5GSUB

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuB00
5FUGA 1TAFA 5GSUB 5AY8C 3A6ND 2F8NG 3UTAB 5CPJD 4KUDD 1S32A 1M18A 1HQ3C 5AV5C 3UTBD 3MVDB 5CP6B 3AZHB 1H3OA 4XUJC 3X1UC 4J8VD 3KXBB 3REHB 3B0CW 3WA9B 3AV2B 1ZLAB 2FJ7B 5B1MB 4CSRB 5B1LD 5AVCA 4Z66C 4KGCD 3MGQA 2RVQD 3MGSB 3AZED 4Z5TB 5B24D 3TU4A 4H9SA 5GT3A 5GSUC 3AYWA 5BO0B 1Q9CA 3AZKD 3UTAC 1M1AA 3MGPA 2HUEB 3KWQD 3MVDC 4WU8B 3MNNB 4G91B 3O62B 5CP6C 3AZHC 5B31A 3KXBC 3REIB 1P3AD 3REHC 2F8ND 3WA9C 4KUDA 3AV2C 5B2ID 3X1SB 1ZLAC 1BFMA 4X23A 1P3BD 5B1MC 3TU4C 4XZQD 3MGSC 4Z5TC 1BH9A 1P3FB 2AROB 1F66A 3VH6A 4KGCA 5DNMA 2HUEC 2CV5A 4WU8C 3MNNC 3AZEA 4G91C 3LZ1B 3REJA 5B24A 3O62C 1TZYD 3AN2B 3X1TA 3MGRD 3KUYD 3REIC 3AZKA 5B2JB 3KWQA 5AV6D 1M19B 3X1SC 4J8UD 1P34B 1KX4D 5GXQA 3C1CB 1P3IA 1P3OA 5G49B 3W97D 5B32D 2F8NA 4CAYB 3W96A 1P3FC 4E45A 2NQBA 2AROC 1P3BA 1AOIA 3AZMB 4YM6A 4XZQA 4R8PD 1EQZA 5AY8D 3C1BA 3LZ1C 4ZBJB 4LD9D 3AN2C 1KX5A 5E5AD 1JFIA 1P3GA 4H9RA 3R45B 5B2JC 5CPKA 5CPIA 1M19C 1P34C 3WAAB 5B40B 5B0ZA 1P3LB 4H9OA 1B6WA 3C1CC 4E44A 3UT9B 3KUYA 3B6GB 5AVBD 2YFWA 4Z66D 5GT0A 5BT1C 4J8UA 3AZMC 5B31G 3AZLB 3X1VB 4J8XB 4J8WB 4H9QB 1S32D 1M18D 5F99B 3WTPA 4ZUXB 4ZBJC 3W98B 2NZDA 5AV9B 3MVDD 5JRGB 1N1JB 4JJNB 5DNNA 4QLCB 3WAAC 5AY8A 3V9RA 5B40C 3AZNB 1P3LC 3REHD 3WA9D 4KHAB 5AVCD 1HQ3A 5AV5A 2PYOB 1WWIA 4NE5A 3MGQD 3UT9C 1ZLAD 3B6GC 5AV8B 3TU4D 5GT3D 4XUJA 3X1UA 3LJAB 2JSSA 3MGSD 3AYWD 3AZGB 2BYKA 2IO5B 3X1VC 3AZLC 4J8XC 5B33B 3MGPD 4J8WC 1M1AD 5F99C 3W98C 4WNNB 4ZUXC 4Z66A 5AV9C 3AFAB 4UUZA 5JRGC 4JJNC 3WKJB 5B31D 4Z2MH 3B6FB 4QLCC 5GSUA 3AZNC 1P3MB 4X23D 3UTAA 2PYOC 3MVDA 3NQJB 5AV8C 1P3KB 5CP6A 3AZHA 3LJAC 3KXBA 3AZGC 1F66D 3REHA 2IO5C 3WA9A 5DNMD 5B33C 3AV2A 1ZLAA 2CV5D 2FJ7A 5B1MA 4CSRA 3LELB 3AFAC 3REJD 3WKJC 3X1TD 3MGSA 3AZFB 4YS3B 1ID3B 4Z5TA 3B6FC 5JA4B 5BO0A 1P3MC 5GXQD 1M19D 4WU8A 1P3ID 1P3OD 3MNNA 1A7WA 4H9NB 3O62A 1P3KC 3W96D 5B0YB 2NQBD 3REIA 1AOID 2FJ7C 3AZJB 3AZIB 4YM6D 2L5AA 3X1SA 3LZ0B 4DRBA 1EQZD 3C1BD 2HIOB 3LELC 3NQUB 4Z2MG 2BYMB 1KX5D 1WWSA 4YS3C 3AZFC 1P3GD 1ID3C 5BS7C 4G92B 1P3FA 3B0DB 5CPKD 5CPID 2AROA 3A6NB 5B0ZD 5CPJB 3VH6T 4WZSB 3UTBB 4H9PB 3LZ1A 3AN2A 5B0YC 3UT9D 5GT0D 4J8VB 5B2JA 3AZJC 5BNVB 3AZIC 3LZ0C 1M19A 1P34A 2NZDD 2HIOC 5B1LB 3WTPD 1HTAA 2YFVB 3X1VD 3C1CA 5F99D 5G49A 3W98D 5DNND 4CAYA 4G92C 3B0DC 3A6NC 3AZMA 3UTBC 1HQ3D 5AV5D 3AZND 1BH8B 4XUJD 3X1UD 4J8VC 1P3AB 3R45A 5KDMB 5B2IB 3WAAA 5B40A 1P3LA 5B1LC 5B33D 1KX3B 3UT9A 3W99B 4WU9B 3B6GA 3AFAD 3WKJD 5GSUD 3VH5A 3RELB 3AZLA 3X1VA 4J8XA 4J8WA 4H9QA 3UTAD 5F99A 3W98A 4ZUXA 1P3MD 5AV9A 1TZYB 5CP6D 1N1JA 4WV4B 5JRGA 3MGRB 4JJNA 3AZHD 1P3AC 3KXBD 4AWLB 4QLCA 5B2IC 5AV6B 3AV2D 3AZNA 1KX4B 4KHAA 5B1MD 2FJ7D 3AV1B 2PYOA 1KX3C 3W99C 4WU9C 3REKB 5B32B 5AV8A 3W97B 4Z5TD 1U35B 3LJAA 3RELC 3AZGA 1F1EA 5B33A 2CWEA 4R8PB 4WU8D 4WNNA 3MNND 3AFAA 4LD9B 1TZYC 5E5AB 3O62D 3WKJA 3MGRC 3REID 4AWLC 3B6FA 5AV6C 3X1SD 1P3MA 1KX4C 1R4VA 3AZJD 5BNXB 3AV1C 1P3PB 3NQJA 4DRAA 3REKC 5B32C 5AVBB 3W97C 2HIOD 1U35C 1P3KA 1P3FD 5FUGB 1TAFB 2AROD 1S32B 1M18B 4R8PC 5C3IB 4NFTA 3LZ1D 3LELA 4LD9C 5E5AC 3AN2D 1H3OB 3AZFA 4YS3A 1ID3A 4M6BA 5BS7A 5JA4A 5B2JD 1P34D 1KU5A 1P3PC 5AVCB 3C1CD 3MGQB 5AVBC 4H9NA 3TU4B 5GT3B 5B0YA 3AYWB 5BT1D 3AZMD 3AZJA 1M1AB 3MGPB 3AZIA 1S32C 3LZ0A 1M18C 5C3IC 2HIOA 3NQUA 2BYMA 4HGAB 5B31B 4KUDB 3A6NA 5B32G 4X23B 5B40D 3WAAD 5CPJA 5AVCC 1P3LD 3UTBA 4H9PA 3KSYA 3MGQC 3B6GD 1BH9B 4H9SC 5GT3C 1KX3D 3W99D 4WU9D 4J8VA 3AYWC 1F66B 4KGCB 5DNMB 5BNVA 3MGPC 3AZLD 1M1AC 4J8XD 4J8WD 2CV5B 3RELD 5B1LA 4ZUXD 3AZEB 2YFVA 3REJB 5AV9D 5B24B 3X1TB 5JRGD 4HGAC 4JJND 5B31C 3AZKB 3VH6W 4KUDC 5CPJC 4QLCD 3KWQB 4X23C 5GXQB 1ULYA 2PYOD 1P3IB 1P3OB 2F8NK 5AV8D 2F8NB 3AV1D 3W96B 2NQBB 1BH8A 3LJAD 1F66C 3REKD 1P3AA 3AZGD 1P3BB 1AOIB 5KDMA 5DNMC 1U35D 4KGCC 3B0BA 5B2IA 3WTPE 4YM6B 4XZQB 2CV5C 1EQZB 2RVQC 1B67A 3C1BB 3AZEC 3REJC 5B24C 1KX3A 1KX5B 3X1TC 3W99A 4WU9A 1JFIB 1P3GB 3AZKC 4H9RB 5CPKB 3B6FD 5CPIB 3KWQC 4NE6A 3RELA 5B0ZB 4H9OB 2LY8A 3VH5T 5GXQC 1P3IC 4EO5B 1P3OC 4NE3A 3KUYB 2F8NH 1P3PD 2YFWB 3W96C 1TZYA 1P3KD 2NQBC 3MGRA 5GT0B 4J8UB 1P3BC 1AOIC 5AV6A 4YM6C 4XZQC 1EQZC 3C1BC 3WTPB 1KX4A 2NZDB 3LELD 3AV1A 1KX5C 3W97A 5B32A 5DNNB 3REKA 1P3GC 4YS3D 3AZFD 1ID3D 1U35A 5CPKC 5CPIC 3VH5W 3V9RB 5AY8B 5B0ZC 4R8PA 1HQ3B 5AV5B 4EO5C 3KUYC 4LD9A 5E5AA 5GT0C 4XUJB 5B0YD 3X1UB 4J8UC 2BYKB 3AZID 3LZ0D 3B0CT 2NZDC 3WTPC 1P3PA 5BNXA 4Z66B 4UUZB 5CHLB 5AVBA 5DNNC
chains in the Genus database with same CATH superfamily
5FUGA 1TAFA 5GSUB 5AY8C 3A6ND 2F8NG 3UTAB 5CPJD 4KUDD 1S32A 1M18A 1HQ3C 5AV5C 3UTBD 3MVDB 5CP6B 3AZHB 1H3OA 4XUJC 3X1UC 4J8VD 3KXBB 3REHB 3B0CW 3WA9B 3AV2B 1ZLAB 2FJ7B 5B1MB 4CSRB 5B1LD 5AVCA 2FFFB 4Z66C 4KGCD 3MGQA 2RVQD 3MGSB 3AZED 4Z5TB 5B24D 3TU4A 4H9SA 5GT3A 5GSUC 3AYWA 5BO0B 1Q9CA 3AZKD 3UTAC 1M1AA 3MGPA 2HUEB 3KWQD 3EPJA 3MVDC 4WU8B 3MNNB 4G91B 3O62B 5CP6C 2BG1A 3AZHC 5B31A 3KXBC 3REIB 1P3AD 3REHC 2F8ND 3WA9C 4KUDA 3AV2C 5B2ID 3X1SB 1ZLAC 1BFMA 4X23A 2Y2LA 1P3BD 5B1MC 2ZM5A 3TU4C 2DF4C 4XZQD 3MGSC 4Z5TC 1BH9A 1P3FB 2AROB 1F66A 3KFUG 3VH6A 4KGCA 5DNMA 2HUEC 2CV5A 4WU8C 3MNNC 3AZEA 4G91C 3LZ1B 3REJA 2Y2KA 3H0MC 5B24A 3O62C 1TZYD 3AN2B 3X1TA 3MGRD 3KUYD 3REIC 3AZKA 5B2JB 3KWQA 5AV6D 1M19B 3X1SC 4J8UD 1P34B 1KX4D 5GXQA 3C1CB 1P3IA 1P3OA 5G49B 3W97D 5B32D 2F8NA 4CAYB 3W96A 1P3FC 4E45A 2NQBA 1W2EA 2AROC 1P3BA 1AOIA 3AZMB 4YM6A 4XZQA 4R8PD 1EQZA 5AY8D 3C1BA 3LZ1C 4ZBJB 1Z2CB 4LD9D 3AN2C 1KX5A 5E5AD 1JFIA 1P3GA 4H9RA 3R45B 5B2JC 5CPKA 5CPIA 1M19C 1P34C 3WAAB 5B40B 5B0ZA 1P3LB 4H9OA 1B6WA 3C1CC 4E44A 2Y2OA 3UT9B 3KUYA 3B6GB 5AVBD 2YFWA 4Z66D 2ZY5A 5GT0A 1PZRA 5BT1C 4J8UA 3AZMC 5B31G 3AZLB 3X1VB 4J8XB 4J8WB 4H9QB 1S32D 1M18D 5F99B 3WTPA 4ZUXB 4ZBJC 3W98B 2NZDA 5AV9B 2RIQA 3MVDD 5JRGB 1N1JB 4JJNB 5DNNA 4QLCB 3WAAC 5AY8A 3V9RA 5B40C 3AZNB 1P3LC 3REHD 3WA9D 4KHAB 5AVCD 2Y2IA 1HQ3A 5AV5A 2PYOB 1WWIA 4NE5A 3MGQD 3UT9C 1ZLAD 3B6GC 5AV8B 3TU4D 5GT3D 4XUJA 3X1UA 3LJAB 2JSSA 3MGSD 3AYWD 3AZGB 2BYKA 2IO5B 3X1VC 3AZLC 4J8XC 5B33B 3MGPD 4J8WC 1M1AD 5F99C 3W98C 4WNNB 4ZUXC 4Z66A 5AV9C 3AFAB 3EPKA 4UUZA 5JRGC 4JJNC 3WKJB 5B31D 4Z2MH 3B6FB 4QLCC 5GSUA 3AZNC 1P3MB 4X23D 3UTAA 2PYOC 3MVDA 3NQJB 5AV8C 1P3KB 5CP6A 3AZHA 3LJAC 4DQYB 3KXBA 3AZGC 1F66D 3REHA 2IO5C 3WA9A 5DNMD 5B33C 3AV2A 1ZLAA 2CV5D 2FJ7A 5B1MA 4CSRA 3LELB 3AFAC 3REJD 3WKJC 3X1TD 3MGSA 3AZFB 4YS3B 1ID3B 4Z5TA 3B6FC 5JA4B 5BO0A 2F2AC 1P3MC 5GXQD 1M19D 4WU8A 1P3ID 1P3OD 3MNNA 2ZY2A 1A7WA 4H9NB 3O62A 1P3KC 3W96D 5B0YB 2NQBD 3REIA 1AOID 2FJ7C 3AZJB 3AZIB 4YM6D 2L5AA 3X1SA 3LZ0B 4DRBA 1EQZD 3C1BD 2HIOB 3LELC 3NQUB 4Z2MG 2BYMB 1KX5D 1WWSA 2Y2NA 4YS3C 3AZFC 1P3GD 1ID3C 5BS7C 4G92B 1P3FA 3B0DB 5CPKD 5CPID 2AROA 3EG5B 3A6NB 5B0ZD 5CPJB 3VH6T 4WZSB 3UTBB 4H9PB 3LZ1A 3AN2A 5B0YC 3UT9D 5GT0D 4J8VB 5B2JA 3AZJC 5BNVB 3AZIC 3LZ0C 1M19A 1P34A 2NZDD 2HIOC 5B1LB 3WTPD 1HTAA 2YFVB 3X1VD 3C1CA 5F99D 5G49A 3W98D 5DNND 4CAYA 4G92C 3B0DC 3A6NC 3AZMA 3UTBC 1HQ3D 5AV5D 3AZND 3IP4C 1BH8B 4XUJD 3X1UD 4J8VC 1P3AB 3R45A 5KDMB 5B2IB 3WAAA 5B40A 1P3LA 5B1LC 5B33D 1KX3B 3UT9A 3W99B 4WU9B 3B6GA 3AFAD 2G5IC 3WKJD 2G5HC 5GSUD 4WJ3C 2Y2PA 3VH5A 2Y2JA 3A1IA 3RELB 3AZLA 3X1VA 4J8XA 4J8WA 4H9QA 3UTAD 5F99A 3W98A 4ZUXA 1P3MD 5AV9A 1TZYB 5CP6D 1N1JA 4WV4B 5JRGA 3MGRB 2ZY3A 4JJNA 3AZHD 2Y2QA 3KXBD 1P3AC 4AWLB 4QLCA 5B2IC 5AV6B 3AV2D 3AZNA 1KX4B 4KHAA 5B1MD 2FJ7D 3AV1B 2PYOA 3A1KA 1KX3C 3W99C 1T3UA 4WU9C 3REKB 5B32B 2JCHA 5AV8A 3W97B 4Z5TD 1U35B 3LJAA 3RELC 3AZGA 1F1EA 5B33A 3H0LC 2CWEA 4R8PB 4WU8D 4WNNA 3MNND 3AFAA 4LD9B 1TZYC 5E5AB 3O62D 3WKJA 4KGCC 3MGRC 3REID 4AWLC 3B6FA 5AV6C 3X1SD 1P3MA 2JE5A 1KX4C 3F6TA 1R4VA 3AZJD 5BNXB 3AV1C 1P3PB 2J8PA 3NQJA 4DRAA 3REKC 5B32C 5AVBB 3W97C 2HIOD 1U35C 1P3KA 1P3FD 2VQRA 5FUGB 1TAFB 2AROD 3P5JB 3H0RC 1S32B 1M18B 4R8PC 5C3IB 4NFTA 3LZ1D 3LELA 4LD9C 5E5AC 3AN2D 1H3OB 3AZFA 4YS3A 1ID3A 4M6BA 5BS7A 5JA4A 5B2JD 1P34D 1KU5A 1P3PC 5AVCB 3C1CD 3MGQB 2Y2HA 5AVBC 4H9NA 3TU4B 5GT3B 5B0YA 3AYWB 5BT1D 3AZMD 3AZJA 1M1AB 3MGPB 3AZIA 1S32C 3LZ0A 1M18C 5C3IC 2HIOA 3NQUA 2BYMA 2W8SA 4HGAB 5B31B 4KUDB 3A6NA 2XD1A 5B32G 4X23B 5B40D 3WAAD 5CPJA 5AVCC 1P3LD 3UTBA 4H9PA 3KSYA 3MGQC 3B6GD 2UWXA 1BH9B 4H9SC 5GT3C 1KX3D 3W99D 4WU9D 4J8VA 3AYWC 1F66B 4KGCB 5DNMB 5BNVA 3MGPC 3AZLD 1M1AC 4J8XD 4J8WD 2CV5B 3RELD 5B1LA 4ZUXD 3AZEB 2YFVA 3REJB 5AV9D 5B24B 3X1TB 5JRGD 4HGAC 4JJND 5B31C 3AZKB 3VH6W 4KUDC 5CPJC 4QLCD 3KWQB 4X23C 5GXQB 1ULYA 2PYOD 1P3IB 1P3OB 2F8NK 5AV8D 2F8NB 3AV1D 3W96B 2NQBB 1BH8A 3LJAD 1F66C 3REKD 1P3AA 3AZGD 2DQNC 1P3BB 5KDMA 5DNMC 1U35D 3FDDA 1AOIB 3B0BA 5B2IA 3WTPE 4YM6B 4XZQB 2CV5C 1EQZB 2RVQC 1B67A 3C1BB 3AZEC 3REJC 5B24C 3EPHA 2Y2GA 1KX3A 1KX5B 3X1TC 3W99A 4WU9A 1JFIB 1P3GB 4UPKA 3AZKC 4H9RB 5CPKB 3B6FD 5CPIB 3KWQC 4NE6A 3RELA 5B0ZB 4H9OB 2LY8A 3VH5T 5GXQC 1P3IC 4EO5B 1P3OC 4NE3A 3KUYB 2F8NH 1P3PD 2YFWB 3W96C 1TZYA 1P3KD 2NQBC 3MGRA 5GT0B 4J8UB 1P3BC 1AOIC 2ZY4A 5AV6A 4YM6C 4XZQC 1EQZC 3C1BC 3WTPB 1KX4A 2NZDB 3LELD 3AV1A 1KX5C 3W97A 5B32A 5DNNB 3REKA 1P3GC 2Y2MA 4YS3D 3EPLA 3AZFD 1U35A 1ID3D 5CPKC 3AL0C 5CPIC 3VH5W 3V9RB 5AY8B 5B0ZC 4R8PA 1HQ3B 5AV5B 4EO5C 3KUYC 4LD9A 5E5AA 5GT0C 4XUJB 5B0YD 3X1UB 4J8UC 2BYKB 3AZID 2XD5A 3LZ0D 3B0CT 2NZDC 3WTPC 1P3PA 5BNXA 4Z66B 4UUZB 5CHLB 5AVBA 5DNNC
chains in the Genus database with same CATH topology
5FUGA 1TAFA 5GSUB 5AY8C 3A6ND 2F8NG 3UTAB 5CPJD 4KUDD 1S32A 1M18A 1HQ3C 5AV5C 3UTBD 3MVDB 5CP6B 3AZHB 1H3OA 4XUJC 3X1UC 4J8VD 3KXBB 3REHB 3B0CW 3WA9B 3AV2B 1ZLAB 2FJ7B 5B1MB 4CSRB 5B1LD 5AVCA 2FFFB 4Z66C 4KGCD 3MGQA 2RVQD 3MGSB 3AZED 4Z5TB 5B24D 3TU4A 4H9SA 5GT3A 5GSUC 3AYWA 5BO0B 1Q9CA 3AZKD 3UTAC 1M1AA 3MGPA 2HUEB 3KWQD 3EPJA 3MVDC 4WU8B 3MNNB 4G91B 3O62B 5CP6C 2BG1A 3AZHC 5B31A 3KXBC 3REIB 1P3AD 3REHC 2F8ND 3WA9C 4KUDA 3AV2C 5B2ID 3X1SB 1ZLAC 1BFMA 4X23A 2Y2LA 1P3BD 5B1MC 2ZM5A 3TU4C 2DF4C 4XZQD 3MGSC 4Z5TC 1BH9A 1P3FB 2AROB 1F66A 3KFUG 3VH6A 4KGCA 5DNMA 2HUEC 2CV5A 4WU8C 3MNNC 3AZEA 4G91C 3LZ1B 3REJA 2Y2KA 3H0MC 5B24A 3O62C 1TZYD 3AN2B 3X1TA 3MGRD 3KUYD 3REIC 3AZKA 5B2JB 3KWQA 5AV6D 1M19B 3X1SC 4J8UD 1P34B 1KX4D 5GXQA 3C1CB 1P3IA 1P3OA 5G49B 3W97D 5B32D 2F8NA 4CAYB 3W96A 1P3FC 4E45A 2NQBA 1W2EA 2AROC 1P3BA 1AOIA 3AZMB 4YM6A 4XZQA 4R8PD 1EQZA 5AY8D 3C1BA 3LZ1C 4ZBJB 1Z2CB 4LD9D 3AN2C 1KX5A 5E5AD 1JFIA 1P3GA 4H9RA 3R45B 5B2JC 5CPKA 5CPIA 1M19C 1P34C 3WAAB 5B40B 5B0ZA 1P3LB 4H9OA 1B6WA 3C1CC 4E44A 2Y2OA 3UT9B 3KUYA 3B6GB 5AVBD 2YFWA 4Z66D 2ZY5A 5GT0A 1PZRA 5BT1C 4J8UA 3AZMC 5B31G 3AZLB 3X1VB 4J8XB 4J8WB 4H9QB 1S32D 1M18D 5F99B 3WTPA 4ZUXB 4ZBJC 3W98B 2NZDA 5AV9B 2RIQA 3MVDD 5JRGB 1N1JB 4JJNB 5DNNA 4QLCB 3WAAC 5AY8A 3V9RA 5B40C 3AZNB 1P3LC 3REHD 3WA9D 4KHAB 5AVCD 2Y2IA 1HQ3A 5AV5A 2PYOB 1WWIA 4NE5A 3MGQD 3UT9C 1ZLAD 3B6GC 5AV8B 3TU4D 5GT3D 4XUJA 3X1UA 3LJAB 2JSSA 3MGSD 3AYWD 3AZGB 2BYKA 2IO5B 3X1VC 3AZLC 4J8XC 5B33B 3MGPD 4J8WC 1M1AD 5F99C 3W98C 4WNNB 4ZUXC 4Z66A 5AV9C 3AFAB 3EPKA 4UUZA 5JRGC 4JJNC 3WKJB 5B31D 4Z2MH 3B6FB 4QLCC 5GSUA 3AZNC 1P3MB 4X23D 3UTAA 2PYOC 3MVDA 3NQJB 5AV8C 1P3KB 5CP6A 3AZHA 3LJAC 4DQYB 3KXBA 3AZGC 1F66D 3REHA 2IO5C 3WA9A 5DNMD 5B33C 3AV2A 1ZLAA 2CV5D 2FJ7A 5B1MA 4CSRA 3LELB 3AFAC 3REJD 3WKJC 3X1TD 3MGSA 3AZFB 4YS3B 1ID3B 4Z5TA 3B6FC 5JA4B 5BO0A 2F2AC 1P3MC 5GXQD 1M19D 4WU8A 1P3ID 1P3OD 3MNNA 2ZY2A 1A7WA 4H9NB 3O62A 1P3KC 3W96D 5B0YB 2NQBD 3REIA 1AOID 2FJ7C 3AZJB 3AZIB 4YM6D 2L5AA 3X1SA 3LZ0B 4DRBA 1EQZD 3C1BD 2HIOB 3LELC 3NQUB 4Z2MG 2BYMB 1KX5D 1WWSA 2Y2NA 4YS3C 3AZFC 1P3GD 1ID3C 5BS7C 4G92B 1P3FA 3B0DB 5CPKD 5CPID 2AROA 3EG5B 3A6NB 5B0ZD 5CPJB 3VH6T 4WZSB 3UTBB 4H9PB 3LZ1A 3AN2A 5B0YC 3UT9D 5GT0D 4J8VB 5B2JA 3AZJC 5BNVB 3AZIC 3LZ0C 1M19A 1P34A 2NZDD 2HIOC 5B1LB 3WTPD 1HTAA 2YFVB 3X1VD 3C1CA 5F99D 5G49A 3W98D 5DNND 4CAYA 4G92C 3B0DC 3A6NC 3AZMA 3UTBC 1HQ3D 5AV5D 3AZND 3IP4C 1BH8B 4XUJD 3X1UD 4J8VC 1P3AB 3R45A 5KDMB 5B2IB 3WAAA 5B40A 1P3LA 5B1LC 5B33D 1KX3B 3UT9A 3W99B 4WU9B 3B6GA 3AFAD 2G5IC 3WKJD 2G5HC 5GSUD 4WJ3C 2Y2PA 3VH5A 2Y2JA 3A1IA 3RELB 3AZLA 3X1VA 4J8XA 4J8WA 4H9QA 3UTAD 5F99A 3W98A 4ZUXA 1P3MD 5AV9A 1TZYB 5CP6D 1N1JA 4WV4B 5JRGA 3MGRB 2ZY3A 4JJNA 3AZHD 2Y2QA 3KXBD 1P3AC 4AWLB 4QLCA 5B2IC 5AV6B 3AV2D 3AZNA 1KX4B 4KHAA 5B1MD 2FJ7D 3AV1B 2PYOA 3A1KA 1KX3C 3W99C 1T3UA 4WU9C 3REKB 5B32B 2JCHA 5AV8A 3W97B 4Z5TD 1U35B 3LJAA 3RELC 3AZGA 1F1EA 5B33A 3H0LC 2CWEA 4R8PB 4WU8D 4WNNA 3MNND 3AFAA 4LD9B 1TZYC 5E5AB 3O62D 3WKJA 4KGCC 3MGRC 3REID 4AWLC 3B6FA 5AV6C 3X1SD 1P3MA 2JE5A 1KX4C 3F6TA 1R4VA 3AZJD 5BNXB 3AV1C 1P3PB 2J8PA 3NQJA 4DRAA 3REKC 5B32C 5AVBB 3W97C 2HIOD 1U35C 1P3KA 1P3FD 2VQRA 5FUGB 1TAFB 2AROD 3P5JB 3H0RC 1S32B 1M18B 4R8PC 5C3IB 4NFTA 3LZ1D 3LELA 4LD9C 5E5AC 3AN2D 1H3OB 3AZFA 4YS3A 1ID3A 4M6BA 5BS7A 5JA4A 5B2JD 1P34D 1KU5A 1P3PC 5AVCB 3C1CD 3MGQB 2Y2HA 5AVBC 4H9NA 3TU4B 5GT3B 5B0YA 3AYWB 5BT1D 3AZMD 3AZJA 1M1AB 3MGPB 3AZIA 1S32C 3LZ0A 1M18C 5C3IC 2HIOA 3NQUA 2BYMA 2W8SA 4HGAB 5B31B 4KUDB 3A6NA 2XD1A 5B32G 4X23B 5B40D 3WAAD 5CPJA 5AVCC 1P3LD 3UTBA 4H9PA 3KSYA 3MGQC 3B6GD 2UWXA 1BH9B 4H9SC 5GT3C 1KX3D 3W99D 4WU9D 4J8VA 3AYWC 1F66B 4KGCB 5DNMB 5BNVA 3MGPC 3AZLD 1M1AC 4J8XD 4J8WD 2CV5B 3RELD 5B1LA 4ZUXD 3AZEB 2YFVA 3REJB 5AV9D 5B24B 3X1TB 5JRGD 4HGAC 4JJND 5B31C 3AZKB 3VH6W 4KUDC 5CPJC 4QLCD 3KWQB 4X23C 5GXQB 1ULYA 2PYOD 1P3IB 1P3OB 2F8NK 5AV8D 2F8NB 3AV1D 3W96B 2NQBB 1BH8A 3LJAD 1F66C 3REKD 1P3AA 3AZGD 2DQNC 1P3BB 5KDMA 5DNMC 1U35D 3FDDA 1AOIB 3B0BA 5B2IA 3WTPE 4YM6B 4XZQB 2CV5C 1EQZB 2RVQC 1B67A 3C1BB 3AZEC 3REJC 5B24C 3EPHA 2Y2GA 1KX3A 1KX5B 3X1TC 3W99A 4WU9A 1JFIB 1P3GB 4UPKA 3AZKC 4H9RB 5CPKB 3B6FD 5CPIB 3KWQC 4NE6A 3RELA 5B0ZB 4H9OB 2LY8A 3VH5T 5GXQC 1P3IC 4EO5B 1P3OC 4NE3A 3KUYB 2F8NH 1P3PD 2YFWB 3W96C 1TZYA 1P3KD 2NQBC 3MGRA 5GT0B 4J8UB 1P3BC 1AOIC 2ZY4A 5AV6A 4YM6C 4XZQC 1EQZC 3C1BC 3WTPB 1KX4A 2NZDB 3LELD 3AV1A 1KX5C 3W97A 5B32A 5DNNB 3REKA 1P3GC 2Y2MA 4YS3D 3EPLA 3AZFD 1U35A 1ID3D 5CPKC 3AL0C 5CPIC 3VH5W 3V9RB 5AY8B 5B0ZC 4R8PA 1HQ3B 5AV5B 4EO5C 3KUYC 4LD9A 5E5AA 5GT0C 4XUJB 5B0YD 3X1UB 4J8UC 2BYKB 3AZID 2XD5A 3LZ0D 3B0CT 2NZDC 3WTPC 1P3PA 5BNXA 4Z66B 4UUZB 5CHLB 5AVBA 5DNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG A;  1TAF A;  5GSU B;  5AY8 C;  3A6N D;  2F8N G;  3UTA B;  5CPJ D;  4KUD D;  1S32 A;  1M18 A;  1HQ3 C;  5AV5 C;  3UTB D;  3MVD B;  5CP6 B;  3AZH B;  1H3O A;  4XUJ C;  3X1U C;  4J8V D;  3KXB B;  3REH B;  3B0C W;  3WA9 B;  3AV2 B;  1ZLA B;  2FJ7 B;  5B1M B;  4CSR B;  5B1L D;  5AVC A;  4Z66 C;  4KGC D;  3MGQ A;  2RVQ D;  3MGS B;  3AZE D;  4Z5T B;  5B24 D;  3TU4 A;  4H9S A;  5GT3 A;  5GSU C;  3AYW A;  5BO0 B;  1Q9C A;  3AZK D;  3UTA C;  1M1A A;  3MGP A;  2HUE B;  3KWQ D;  3MVD C;  4WU8 B;  3MNN B;  4G91 B;  3O62 B;  5CP6 C;  3AZH C;  5B31 A;  3KXB C;  3REI B;  1P3A D;  3REH C;  2F8N D;  3WA9 C;  4KUD A;  3AV2 C;  5B2I D;  3X1S B;  1ZLA C;  1BFM A;  4X23 A;  1P3B D;  5B1M C;  3TU4 C;  4XZQ D;  3MGS C;  4Z5T C;  1BH9 A;  1P3F B;  2ARO B;  1F66 A;  3VH6 A;  4KGC A;  5DNM A;  2HUE C;  2CV5 A;  4WU8 C;  3MNN C;  3AZE A;  4G91 C;  3LZ1 B;  3REJ A;  5B24 A;  3O62 C;  1TZY D;  3AN2 B;  3X1T A;  3MGR D;  3KUY D;  3REI C;  3AZK A;  5B2J B;  3KWQ A;  5AV6 D;  1M19 B;  3X1S C;  4J8U D;  1P34 B;  1KX4 D;  5GXQ A;  3C1C B;  1P3I A;  1P3O A;  5G49 B;  3W97 D;  5B32 D;  2F8N A;  4CAY B;  3W96 A;  1P3F C;  4E45 A;  2NQB A;  2ARO C;  1P3B A;  1AOI A;  3AZM B;  4YM6 A;  4XZQ A;  4R8P D;  1EQZ A;  5AY8 D;  3C1B A;  3LZ1 C;  4ZBJ B;  4LD9 D;  3AN2 C;  1KX5 A;  5E5A D;  1JFI A;  1P3G A;  4H9R A;  3R45 B;  5B2J C;  5CPK A;  5CPI A;  1M19 C;  1P34 C;  3WAA B;  5B40 B;  5B0Z A;  1P3L B;  4H9O A;  1B6W A;  3C1C C;  4E44 A;  3UT9 B;  3KUY A;  3B6G B;  5AVB D;  2YFW A;  4Z66 D;  5GT0 A;  5BT1 C;  4J8U A;  3AZM C;  5B31 G;  3AZL B;  3X1V B;  4J8X B;  4J8W B;  4H9Q B;  1S32 D;  1M18 D;  5F99 B;  3WTP A;  4ZUX B;  4ZBJ C;  3W98 B;  2NZD A;  5AV9 B;  3MVD D;  5JRG B;  1N1J B;  4JJN B;  5DNN A;  4QLC B;  3WAA C;  5AY8 A;  3V9R A;  5B40 C;  3AZN B;  1P3L C;  3REH D;  3WA9 D;  4KHA B;  5AVC D;  1HQ3 A;  5AV5 A;  2PYO B;  1WWI A;  4NE5 A;  3MGQ D;  3UT9 C;  1ZLA D;  3B6G C;  5AV8 B;  3TU4 D;  5GT3 D;  4XUJ A;  3X1U A;  3LJA B;  2JSS A;  3MGS D;  3AYW D;  3AZG B;  2BYK A;  2IO5 B;  3X1V C;  3AZL C;  4J8X C;  5B33 B;  3MGP D;  4J8W C;  1M1A D;  5F99 C;  3W98 C;  4WNN B;  4ZUX C;  4Z66 A;  5AV9 C;  3AFA B;  4UUZ A;  5JRG C;  4JJN C;  3WKJ B;  5B31 D;  4Z2M H;  3B6F B;  4QLC C;  5GSU A;  3AZN C;  1P3M B;  4X23 D;  3UTA A;  2PYO C;  3MVD A;  3NQJ B;  5AV8 C;  1P3K B;  5CP6 A;  3AZH A;  3LJA C;  3KXB A;  3AZG C;  1F66 D;  3REH A;  2IO5 C;  3WA9 A;  5DNM D;  5B33 C;  3AV2 A;  1ZLA A;  2CV5 D;  2FJ7 A;  5B1M A;  4CSR A;  3LEL B;  3AFA C;  3REJ D;  3WKJ C;  3X1T D;  3MGS A;  3AZF B;  4YS3 B;  1ID3 B;  4Z5T A;  3B6F C;  5JA4 B;  5BO0 A;  1P3M C;  5GXQ D;  1M19 D;  4WU8 A;  1P3I D;  1P3O D;  3MNN A;  1A7W A;  4H9N B;  3O62 A;  1P3K C;  3W96 D;  5B0Y B;  2NQB D;  3REI A;  1AOI D;  2FJ7 C;  3AZJ B;  3AZI B;  4YM6 D;  2L5A A;  3X1S A;  3LZ0 B;  4DRB A;  1EQZ D;  3C1B D;  2HIO B;  3LEL C;  3NQU B;  4Z2M G;  2BYM B;  1KX5 D;  1WWS A;  4YS3 C;  3AZF C;  1P3G D;  1ID3 C;  5BS7 C;  4G92 B;  1P3F A;  3B0D B;  5CPK D;  5CPI D;  2ARO A;  3A6N B;  5B0Z D;  5CPJ B;  3VH6 T;  4WZS B;  3UTB B;  4H9P B;  3LZ1 A;  3AN2 A;  5B0Y C;  3UT9 D;  5GT0 D;  4J8V B;  5B2J A;  3AZJ C;  5BNV B;  3AZI C;  3LZ0 C;  1M19 A;  1P34 A;  2NZD D;  2HIO C;  5B1L B;  3WTP D;  1HTA A;  2YFV B;  3X1V D;  3C1C A;  5F99 D;  5G49 A;  3W98 D;  5DNN D;  4CAY A;  4G92 C;  3B0D C;  3A6N C;  3AZM A;  3UTB C;  1HQ3 D;  5AV5 D;  3AZN D;  1BH8 B;  4XUJ D;  3X1U D;  4J8V C;  1P3A B;  3R45 A;  5KDM B;  5B2I B;  3WAA A;  5B40 A;  1P3L A;  5B1L C;  5B33 D;  1KX3 B;  3UT9 A;  3W99 B;  4WU9 B;  3B6G A;  3AFA D;  3WKJ D;  5GSU D;  3VH5 A;  3REL B;  3AZL A;  3X1V A;  4J8X A;  4J8W A;  4H9Q A;  3UTA D;  5F99 A;  3W98 A;  4ZUX A;  1P3M D;  5AV9 A;  1TZY B;  5CP6 D;  1N1J A;  4WV4 B;  5JRG A;  3MGR B;  4JJN A;  3AZH D;  1P3A C;  3KXB D;  4AWL B;  4QLC A;  5B2I C;  5AV6 B;  3AV2 D;  3AZN A;  1KX4 B;  4KHA A;  5B1M D;  2FJ7 D;  3AV1 B;  2PYO A;  1KX3 C;  3W99 C;  4WU9 C;  3REK B;  5B32 B;  5AV8 A;  3W97 B;  4Z5T D;  1U35 B;  3LJA A;  3REL C;  3AZG A;  1F1E A;  5B33 A;  2CWE A;  4R8P B;  4WU8 D;  4WNN A;  3MNN D;  3AFA A;  4LD9 B;  1TZY C;  5E5A B;  3O62 D;  3WKJ A;  3MGR C;  3REI D;  4AWL C;  3B6F A;  5AV6 C;  3X1S D;  1P3M A;  1KX4 C;  1R4V A;  3AZJ D;  5BNX B;  3AV1 C;  1P3P B;  3NQJ A;  4DRA A;  3REK C;  5B32 C;  5AVB B;  3W97 C;  2HIO D;  1U35 C;  1P3K A;  1P3F D;  5FUG B;  1TAF B;  2ARO D;  1S32 B;  1M18 B;  4R8P C;  5C3I B;  4NFT A;  3LZ1 D;  3LEL A;  4LD9 C;  5E5A C;  3AN2 D;  1H3O B;  3AZF A;  4YS3 A;  1ID3 A;  4M6B A;  5BS7 A;  5JA4 A;  5B2J D;  1P34 D;  1KU5 A;  1P3P C;  5AVC B;  3C1C D;  3MGQ B;  5AVB C;  4H9N A;  3TU4 B;  5GT3 B;  5B0Y A;  3AYW B;  5BT1 D;  3AZM D;  3AZJ A;  1M1A B;  3MGP B;  3AZI A;  1S32 C;  3LZ0 A;  1M18 C;  5C3I C;  2HIO A;  3NQU A;  2BYM A;  4HGA B;  5B31 B;  4KUD B;  3A6N A;  5B32 G;  4X23 B;  5B40 D;  3WAA D;  5CPJ A;  5AVC C;  1P3L D;  3UTB A;  4H9P A;  3KSY A;  3MGQ C;  3B6G D;  1BH9 B;  4H9S C;  5GT3 C;  1KX3 D;  3W99 D;  4WU9 D;  4J8V A;  3AYW C;  1F66 B;  4KGC B;  5DNM B;  5BNV A;  3MGP C;  3AZL D;  1M1A C;  4J8X D;  4J8W D;  2CV5 B;  3REL D;  5B1L A;  4ZUX D;  3AZE B;  2YFV A;  3REJ B;  5AV9 D;  5B24 B;  3X1T B;  5JRG D;  4HGA C;  4JJN D;  5B31 C;  3AZK B;  3VH6 W;  4KUD C;  5CPJ C;  4QLC D;  3KWQ B;  4X23 C;  5GXQ B;  1ULY A;  2PYO D;  1P3I B;  1P3O B;  2F8N K;  5AV8 D;  2F8N B;  3AV1 D;  3W96 B;  2NQB B;  1BH8 A;  3LJA D;  1F66 C;  3REK D;  1P3A A;  3AZG D;  1P3B B;  1AOI B;  5KDM A;  5DNM C;  1U35 D;  4KGC C;  3B0B A;  5B2I A;  3WTP E;  4YM6 B;  4XZQ B;  2CV5 C;  1EQZ B;  2RVQ C;  1B67 A;  3C1B B;  3AZE C;  3REJ C;  5B24 C;  1KX3 A;  1KX5 B;  3X1T C;  3W99 A;  4WU9 A;  1JFI B;  1P3G B;  3AZK C;  4H9R B;  5CPK B;  3B6F D;  5CPI B;  3KWQ C;  4NE6 A;  3REL A;  5B0Z B;  4H9O B;  2LY8 A;  3VH5 T;  5GXQ C;  1P3I C;  4EO5 B;  1P3O C;  4NE3 A;  3KUY B;  2F8N H;  1P3P D;  2YFW B;  3W96 C;  1TZY A;  1P3K D;  2NQB C;  3MGR A;  5GT0 B;  4J8U B;  1P3B C;  1AOI C;  5AV6 A;  4YM6 C;  4XZQ C;  1EQZ C;  3C1B C;  3WTP B;  1KX4 A;  2NZD B;  3LEL D;  3AV1 A;  1KX5 C;  3W97 A;  5B32 A;  5DNN B;  3REK A;  1P3G C;  4YS3 D;  3AZF D;  1ID3 D;  1U35 A;  5CPK C;  5CPI C;  3VH5 W;  3V9R B;  5AY8 B;  5B0Z C;  4R8P A;  1HQ3 B;  5AV5 B;  4EO5 C;  3KUY C;  4LD9 A;  5E5A A;  5GT0 C;  4XUJ B;  5B0Y D;  3X1U B;  4J8U C;  2BYK B;  3AZI D;  3LZ0 D;  3B0C T;  2NZD C;  3WTP C;  1P3P A;  5BNX A;  4Z66 B;  4UUZ B;  5CHL B;  5AVB A;  5DNN C; 
#chains in the Genus database with same CATH topology
 5FUG A;  1TAF A;  5GSU B;  5AY8 C;  3A6N D;  2F8N G;  3UTA B;  5CPJ D;  4KUD D;  1S32 A;  1M18 A;  1HQ3 C;  5AV5 C;  3UTB D;  3MVD B;  5CP6 B;  3AZH B;  1H3O A;  4XUJ C;  3X1U C;  4J8V D;  3KXB B;  3REH B;  3B0C W;  3WA9 B;  3AV2 B;  1ZLA B;  2FJ7 B;  5B1M B;  4CSR B;  5B1L D;  5AVC A;  2FFF B;  4Z66 C;  4KGC D;  3MGQ A;  2RVQ D;  3MGS B;  3AZE D;  4Z5T B;  5B24 D;  3TU4 A;  4H9S A;  5GT3 A;  5GSU C;  3AYW A;  5BO0 B;  1Q9C A;  3AZK D;  3UTA C;  1M1A A;  3MGP A;  2HUE B;  3KWQ D;  3EPJ A;  3MVD C;  4WU8 B;  3MNN B;  4G91 B;  3O62 B;  5CP6 C;  2BG1 A;  3AZH C;  5B31 A;  3KXB C;  3REI B;  1P3A D;  3REH C;  2F8N D;  3WA9 C;  4KUD A;  3AV2 C;  5B2I D;  3X1S B;  1ZLA C;  1BFM A;  4X23 A;  2Y2L A;  1P3B D;  5B1M C;  2ZM5 A;  3TU4 C;  2DF4 C;  4XZQ D;  3MGS C;  4Z5T C;  1BH9 A;  1P3F B;  2ARO B;  1F66 A;  3KFU G;  3VH6 A;  4KGC A;  5DNM A;  2HUE C;  2CV5 A;  4WU8 C;  3MNN C;  3AZE A;  4G91 C;  3LZ1 B;  3REJ A;  2Y2K A;  3H0M C;  5B24 A;  3O62 C;  1TZY D;  3AN2 B;  3X1T A;  3MGR D;  3KUY D;  3REI C;  3AZK A;  5B2J B;  3KWQ A;  5AV6 D;  1M19 B;  3X1S C;  4J8U D;  1P34 B;  1KX4 D;  5GXQ A;  3C1C B;  1P3I A;  1P3O A;  5G49 B;  3W97 D;  5B32 D;  2F8N A;  4CAY B;  3W96 A;  1P3F C;  4E45 A;  2NQB A;  1W2E A;  2ARO C;  1P3B A;  1AOI A;  3AZM B;  4YM6 A;  4XZQ A;  4R8P D;  1EQZ A;  5AY8 D;  3C1B A;  3LZ1 C;  4ZBJ B;  1Z2C B;  4LD9 D;  3AN2 C;  1KX5 A;  5E5A D;  1JFI A;  1P3G A;  4H9R A;  3R45 B;  5B2J C;  5CPK A;  5CPI A;  1M19 C;  1P34 C;  3WAA B;  5B40 B;  5B0Z A;  1P3L B;  4H9O A;  1B6W A;  3C1C C;  4E44 A;  2Y2O A;  3UT9 B;  3KUY A;  3B6G B;  5AVB D;  2YFW A;  4Z66 D;  2ZY5 A;  5GT0 A;  1PZR A;  5BT1 C;  4J8U A;  3AZM C;  5B31 G;  3AZL B;  3X1V B;  4J8X B;  4J8W B;  4H9Q B;  1S32 D;  1M18 D;  5F99 B;  3WTP A;  4ZUX B;  4ZBJ C;  3W98 B;  2NZD A;  5AV9 B;  2RIQ A;  3MVD D;  5JRG B;  1N1J B;  4JJN B;  5DNN A;  4QLC B;  3WAA C;  5AY8 A;  3V9R A;  5B40 C;  3AZN B;  1P3L C;  3REH D;  3WA9 D;  4KHA B;  5AVC D;  2Y2I A;  1HQ3 A;  5AV5 A;  2PYO B;  1WWI A;  4NE5 A;  3MGQ D;  3UT9 C;  1ZLA D;  3B6G C;  5AV8 B;  3TU4 D;  5GT3 D;  4XUJ A;  3X1U A;  3LJA B;  2JSS A;  3MGS D;  3AYW D;  3AZG B;  2BYK A;  2IO5 B;  3X1V C;  3AZL C;  4J8X C;  5B33 B;  3MGP D;  4J8W C;  1M1A D;  5F99 C;  3W98 C;  4WNN B;  4ZUX C;  4Z66 A;  5AV9 C;  3AFA B;  3EPK A;  4UUZ A;  5JRG C;  4JJN C;  3WKJ B;  5B31 D;  4Z2M H;  3B6F B;  4QLC C;  5GSU A;  3AZN C;  1P3M B;  4X23 D;  3UTA A;  2PYO C;  3MVD A;  3NQJ B;  5AV8 C;  1P3K B;  5CP6 A;  3AZH A;  3LJA C;  4DQY B;  3KXB A;  3AZG C;  1F66 D;  3REH A;  2IO5 C;  3WA9 A;  5DNM D;  5B33 C;  3AV2 A;  1ZLA A;  2CV5 D;  2FJ7 A;  5B1M A;  4CSR A;  3LEL B;  3AFA C;  3REJ D;  3WKJ C;  3X1T D;  3MGS A;  3AZF B;  4YS3 B;  1ID3 B;  4Z5T A;  3B6F C;  5JA4 B;  5BO0 A;  2F2A C;  1P3M C;  5GXQ D;  1M19 D;  4WU8 A;  1P3I D;  1P3O D;  3MNN A;  2ZY2 A;  1A7W A;  4H9N B;  3O62 A;  1P3K C;  3W96 D;  5B0Y B;  2NQB D;  3REI A;  1AOI D;  2FJ7 C;  3AZJ B;  3AZI B;  4YM6 D;  2L5A A;  3X1S A;  3LZ0 B;  4DRB A;  1EQZ D;  3C1B D;  2HIO B;  3LEL C;  3NQU B;  4Z2M G;  2BYM B;  1KX5 D;  1WWS A;  2Y2N A;  4YS3 C;  3AZF C;  1P3G D;  1ID3 C;  5BS7 C;  4G92 B;  1P3F A;  3B0D B;  5CPK D;  5CPI D;  2ARO A;  3EG5 B;  3A6N B;  5B0Z D;  5CPJ B;  3VH6 T;  4WZS B;  3UTB B;  4H9P B;  3LZ1 A;  3AN2 A;  5B0Y C;  3UT9 D;  5GT0 D;  4J8V B;  5B2J A;  3AZJ C;  5BNV B;  3AZI C;  3LZ0 C;  1M19 A;  1P34 A;  2NZD D;  2HIO C;  5B1L B;  3WTP D;  1HTA A;  2YFV B;  3X1V D;  3C1C A;  5F99 D;  5G49 A;  3W98 D;  5DNN D;  4CAY A;  4G92 C;  3B0D C;  3A6N C;  3AZM A;  3UTB C;  1HQ3 D;  5AV5 D;  3AZN D;  3IP4 C;  1BH8 B;  4XUJ D;  3X1U D;  4J8V C;  1P3A B;  3R45 A;  5KDM B;  5B2I B;  3WAA A;  5B40 A;  1P3L A;  5B1L C;  5B33 D;  1KX3 B;  3UT9 A;  3W99 B;  4WU9 B;  3B6G A;  3AFA D;  2G5I C;  3WKJ D;  2G5H C;  5GSU D;  4WJ3 C;  2Y2P A;  3VH5 A;  2Y2J A;  3A1I A;  3REL B;  3AZL A;  3X1V A;  4J8X A;  4J8W A;  4H9Q A;  3UTA D;  5F99 A;  3W98 A;  4ZUX A;  1P3M D;  5AV9 A;  1TZY B;  5CP6 D;  1N1J A;  4WV4 B;  5JRG A;  3MGR B;  2ZY3 A;  4JJN A;  3AZH D;  2Y2Q A;  3KXB D;  1P3A C;  4AWL B;  4QLC A;  5B2I C;  5AV6 B;  3AV2 D;  3AZN A;  1KX4 B;  4KHA A;  5B1M D;  2FJ7 D;  3AV1 B;  2PYO A;  3A1K A;  1KX3 C;  3W99 C;  1T3U A;  4WU9 C;  3REK B;  5B32 B;  2JCH A;  5AV8 A;  3W97 B;  4Z5T D;  1U35 B;  3LJA A;  3REL C;  3AZG A;  1F1E A;  5B33 A;  3H0L C;  2CWE A;  4R8P B;  4WU8 D;  4WNN A;  3MNN D;  3AFA A;  4LD9 B;  1TZY C;  5E5A B;  3O62 D;  3WKJ A;  4KGC C;  3MGR C;  3REI D;  4AWL C;  3B6F A;  5AV6 C;  3X1S D;  1P3M A;  2JE5 A;  1KX4 C;  3F6T A;  1R4V A;  3AZJ D;  5BNX B;  3AV1 C;  1P3P B;  2J8P A;  3NQJ A;  4DRA A;  3REK C;  5B32 C;  5AVB B;  3W97 C;  2HIO D;  1U35 C;  1P3K A;  1P3F D;  2VQR A;  5FUG B;  1TAF B;  2ARO D;  3P5J B;  3H0R C;  1S32 B;  1M18 B;  4R8P C;  5C3I B;  4NFT A;  3LZ1 D;  3LEL A;  4LD9 C;  5E5A C;  3AN2 D;  1H3O B;  3AZF A;  4YS3 A;  1ID3 A;  4M6B A;  5BS7 A;  5JA4 A;  5B2J D;  1P34 D;  1KU5 A;  1P3P C;  5AVC B;  3C1C D;  3MGQ B;  2Y2H A;  5AVB C;  4H9N A;  3TU4 B;  5GT3 B;  5B0Y A;  3AYW B;  5BT1 D;  3AZM D;  3AZJ A;  1M1A B;  3MGP B;  3AZI A;  1S32 C;  3LZ0 A;  1M18 C;  5C3I C;  2HIO A;  3NQU A;  2BYM A;  2W8S A;  4HGA B;  5B31 B;  4KUD B;  3A6N A;  2XD1 A;  5B32 G;  4X23 B;  5B40 D;  3WAA D;  5CPJ A;  5AVC C;  1P3L D;  3UTB A;  4H9P A;  3KSY A;  3MGQ C;  3B6G D;  2UWX A;  1BH9 B;  4H9S C;  5GT3 C;  1KX3 D;  3W99 D;  4WU9 D;  4J8V A;  3AYW C;  1F66 B;  4KGC B;  5DNM B;  5BNV A;  3MGP C;  3AZL D;  1M1A C;  4J8X D;  4J8W D;  2CV5 B;  3REL D;  5B1L A;  4ZUX D;  3AZE B;  2YFV A;  3REJ B;  5AV9 D;  5B24 B;  3X1T B;  5JRG D;  4HGA C;  4JJN D;  5B31 C;  3AZK B;  3VH6 W;  4KUD C;  5CPJ C;  4QLC D;  3KWQ B;  4X23 C;  5GXQ B;  1ULY A;  2PYO D;  1P3I B;  1P3O B;  2F8N K;  5AV8 D;  2F8N B;  3AV1 D;  3W96 B;  2NQB B;  1BH8 A;  3LJA D;  1F66 C;  3REK D;  1P3A A;  3AZG D;  2DQN C;  1P3B B;  5KDM A;  5DNM C;  1U35 D;  3FDD A;  1AOI B;  3B0B A;  5B2I A;  3WTP E;  4YM6 B;  4XZQ B;  2CV5 C;  1EQZ B;  2RVQ C;  1B67 A;  3C1B B;  3AZE C;  3REJ C;  5B24 C;  3EPH A;  2Y2G A;  1KX3 A;  1KX5 B;  3X1T C;  3W99 A;  4WU9 A;  1JFI B;  1P3G B;  4UPK A;  3AZK C;  4H9R B;  5CPK B;  3B6F D;  5CPI B;  3KWQ C;  4NE6 A;  3REL A;  5B0Z B;  4H9O B;  2LY8 A;  3VH5 T;  5GXQ C;  1P3I C;  4EO5 B;  1P3O C;  4NE3 A;  3KUY B;  2F8N H;  1P3P D;  2YFW B;  3W96 C;  1TZY A;  1P3K D;  2NQB C;  3MGR A;  5GT0 B;  4J8U B;  1P3B C;  1AOI C;  2ZY4 A;  5AV6 A;  4YM6 C;  4XZQ C;  1EQZ C;  3C1B C;  3WTP B;  1KX4 A;  2NZD B;  3LEL D;  3AV1 A;  1KX5 C;  3W97 A;  5B32 A;  5DNN B;  3REK A;  1P3G C;  2Y2M A;  4YS3 D;  3EPL A;  3AZF D;  1U35 A;  1ID3 D;  5CPK C;  3AL0 C;  5CPI C;  3VH5 W;  3V9R B;  5AY8 B;  5B0Z C;  4R8P A;  1HQ3 B;  5AV5 B;  4EO5 C;  3KUY C;  4LD9 A;  5E5A A;  5GT0 C;  4XUJ B;  5B0Y D;  3X1U B;  4J8U C;  2BYK B;  3AZI D;  2XD5 A;  3LZ0 D;  3B0C T;  2NZD C;  3WTP C;  1P3P A;  5BNX A;  4Z66 B;  4UUZ B;  5CHL B;  5AVB A;  5DNN C; 
#chains in the Genus database with same CATH homology
 5FUG A;  1TAF A;  5GSU B;  5AY8 C;  3A6N D;  2F8N G;  3UTA B;  5CPJ D;  4KUD D;  1S32 A;  1M18 A;  1HQ3 C;  5AV5 C;  3UTB D;  3MVD B;  5CP6 B;  3AZH B;  1H3O A;  4XUJ C;  3X1U C;  4J8V D;  3KXB B;  3REH B;  3B0C W;  3WA9 B;  3AV2 B;  1ZLA B;  2FJ7 B;  5B1M B;  4CSR B;  5B1L D;  5AVC A;  2FFF B;  4Z66 C;  4KGC D;  3MGQ A;  2RVQ D;  3MGS B;  3AZE D;  4Z5T B;  5B24 D;  3TU4 A;  4H9S A;  5GT3 A;  5GSU C;  3AYW A;  5BO0 B;  1Q9C A;  3AZK D;  3UTA C;  1M1A A;  3MGP A;  2HUE B;  3KWQ D;  3EPJ A;  3MVD C;  4WU8 B;  3MNN B;  4G91 B;  3O62 B;  5CP6 C;  2BG1 A;  3AZH C;  5B31 A;  3KXB C;  3REI B;  1P3A D;  3REH C;  2F8N D;  3WA9 C;  4KUD A;  3AV2 C;  5B2I D;  3X1S B;  1ZLA C;  1BFM A;  4X23 A;  2Y2L A;  1P3B D;  5B1M C;  2ZM5 A;  3TU4 C;  2DF4 C;  4XZQ D;  3MGS C;  4Z5T C;  1BH9 A;  1P3F B;  2ARO B;  1F66 A;  3KFU G;  3VH6 A;  4KGC A;  5DNM A;  2HUE C;  2CV5 A;  4WU8 C;  3MNN C;  3AZE A;  4G91 C;  3LZ1 B;  3REJ A;  2Y2K A;  3H0M C;  5B24 A;  3O62 C;  1TZY D;  3AN2 B;  3X1T A;  3MGR D;  3KUY D;  3REI C;  3AZK A;  5B2J B;  3KWQ A;  5AV6 D;  1M19 B;  3X1S C;  4J8U D;  1P34 B;  1KX4 D;  5GXQ A;  3C1C B;  1P3I A;  1P3O A;  5G49 B;  3W97 D;  5B32 D;  2F8N A;  4CAY B;  3W96 A;  1P3F C;  4E45 A;  2NQB A;  1W2E A;  2ARO C;  1P3B A;  1AOI A;  3AZM B;  4YM6 A;  4XZQ A;  4R8P D;  1EQZ A;  5AY8 D;  3C1B A;  3LZ1 C;  4ZBJ B;  1Z2C B;  4LD9 D;  3AN2 C;  1KX5 A;  5E5A D;  1JFI A;  1P3G A;  4H9R A;  3R45 B;  5B2J C;  5CPK A;  5CPI A;  1M19 C;  1P34 C;  3WAA B;  5B40 B;  5B0Z A;  1P3L B;  4H9O A;  1B6W A;  3C1C C;  4E44 A;  2Y2O A;  3UT9 B;  3KUY A;  3B6G B;  5AVB D;  2YFW A;  4Z66 D;  2ZY5 A;  5GT0 A;  1PZR A;  5BT1 C;  4J8U A;  3AZM C;  5B31 G;  3AZL B;  3X1V B;  4J8X B;  4J8W B;  4H9Q B;  1S32 D;  1M18 D;  5F99 B;  3WTP A;  4ZUX B;  4ZBJ C;  3W98 B;  2NZD A;  5AV9 B;  2RIQ A;  3MVD D;  5JRG B;  1N1J B;  4JJN B;  5DNN A;  4QLC B;  3WAA C;  5AY8 A;  3V9R A;  5B40 C;  3AZN B;  1P3L C;  3REH D;  3WA9 D;  4KHA B;  5AVC D;  2Y2I A;  1HQ3 A;  5AV5 A;  2PYO B;  1WWI A;  4NE5 A;  3MGQ D;  3UT9 C;  1ZLA D;  3B6G C;  5AV8 B;  3TU4 D;  5GT3 D;  4XUJ A;  3X1U A;  3LJA B;  2JSS A;  3MGS D;  3AYW D;  3AZG B;  2BYK A;  2IO5 B;  3X1V C;  3AZL C;  4J8X C;  5B33 B;  3MGP D;  4J8W C;  1M1A D;  5F99 C;  3W98 C;  4WNN B;  4ZUX C;  4Z66 A;  5AV9 C;  3AFA B;  3EPK A;  4UUZ A;  5JRG C;  4JJN C;  3WKJ B;  5B31 D;  4Z2M H;  3B6F B;  4QLC C;  5GSU A;  3AZN C;  1P3M B;  4X23 D;  3UTA A;  2PYO C;  3MVD A;  3NQJ B;  5AV8 C;  1P3K B;  5CP6 A;  3AZH A;  3LJA C;  4DQY B;  3KXB A;  3AZG C;  1F66 D;  3REH A;  2IO5 C;  3WA9 A;  5DNM D;  5B33 C;  3AV2 A;  1ZLA A;  2CV5 D;  2FJ7 A;  5B1M A;  4CSR A;  3LEL B;  3AFA C;  3REJ D;  3WKJ C;  3X1T D;  3MGS A;  3AZF B;  4YS3 B;  1ID3 B;  4Z5T A;  3B6F C;  5JA4 B;  5BO0 A;  2F2A C;  1P3M C;  5GXQ D;  1M19 D;  4WU8 A;  1P3I D;  1P3O D;  3MNN A;  2ZY2 A;  1A7W A;  4H9N B;  3O62 A;  1P3K C;  3W96 D;  5B0Y B;  2NQB D;  3REI A;  1AOI D;  2FJ7 C;  3AZJ B;  3AZI B;  4YM6 D;  2L5A A;  3X1S A;  3LZ0 B;  4DRB A;  1EQZ D;  3C1B D;  2HIO B;  3LEL C;  3NQU B;  4Z2M G;  2BYM B;  1KX5 D;  1WWS A;  2Y2N A;  4YS3 C;  3AZF C;  1P3G D;  1ID3 C;  5BS7 C;  4G92 B;  1P3F A;  3B0D B;  5CPK D;  5CPI D;  2ARO A;  3EG5 B;  3A6N B;  5B0Z D;  5CPJ B;  3VH6 T;  4WZS B;  3UTB B;  4H9P B;  3LZ1 A;  3AN2 A;  5B0Y C;  3UT9 D;  5GT0 D;  4J8V B;  5B2J A;  3AZJ C;  5BNV B;  3AZI C;  3LZ0 C;  1M19 A;  1P34 A;  2NZD D;  2HIO C;  5B1L B;  3WTP D;  1HTA A;  2YFV B;  3X1V D;  3C1C A;  5F99 D;  5G49 A;  3W98 D;  5DNN D;  4CAY A;  4G92 C;  3B0D C;  3A6N C;  3AZM A;  3UTB C;  1HQ3 D;  5AV5 D;  3AZN D;  3IP4 C;  1BH8 B;  4XUJ D;  3X1U D;  4J8V C;  1P3A B;  3R45 A;  5KDM B;  5B2I B;  3WAA A;  5B40 A;  1P3L A;  5B1L C;  5B33 D;  1KX3 B;  3UT9 A;  3W99 B;  4WU9 B;  3B6G A;  3AFA D;  2G5I C;  3WKJ D;  2G5H C;  5GSU D;  4WJ3 C;  2Y2P A;  3VH5 A;  2Y2J A;  3A1I A;  3REL B;  3AZL A;  3X1V A;  4J8X A;  4J8W A;  4H9Q A;  3UTA D;  5F99 A;  3W98 A;  4ZUX A;  1P3M D;  5AV9 A;  1TZY B;  5CP6 D;  1N1J A;  4WV4 B;  5JRG A;  3MGR B;  2ZY3 A;  4JJN A;  3AZH D;  2Y2Q A;  3KXB D;  1P3A C;  4AWL B;  4QLC A;  5B2I C;  5AV6 B;  3AV2 D;  3AZN A;  1KX4 B;  4KHA A;  5B1M D;  2FJ7 D;  3AV1 B;  2PYO A;  3A1K A;  1KX3 C;  3W99 C;  1T3U A;  4WU9 C;  3REK B;  5B32 B;  2JCH A;  5AV8 A;  3W97 B;  4Z5T D;  1U35 B;  3LJA A;  3REL C;  3AZG A;  1F1E A;  5B33 A;  3H0L C;  2CWE A;  4R8P B;  4WU8 D;  4WNN A;  3MNN D;  3AFA A;  4LD9 B;  1TZY C;  5E5A B;  3O62 D;  3WKJ A;  4KGC C;  3MGR C;  3REI D;  4AWL C;  3B6F A;  5AV6 C;  3X1S D;  1P3M A;  2JE5 A;  1KX4 C;  3F6T A;  1R4V A;  3AZJ D;  5BNX B;  3AV1 C;  1P3P B;  2J8P A;  3NQJ A;  4DRA A;  3REK C;  5B32 C;  5AVB B;  3W97 C;  2HIO D;  1U35 C;  1P3K A;  1P3F D;  2VQR A;  5FUG B;  1TAF B;  2ARO D;  3P5J B;  3H0R C;  1S32 B;  1M18 B;  4R8P C;  5C3I B;  4NFT A;  3LZ1 D;  3LEL A;  4LD9 C;  5E5A C;  3AN2 D;  1H3O B;  3AZF A;  4YS3 A;  1ID3 A;  4M6B A;  5BS7 A;  5JA4 A;  5B2J D;  1P34 D;  1KU5 A;  1P3P C;  5AVC B;  3C1C D;  3MGQ B;  2Y2H A;  5AVB C;  4H9N A;  3TU4 B;  5GT3 B;  5B0Y A;  3AYW B;  5BT1 D;  3AZM D;  3AZJ A;  1M1A B;  3MGP B;  3AZI A;  1S32 C;  3LZ0 A;  1M18 C;  5C3I C;  2HIO A;  3NQU A;  2BYM A;  2W8S A;  4HGA B;  5B31 B;  4KUD B;  3A6N A;  2XD1 A;  5B32 G;  4X23 B;  5B40 D;  3WAA D;  5CPJ A;  5AVC C;  1P3L D;  3UTB A;  4H9P A;  3KSY A;  3MGQ C;  3B6G D;  2UWX A;  1BH9 B;  4H9S C;  5GT3 C;  1KX3 D;  3W99 D;  4WU9 D;  4J8V A;  3AYW C;  1F66 B;  4KGC B;  5DNM B;  5BNV A;  3MGP C;  3AZL D;  1M1A C;  4J8X D;  4J8W D;  2CV5 B;  3REL D;  5B1L A;  4ZUX D;  3AZE B;  2YFV A;  3REJ B;  5AV9 D;  5B24 B;  3X1T B;  5JRG D;  4HGA C;  4JJN D;  5B31 C;  3AZK B;  3VH6 W;  4KUD C;  5CPJ C;  4QLC D;  3KWQ B;  4X23 C;  5GXQ B;  1ULY A;  2PYO D;  1P3I B;  1P3O B;  2F8N K;  5AV8 D;  2F8N B;  3AV1 D;  3W96 B;  2NQB B;  1BH8 A;  3LJA D;  1F66 C;  3REK D;  1P3A A;  3AZG D;  2DQN C;  1P3B B;  5KDM A;  5DNM C;  1U35 D;  3FDD A;  1AOI B;  3B0B A;  5B2I A;  3WTP E;  4YM6 B;  4XZQ B;  2CV5 C;  1EQZ B;  2RVQ C;  1B67 A;  3C1B B;  3AZE C;  3REJ C;  5B24 C;  3EPH A;  2Y2G A;  1KX3 A;  1KX5 B;  3X1T C;  3W99 A;  4WU9 A;  1JFI B;  1P3G B;  4UPK A;  3AZK C;  4H9R B;  5CPK B;  3B6F D;  5CPI B;  3KWQ C;  4NE6 A;  3REL A;  5B0Z B;  4H9O B;  2LY8 A;  3VH5 T;  5GXQ C;  1P3I C;  4EO5 B;  1P3O C;  4NE3 A;  3KUY B;  2F8N H;  1P3P D;  2YFW B;  3W96 C;  1TZY A;  1P3K D;  2NQB C;  3MGR A;  5GT0 B;  4J8U B;  1P3B C;  1AOI C;  2ZY4 A;  5AV6 A;  4YM6 C;  4XZQ C;  1EQZ C;  3C1B C;  3WTP B;  1KX4 A;  2NZD B;  3LEL D;  3AV1 A;  1KX5 C;  3W97 A;  5B32 A;  5DNN B;  3REK A;  1P3G C;  2Y2M A;  4YS3 D;  3EPL A;  3AZF D;  1U35 A;  1ID3 D;  5CPK C;  3AL0 C;  5CPI C;  3VH5 W;  3V9R B;  5AY8 B;  5B0Z C;  4R8P A;  1HQ3 B;  5AV5 B;  4EO5 C;  3KUY C;  4LD9 A;  5E5A A;  5GT0 C;  4XUJ B;  5B0Y D;  3X1U B;  4J8U C;  2BYK B;  3AZI D;  2XD5 A;  3LZ0 D;  3B0C T;  2NZD C;  3WTP C;  1P3P A;  5BNX A;  4Z66 B;  4UUZ B;  5CHL B;  5AVB A;  5DNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...