A 5GSUD 4YS3A 1ID3C 3REJC 4WU9C 4YM6D 3AV2B 4Z5TD 2Y2KA 1Q9CA 4G92C 5B2JD 3C1CB 4G91B 4ZUXD 5B0YA 3X1TB 1P3BD 5JRGD 3WA9A 5AV6D 1U35D 4J8UD 1HQ3C 3REHC 2F8NA 3RELA 2HIOD 1ZLAA 2F8NH 4KGCD 2CV5D 1ID3B 3REJB 4WU9B 5CPID 4WZSB 3LZ1C 2ZY3A 4G92B 1N1JA 4KHAB 4H9NB 1JFIA 3WAAC 5CP6C 4NE5A 4Z66A 4UUZA 4J8VC 3MGQD 5GXQC 1P3LC 1HQ3B 4WV4B 3REHB 2DQNC 5GT0C 1WWIA 5F99C 5CPJC 3MVDD 5CPKD 3LZ1B 2G5HC 1S32A 1KX3C 3KXBD 2LY8A 5B2IC 5G49A 3AYWC 1EQZC 1T3UA 4XUJC 5CP6B 3KUYD 3WAAB 3UTAA 5DNMA 4R8PD 3KWQD 3AZMD 5GSUC 4J8VB 1P3MD 4XZQA 5GT3A 5GXQB 1P3LB 3X1SA 3RELC 5GT0B 4YM6C 5F99B 4Z5TC 5CPJB 1Z2CB 2JCHA 4QLCD 4ZUXC 1KX3B 2L5AA 3B6GD 5B2IB 2Y2PA 3MGSA 2NQBD 3AYWB 1KU5A 5B24A 1P3OB 1EQZB 5JRGC 3AZND 5B1LD 4XUJB 5B33A 3VH5T 5GSUB 4KGCC 3B0CW 5AV8C 2F8NB 3AN2A 3VH6A 4YM6B 4Z5TB 2ZY4A 1M19C 3W98D 5AVBA 1P3FD 1S32C 3B6FD 4ZUXB 4WU8C 1N1JB 5B31G 1JFIB 5JRGB 3AV2A 2IO5C 3UTAC 5DNMC 2PYOA 4UUZB 3WKJC 1H3OB 4KGCB 3WTPD 5AV8B 3MVDC 5AV5D 3AZED 3X1TA 3MGPA 2ZY5A 2Y2IA 3O62D 1M19B 3LELD 3MGRD 1M1AC 1S32B 4WU8B 1ID3A 3REJA 3UTBA 5B24C 2IO5B 5B33C 3UTAB 2AROD 2XD1A 4KHAA 5DNMB 5AV9A 3WKJB 1F66D 3MVDB 1P34C 3AN2C 3LJAD 1HQ3A 2ZY2A 1M1AB 1A7WA 5KDMB 3AZFC 3KUYB 5B24B 3W96A 3AZJD 2JE5A 5B33B 2PYOC 3LZ0D 1TZYD 1PZRA 4WJ3C 5B31A 4NE3A 1P34B 3W98C 5CP6A 3AN2B 3WAAA 3MGPC 3A6ND 5B0ZD 3V9RA 5GXQA 1P3LA 4KUDC 5DNND 2Y2QA 5F99A 5CPJA 3AZGD 3AZFB 3UTBC 5E5AA 5B40A 1P3AA 1KX3A 3AZHA 5B2IA 3W97D 1P3ID 2PYOB 5AV9C 4YS3D 3AYWA 1P3OA 1EQZA 2YFVA 3NQUB 3LELC 3W98B 4XUJA 4Z2MH 1P3GA 3MGPB 4LD9D 5GSUA 3VH6T 1BH8B 4KUDB 2VQRA 5B0YD 3H0MC 4YM6A 3MNND 4Z5TA 3UTBB 3AZKC 2AROC 3NQJB 2BG1A 5B2JA 3W96C 5B1MD 4ZUXA 3REID 3FDDA 3AZEB 5AV9B 1M18D 2Y2OA 1P3BA 1WWSA 5B31C 3X1UC 5JRGA 5AV6A 3AZID 4J8UA 3LELB 1U35A 3AFAD 1H3OA 2HIOA 4KGCA 2CV5A 5AV8A 5CPIA 1AOID 5AVCC 1HTAA 3TU4D 3F6TA 5E5AC 4CSRA 5B40C 1P3AC 4Z66D 2AROB 3LZ0C 3AZKB 1P3PD 1M19A 3W96B 3AZHC 4WU8A 3REKD 3A6NC 1P3OC 3X1UB 5B31B 3MGQA 3X1VC 1P3GC 2RVQC 3WKJA 3V9RB 4CAYB 3MVDA 3AV1D 2UWXA 5CPKA 5AVCB 3KXBA 5E5AB 1P3IC 5B40B 1P3AB 5B2JC 3LZ0B 2NZDD 1M1AA 3AZHB 3W99D 5KDMA 1KX5D 3KUYA 1P3BC 3A6NB 4R8PA 3KWQA 2YFVB 3AZMA 5AV6C 1U35C 4J8UC 3X1VB 1P3GB 2HIOC 2CV5C 3MGSD 5CPIC 5C3IC 1P34A 5B1MC 3REIC 2ZM5A 2FJ7D 3UT9D 3B6GA 1P3IB 5B2JB 2NQBA 4E45A 2Y2HA 3AZNA 3AZFA 1P3BB 3AFAC 2J8PA 5BT1D 3MGQC 5AV6B 1U35B 5AY8D 4J8UB 3EPLA 1AOIC 2HIOB 2DF4C 4HGAC 2CV5B 5CPIB 1P3PC 3B0DC 5C3IB 3NQUA 5CPKC 3W98A 2Y2LA 5B1MB 3KXBC 3REIB 3B6FA 4CSRB 3C1CD 1BH8A 4J8WD 4KUDA 3X1TD 4H9OB 3KUYC 4DRBA 3NQJA 4R8PC 3KWQC 3AFAB 3AZMC 5B32G 3MGQB 1P3MC 4X23D 5AV5A 4J8XD 3AZEA 1AOIB 4WU9D 4HGAB 2BYKB 3B0DB 4QLCC 3O62A 3LELA 5CPKB 3MGRA 3VH6W 1P3PB 3KXBB 1BFMA 3B6GC 1BH9B 2NQBC 4UPKA 4H9PB 5JA4B 4NE6A 3AZNC 3H0LC 5B1LC 5BNVA 1P3KD 3AZKA 2AROA 3A1IA 4R8PB 3KWQB 3AZMB 1P3MB 1HQ3D 3REHD 1F66A 3LJAA 3UT9C 3X1UA 3EPHA 4QLCB 3LZ1D 1P3FC 3B6FC 3B6GB 4CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 D;  2NQB B;  3B0C T;  3AZL D;  5AVC A;  3AZJ A;  5FUG B;  5CP6 D;  3C1B D;  3AZN B;  5B1L B;  3LZ0 A;  4J8V D;  1TZY A;  1KX4 D;  4JJN D;  3WTP C;  2BYM A;  5AV5 C;  3AZE C;  2YFW B;  5GT0 D;  1R4V A;  3A6N A;  5B0Z A;  3UT9 B;  3O62 C;  3X1V A;  3MGR C;  1P3F B;  1KX3 D;  3B6F B;  4J8W C;  5B2I D;  5DNN A;  3AZG A;  3AYW D;  3R45 B;  1TAF B;  4XUJ D;  3W97 A;  1P3I A;  4J8X C;  3WA9 D;  2CWE A;  3B0B A;  5BS7 A;  1F66 C;  3WTP B;  2F8N D;  5AV5 B;  3REL D;  1ZLA D;  1B6W A;  3LJA C;  3VH5 W;  4LD9 A;  3O62 B;  4H9Q A;  4M6B A;  3MGR B;  4J8W B;  3MNN A;  1P3K C;  3AZJ C;  5B1M A;  3REI A;  5BNV B;  4X23 B;  4J8X B;  1TZY C;  1M18 A;  5AV8 D;  1F66 B;  3AZI A;  4H9O A;  5B0Z C;  3LJA B;  3AFA A;  4NFT A;  1M19 D;  5BO0 A;  4WNN B;  1S32 D;  5B32 C;  3AZL C;  1AOI A;  4WU8 D;  5DNN C;  3C1B C;  3TU4 A;  3AZG C;  1P3K B;  2BYK A;  1P3P A;  3AZJ B;  1KX4 C;  4JJN C;  1BH9 A;  3UTA D;  5DNM D;  3REK A;  3W97 C;  5BNX B;  4YS3 C;  3WKJ D;  1TZY B;  4XZQ D;  5GT3 D;  5BS7 C;  2BYM B;  4H9P A;  5JA4 A;  3X1S D;  4H9S A;  5B0Z B;  4LD9 C;  4EO5 C;  1P3M A;  4H9R A;  1M1A D;  4ZBJ C;  4DRA A;  5B32 B;  3AV1 A;  3AZL B;  5B0Y C;  5DNN B;  3MNN C;  3C1B B;  3KSY A;  3AZG B;  5B24 D;  4QLC A;  2HUE C;  3WA9 C;  2NZD A;  4AWL C;  1KX4 B;  4JJN B;  5B33 D;  1KX5 A;  3W97 B;  3W99 A;  1ZLA C;  4YS3 B;  1M18 C;  5FUG A;  1P34 D;  3AZI C;  3AN2 D;  5B1L A;  4LD9 B;  4EO5 B;  5AVB D;  4H9Q B;  4ZBJ B;  2YFW A;  3TU4 C;  5B0Y B;  3AZF D;  3MNN B;  3UT9 A;  2FJ7 A;  4Z66 C;  2HUE B;  3AV2 D;  1P3F A;  3WA9 B;  4AWL B;  3WTP E;  3REK C;  2PYO D;  3REL B;  1ZLA B;  3R45 A;  1M18 B;  1TAF A;  4H9S C;  3AZI B;  5AY8 A;  3MGP D;  5BO0 B;  3WTP A;  3AV1 C;  4KUD D;  1ID3 D;  3REJ D;  3TU4 B;  3UTB D;  4Z66 B;  3C1C A;  2NZD C;  2JSS A;  4XZQ C;  5GT3 C;  4J8W A;  3W99 C;  1KX5 C;  3REK B;  3X1S C;  5AV9 D;  4X23 A;  4E44 A;  5G49 B;  4J8X A;  4H9R B;  3MGS C;  4WU9 A;  4Z2M G;  3AV1 B;  2FJ7 C;  3AZK D;  1B67 A;  4WNN A;  3W96 D;  4H9N A;  2NZD B;  2F8N K;  2F8N G;  4XZQ B;  5GT3 B;  1KX5 B;  3W99 B;  3X1S B;  1P3K A;  3X1U D;  5B31 D;  5BT1 C;  3WAA D;  5AVB C;  5AY8 C;  3REH A;  5BNX A;  5GXQ D;  3MGS B;  5CHL B;  1P3L D;  5AVC D;  1F1E A;  3LZ1 A;  3AV2 C;  5F99 D;  5CPJ D;  2FJ7 B;  5E5A D;  5B40 D;  1P3A D;  3C1C C;  4G91 C;  5B32 A;  3VH5 A;  3AZH D;  3AZL A;  3C1B A;  3X1T C;  1P3O D;  1EQZ D;  1ULY A;  4J8V A;  3X1V D;  1KX4 A;  1P3G D;  5AVB B;  4JJN A;  5AY8 B;  2RVQ D;  4X23 C;  5GT0 A;  5GSU D;  4YS3 A;  1ID3 C;  3REJ C;  4WU9 C;  4YM6 D;  3AV2 B;  4Z5T D;  1Q9C A;  4G92 C;  5B2J D;  3C1C B;  4G91 B;  4ZUX D;  5B0Y A;  3X1T B;  1P3B D;  5JRG D;  3WA9 A;  5AV6 D;  1U35 D;  4J8U D;  1HQ3 C;  3REH C;  2F8N A;  3REL A;  2HIO D;  1ZLA A;  2F8N H;  4KGC D;  2CV5 D;  1ID3 B;  3REJ B;  4WU9 B;  5CPI D;  4WZS B;  3LZ1 C;  4G92 B;  1N1J A;  4KHA B;  4H9N B;  1JFI A;  3WAA C;  5CP6 C;  4NE5 A;  4Z66 A;  4UUZ A;  4J8V C;  3MGQ D;  5GXQ C;  1P3L C;  1HQ3 B;  4WV4 B;  3REH B;  5GT0 C;  1WWI A;  5F99 C;  5CPJ C;  3MVD D;  5CPK D;  3LZ1 B;  1S32 A;  1KX3 C;  3KXB D;  2LY8 A;  5B2I C;  5G49 A;  3AYW C;  1EQZ C;  4XUJ C;  5CP6 B;  3KUY D;  3WAA B;  3UTA A;  5DNM A;  4R8P D;  3KWQ D;  3AZM D;  5GSU C;  4J8V B;  1P3M D;  4XZQ A;  5GT3 A;  5GXQ B;  1P3L B;  3X1S A;  3REL C;  5GT0 B;  4YM6 C;  5F99 B;  4Z5T C;  5CPJ B;  4QLC D;  4ZUX C;  1KX3 B;  2L5A A;  3B6G D;  5B2I B;  3MGS A;  2NQB D;  3AYW B;  1KU5 A;  5B24 A;  1P3O B;  1EQZ B;  5JRG C;  3AZN D;  5B1L D;  4XUJ B;  5B33 A;  3VH5 T;  5GSU B;  4KGC C;  3B0C W;  5AV8 C;  2F8N B;  3AN2 A;  3VH6 A;  4YM6 B;  4Z5T B;  1M19 C;  3W98 D;  5AVB A;  1P3F D;  1S32 C;  3B6F D;  4ZUX B;  4WU8 C;  1N1J B;  5B31 G;  1JFI B;  5JRG B;  3AV2 A;  2IO5 C;  3UTA C;  5DNM C;  2PYO A;  4UUZ B;  3WKJ C;  1H3O B;  4KGC B;  3WTP D;  5AV8 B;  3MVD C;  5AV5 D;  3AZE D;  3X1T A;  3MGP A;  3O62 D;  1M19 B;  3LEL D;  3MGR D;  1M1A C;  1S32 B;  4WU8 B;  1ID3 A;  3REJ A;  3UTB A;  5B24 C;  2IO5 B;  5B33 C;  3UTA B;  2ARO D;  5DNM B;  4KHA A;  5AV9 A;  3WKJ B;  1F66 D;  3MVD B;  1P34 C;  3AN2 C;  3LJA D;  1HQ3 A;  1M1A B;  1A7W A;  5KDM B;  3AZF C;  3KUY B;  5B24 B;  3W96 A;  3AZJ D;  5B33 B;  2PYO C;  3LZ0 D;  1TZY D;  5B31 A;  4NE3 A;  1P34 B;  3W98 C;  5CP6 A;  3AN2 B;  3WAA A;  3MGP C;  3A6N D;  5B0Z D;  3V9R A;  5GXQ A;  1P3L A;  4KUD C;  5DNN D;  5F99 A;  5CPJ A;  3AZG D;  3AZF B;  3UTB C;  5E5A A;  5B40 A;  1P3A A;  1KX3 A;  3AZH A;  5B2I A;  3W97 D;  1P3I D;  2PYO B;  5AV9 C;  4YS3 D;  3AYW A;  1P3O A;  1EQZ A;  2YFV A;  3NQU B;  3LEL C;  3W98 B;  4XUJ A;  4Z2M H;  1P3G A;  3MGP B;  4LD9 D;  5GSU A;  3VH6 T;  1BH8 B;  4KUD B;  5B0Y D;  4YM6 A;  3MNN D;  4Z5T A;  3UTB B;  3AZK C;  2ARO C;  3NQJ B;  5B2J A;  3W96 C;  5B1M D;  4ZUX A;  3REI D;  3AZE B;  5AV9 B;  1M18 D;  1P3B A;  1WWS A;  5B31 C;  3X1U C;  5JRG A;  5AV6 A;  3AZI D;  4J8U A;  3LEL B;  1U35 A;  3AFA D;  1H3O A;  2HIO A;  4KGC A;  2CV5 A;  5AV8 A;  5CPI A;  1AOI D;  5AVC C;  1HTA A;  3TU4 D;  5E5A C;  4CSR A;  5B40 C;  1P3A C;  4Z66 D;  2ARO B;  3LZ0 C;  3AZK B;  1P3P D;  1M19 A;  3W96 B;  3AZH C;  4WU8 A;  3REK D;  3A6N C;  1P3O C;  3X1U B;  5B31 B;  3MGQ A;  3X1V C;  1P3G C;  2RVQ C;  3WKJ A;  3V9R B;  4CAY B;  3MVD A;  3AV1 D;  5CPK A;  5AVC B;  3KXB A;  5E5A B;  1P3I C;  5B40 B;  1P3A B;  5B2J C;  3LZ0 B;  2NZD D;  1M1A A;  3AZH B;  3W99 D;  5KDM A;  1KX5 D;  3KUY A;  1P3B C;  3A6N B;  4R8P A;  3KWQ A;  2YFV B;  3AZM A;  5AV6 C;  1U35 C;  4J8U C;  3X1V B;  1P3G B;  2HIO C;  2CV5 C;  3MGS D;  5CPI C;  5C3I C;  1P34 A;  5B1M C;  3REI C;  2FJ7 D;  3UT9 D;  3B6G A;  1P3I B;  5B2J B;  2NQB A;  4E45 A;  3AZN A;  3AZF A;  1P3B B;  3AFA C;  5BT1 D;  3MGQ C;  5AV6 B;  1U35 B;  5AY8 D;  4J8U B;  1AOI C;  2HIO B;  4HGA C;  2CV5 B;  5CPI B;  1P3P C;  3B0D C;  5C3I B;  3NQU A;  5CPK C;  3W98 A;  5B1M B;  3KXB C;  3REI B;  3B6F A;  4CSR B;  3C1C D;  1BH8 A;  4J8W D;  4KUD A;  3X1T D;  4H9O B;  3KUY C;  4DRB A;  3NQJ A;  4R8P C;  3KWQ C;  3AFA B;  3AZM C;  5B32 G;  3MGQ B;  1P3M C;  4X23 D;  5AV5 A;  4J8X D;  3AZE A;  1AOI B;  4WU9 D;  4HGA B;  2BYK B;  3B0D B;  4QLC C;  3O62 A;  3LEL A;  5CPK B;  3MGR A;  3VH6 W;  1P3P B;  3KXB B;  1BFM A;  3B6G C;  1BH9 B;  2NQB C;  4H9P B;  5JA4 B;  4NE6 A;  3AZN C;  5B1L C;  5BNV A;  1P3K D;  3AZK A;  2ARO A;  4R8P B;  3KWQ B;  3AZM B;  1P3M B;  1HQ3 D;  3REH D;  1F66 A;  3LJA A;  3UT9 C;  3X1U A;  4QLC B;  3LZ1 D;  1P3F C;  3B6F C;  3B6G B;  4CAY A; 
#chains in the Genus database with same CATH topology
 5B32 D;  2NQB B;  3B0C T;  2Y2N A;  3AZL D;  5AVC A;  3AZJ A;  5FUG B;  5CP6 D;  3C1B D;  3AZN B;  3KFU G;  5B1L B;  4DQY B;  3LZ0 A;  4J8V D;  1TZY A;  1KX4 D;  4JJN D;  3WTP C;  2BYM A;  5AV5 C;  3AZE C;  2YFW B;  5GT0 D;  1R4V A;  3A6N A;  5B0Z A;  3UT9 B;  3O62 C;  3X1V A;  3MGR C;  1P3F B;  1KX3 D;  3B6F B;  4J8W C;  5B2I D;  5DNN A;  3AZG A;  3AYW D;  3R45 B;  1TAF B;  4XUJ D;  3W97 A;  1P3I A;  4J8X C;  3WA9 D;  2CWE A;  3B0B A;  5BS7 A;  1F66 C;  3WTP B;  2F8N D;  5AV5 B;  3REL D;  1ZLA D;  3AL0 C;  1B6W A;  3LJA C;  3EG5 B;  3VH5 W;  4LD9 A;  3O62 B;  4H9Q A;  4M6B A;  3MGR B;  4J8W B;  3MNN A;  1P3K C;  3AZJ C;  5B1M A;  3REI A;  5BNV B;  4X23 B;  4J8X B;  1TZY C;  1M18 A;  5AV8 D;  1F66 B;  3AZI A;  4H9O A;  5B0Z C;  3LJA B;  3AFA A;  4NFT A;  1M19 D;  5BO0 A;  4WNN B;  1S32 D;  5B32 C;  3AZL C;  1AOI A;  4WU8 D;  5DNN C;  3C1B C;  3TU4 A;  3AZG C;  2XD5 A;  1P3K B;  2BYK A;  1P3P A;  2Y2G A;  3AZJ B;  1KX4 C;  4JJN C;  1BH9 A;  3UTA D;  5DNM D;  3REK A;  3W97 C;  5BNX B;  4YS3 C;  3WKJ D;  1TZY B;  3IP4 C;  5GT3 D;  4XZQ D;  5BS7 C;  2BYM B;  4H9P A;  5JA4 A;  3P5J B;  3X1S D;  4H9S A;  5B0Z B;  4LD9 C;  4EO5 C;  1P3M A;  4H9R A;  1M1A D;  4ZBJ C;  4DRA A;  5B32 B;  3AV1 A;  3AZL B;  5B0Y C;  5DNN B;  3MNN C;  3C1B B;  3KSY A;  3AZG B;  5B24 D;  4QLC A;  2HUE C;  3WA9 C;  2NZD A;  4AWL C;  1KX4 B;  4JJN B;  5B33 D;  1KX5 A;  3W97 B;  3W99 A;  1ZLA C;  4YS3 B;  1M18 C;  2FFF B;  3H0R C;  5FUG A;  1P34 D;  3AZI C;  3AN2 D;  5B1L A;  4LD9 B;  4EO5 B;  5AVB D;  4H9Q B;  2W8S A;  4ZBJ B;  2YFW A;  3TU4 C;  5B0Y B;  3AZF D;  3MNN B;  3UT9 A;  2FJ7 A;  4Z66 C;  2HUE B;  3AV2 D;  1P3F A;  3WA9 B;  4AWL B;  3WTP E;  3REK C;  2PYO D;  3REL B;  1ZLA B;  2Y2J A;  3R45 A;  1M18 B;  3EPJ A;  1TAF A;  4H9S C;  3AZI B;  5AY8 A;  3MGP D;  5BO0 B;  3WTP A;  3AV1 C;  4KUD D;  1ID3 D;  3REJ D;  3TU4 B;  3UTB D;  4Z66 B;  3C1C A;  2NZD C;  2JSS A;  4XZQ C;  5GT3 C;  4J8W A;  3W99 C;  1KX5 C;  3REK B;  3X1S C;  5AV9 D;  2Y2M A;  2G5I C;  2RIQ A;  4X23 A;  4E44 A;  5G49 B;  4J8X A;  4H9R B;  3MGS C;  4WU9 A;  4Z2M G;  3AV1 B;  2FJ7 C;  3AZK D;  1B67 A;  4WNN A;  3W96 D;  4H9N A;  2NZD B;  2F8N K;  2F8N G;  1W2E A;  4XZQ B;  5GT3 B;  1KX5 B;  3W99 B;  3X1S B;  1P3K A;  3X1U D;  5B31 D;  5BT1 C;  3WAA D;  5AVB C;  5AY8 C;  3REH A;  5BNX A;  2F2A C;  5GXQ D;  3MGS B;  5CHL B;  1P3L D;  5AVC D;  1F1E A;  3LZ1 A;  3AV2 C;  5F99 D;  5CPJ D;  3EPK A;  2FJ7 B;  5E5A D;  3A1K A;  5B40 D;  1P3A D;  3C1C C;  4G91 C;  5B32 A;  3VH5 A;  3AZH D;  3AZL A;  3C1B A;  3X1T C;  1P3O D;  1EQZ D;  1ULY A;  4J8V A;  3X1V D;  1KX4 A;  1P3G D;  5AVB B;  4JJN A;  5AY8 B;  2RVQ D;  4X23 C;  5GT0 A;  5GSU D;  4YS3 A;  1ID3 C;  3REJ C;  4WU9 C;  4YM6 D;  3AV2 B;  4Z5T D;  2Y2K A;  1Q9C A;  4G92 C;  5B2J D;  3C1C B;  4G91 B;  4ZUX D;  5B0Y A;  3X1T B;  1P3B D;  5JRG D;  3WA9 A;  5AV6 D;  1U35 D;  4J8U D;  1HQ3 C;  3REH C;  2F8N A;  3REL A;  2HIO D;  1ZLA A;  2F8N H;  4KGC D;  2CV5 D;  1ID3 B;  3REJ B;  4WU9 B;  5CPI D;  4WZS B;  3LZ1 C;  2ZY3 A;  4G92 B;  1N1J A;  4KHA B;  4H9N B;  1JFI A;  3WAA C;  5CP6 C;  4NE5 A;  4Z66 A;  4UUZ A;  4J8V C;  3MGQ D;  5GXQ C;  1P3L C;  1HQ3 B;  4WV4 B;  3REH B;  2DQN C;  5GT0 C;  1WWI A;  5F99 C;  5CPJ C;  3MVD D;  5CPK D;  3LZ1 B;  2G5H C;  1S32 A;  1KX3 C;  3KXB D;  2LY8 A;  5B2I C;  5G49 A;  3AYW C;  1EQZ C;  1T3U A;  4XUJ C;  5CP6 B;  3KUY D;  3WAA B;  3UTA A;  5DNM A;  4R8P D;  3KWQ D;  3AZM D;  5GSU C;  4J8V B;  1P3M D;  4XZQ A;  5GT3 A;  5GXQ B;  1P3L B;  3X1S A;  3REL C;  5GT0 B;  4YM6 C;  5F99 B;  4Z5T C;  5CPJ B;  1Z2C B;  2JCH A;  4QLC D;  4ZUX C;  1KX3 B;  2L5A A;  3B6G D;  5B2I B;  2Y2P A;  3MGS A;  2NQB D;  3AYW B;  1KU5 A;  5B24 A;  1P3O B;  1EQZ B;  5JRG C;  3AZN D;  5B1L D;  4XUJ B;  5B33 A;  3VH5 T;  5GSU B;  4KGC C;  3B0C W;  5AV8 C;  2F8N B;  3AN2 A;  3VH6 A;  4YM6 B;  4Z5T B;  2ZY4 A;  1M19 C;  3W98 D;  5AVB A;  1P3F D;  1S32 C;  3B6F D;  4ZUX B;  4WU8 C;  1N1J B;  5B31 G;  1JFI B;  5JRG B;  3AV2 A;  2IO5 C;  3UTA C;  5DNM C;  2PYO A;  4UUZ B;  3WKJ C;  1H3O B;  4KGC B;  3WTP D;  5AV8 B;  3MVD C;  5AV5 D;  3AZE D;  3X1T A;  3MGP A;  2ZY5 A;  2Y2I A;  3O62 D;  1M19 B;  3LEL D;  3MGR D;  1M1A C;  1S32 B;  4WU8 B;  1ID3 A;  3REJ A;  3UTB A;  5B24 C;  2IO5 B;  5B33 C;  3UTA B;  2ARO D;  2XD1 A;  4KHA A;  5DNM B;  5AV9 A;  3WKJ B;  1F66 D;  3MVD B;  1P34 C;  3AN2 C;  3LJA D;  1HQ3 A;  2ZY2 A;  1M1A B;  1A7W A;  5KDM B;  3AZF C;  3KUY B;  5B24 B;  3W96 A;  3AZJ D;  2JE5 A;  5B33 B;  2PYO C;  3LZ0 D;  1TZY D;  1PZR A;  4WJ3 C;  5B31 A;  4NE3 A;  1P34 B;  3W98 C;  5CP6 A;  3AN2 B;  3WAA A;  3MGP C;  3A6N D;  5B0Z D;  3V9R A;  5GXQ A;  1P3L A;  4KUD C;  5DNN D;  2Y2Q A;  5F99 A;  5CPJ A;  3AZG D;  3AZF B;  3UTB C;  5E5A A;  5B40 A;  1P3A A;  1KX3 A;  3AZH A;  5B2I A;  3W97 D;  1P3I D;  2PYO B;  5AV9 C;  4YS3 D;  3AYW A;  1P3O A;  1EQZ A;  2YFV A;  3NQU B;  3LEL C;  3W98 B;  4XUJ A;  4Z2M H;  1P3G A;  3MGP B;  4LD9 D;  5GSU A;  3VH6 T;  1BH8 B;  4KUD B;  2VQR A;  5B0Y D;  3H0M C;  4YM6 A;  3MNN D;  4Z5T A;  3UTB B;  3AZK C;  2ARO C;  3NQJ B;  2BG1 A;  5B2J A;  3W96 C;  5B1M D;  4ZUX A;  3REI D;  3FDD A;  3AZE B;  5AV9 B;  1M18 D;  2Y2O A;  1P3B A;  1WWS A;  5B31 C;  3X1U C;  5JRG A;  5AV6 A;  3AZI D;  4J8U A;  3LEL B;  1U35 A;  3AFA D;  1H3O A;  2HIO A;  4KGC A;  2CV5 A;  5AV8 A;  5CPI A;  1AOI D;  5AVC C;  1HTA A;  3TU4 D;  3F6T A;  5E5A C;  4CSR A;  5B40 C;  1P3A C;  4Z66 D;  2ARO B;  3LZ0 C;  3AZK B;  1P3P D;  1M19 A;  3W96 B;  3AZH C;  4WU8 A;  3REK D;  3A6N C;  1P3O C;  3X1U B;  5B31 B;  3MGQ A;  3X1V C;  1P3G C;  2RVQ C;  3WKJ A;  3V9R B;  4CAY B;  3MVD A;  3AV1 D;  2UWX A;  5CPK A;  5AVC B;  3KXB A;  5E5A B;  1P3I C;  5B40 B;  1P3A B;  5B2J C;  3LZ0 B;  2NZD D;  1M1A A;  3AZH B;  3W99 D;  5KDM A;  1KX5 D;  3KUY A;  1P3B C;  3A6N B;  4R8P A;  3KWQ A;  2YFV B;  3AZM A;  5AV6 C;  1U35 C;  4J8U C;  3X1V B;  1P3G B;  2HIO C;  2CV5 C;  3MGS D;  5CPI C;  5C3I C;  1P34 A;  5B1M C;  3REI C;  2ZM5 A;  2FJ7 D;  3UT9 D;  3B6G A;  1P3I B;  5B2J B;  2NQB A;  4E45 A;  2Y2H A;  3AZN A;  3AZF A;  1P3B B;  3AFA C;  2J8P A;  5BT1 D;  3MGQ C;  5AV6 B;  1U35 B;  5AY8 D;  4J8U B;  3EPL A;  1AOI C;  2HIO B;  2DF4 C;  4HGA C;  2CV5 B;  5CPI B;  1P3P C;  3B0D C;  5C3I B;  3NQU A;  5CPK C;  3W98 A;  2Y2L A;  5B1M B;  3KXB C;  3REI B;  3B6F A;  4CSR B;  3C1C D;  1BH8 A;  4J8W D;  4KUD A;  3X1T D;  4H9O B;  3KUY C;  4DRB A;  3NQJ A;  4R8P C;  3KWQ C;  3AFA B;  3AZM C;  5B32 G;  3MGQ B;  1P3M C;  4X23 D;  5AV5 A;  4J8X D;  3AZE A;  1AOI B;  4WU9 D;  4HGA B;  2BYK B;  3B0D B;  4QLC C;  3O62 A;  3LEL A;  5CPK B;  3MGR A;  3VH6 W;  1P3P B;  3KXB B;  1BFM A;  3B6G C;  1BH9 B;  2NQB C;  4UPK A;  4H9P B;  5JA4 B;  4NE6 A;  3AZN C;  3H0L C;  5B1L C;  5BNV A;  1P3K D;  3AZK A;  2ARO A;  3A1I A;  4R8P B;  3KWQ B;  3AZM B;  1P3M B;  1HQ3 D;  3REH D;  1F66 A;  3LJA A;  3UT9 C;  3X1U A;  3EPH A;  4QLC B;  3LZ1 D;  1P3F C;  3B6F C;  3B6G B;  4CAY A; 
#chains in the Genus database with same CATH homology
 5B32 D;  2NQB B;  3B0C T;  2Y2N A;  3AZL D;  5AVC A;  3AZJ A;  5FUG B;  5CP6 D;  3C1B D;  3AZN B;  3KFU G;  5B1L B;  4DQY B;  3LZ0 A;  4J8V D;  1TZY A;  1KX4 D;  4JJN D;  3WTP C;  2BYM A;  5AV5 C;  3AZE C;  2YFW B;  5GT0 D;  1R4V A;  3A6N A;  5B0Z A;  3UT9 B;  3O62 C;  3X1V A;  3MGR C;  1P3F B;  1KX3 D;  3B6F B;  4J8W C;  5B2I D;  5DNN A;  3AZG A;  3AYW D;  3R45 B;  1TAF B;  4XUJ D;  3W97 A;  1P3I A;  4J8X C;  3WA9 D;  2CWE A;  3B0B A;  5BS7 A;  1F66 C;  3WTP B;  2F8N D;  5AV5 B;  3REL D;  1ZLA D;  3AL0 C;  1B6W A;  3LJA C;  3EG5 B;  3VH5 W;  4LD9 A;  3O62 B;  4H9Q A;  4M6B A;  3MGR B;  4J8W B;  3MNN A;  1P3K C;  3AZJ C;  5B1M A;  3REI A;  5BNV B;  4X23 B;  4J8X B;  1TZY C;  1M18 A;  5AV8 D;  1F66 B;  3AZI A;  4H9O A;  5B0Z C;  3LJA B;  3AFA A;  4NFT A;  1M19 D;  5BO0 A;  4WNN B;  1S32 D;  5B32 C;  3AZL C;  1AOI A;  4WU8 D;  5DNN C;  3C1B C;  3TU4 A;  3AZG C;  2XD5 A;  1P3K B;  2BYK A;  1P3P A;  2Y2G A;  3AZJ B;  1KX4 C;  4JJN C;  1BH9 A;  3UTA D;  5DNM D;  3REK A;  3W97 C;  5BNX B;  4YS3 C;  3WKJ D;  1TZY B;  3IP4 C;  5GT3 D;  4XZQ D;  5BS7 C;  2BYM B;  4H9P A;  5JA4 A;  3P5J B;  3X1S D;  4H9S A;  5B0Z B;  4LD9 C;  4EO5 C;  1P3M A;  4H9R A;  1M1A D;  4ZBJ C;  4DRA A;  5B32 B;  3AV1 A;  3AZL B;  5B0Y C;  5DNN B;  3MNN C;  3C1B B;  3KSY A;  3AZG B;  5B24 D;  4QLC A;  2HUE C;  3WA9 C;  2NZD A;  4AWL C;  1KX4 B;  4JJN B;  5B33 D;  1KX5 A;  3W97 B;  3W99 A;  1ZLA C;  4YS3 B;  1M18 C;  2FFF B;  3H0R C;  5FUG A;  1P34 D;  3AZI C;  3AN2 D;  5B1L A;  4LD9 B;  4EO5 B;  5AVB D;  4H9Q B;  2W8S A;  4ZBJ B;  2YFW A;  3TU4 C;  5B0Y B;  3AZF D;  3MNN B;  3UT9 A;  2FJ7 A;  4Z66 C;  2HUE B;  3AV2 D;  1P3F A;  3WA9 B;  4AWL B;  3WTP E;  3REK C;  2PYO D;  3REL B;  1ZLA B;  2Y2J A;  3R45 A;  1M18 B;  3EPJ A;  1TAF A;  4H9S C;  3AZI B;  5AY8 A;  3MGP D;  5BO0 B;  3WTP A;  3AV1 C;  4KUD D;  1ID3 D;  3REJ D;  3TU4 B;  3UTB D;  4Z66 B;  3C1C A;  2NZD C;  2JSS A;  4XZQ C;  5GT3 C;  4J8W A;  3W99 C;  1KX5 C;  3REK B;  3X1S C;  5AV9 D;  2Y2M A;  2G5I C;  2RIQ A;  4X23 A;  4E44 A;  5G49 B;  4J8X A;  4H9R B;  3MGS C;  4WU9 A;  4Z2M G;  3AV1 B;  2FJ7 C;  3AZK D;  1B67 A;  4WNN A;  3W96 D;  4H9N A;  2NZD B;  2F8N K;  2F8N G;  1W2E A;  4XZQ B;  5GT3 B;  1KX5 B;  3W99 B;  3X1S B;  1P3K A;  3X1U D;  5B31 D;  5BT1 C;  3WAA D;  5AVB C;  5AY8 C;  3REH A;  5BNX A;  2F2A C;  5GXQ D;  3MGS B;  5CHL B;  1P3L D;  5AVC D;  1F1E A;  3LZ1 A;  3AV2 C;  5F99 D;  5CPJ D;  3EPK A;  2FJ7 B;  5E5A D;  3A1K A;  5B40 D;  1P3A D;  3C1C C;  4G91 C;  5B32 A;  3VH5 A;  3AZH D;  3AZL A;  3C1B A;  3X1T C;  1P3O D;  1EQZ D;  1ULY A;  4J8V A;  3X1V D;  1KX4 A;  1P3G D;  5AVB B;  4JJN A;  5AY8 B;  2RVQ D;  4X23 C;  5GT0 A;  5GSU D;  4YS3 A;  1ID3 C;  3REJ C;  4WU9 C;  4YM6 D;  3AV2 B;  4Z5T D;  2Y2K A;  1Q9C A;  4G92 C;  5B2J D;  3C1C B;  4G91 B;  4ZUX D;  5B0Y A;  3X1T B;  1P3B D;  5JRG D;  3WA9 A;  5AV6 D;  1U35 D;  4J8U D;  1HQ3 C;  3REH C;  2F8N A;  3REL A;  2HIO D;  1ZLA A;  2F8N H;  4KGC D;  2CV5 D;  1ID3 B;  3REJ B;  4WU9 B;  5CPI D;  4WZS B;  3LZ1 C;  2ZY3 A;  4G92 B;  1N1J A;  4KHA B;  4H9N B;  1JFI A;  3WAA C;  5CP6 C;  4NE5 A;  4Z66 A;  4UUZ A;  4J8V C;  3MGQ D;  5GXQ C;  1P3L C;  1HQ3 B;  4WV4 B;  3REH B;  2DQN C;  5GT0 C;  1WWI A;  5F99 C;  5CPJ C;  3MVD D;  5CPK D;  3LZ1 B;  2G5H C;  1S32 A;  1KX3 C;  3KXB D;  2LY8 A;  5B2I C;  5G49 A;  3AYW C;  1EQZ C;  1T3U A;  4XUJ C;  5CP6 B;  3KUY D;  3WAA B;  3UTA A;  5DNM A;  4R8P D;  3KWQ D;  3AZM D;  5GSU C;  4J8V B;  1P3M D;  4XZQ A;  5GT3 A;  5GXQ B;  1P3L B;  3X1S A;  3REL C;  5GT0 B;  4YM6 C;  5F99 B;  4Z5T C;  5CPJ B;  1Z2C B;  2JCH A;  4QLC D;  4ZUX C;  1KX3 B;  2L5A A;  3B6G D;  5B2I B;  2Y2P A;  3MGS A;  2NQB D;  3AYW B;  1KU5 A;  5B24 A;  1P3O B;  1EQZ B;  5JRG C;  3AZN D;  5B1L D;  4XUJ B;  5B33 A;  3VH5 T;  5GSU B;  4KGC C;  3B0C W;  5AV8 C;  2F8N B;  3AN2 A;  3VH6 A;  4YM6 B;  4Z5T B;  2ZY4 A;  1M19 C;  3W98 D;  5AVB A;  1P3F D;  1S32 C;  3B6F D;  4ZUX B;  4WU8 C;  1N1J B;  5B31 G;  1JFI B;  5JRG B;  3AV2 A;  2IO5 C;  3UTA C;  5DNM C;  2PYO A;  4UUZ B;  3WKJ C;  1H3O B;  4KGC B;  3WTP D;  5AV8 B;  3MVD C;  5AV5 D;  3AZE D;  3X1T A;  3MGP A;  2ZY5 A;  2Y2I A;  3O62 D;  1M19 B;  3LEL D;  3MGR D;  1M1A C;  1S32 B;  4WU8 B;  1ID3 A;  3REJ A;  3UTB A;  5B24 C;  2IO5 B;  5B33 C;  3UTA B;  2ARO D;  2XD1 A;  4KHA A;  5DNM B;  5AV9 A;  3WKJ B;  1F66 D;  3MVD B;  1P34 C;  3AN2 C;  3LJA D;  1HQ3 A;  2ZY2 A;  1M1A B;  1A7W A;  5KDM B;  3AZF C;  3KUY B;  5B24 B;  3W96 A;  3AZJ D;  2JE5 A;  5B33 B;  2PYO C;  3LZ0 D;  1TZY D;  1PZR A;  4WJ3 C;  5B31 A;  4NE3 A;  1P34 B;  3W98 C;  5CP6 A;  3AN2 B;  3WAA A;  3MGP C;  3A6N D;  5B0Z D;  3V9R A;  5GXQ A;  1P3L A;  4KUD C;  5DNN D;  2Y2Q A;  5F99 A;  5CPJ A;  3AZG D;  3AZF B;  3UTB C;  5E5A A;  5B40 A;  1P3A A;  1KX3 A;  3AZH A;  5B2I A;  3W97 D;  1P3I D;  2PYO B;  5AV9 C;  4YS3 D;  3AYW A;  1P3O A;  1EQZ A;  2YFV A;  3NQU B;  3LEL C;  3W98 B;  4XUJ A;  4Z2M H;  1P3G A;  3MGP B;  4LD9 D;  5GSU A;  3VH6 T;  1BH8 B;  4KUD B;  2VQR A;  5B0Y D;  3H0M C;  4YM6 A;  3MNN D;  4Z5T A;  3UTB B;  3AZK C;  2ARO C;  3NQJ B;  2BG1 A;  5B2J A;  3W96 C;  5B1M D;  4ZUX A;  3REI D;  3FDD A;  3AZE B;  5AV9 B;  1M18 D;  2Y2O A;  1P3B A;  1WWS A;  5B31 C;  3X1U C;  5JRG A;  5AV6 A;  3AZI D;  4J8U A;  3LEL B;  1U35 A;  3AFA D;  1H3O A;  2HIO A;  4KGC A;  2CV5 A;  5AV8 A;  5CPI A;  1AOI D;  5AVC C;  1HTA A;  3TU4 D;  3F6T A;  5E5A C;  4CSR A;  5B40 C;  1P3A C;  4Z66 D;  2ARO B;  3LZ0 C;  3AZK B;  1P3P D;  1M19 A;  3W96 B;  3AZH C;  4WU8 A;  3REK D;  3A6N C;  1P3O C;  3X1U B;  5B31 B;  3MGQ A;  3X1V C;  1P3G C;  2RVQ C;  3WKJ A;  3V9R B;  4CAY B;  3MVD A;  3AV1 D;  2UWX A;  5CPK A;  5AVC B;  3KXB A;  5E5A B;  1P3I C;  5B40 B;  1P3A B;  5B2J C;  3LZ0 B;  2NZD D;  1M1A A;  3AZH B;  3W99 D;  5KDM A;  1KX5 D;  3KUY A;  1P3B C;  3A6N B;  4R8P A;  3KWQ A;  2YFV B;  3AZM A;  5AV6 C;  1U35 C;  4J8U C;  3X1V B;  1P3G B;  2HIO C;  2CV5 C;  3MGS D;  5CPI C;  5C3I C;  1P34 A;  5B1M C;  3REI C;  2ZM5 A;  2FJ7 D;  3UT9 D;  3B6G A;  1P3I B;  5B2J B;  2NQB A;  4E45 A;  2Y2H A;  3AZN A;  3AZF A;  1P3B B;  3AFA C;  2J8P A;  5BT1 D;  3MGQ C;  5AV6 B;  1U35 B;  5AY8 D;  4J8U B;  3EPL A;  1AOI C;  2HIO B;  2DF4 C;  4HGA C;  2CV5 B;  5CPI B;  1P3P C;  3B0D C;  5C3I B;  3NQU A;  5CPK C;  3W98 A;  2Y2L A;  5B1M B;  3KXB C;  3REI B;  3B6F A;  4CSR B;  3C1C D;  1BH8 A;  4J8W D;  4KUD A;  3X1T D;  4H9O B;  3KUY C;  4DRB A;  3NQJ A;  4R8P C;  3KWQ C;  3AFA B;  3AZM C;  5B32 G;  3MGQ B;  1P3M C;  4X23 D;  5AV5 A;  4J8X D;  3AZE A;  1AOI B;  4WU9 D;  4HGA B;  2BYK B;  3B0D B;  4QLC C;  3O62 A;  3LEL A;  5CPK B;  3MGR A;  3VH6 W;  1P3P B;  3KXB B;  1BFM A;  3B6G C;  1BH9 B;  2NQB C;  4UPK A;  4H9P B;  5JA4 B;  4NE6 A;  3AZN C;  3H0L C;  5B1L C;  5BNV A;  1P3K D;  3AZK A;  2ARO A;  3A1I A;  4R8P B;  3KWQ B;  3AZM B;  1P3M B;  1HQ3 D;  3REH D;  1F66 A;  3LJA A;  3UT9 C;  3X1U A;  3EPH A;  4QLC B;  3LZ1 D;  1P3F C;  3B6F C;  3B6G B;  4CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...