5GSUB

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuB00
5AV5A 5AV5C 5B40C 5DNND 3X1VB 5CP6D 3WTPE 2F8NG 4QLCD 3AZJB 2HIOC 3AZIA 3AZIC 1U35D 5FUGB 3UTAC 3UTAA 3MGPD 2HUEC 5AY8D 4G92B 1AOIA 3C1CB 3LJAD 5B1LD 3WA9D 5G49A 5DNMD 5B31A 4H9OA 5AVCD 3AZGA 2CV5D 3W98C 5B0YA 4WU8A 4WU8C 4H9PB 5GT0C 5GT0A 3AV2C 5GXQC 5GXQA 5CPJA 5BT1C 5GSUD 5CPJC 1A7WA 1KX4D 3KXBB 4X23D 3X1SC 4G91C 5JA4B 5GT3A 1P3BB 3AFAB 5BNXB 4J8WA 2BYMA 1P3FA 4J8XA 3A6NC 1S32C 1S32A 1M19B 4NE6A 4NFTA 1M1AA 1P3LC 1P3LA 3AZMA 3AZMC 5CPIB 3MNNC 4WU9D 5B24D 3B6FA 1P3GB 1M18D 5E5AB 4ZBJC 3C1BA 4UUZA 3REHA 3REHC 3RELB 4J8VD 5AVBD 5AV9C 5AV9A 3MGQB 4ZUXA 4ZUXC 3O62D 5B1MA 3X1UA 5B32A 5B32C 4XUJB 2IO5B 2NZDC 1KX5A 1KX5C 5BS7C 1P3IB 3WKJB 2NQBA 2NQBC 4XZQD 3MGSA 3REKD 1ZLAC 4R8PC 3KUYB 3R45A 1P3PD 3W99D 5CPKD 2F8NA 5JRGB 4JJNC 4KGCD 3VH5W 4YS3C 1P34B 3AZHC 2YFVB 3W97A 3W97C 3WAAB 1F66B 5B33A 5B33C 1P3MB 3UTBB 4CAYA 5DNNC 5DNNA 4YM6D 5CP6C 4QLCC 1U35C 1U35A 3X1VD 3MGPC 5AY8C 2LY8A 4WNNB 3AZFB 4Z5TC 4Z5TA 3WTPA 3LJAC 3REIA 5B1LA 5B1LC 5DNMC 1P3AB 3WA9C 3NQJA 3WA9A 3KWQB 3C1CD 5AVCA 5AVCC 2CV5C 4EO5C 1JFIB 2FJ7B 3LZ1A 4KUDB 4DRBA 4NE5A 4CSRA 5BNVA 3AV1B 5GSUC 3W96B 1KX4C 5C3IB 4X23A 4X23C 3AZEB 2BYKA 3KXBD 5B2IB 3UT9B 3V9RB 2AROB 1P3OD 3AFAD 1TAFB 4WU9A 4WU9C 1M19D 2PYOB 5BO0A 5B24C 5B24A 3REJD 5CPID 3B6GB 1M18C 3AZKA 4H9SC 4H9SA 1P3KA 3LZ0B 3MVDD 1P3GD 1ID3B 5E5AD 4J8VC 5AVBC 3VH6A 3TU4B 4Z2MG 1HQ3D 3O62C 3O62A 4H9NB 3AZIB 5B40A 4H9QA 2HUEB 4XUJD 1AOIB 4XZQA 4XZQC 2HIOA 3WKJD 5G49B 3REKC 5B31B 4H9OB 3AZGB 1Q9CA 5B0YB 4LD9B 5KDMA 1P3PC 3W99C 5CPKA 5CPKC 1P3PA 4WU8B 4KGCC 4KGCA 3W98A 5GT0B 2CWEA 4KHAA 5GXQB 4Z66D 5JRGD 4HGAC 3AZLD 3AV2A 1P34D 5GT3B 1WWIA 2F8NK 3X1SA 4YM6A 4YM6C 1F66D 4J8WB 2BYMB 1P3FB 1P3MD 4J8XB 1S32B 3X1VC 3X1VA 1M1AB 3AN2D 3A6NA 5B0ZB 3AZNB 3B6FB 3AZFD 3X1TD 3MNNA 3C1BB 1P3AD 3KWQD 2FJ7D 1TZYB 4KUDD 5B1MB 3X1UB 4H9PA 5B2JD 3B0BA 1KX5B 3W96D 3VH6T 3KXBC 2L5AA 2NZDA 5BS7A 1H3OA 3MGSB 1P3OC 5B2ID 1P3OA 3AFAA 3AFAC 3UT9D 3LELD 2AROD 1M19A 1M19C 2F8NB 1ZLAA 5CPIC 3REJA 4R8PA 3REJC 2PYOD 1B6WA 4JJNA 3MVDA 3MVDC 3W97B 5E5AC 4YS3A 5B33B 3LZ0D 3AZHA 1ID3D 1HQ3C 1HQ3A 1KX3D 1EQZB 4CAYB 5DNNB 3B0DB 3TU4D 1U35B 3AYWD 4XUJC 5CP6A 4QLCA 4Z5TB 3WTPB 3REIB 3WKJA 3WA9B 3WKJC 1AOID 5AV8B 3MGPA 5AY8A 3MGRB 3AZJD 3LJAA 4AWLC 5B31D 5DNMA 3LZ1B 3AZGD 5B0YD 2CV5A 4LD9D 4CSRB 4Z66A 4Z66C 5F99B 5AV6B 1BH9A 5JRGC 5GT0D 3AZLC 4X23B 3AZLA 2BYKB 1P34C 2YFVA 5GSUA 1KX4A 4H9RB 4J8UB 1F66A 1F66C 5GT3D 4J8WD 1P3FD 4J8XD 3AN2C 3AN2A 4WU9B 1P3BD 5B24B 1M1AD 1WWSA 3AZFC 3X1TC 3X1TA 3AZKB 5B0ZD 1P3AC 1P3AA 3AZND 1P3KB 3B6FD 3KWQC 3C1BD 1M18A 2YFWA 4Z2MH 2FJ7C 3VH6W 4KUDC 3O62B 2RVQD 4J8VA 5AVBA 1TZYD 5B2JA 4DRAA 5B2JC 5B1MD 5AV5B 5B40B 3X1UD 4H9QB 3W96C 3RELD 1N1JA 5C3IC 3MGQD 1BFMA 1KX5D 2HIOB 3UTAB 5B2IC 3UT9A 3UT9C 1P3ID 3LELA 3LELC 2AROC 2AROA 3NQUA 3MGSD 1B67A 5KDMB 3REKA 3W98B 2PYOC 2PYOA 2F8ND 3W99A 3KUYD 3AV2B 5CPJB 3LZ0C 3W97D 1ID3C 4E45A 3X1SB 1KX3A 1KX3C 4YM6B 4G91B 3VH5T 3TU4A 3TU4C 1EQZD 3WAAD 3AYWA 3AYWC 4H9NA 1BH8A 4E44A 3UTBD 3A6NB 1AOIC 3B0CT 1P3LB 3AZMB 4Z5TD 3MNNB 3WTPD 3REID 3AZJA 3AZJC 5FUGA 5AV8D 5B31C 4G92C 3MGRD 3AZGC 4ZBJB 5B0YC 3C1CA 3C1CC 4LD9C 4UUZB 4LD9A 3REHB 3LZ1D 5AV9B 5F99D 5AV6D 4ZUXB 5B32B 3AV1D 2NZDB 5GT3C 1H3OB 1P3OB 3KXBA 1F1EA 4J8UD 3AZED 2NQBB 4J8WC 1P3FC 5JA4A 4J8XC 1P3BA 1P3BC 5BNXA 1M1AC 1ZLAB 3REJB 4R8PB 4WV4B 3R45B 5B0ZA 5B0ZC 4JJNB 3MVDB 3AZNA 3AZNC 3B6FC 5CPIA 3AZKD 3C1BC 4YS3B 1P3KD 3AZHB 1HQ3B 3B6GD 1P3GC 1P3GA 5E5AA 2RVQC 1TZYA 1TZYC 5B1MC 3X1UC 3RELA 3RELC 1KU5A 4NE3A 3MGQA 3MGQC 5CP6B 5B40D 5AV5D 4QLCB 1ULYA 3MGPB 4XUJA 5AY8B 2IO5C 2HIOD 3AZID 1P3IA 1P3IC 1HTAA 3UTAD 3LJAB 3MGSC 4AWLB 5B1LB 5DNMB 4M6BA 3NQJB 5CHLB 5AVCB 2CV5B 4EO5B 4Z66B 1BH9B 2JSSA 3W98D 3AZLB 3KUYA 3KUYC 5BNVB 5GSUB 3VH5A 5JRGA 4WU8D 1KX4B 3AV2D 1R4VA 5GXQD 5CPJD 5BT1D 1P34A 3X1SD 3WAAC 1EQZA 1EQZC 3WAAA 3B0CW 3B0DC 5B31G 3AN2B 1P3MC 3UTBA 3UTBC 1P3MA 3X1TB 3A6ND 3WTPC 3REIC 1S32D 5BO0B 5AV8A 5AV8C 3AZMD 1P3LD 4WNNA 3MNND 3MGRA 3MGRC 3AZFA 1M18B 2YFWB 3LZ1C 3KWQA 4J8VB 5AVBB 3REHD 5B2JB 5F99A 5AV6A 5AV6C 5F99C 1JFIA 2FJ7A 4KUDA 1N1JB 2F8NH 5AV9D 3AV1C 3AV1A 4ZUXD 3W96A 4H9RA 5B32D 4J8UA 4J8UC 2NZDD 3AZEA 3AZEC 4XZQB 3LELB 3NQUB 2NQBD 5B2IA 3REKB 3V9RA 1P3PB 3W99B 5CPKB 1ZLAD 4R8PD 4KGCB 4KHAB 3AZKC 1TAFA 5B32G 1P3KC 4JJND 4HGAB 4WZSB 3KSYA 3B6GA 1KX3B 3B6GC 4YS3D 3AZHD 3LZ0A 1ID3A 3AYWB 1BH8B 5B33D
chains in the Genus database with same CATH superfamily
5AV5A 5AV5C 5B40C 5DNND 3X1VB 5CP6D 3WTPE 2F8NG 4QLCD 3AZJB 2HIOC 3AZIA 3AZIC 1U35D 5FUGB 3UTAC 3UTAA 3MGPD 2HUEC 5AY8D 4G92B 1AOIA 3C1CB 3LJAD 5B1LD 3WA9D 5G49A 5DNMD 5B31A 4H9OA 5AVCD 3AZGA 2CV5D 3W98C 5B0YA 4WU8A 4WU8C 4H9PB 5GT0C 5GT0A 3AV2C 5GXQC 5GXQA 5CPJA 5BT1C 5GSUD 5CPJC 1A7WA 1KX4D 3KXBB 4X23D 3X1SC 4G91C 5JA4B 5GT3A 1P3BB 3AFAB 5BNXB 4J8WA 2BYMA 1P3FA 4J8XA 3A6NC 1S32C 1S32A 1M19B 4NE6A 4NFTA 1M1AA 1P3LC 1P3LA 3AZMA 3AZMC 5CPIB 3MNNC 4WU9D 5B24D 3B6FA 1P3GB 1M18D 5E5AB 4ZBJC 3C1BA 4UUZA 2ZY4A 3REHA 3REHC 3RELB 4J8VD 5AVBD 2Y2NA 5AV9C 5AV9A 3MGQB 4ZUXA 4ZUXC 3O62D 5B1MA 3X1UA 2Y2KA 5B32A 5B32C 4XUJB 2IO5B 2NZDC 2W8SA 1KX5A 5BS7C 1P3IB 1KX5C 3WKJB 2NQBA 2NQBC 4XZQD 3MGSA 4WJ3C 3REKD 1ZLAC 4R8PC 3KUYB 3R45A 1P3PD 3W99D 5CPKD 2F8NA 5JRGB 4JJNC 4KGCD 3VH5W 4YS3C 1P34B 3AZHC 2YFVB 3W97A 3W97C 3WAAB 3A1IA 1F66B 5B33A 5B33C 1P3MB 3UTBB 4CAYA 5DNNC 5DNNA 4YM6D 5CP6C 4QLCC 1U35C 3EG5B 1U35A 2Y2HA 3X1VD 3MGPC 5AY8C 2LY8A 4WNNB 3AZFB 4Z5TC 4Z5TA 3WTPA 3LJAC 1W2EA 3REIA 5B1LA 5B1LC 5DNMC 1P3AB 3WA9C 3NQJA 3WA9A 3KWQB 3C1CD 5AVCA 5AVCC 2CV5C 4EO5C 1JFIB 3FDDA 2FJ7B 3LZ1A 4KUDB 2Y2JA 4DRBA 2G5IC 4NE5A 4CSRA 5BNVA 3AV1B 5GSUC 3W96B 1KX4C 5C3IB 4X23A 4X23C 3AZEB 2XD5A 2BYKA 3KXBD 5B2IB 3UT9B 3V9RB 2F2AC 2AROB 1P3OD 3AFAD 2DQNC 1TAFB 4WU9A 4WU9C 1M19D 2PYOB 5BO0A 5B24C 5B24A 3REJD 5CPID 3B6GB 3A1KA 1M18C 3AZKA 2JCHA 4H9SC 4H9SA 1T3UA 1P3KA 3LZ0B 3MVDD 1P3GD 1ID3B 5E5AD 4J8VC 5AVBC 3VH6A 2FFFB 3TU4B 4Z2MG 1HQ3D 3O62C 3O62A 4H9NB 3AZIB 5B40A 4H9QA 3EPJA 2HUEB 4XUJD 1AOIB 4XZQA 4XZQC 2HIOA 3WKJD 5G49B 3REKC 5B31B 4H9OB 3AZGB 1Q9CA 5B0YB 4LD9B 5KDMA 1P3PC 3W99C 5CPKA 5CPKC 1P3PA 4WU8B 4KGCC 4KGCA 3W98A 5GT0B 2CWEA 4KHAA 5GXQB 4Z66D 5JRGD 4HGAC 3AZLD 3AV2A 1P34D 5GT3B 1WWIA 2F8NK 3X1SA 4YM6A 4YM6C 1F66D 4J8WB 2BYMB 1P3FB 1P3MD 4J8XB 1S32B 3X1VC 3X1VA 3P5JB 4DQYB 1M1AB 3AN2D 3A6NA 5B0ZB 3AZNB 3B6FB 3AZFD 3X1TD 3MNNA 3C1BB 1P3AD 3KWQD 2FJ7D 1TZYB 4KUDD 5B1MB 3X1UB 4H9PA 5B2JD 3B0BA 1KX5B 3W96D 3VH6T 3KXBC 2L5AA 2NZDA 5BS7A 1H3OA 3MGSB 1P3OC 4UPKA 5B2ID 1P3OA 3AFAA 3AFAC 3UT9D 3LELD 2AROD 2J8PA 2ZM5A 3H0MC 3H0RC 1M19A 3EPLA 1M19C 2F8NB 1ZLAA 5CPIC 3REJA 4R8PA 3REJC 2PYOD 1B6WA 4JJNA 3MVDA 3MVDC 3W97B 2ZY2A 5E5AC 4YS3A 5B33B 3LZ0D 3AZHA 1ID3D 1HQ3C 1HQ3A 1KX3D 1EQZB 4CAYB 5DNNB 3B0DB 3TU4D 1PZRA 1U35B 3AYWD 2ZY5A 4XUJC 5CP6A 4QLCA 4Z5TB 3WTPB 3REIB 3IP4C 3WKJA 3WA9B 3WKJC 1AOID 5AV8B 3MGPA 5AY8A 3MGRB 3AZJD 3LJAA 4AWLC 5B31D 5DNMA 3LZ1B 3AZGD 5B0YD 2CV5A 4LD9D 4CSRB 4Z66A 4Z66C 5F99B 5AV6B 1BH9A 5JRGC 5GT0D 3AZLC 4X23B 3AZLA 2BYKB 1P34C 2YFVA 2ZY3A 5GSUA 1KX4A 4H9RB 4J8UB 1F66A 1F66C 5GT3D 4J8WD 1P3FD 2Y2QA 4J8XD 3AN2C 3AN2A 4WU9B 1P3BD 5B24B 1M1AD 1WWSA 3AZFC 3X1TC 3X1TA 3AZKB 5B0ZD 1P3AC 1P3AA 3AZND 1P3KB 3B6FD 3KWQC 3C1BD 3AL0C 1M18A 2YFWA 4Z2MH 2FJ7C 3VH6W 4KUDC 3O62B 2RVQD 4J8VA 5AVBA 1TZYD 5B2JA 4DRAA 5B2JC 5B1MD 5AV5B 5B40B 3X1UD 4H9QB 3W96C 3RELD 1N1JA 5C3IC 3MGQD 1BFMA 1KX5D 2VQRA 2HIOB 3UTAB 5B2IC 3UT9A 3UT9C 1P3ID 3LELA 3LELC 2AROC 2AROA 3NQUA 3MGSD 1B67A 2XD1A 5KDMB 2BG1A 3REKA 3W98B 3KFUG 2PYOC 2PYOA 2F8ND 3EPHA 3W99A 3KUYD 3AV2B 5CPJB 3LZ0C 3W97D 1ID3C 4E45A 3X1SB 1KX3A 1KX3C 4YM6B 4G91B 3VH5T 3TU4A 3TU4C 1EQZD 3WAAD 3AYWA 3AYWC 4H9NA 1BH8A 4E44A 3UTBD 3A6NB 1AOIC 3B0CT 1P3LB 3AZMB 4Z5TD 3MNNB 3WTPD 3REID 3AZJA 3AZJC 5FUGA 5AV8D 5B31C 4G92C 3MGRD 3AZGC 4ZBJB 5B0YC 3C1CA 3C1CC 4LD9C 4UUZB 4LD9A 3REHB 3LZ1D 3H0LC 5AV9B 5F99D 2Y2PA 5AV6D 4ZUXB 2Y2LA 5B32B 3AV1D 2NZDB 5GT3C 1H3OB 1P3OB 3KXBA 1F1EA 4J8UD 2DF4C 3AZED 2NQBB 4J8WC 2JE5A 1P3FC 5JA4A 4J8XC 3F6TA 1P3BA 1P3BC 5BNXA 1M1AC 1ZLAB 3REJB 4R8PB 4WV4B 1Z2CB 3R45B 2Y2OA 5B0ZA 5B0ZC 4JJNB 3MVDB 3AZNA 3AZNC 3B6FC 2UWXA 5CPIA 3AZKD 3C1BC 4YS3B 1P3KD 2Y2GA 3AZHB 1HQ3B 3B6GD 1P3GC 1P3GA 5E5AA 2RVQC 1TZYA 1TZYC 5B1MC 3X1UC 3RELA 3RELC 1KU5A 2Y2IA 4NE3A 2Y2MA 3MGQA 3MGQC 5CP6B 5B40D 5AV5D 4QLCB 1ULYA 3MGPB 4XUJA 5AY8B 2IO5C 2HIOD 3AZID 1P3IA 1P3IC 1HTAA 3UTAD 3LJAB 3MGSC 2G5HC 4AWLB 5B1LB 5DNMB 4M6BA 3NQJB 5CHLB 5AVCB 2CV5B 4EO5B 4Z66B 1BH9B 2JSSA 3W98D 3AZLB 3KUYA 3KUYC 5BNVB 5GSUB 3VH5A 5JRGA 4WU8D 1KX4B 3AV2D 1R4VA 5GXQD 5CPJD 5BT1D 1P34A 3X1SD 3WAAC 1EQZA 1EQZC 3WAAA 3B0CW 3B0DC 5B31G 3AN2B 1P3MC 3UTBA 3UTBC 1P3MA 3X1TB 3A6ND 3WTPC 3REIC 1S32D 5BO0B 5AV8A 5AV8C 3AZMD 1P3LD 4WNNA 3MNND 3MGRA 3MGRC 3AZFA 1M18B 2YFWB 3LZ1C 3KWQA 3EPKA 5AVBB 4J8VB 3REHD 5B2JB 5F99A 5AV6A 5AV6C 5F99C 1JFIA 2FJ7A 4KUDA 1N1JB 2F8NH 5AV9D 3AV1C 3AV1A 4ZUXD 2RIQA 3W96A 4H9RA 5B32D 4J8UA 4J8UC 2NZDD 3AZEA 3AZEC 4XZQB 3LELB 3NQUB 2NQBD 5B2IA 3REKB 3V9RA 1P3PB 3W99B 5CPKB 1ZLAD 4R8PD 4KGCB 4KHAB 3AZKC 1TAFA 5B32G 1P3KC 4JJND 4HGAB 4WZSB 3KSYA 3B6GA 1KX3B 3B6GC 4YS3D 3AZHD 3LZ0A 1ID3A 3AYWB 1BH8B 5B33D
chains in the Genus database with same CATH topology
5AV5A 5AV5C 5B40C 5DNND 3X1VB 5CP6D 3WTPE 2F8NG 4QLCD 3AZJB 2HIOC 3AZIA 3AZIC 1U35D 5FUGB 3UTAC 3UTAA 3MGPD 2HUEC 5AY8D 4G92B 1AOIA 3C1CB 3LJAD 5B1LD 3WA9D 5G49A 5DNMD 5B31A 4H9OA 5AVCD 3AZGA 2CV5D 3W98C 5B0YA 4WU8A 4WU8C 4H9PB 5GT0C 5GT0A 3AV2C 5GXQC 5GXQA 5CPJA 5BT1C 5GSUD 5CPJC 1A7WA 1KX4D 3KXBB 4X23D 3X1SC 4G91C 5JA4B 5GT3A 1P3BB 3AFAB 5BNXB 4J8WA 2BYMA 1P3FA 4J8XA 3A6NC 1S32C 1S32A 1M19B 4NE6A 4NFTA 1M1AA 1P3LC 1P3LA 3AZMA 3AZMC 5CPIB 3MNNC 4WU9D 5B24D 3B6FA 1P3GB 1M18D 5E5AB 4ZBJC 3C1BA 4UUZA 2ZY4A 3REHA 3REHC 3RELB 4J8VD 5AVBD 2Y2NA 5AV9C 5AV9A 3MGQB 4ZUXA 4ZUXC 3O62D 5B1MA 3X1UA 2Y2KA 5B32A 5B32C 4XUJB 2IO5B 2NZDC 2W8SA 1KX5A 5BS7C 1P3IB 1KX5C 3WKJB 2NQBA 2NQBC 4XZQD 3MGSA 4WJ3C 3REKD 1ZLAC 4R8PC 3KUYB 3R45A 1P3PD 3W99D 5CPKD 2F8NA 5JRGB 4JJNC 4KGCD 3VH5W 4YS3C 1P34B 3AZHC 2YFVB 3W97A 3W97C 3WAAB 3A1IA 1F66B 5B33A 5B33C 1P3MB 3UTBB 4CAYA 5DNNC 5DNNA 4YM6D 5CP6C 4QLCC 1U35C 3EG5B 1U35A 2Y2HA 3X1VD 3MGPC 5AY8C 2LY8A 4WNNB 3AZFB 4Z5TC 4Z5TA 3WTPA 3LJAC 1W2EA 3REIA 5B1LA 5B1LC 5DNMC 1P3AB 3WA9C 3NQJA 3WA9A 3KWQB 3C1CD 5AVCA 5AVCC 2CV5C 4EO5C 1JFIB 3FDDA 2FJ7B 3LZ1A 4KUDB 2Y2JA 4DRBA 2G5IC 4NE5A 4CSRA 5BNVA 3AV1B 5GSUC 3W96B 1KX4C 5C3IB 4X23A 4X23C 3AZEB 2XD5A 2BYKA 3KXBD 5B2IB 3UT9B 3V9RB 2F2AC 2AROB 1P3OD 3AFAD 2DQNC 1TAFB 4WU9A 4WU9C 1M19D 2PYOB 5BO0A 5B24C 5B24A 3REJD 5CPID 3B6GB 3A1KA 1M18C 3AZKA 2JCHA 4H9SC 4H9SA 1T3UA 1P3KA 3LZ0B 3MVDD 1P3GD 1ID3B 5E5AD 4J8VC 5AVBC 3VH6A 2FFFB 3TU4B 4Z2MG 1HQ3D 3O62C 3O62A 4H9NB 3AZIB 5B40A 4H9QA 3EPJA 2HUEB 4XUJD 1AOIB 4XZQA 4XZQC 2HIOA 3WKJD 5G49B 3REKC 5B31B 4H9OB 3AZGB 1Q9CA 5B0YB 4LD9B 5KDMA 1P3PC 3W99C 5CPKA 5CPKC 1P3PA 4WU8B 4KGCC 4KGCA 3W98A 5GT0B 2CWEA 4KHAA 5GXQB 4Z66D 5JRGD 4HGAC 3AZLD 3AV2A 1P34D 5GT3B 1WWIA 2F8NK 3X1SA 4YM6A 4YM6C 1F66D 4J8WB 2BYMB 1P3FB 1P3MD 4J8XB 1S32B 3X1VC 3X1VA 3P5JB 4DQYB 1M1AB 3AN2D 3A6NA 5B0ZB 3AZNB 3B6FB 3AZFD 3X1TD 3MNNA 3C1BB 1P3AD 3KWQD 2FJ7D 1TZYB 4KUDD 5B1MB 3X1UB 4H9PA 5B2JD 3B0BA 1KX5B 3W96D 3VH6T 3KXBC 2L5AA 2NZDA 5BS7A 1H3OA 3MGSB 1P3OC 4UPKA 5B2ID 1P3OA 3AFAA 3AFAC 3UT9D 3LELD 2AROD 2J8PA 2ZM5A 3H0MC 3H0RC 1M19A 3EPLA 1M19C 2F8NB 1ZLAA 5CPIC 3REJA 4R8PA 3REJC 2PYOD 1B6WA 4JJNA 3MVDA 3MVDC 3W97B 2ZY2A 5E5AC 4YS3A 5B33B 3LZ0D 3AZHA 1ID3D 1HQ3C 1HQ3A 1KX3D 1EQZB 4CAYB 5DNNB 3B0DB 3TU4D 1PZRA 1U35B 3AYWD 2ZY5A 4XUJC 5CP6A 4QLCA 4Z5TB 3WTPB 3REIB 3IP4C 3WKJA 3WA9B 3WKJC 1AOID 5AV8B 3MGPA 5AY8A 3MGRB 3AZJD 3LJAA 4AWLC 5B31D 5DNMA 3LZ1B 3AZGD 5B0YD 2CV5A 4LD9D 4CSRB 4Z66A 4Z66C 5F99B 5AV6B 1BH9A 5JRGC 5GT0D 3AZLC 4X23B 3AZLA 2BYKB 1P34C 2YFVA 2ZY3A 5GSUA 1KX4A 4H9RB 4J8UB 1F66A 1F66C 5GT3D 4J8WD 1P3FD 2Y2QA 4J8XD 3AN2C 3AN2A 4WU9B 1P3BD 5B24B 1M1AD 1WWSA 3AZFC 3X1TC 3X1TA 3AZKB 5B0ZD 1P3AC 1P3AA 3AZND 1P3KB 3B6FD 3KWQC 3C1BD 3AL0C 1M18A 2YFWA 4Z2MH 2FJ7C 3VH6W 4KUDC 3O62B 2RVQD 4J8VA 5AVBA 1TZYD 5B2JA 4DRAA 5B2JC 5B1MD 5AV5B 5B40B 3X1UD 4H9QB 3W96C 3RELD 1N1JA 5C3IC 3MGQD 1BFMA 1KX5D 2VQRA 2HIOB 3UTAB 5B2IC 3UT9A 3UT9C 1P3ID 3LELA 3LELC 2AROC 2AROA 3NQUA 3MGSD 1B67A 2XD1A 5KDMB 2BG1A 3REKA 3W98B 3KFUG 2PYOC 2PYOA 2F8ND 3EPHA 3W99A 3KUYD 3AV2B 5CPJB 3LZ0C 3W97D 1ID3C 4E45A 3X1SB 1KX3A 1KX3C 4YM6B 4G91B 3VH5T 3TU4A 3TU4C 1EQZD 3WAAD 3AYWA 3AYWC 4H9NA 1BH8A 4E44A 3UTBD 3A6NB 1AOIC 3B0CT 1P3LB 3AZMB 4Z5TD 3MNNB 3WTPD 3REID 3AZJA 3AZJC 5FUGA 5AV8D 5B31C 4G92C 3MGRD 3AZGC 4ZBJB 5B0YC 3C1CA 3C1CC 4LD9C 4UUZB 4LD9A 3REHB 3LZ1D 3H0LC 5AV9B 5F99D 2Y2PA 5AV6D 4ZUXB 2Y2LA 5B32B 3AV1D 2NZDB 5GT3C 1H3OB 1P3OB 3KXBA 1F1EA 4J8UD 2DF4C 3AZED 2NQBB 4J8WC 2JE5A 1P3FC 5JA4A 4J8XC 3F6TA 1P3BA 1P3BC 5BNXA 1M1AC 1ZLAB 3REJB 4R8PB 4WV4B 1Z2CB 3R45B 2Y2OA 5B0ZA 5B0ZC 4JJNB 3MVDB 3AZNA 3AZNC 3B6FC 2UWXA 5CPIA 3AZKD 3C1BC 4YS3B 1P3KD 2Y2GA 3AZHB 1HQ3B 3B6GD 1P3GC 1P3GA 5E5AA 2RVQC 1TZYA 1TZYC 5B1MC 3X1UC 3RELA 3RELC 1KU5A 2Y2IA 4NE3A 2Y2MA 3MGQA 3MGQC 5CP6B 5B40D 5AV5D 4QLCB 1ULYA 3MGPB 4XUJA 5AY8B 2IO5C 2HIOD 3AZID 1P3IA 1P3IC 1HTAA 3UTAD 3LJAB 3MGSC 2G5HC 4AWLB 5B1LB 5DNMB 4M6BA 3NQJB 5CHLB 5AVCB 2CV5B 4EO5B 4Z66B 1BH9B 2JSSA 3W98D 3AZLB 3KUYA 3KUYC 5BNVB 5GSUB 3VH5A 5JRGA 4WU8D 1KX4B 3AV2D 1R4VA 5GXQD 5CPJD 5BT1D 1P34A 3X1SD 3WAAC 1EQZA 1EQZC 3WAAA 3B0CW 3B0DC 5B31G 3AN2B 1P3MC 3UTBA 3UTBC 1P3MA 3X1TB 3A6ND 3WTPC 3REIC 1S32D 5BO0B 5AV8A 5AV8C 3AZMD 1P3LD 4WNNA 3MNND 3MGRA 3MGRC 3AZFA 1M18B 2YFWB 3LZ1C 3KWQA 3EPKA 5AVBB 4J8VB 3REHD 5B2JB 5F99A 5AV6A 5AV6C 5F99C 1JFIA 2FJ7A 4KUDA 1N1JB 2F8NH 5AV9D 3AV1C 3AV1A 4ZUXD 2RIQA 3W96A 4H9RA 5B32D 4J8UA 4J8UC 2NZDD 3AZEA 3AZEC 4XZQB 3LELB 3NQUB 2NQBD 5B2IA 3REKB 3V9RA 1P3PB 3W99B 5CPKB 1ZLAD 4R8PD 4KGCB 4KHAB 3AZKC 1TAFA 5B32G 1P3KC 4JJND 4HGAB 4WZSB 3KSYA 3B6GA 1KX3B 3B6GC 4YS3D 3AZHD 3LZ0A 1ID3A 3AYWB 1BH8B 5B33D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 A;  5AV5 C;  5B40 C;  5DNN D;  3X1V B;  5CP6 D;  3WTP E;  2F8N G;  4QLC D;  3AZJ B;  2HIO C;  3AZI A;  3AZI C;  1U35 D;  5FUG B;  3UTA C;  3UTA A;  3MGP D;  2HUE C;  5AY8 D;  4G92 B;  1AOI A;  3C1C B;  3LJA D;  5B1L D;  3WA9 D;  5G49 A;  5DNM D;  5B31 A;  4H9O A;  5AVC D;  3AZG A;  2CV5 D;  3W98 C;  5B0Y A;  4WU8 A;  4WU8 C;  4H9P B;  5GT0 C;  5GT0 A;  3AV2 C;  5GXQ C;  5GXQ A;  5CPJ A;  5BT1 C;  5GSU D;  5CPJ C;  1A7W A;  1KX4 D;  3KXB B;  4X23 D;  3X1S C;  4G91 C;  5JA4 B;  5GT3 A;  1P3B B;  3AFA B;  5BNX B;  4J8W A;  2BYM A;  1P3F A;  4J8X A;  3A6N C;  1S32 C;  1S32 A;  1M19 B;  4NE6 A;  4NFT A;  1M1A A;  1P3L C;  1P3L A;  3AZM A;  3AZM C;  5CPI B;  3MNN C;  4WU9 D;  5B24 D;  3B6F A;  1P3G B;  1M18 D;  5E5A B;  4ZBJ C;  3C1B A;  4UUZ A;  3REH A;  3REH C;  3REL B;  4J8V D;  5AVB D;  5AV9 C;  5AV9 A;  3MGQ B;  4ZUX A;  4ZUX C;  3O62 D;  5B1M A;  3X1U A;  5B32 A;  5B32 C;  4XUJ B;  2IO5 B;  2NZD C;  1KX5 A;  1KX5 C;  5BS7 C;  1P3I B;  3WKJ B;  2NQB A;  2NQB C;  4XZQ D;  3MGS A;  3REK D;  1ZLA C;  4R8P C;  3KUY B;  3R45 A;  1P3P D;  3W99 D;  5CPK D;  2F8N A;  5JRG B;  4JJN C;  4KGC D;  3VH5 W;  4YS3 C;  1P34 B;  3AZH C;  2YFV B;  3W97 A;  3W97 C;  3WAA B;  1F66 B;  5B33 A;  5B33 C;  1P3M B;  3UTB B;  4CAY A;  5DNN C;  5DNN A;  4YM6 D;  5CP6 C;  4QLC C;  1U35 C;  1U35 A;  3X1V D;  3MGP C;  5AY8 C;  2LY8 A;  4WNN B;  3AZF B;  4Z5T C;  4Z5T A;  3WTP A;  3LJA C;  3REI A;  5B1L A;  5B1L C;  5DNM C;  1P3A B;  3WA9 C;  3NQJ A;  3WA9 A;  3KWQ B;  3C1C D;  5AVC A;  5AVC C;  2CV5 C;  4EO5 C;  1JFI B;  2FJ7 B;  3LZ1 A;  4KUD B;  4DRB A;  4NE5 A;  4CSR A;  5BNV A;  3AV1 B;  5GSU C;  3W96 B;  1KX4 C;  5C3I B;  4X23 A;  4X23 C;  3AZE B;  2BYK A;  3KXB D;  5B2I B;  3UT9 B;  3V9R B;  2ARO B;  1P3O D;  3AFA D;  1TAF B;  4WU9 A;  4WU9 C;  1M19 D;  2PYO B;  5BO0 A;  5B24 C;  5B24 A;  3REJ D;  5CPI D;  3B6G B;  1M18 C;  3AZK A;  4H9S C;  4H9S A;  1P3K A;  3LZ0 B;  3MVD D;  1P3G D;  1ID3 B;  5E5A D;  4J8V C;  5AVB C;  3VH6 A;  3TU4 B;  4Z2M G;  1HQ3 D;  3O62 C;  3O62 A;  4H9N B;  3AZI B;  5B40 A;  4H9Q A;  2HUE B;  4XUJ D;  1AOI B;  4XZQ A;  4XZQ C;  2HIO A;  3WKJ D;  5G49 B;  3REK C;  5B31 B;  4H9O B;  3AZG B;  1Q9C A;  5B0Y B;  4LD9 B;  5KDM A;  1P3P C;  3W99 C;  5CPK A;  5CPK C;  1P3P A;  4WU8 B;  4KGC C;  4KGC A;  3W98 A;  5GT0 B;  2CWE A;  4KHA A;  5GXQ B;  4Z66 D;  5JRG D;  4HGA C;  3AZL D;  3AV2 A;  1P34 D;  5GT3 B;  1WWI A;  2F8N K;  3X1S A;  4YM6 A;  4YM6 C;  1F66 D;  4J8W B;  2BYM B;  1P3F B;  1P3M D;  4J8X B;  1S32 B;  3X1V C;  3X1V A;  1M1A B;  3AN2 D;  3A6N A;  5B0Z B;  3AZN B;  3B6F B;  3AZF D;  3X1T D;  3MNN A;  3C1B B;  1P3A D;  3KWQ D;  2FJ7 D;  1TZY B;  4KUD D;  5B1M B;  3X1U B;  4H9P A;  5B2J D;  3B0B A;  1KX5 B;  3W96 D;  3VH6 T;  3KXB C;  2L5A A;  2NZD A;  5BS7 A;  1H3O A;  3MGS B;  1P3O C;  5B2I D;  1P3O A;  3AFA A;  3AFA C;  3UT9 D;  3LEL D;  2ARO D;  1M19 A;  1M19 C;  2F8N B;  1ZLA A;  5CPI C;  3REJ A;  4R8P A;  3REJ C;  2PYO D;  1B6W A;  4JJN A;  3MVD A;  3MVD C;  3W97 B;  5E5A C;  4YS3 A;  5B33 B;  3LZ0 D;  3AZH A;  1ID3 D;  1HQ3 C;  1HQ3 A;  1KX3 D;  1EQZ B;  4CAY B;  5DNN B;  3B0D B;  3TU4 D;  1U35 B;  3AYW D;  4XUJ C;  5CP6 A;  4QLC A;  4Z5T B;  3WTP B;  3REI B;  3WKJ A;  3WA9 B;  3WKJ C;  1AOI D;  5AV8 B;  3MGP A;  5AY8 A;  3MGR B;  3AZJ D;  3LJA A;  4AWL C;  5B31 D;  5DNM A;  3LZ1 B;  3AZG D;  5B0Y D;  2CV5 A;  4LD9 D;  4CSR B;  4Z66 A;  4Z66 C;  5F99 B;  5AV6 B;  1BH9 A;  5JRG C;  5GT0 D;  3AZL C;  4X23 B;  3AZL A;  2BYK B;  1P34 C;  2YFV A;  5GSU A;  1KX4 A;  4H9R B;  4J8U B;  1F66 A;  1F66 C;  5GT3 D;  4J8W D;  1P3F D;  4J8X D;  3AN2 C;  3AN2 A;  4WU9 B;  1P3B D;  5B24 B;  1M1A D;  1WWS A;  3AZF C;  3X1T C;  3X1T A;  3AZK B;  5B0Z D;  1P3A C;  1P3A A;  3AZN D;  1P3K B;  3B6F D;  3KWQ C;  3C1B D;  1M18 A;  2YFW A;  4Z2M H;  2FJ7 C;  3VH6 W;  4KUD C;  3O62 B;  2RVQ D;  4J8V A;  5AVB A;  1TZY D;  5B2J A;  4DRA A;  5B2J C;  5B1M D;  5AV5 B;  5B40 B;  3X1U D;  4H9Q B;  3W96 C;  3REL D;  1N1J A;  5C3I C;  3MGQ D;  1BFM A;  1KX5 D;  2HIO B;  3UTA B;  5B2I C;  3UT9 A;  3UT9 C;  1P3I D;  3LEL A;  3LEL C;  2ARO C;  2ARO A;  3NQU A;  3MGS D;  1B67 A;  5KDM B;  3REK A;  3W98 B;  2PYO C;  2PYO A;  2F8N D;  3W99 A;  3KUY D;  3AV2 B;  5CPJ B;  3LZ0 C;  3W97 D;  1ID3 C;  4E45 A;  3X1S B;  1KX3 A;  1KX3 C;  4YM6 B;  4G91 B;  3VH5 T;  3TU4 A;  3TU4 C;  1EQZ D;  3WAA D;  3AYW A;  3AYW C;  4H9N A;  1BH8 A;  4E44 A;  3UTB D;  3A6N B;  1AOI C;  3B0C T;  1P3L B;  3AZM B;  4Z5T D;  3MNN B;  3WTP D;  3REI D;  3AZJ A;  3AZJ C;  5FUG A;  5AV8 D;  5B31 C;  4G92 C;  3MGR D;  3AZG C;  4ZBJ B;  5B0Y C;  3C1C A;  3C1C C;  4LD9 C;  4UUZ B;  4LD9 A;  3REH B;  3LZ1 D;  5AV9 B;  5F99 D;  5AV6 D;  4ZUX B;  5B32 B;  3AV1 D;  2NZD B;  5GT3 C;  1H3O B;  1P3O B;  3KXB A;  1F1E A;  4J8U D;  3AZE D;  2NQB B;  4J8W C;  1P3F C;  5JA4 A;  4J8X C;  1P3B A;  1P3B C;  5BNX A;  1M1A C;  1ZLA B;  3REJ B;  4R8P B;  4WV4 B;  3R45 B;  5B0Z A;  5B0Z C;  4JJN B;  3MVD B;  3AZN A;  3AZN C;  3B6F C;  5CPI A;  3AZK D;  3C1B C;  4YS3 B;  1P3K D;  3AZH B;  1HQ3 B;  3B6G D;  1P3G C;  1P3G A;  5E5A A;  2RVQ C;  1TZY A;  1TZY C;  5B1M C;  3X1U C;  3REL A;  3REL C;  1KU5 A;  4NE3 A;  3MGQ A;  3MGQ C;  5CP6 B;  5B40 D;  5AV5 D;  4QLC B;  1ULY A;  3MGP B;  4XUJ A;  5AY8 B;  2IO5 C;  2HIO D;  3AZI D;  1P3I A;  1P3I C;  1HTA A;  3UTA D;  3LJA B;  3MGS C;  4AWL B;  5B1L B;  5DNM B;  4M6B A;  3NQJ B;  5CHL B;  5AVC B;  2CV5 B;  4EO5 B;  4Z66 B;  1BH9 B;  2JSS A;  3W98 D;  3AZL B;  3KUY A;  3KUY C;  5BNV B;  5GSU B;  3VH5 A;  5JRG A;  4WU8 D;  1KX4 B;  3AV2 D;  1R4V A;  5GXQ D;  5CPJ D;  5BT1 D;  1P34 A;  3X1S D;  3WAA C;  1EQZ A;  1EQZ C;  3WAA A;  3B0C W;  3B0D C;  5B31 G;  3AN2 B;  1P3M C;  3UTB A;  3UTB C;  1P3M A;  3X1T B;  3A6N D;  3WTP C;  3REI C;  1S32 D;  5BO0 B;  5AV8 A;  5AV8 C;  3AZM D;  1P3L D;  4WNN A;  3MNN D;  3MGR A;  3MGR C;  3AZF A;  1M18 B;  2YFW B;  3LZ1 C;  3KWQ A;  4J8V B;  5AVB B;  3REH D;  5B2J B;  5F99 A;  5AV6 A;  5AV6 C;  5F99 C;  1JFI A;  2FJ7 A;  4KUD A;  1N1J B;  2F8N H;  5AV9 D;  3AV1 C;  3AV1 A;  4ZUX D;  3W96 A;  4H9R A;  5B32 D;  4J8U A;  4J8U C;  2NZD D;  3AZE A;  3AZE C;  4XZQ B;  3LEL B;  3NQU B;  2NQB D;  5B2I A;  3REK B;  3V9R A;  1P3P B;  3W99 B;  5CPK B;  1ZLA D;  4R8P D;  4KGC B;  4KHA B;  3AZK C;  1TAF A;  5B32 G;  1P3K C;  4JJN D;  4HGA B;  4WZS B;  3KSY A;  3B6G A;  1KX3 B;  3B6G C;  4YS3 D;  3AZH D;  3LZ0 A;  1ID3 A;  3AYW B;  1BH8 B;  5B33 D; 
#chains in the Genus database with same CATH topology
 5AV5 A;  5AV5 C;  5B40 C;  5DNN D;  3X1V B;  5CP6 D;  3WTP E;  2F8N G;  4QLC D;  3AZJ B;  2HIO C;  3AZI A;  3AZI C;  1U35 D;  5FUG B;  3UTA C;  3UTA A;  3MGP D;  2HUE C;  5AY8 D;  4G92 B;  1AOI A;  3C1C B;  3LJA D;  5B1L D;  3WA9 D;  5G49 A;  5DNM D;  5B31 A;  4H9O A;  5AVC D;  3AZG A;  2CV5 D;  3W98 C;  5B0Y A;  4WU8 A;  4WU8 C;  4H9P B;  5GT0 C;  5GT0 A;  3AV2 C;  5GXQ C;  5GXQ A;  5CPJ A;  5BT1 C;  5GSU D;  5CPJ C;  1A7W A;  1KX4 D;  3KXB B;  4X23 D;  3X1S C;  4G91 C;  5JA4 B;  5GT3 A;  1P3B B;  3AFA B;  5BNX B;  4J8W A;  2BYM A;  1P3F A;  4J8X A;  3A6N C;  1S32 C;  1S32 A;  1M19 B;  4NE6 A;  4NFT A;  1M1A A;  1P3L C;  1P3L A;  3AZM A;  3AZM C;  5CPI B;  3MNN C;  4WU9 D;  5B24 D;  3B6F A;  1P3G B;  1M18 D;  5E5A B;  4ZBJ C;  3C1B A;  4UUZ A;  2ZY4 A;  3REH A;  3REH C;  3REL B;  4J8V D;  5AVB D;  2Y2N A;  5AV9 C;  5AV9 A;  3MGQ B;  4ZUX A;  4ZUX C;  3O62 D;  5B1M A;  3X1U A;  2Y2K A;  5B32 A;  5B32 C;  4XUJ B;  2IO5 B;  2NZD C;  2W8S A;  1KX5 A;  5BS7 C;  1P3I B;  1KX5 C;  3WKJ B;  2NQB A;  2NQB C;  4XZQ D;  3MGS A;  4WJ3 C;  3REK D;  1ZLA C;  4R8P C;  3KUY B;  3R45 A;  1P3P D;  3W99 D;  5CPK D;  2F8N A;  5JRG B;  4JJN C;  4KGC D;  3VH5 W;  4YS3 C;  1P34 B;  3AZH C;  2YFV B;  3W97 A;  3W97 C;  3WAA B;  3A1I A;  1F66 B;  5B33 A;  5B33 C;  1P3M B;  3UTB B;  4CAY A;  5DNN C;  5DNN A;  4YM6 D;  5CP6 C;  4QLC C;  1U35 C;  3EG5 B;  1U35 A;  2Y2H A;  3X1V D;  3MGP C;  5AY8 C;  2LY8 A;  4WNN B;  3AZF B;  4Z5T C;  4Z5T A;  3WTP A;  3LJA C;  1W2E A;  3REI A;  5B1L A;  5B1L C;  5DNM C;  1P3A B;  3WA9 C;  3NQJ A;  3WA9 A;  3KWQ B;  3C1C D;  5AVC A;  5AVC C;  2CV5 C;  4EO5 C;  1JFI B;  3FDD A;  2FJ7 B;  3LZ1 A;  4KUD B;  2Y2J A;  4DRB A;  2G5I C;  4NE5 A;  4CSR A;  5BNV A;  3AV1 B;  5GSU C;  3W96 B;  1KX4 C;  5C3I B;  4X23 A;  4X23 C;  3AZE B;  2XD5 A;  2BYK A;  3KXB D;  5B2I B;  3UT9 B;  3V9R B;  2F2A C;  2ARO B;  1P3O D;  3AFA D;  2DQN C;  1TAF B;  4WU9 A;  4WU9 C;  1M19 D;  2PYO B;  5BO0 A;  5B24 C;  5B24 A;  3REJ D;  5CPI D;  3B6G B;  3A1K A;  1M18 C;  3AZK A;  2JCH A;  4H9S C;  4H9S A;  1T3U A;  1P3K A;  3LZ0 B;  3MVD D;  1P3G D;  1ID3 B;  5E5A D;  4J8V C;  5AVB C;  3VH6 A;  2FFF B;  3TU4 B;  4Z2M G;  1HQ3 D;  3O62 C;  3O62 A;  4H9N B;  3AZI B;  5B40 A;  4H9Q A;  3EPJ A;  2HUE B;  4XUJ D;  1AOI B;  4XZQ A;  4XZQ C;  2HIO A;  3WKJ D;  5G49 B;  3REK C;  5B31 B;  4H9O B;  3AZG B;  1Q9C A;  5B0Y B;  4LD9 B;  5KDM A;  1P3P C;  3W99 C;  5CPK A;  5CPK C;  1P3P A;  4WU8 B;  4KGC C;  4KGC A;  3W98 A;  5GT0 B;  2CWE A;  4KHA A;  5GXQ B;  4Z66 D;  5JRG D;  4HGA C;  3AZL D;  3AV2 A;  1P34 D;  5GT3 B;  1WWI A;  2F8N K;  3X1S A;  4YM6 A;  4YM6 C;  1F66 D;  4J8W B;  2BYM B;  1P3F B;  1P3M D;  4J8X B;  1S32 B;  3X1V C;  3X1V A;  3P5J B;  4DQY B;  1M1A B;  3AN2 D;  3A6N A;  5B0Z B;  3AZN B;  3B6F B;  3AZF D;  3X1T D;  3MNN A;  3C1B B;  1P3A D;  3KWQ D;  2FJ7 D;  1TZY B;  4KUD D;  5B1M B;  3X1U B;  4H9P A;  5B2J D;  3B0B A;  1KX5 B;  3W96 D;  3VH6 T;  3KXB C;  2L5A A;  2NZD A;  5BS7 A;  1H3O A;  3MGS B;  1P3O C;  4UPK A;  5B2I D;  1P3O A;  3AFA A;  3AFA C;  3UT9 D;  3LEL D;  2ARO D;  2J8P A;  2ZM5 A;  3H0M C;  3H0R C;  1M19 A;  3EPL A;  1M19 C;  2F8N B;  1ZLA A;  5CPI C;  3REJ A;  4R8P A;  3REJ C;  2PYO D;  1B6W A;  4JJN A;  3MVD A;  3MVD C;  3W97 B;  2ZY2 A;  5E5A C;  4YS3 A;  5B33 B;  3LZ0 D;  3AZH A;  1ID3 D;  1HQ3 C;  1HQ3 A;  1KX3 D;  1EQZ B;  4CAY B;  5DNN B;  3B0D B;  3TU4 D;  1PZR A;  1U35 B;  3AYW D;  2ZY5 A;  4XUJ C;  5CP6 A;  4QLC A;  4Z5T B;  3WTP B;  3REI B;  3IP4 C;  3WKJ A;  3WA9 B;  3WKJ C;  1AOI D;  5AV8 B;  3MGP A;  5AY8 A;  3MGR B;  3AZJ D;  3LJA A;  4AWL C;  5B31 D;  5DNM A;  3LZ1 B;  3AZG D;  5B0Y D;  2CV5 A;  4LD9 D;  4CSR B;  4Z66 A;  4Z66 C;  5F99 B;  5AV6 B;  1BH9 A;  5JRG C;  5GT0 D;  3AZL C;  4X23 B;  3AZL A;  2BYK B;  1P34 C;  2YFV A;  2ZY3 A;  5GSU A;  1KX4 A;  4H9R B;  4J8U B;  1F66 A;  1F66 C;  5GT3 D;  4J8W D;  1P3F D;  2Y2Q A;  4J8X D;  3AN2 C;  3AN2 A;  4WU9 B;  1P3B D;  5B24 B;  1M1A D;  1WWS A;  3AZF C;  3X1T C;  3X1T A;  3AZK B;  5B0Z D;  1P3A C;  1P3A A;  3AZN D;  1P3K B;  3B6F D;  3KWQ C;  3C1B D;  3AL0 C;  1M18 A;  2YFW A;  4Z2M H;  2FJ7 C;  3VH6 W;  4KUD C;  3O62 B;  2RVQ D;  4J8V A;  5AVB A;  1TZY D;  5B2J A;  4DRA A;  5B2J C;  5B1M D;  5AV5 B;  5B40 B;  3X1U D;  4H9Q B;  3W96 C;  3REL D;  1N1J A;  5C3I C;  3MGQ D;  1BFM A;  1KX5 D;  2VQR A;  2HIO B;  3UTA B;  5B2I C;  3UT9 A;  3UT9 C;  1P3I D;  3LEL A;  3LEL C;  2ARO C;  2ARO A;  3NQU A;  3MGS D;  1B67 A;  2XD1 A;  5KDM B;  2BG1 A;  3REK A;  3W98 B;  3KFU G;  2PYO C;  2PYO A;  2F8N D;  3EPH A;  3W99 A;  3KUY D;  3AV2 B;  5CPJ B;  3LZ0 C;  3W97 D;  1ID3 C;  4E45 A;  3X1S B;  1KX3 A;  1KX3 C;  4YM6 B;  4G91 B;  3VH5 T;  3TU4 A;  3TU4 C;  1EQZ D;  3WAA D;  3AYW A;  3AYW C;  4H9N A;  1BH8 A;  4E44 A;  3UTB D;  3A6N B;  1AOI C;  3B0C T;  1P3L B;  3AZM B;  4Z5T D;  3MNN B;  3WTP D;  3REI D;  3AZJ A;  3AZJ C;  5FUG A;  5AV8 D;  5B31 C;  4G92 C;  3MGR D;  3AZG C;  4ZBJ B;  5B0Y C;  3C1C A;  3C1C C;  4LD9 C;  4UUZ B;  4LD9 A;  3REH B;  3LZ1 D;  3H0L C;  5AV9 B;  5F99 D;  2Y2P A;  5AV6 D;  4ZUX B;  2Y2L A;  5B32 B;  3AV1 D;  2NZD B;  5GT3 C;  1H3O B;  1P3O B;  3KXB A;  1F1E A;  4J8U D;  2DF4 C;  3AZE D;  2NQB B;  4J8W C;  2JE5 A;  1P3F C;  5JA4 A;  4J8X C;  3F6T A;  1P3B A;  1P3B C;  5BNX A;  1M1A C;  1ZLA B;  3REJ B;  4R8P B;  4WV4 B;  1Z2C B;  3R45 B;  2Y2O A;  5B0Z A;  5B0Z C;  4JJN B;  3MVD B;  3AZN A;  3AZN C;  3B6F C;  2UWX A;  5CPI A;  3AZK D;  3C1B C;  4YS3 B;  1P3K D;  2Y2G A;  3AZH B;  1HQ3 B;  3B6G D;  1P3G C;  1P3G A;  5E5A A;  2RVQ C;  1TZY A;  1TZY C;  5B1M C;  3X1U C;  3REL A;  3REL C;  1KU5 A;  2Y2I A;  4NE3 A;  2Y2M A;  3MGQ A;  3MGQ C;  5CP6 B;  5B40 D;  5AV5 D;  4QLC B;  1ULY A;  3MGP B;  4XUJ A;  5AY8 B;  2IO5 C;  2HIO D;  3AZI D;  1P3I A;  1P3I C;  1HTA A;  3UTA D;  3LJA B;  3MGS C;  2G5H C;  4AWL B;  5B1L B;  5DNM B;  4M6B A;  3NQJ B;  5CHL B;  5AVC B;  2CV5 B;  4EO5 B;  4Z66 B;  1BH9 B;  2JSS A;  3W98 D;  3AZL B;  3KUY A;  3KUY C;  5BNV B;  5GSU B;  3VH5 A;  5JRG A;  4WU8 D;  1KX4 B;  3AV2 D;  1R4V A;  5GXQ D;  5CPJ D;  5BT1 D;  1P34 A;  3X1S D;  3WAA C;  1EQZ A;  1EQZ C;  3WAA A;  3B0C W;  3B0D C;  5B31 G;  3AN2 B;  1P3M C;  3UTB A;  3UTB C;  1P3M A;  3X1T B;  3A6N D;  3WTP C;  3REI C;  1S32 D;  5BO0 B;  5AV8 A;  5AV8 C;  3AZM D;  1P3L D;  4WNN A;  3MNN D;  3MGR A;  3MGR C;  3AZF A;  1M18 B;  2YFW B;  3LZ1 C;  3KWQ A;  3EPK A;  5AVB B;  4J8V B;  3REH D;  5B2J B;  5F99 A;  5AV6 A;  5AV6 C;  5F99 C;  1JFI A;  2FJ7 A;  4KUD A;  1N1J B;  2F8N H;  5AV9 D;  3AV1 C;  3AV1 A;  4ZUX D;  2RIQ A;  3W96 A;  4H9R A;  5B32 D;  4J8U A;  4J8U C;  2NZD D;  3AZE A;  3AZE C;  4XZQ B;  3LEL B;  3NQU B;  2NQB D;  5B2I A;  3REK B;  3V9R A;  1P3P B;  3W99 B;  5CPK B;  1ZLA D;  4R8P D;  4KGC B;  4KHA B;  3AZK C;  1TAF A;  5B32 G;  1P3K C;  4JJN D;  4HGA B;  4WZS B;  3KSY A;  3B6G A;  1KX3 B;  3B6G C;  4YS3 D;  3AZH D;  3LZ0 A;  1ID3 A;  3AYW B;  1BH8 B;  5B33 D; 
#chains in the Genus database with same CATH homology
 5AV5 A;  5AV5 C;  5B40 C;  5DNN D;  3X1V B;  5CP6 D;  3WTP E;  2F8N G;  4QLC D;  3AZJ B;  2HIO C;  3AZI A;  3AZI C;  1U35 D;  5FUG B;  3UTA C;  3UTA A;  3MGP D;  2HUE C;  5AY8 D;  4G92 B;  1AOI A;  3C1C B;  3LJA D;  5B1L D;  3WA9 D;  5G49 A;  5DNM D;  5B31 A;  4H9O A;  5AVC D;  3AZG A;  2CV5 D;  3W98 C;  5B0Y A;  4WU8 A;  4WU8 C;  4H9P B;  5GT0 C;  5GT0 A;  3AV2 C;  5GXQ C;  5GXQ A;  5CPJ A;  5BT1 C;  5GSU D;  5CPJ C;  1A7W A;  1KX4 D;  3KXB B;  4X23 D;  3X1S C;  4G91 C;  5JA4 B;  5GT3 A;  1P3B B;  3AFA B;  5BNX B;  4J8W A;  2BYM A;  1P3F A;  4J8X A;  3A6N C;  1S32 C;  1S32 A;  1M19 B;  4NE6 A;  4NFT A;  1M1A A;  1P3L C;  1P3L A;  3AZM A;  3AZM C;  5CPI B;  3MNN C;  4WU9 D;  5B24 D;  3B6F A;  1P3G B;  1M18 D;  5E5A B;  4ZBJ C;  3C1B A;  4UUZ A;  2ZY4 A;  3REH A;  3REH C;  3REL B;  4J8V D;  5AVB D;  2Y2N A;  5AV9 C;  5AV9 A;  3MGQ B;  4ZUX A;  4ZUX C;  3O62 D;  5B1M A;  3X1U A;  2Y2K A;  5B32 A;  5B32 C;  4XUJ B;  2IO5 B;  2NZD C;  2W8S A;  1KX5 A;  5BS7 C;  1P3I B;  1KX5 C;  3WKJ B;  2NQB A;  2NQB C;  4XZQ D;  3MGS A;  4WJ3 C;  3REK D;  1ZLA C;  4R8P C;  3KUY B;  3R45 A;  1P3P D;  3W99 D;  5CPK D;  2F8N A;  5JRG B;  4JJN C;  4KGC D;  3VH5 W;  4YS3 C;  1P34 B;  3AZH C;  2YFV B;  3W97 A;  3W97 C;  3WAA B;  3A1I A;  1F66 B;  5B33 A;  5B33 C;  1P3M B;  3UTB B;  4CAY A;  5DNN C;  5DNN A;  4YM6 D;  5CP6 C;  4QLC C;  1U35 C;  3EG5 B;  1U35 A;  2Y2H A;  3X1V D;  3MGP C;  5AY8 C;  2LY8 A;  4WNN B;  3AZF B;  4Z5T C;  4Z5T A;  3WTP A;  3LJA C;  1W2E A;  3REI A;  5B1L A;  5B1L C;  5DNM C;  1P3A B;  3WA9 C;  3NQJ A;  3WA9 A;  3KWQ B;  3C1C D;  5AVC A;  5AVC C;  2CV5 C;  4EO5 C;  1JFI B;  3FDD A;  2FJ7 B;  3LZ1 A;  4KUD B;  2Y2J A;  4DRB A;  2G5I C;  4NE5 A;  4CSR A;  5BNV A;  3AV1 B;  5GSU C;  3W96 B;  1KX4 C;  5C3I B;  4X23 A;  4X23 C;  3AZE B;  2XD5 A;  2BYK A;  3KXB D;  5B2I B;  3UT9 B;  3V9R B;  2F2A C;  2ARO B;  1P3O D;  3AFA D;  2DQN C;  1TAF B;  4WU9 A;  4WU9 C;  1M19 D;  2PYO B;  5BO0 A;  5B24 C;  5B24 A;  3REJ D;  5CPI D;  3B6G B;  3A1K A;  1M18 C;  3AZK A;  2JCH A;  4H9S C;  4H9S A;  1T3U A;  1P3K A;  3LZ0 B;  3MVD D;  1P3G D;  1ID3 B;  5E5A D;  4J8V C;  5AVB C;  3VH6 A;  2FFF B;  3TU4 B;  4Z2M G;  1HQ3 D;  3O62 C;  3O62 A;  4H9N B;  3AZI B;  5B40 A;  4H9Q A;  3EPJ A;  2HUE B;  4XUJ D;  1AOI B;  4XZQ A;  4XZQ C;  2HIO A;  3WKJ D;  5G49 B;  3REK C;  5B31 B;  4H9O B;  3AZG B;  1Q9C A;  5B0Y B;  4LD9 B;  5KDM A;  1P3P C;  3W99 C;  5CPK A;  5CPK C;  1P3P A;  4WU8 B;  4KGC C;  4KGC A;  3W98 A;  5GT0 B;  2CWE A;  4KHA A;  5GXQ B;  4Z66 D;  5JRG D;  4HGA C;  3AZL D;  3AV2 A;  1P34 D;  5GT3 B;  1WWI A;  2F8N K;  3X1S A;  4YM6 A;  4YM6 C;  1F66 D;  4J8W B;  2BYM B;  1P3F B;  1P3M D;  4J8X B;  1S32 B;  3X1V C;  3X1V A;  3P5J B;  4DQY B;  1M1A B;  3AN2 D;  3A6N A;  5B0Z B;  3AZN B;  3B6F B;  3AZF D;  3X1T D;  3MNN A;  3C1B B;  1P3A D;  3KWQ D;  2FJ7 D;  1TZY B;  4KUD D;  5B1M B;  3X1U B;  4H9P A;  5B2J D;  3B0B A;  1KX5 B;  3W96 D;  3VH6 T;  3KXB C;  2L5A A;  2NZD A;  5BS7 A;  1H3O A;  3MGS B;  1P3O C;  4UPK A;  5B2I D;  1P3O A;  3AFA A;  3AFA C;  3UT9 D;  3LEL D;  2ARO D;  2J8P A;  2ZM5 A;  3H0M C;  3H0R C;  1M19 A;  3EPL A;  1M19 C;  2F8N B;  1ZLA A;  5CPI C;  3REJ A;  4R8P A;  3REJ C;  2PYO D;  1B6W A;  4JJN A;  3MVD A;  3MVD C;  3W97 B;  2ZY2 A;  5E5A C;  4YS3 A;  5B33 B;  3LZ0 D;  3AZH A;  1ID3 D;  1HQ3 C;  1HQ3 A;  1KX3 D;  1EQZ B;  4CAY B;  5DNN B;  3B0D B;  3TU4 D;  1PZR A;  1U35 B;  3AYW D;  2ZY5 A;  4XUJ C;  5CP6 A;  4QLC A;  4Z5T B;  3WTP B;  3REI B;  3IP4 C;  3WKJ A;  3WA9 B;  3WKJ C;  1AOI D;  5AV8 B;  3MGP A;  5AY8 A;  3MGR B;  3AZJ D;  3LJA A;  4AWL C;  5B31 D;  5DNM A;  3LZ1 B;  3AZG D;  5B0Y D;  2CV5 A;  4LD9 D;  4CSR B;  4Z66 A;  4Z66 C;  5F99 B;  5AV6 B;  1BH9 A;  5JRG C;  5GT0 D;  3AZL C;  4X23 B;  3AZL A;  2BYK B;  1P34 C;  2YFV A;  2ZY3 A;  5GSU A;  1KX4 A;  4H9R B;  4J8U B;  1F66 A;  1F66 C;  5GT3 D;  4J8W D;  1P3F D;  2Y2Q A;  4J8X D;  3AN2 C;  3AN2 A;  4WU9 B;  1P3B D;  5B24 B;  1M1A D;  1WWS A;  3AZF C;  3X1T C;  3X1T A;  3AZK B;  5B0Z D;  1P3A C;  1P3A A;  3AZN D;  1P3K B;  3B6F D;  3KWQ C;  3C1B D;  3AL0 C;  1M18 A;  2YFW A;  4Z2M H;  2FJ7 C;  3VH6 W;  4KUD C;  3O62 B;  2RVQ D;  4J8V A;  5AVB A;  1TZY D;  5B2J A;  4DRA A;  5B2J C;  5B1M D;  5AV5 B;  5B40 B;  3X1U D;  4H9Q B;  3W96 C;  3REL D;  1N1J A;  5C3I C;  3MGQ D;  1BFM A;  1KX5 D;  2VQR A;  2HIO B;  3UTA B;  5B2I C;  3UT9 A;  3UT9 C;  1P3I D;  3LEL A;  3LEL C;  2ARO C;  2ARO A;  3NQU A;  3MGS D;  1B67 A;  2XD1 A;  5KDM B;  2BG1 A;  3REK A;  3W98 B;  3KFU G;  2PYO C;  2PYO A;  2F8N D;  3EPH A;  3W99 A;  3KUY D;  3AV2 B;  5CPJ B;  3LZ0 C;  3W97 D;  1ID3 C;  4E45 A;  3X1S B;  1KX3 A;  1KX3 C;  4YM6 B;  4G91 B;  3VH5 T;  3TU4 A;  3TU4 C;  1EQZ D;  3WAA D;  3AYW A;  3AYW C;  4H9N A;  1BH8 A;  4E44 A;  3UTB D;  3A6N B;  1AOI C;  3B0C T;  1P3L B;  3AZM B;  4Z5T D;  3MNN B;  3WTP D;  3REI D;  3AZJ A;  3AZJ C;  5FUG A;  5AV8 D;  5B31 C;  4G92 C;  3MGR D;  3AZG C;  4ZBJ B;  5B0Y C;  3C1C A;  3C1C C;  4LD9 C;  4UUZ B;  4LD9 A;  3REH B;  3LZ1 D;  3H0L C;  5AV9 B;  5F99 D;  2Y2P A;  5AV6 D;  4ZUX B;  2Y2L A;  5B32 B;  3AV1 D;  2NZD B;  5GT3 C;  1H3O B;  1P3O B;  3KXB A;  1F1E A;  4J8U D;  2DF4 C;  3AZE D;  2NQB B;  4J8W C;  2JE5 A;  1P3F C;  5JA4 A;  4J8X C;  3F6T A;  1P3B A;  1P3B C;  5BNX A;  1M1A C;  1ZLA B;  3REJ B;  4R8P B;  4WV4 B;  1Z2C B;  3R45 B;  2Y2O A;  5B0Z A;  5B0Z C;  4JJN B;  3MVD B;  3AZN A;  3AZN C;  3B6F C;  2UWX A;  5CPI A;  3AZK D;  3C1B C;  4YS3 B;  1P3K D;  2Y2G A;  3AZH B;  1HQ3 B;  3B6G D;  1P3G C;  1P3G A;  5E5A A;  2RVQ C;  1TZY A;  1TZY C;  5B1M C;  3X1U C;  3REL A;  3REL C;  1KU5 A;  2Y2I A;  4NE3 A;  2Y2M A;  3MGQ A;  3MGQ C;  5CP6 B;  5B40 D;  5AV5 D;  4QLC B;  1ULY A;  3MGP B;  4XUJ A;  5AY8 B;  2IO5 C;  2HIO D;  3AZI D;  1P3I A;  1P3I C;  1HTA A;  3UTA D;  3LJA B;  3MGS C;  2G5H C;  4AWL B;  5B1L B;  5DNM B;  4M6B A;  3NQJ B;  5CHL B;  5AVC B;  2CV5 B;  4EO5 B;  4Z66 B;  1BH9 B;  2JSS A;  3W98 D;  3AZL B;  3KUY A;  3KUY C;  5BNV B;  5GSU B;  3VH5 A;  5JRG A;  4WU8 D;  1KX4 B;  3AV2 D;  1R4V A;  5GXQ D;  5CPJ D;  5BT1 D;  1P34 A;  3X1S D;  3WAA C;  1EQZ A;  1EQZ C;  3WAA A;  3B0C W;  3B0D C;  5B31 G;  3AN2 B;  1P3M C;  3UTB A;  3UTB C;  1P3M A;  3X1T B;  3A6N D;  3WTP C;  3REI C;  1S32 D;  5BO0 B;  5AV8 A;  5AV8 C;  3AZM D;  1P3L D;  4WNN A;  3MNN D;  3MGR A;  3MGR C;  3AZF A;  1M18 B;  2YFW B;  3LZ1 C;  3KWQ A;  3EPK A;  5AVB B;  4J8V B;  3REH D;  5B2J B;  5F99 A;  5AV6 A;  5AV6 C;  5F99 C;  1JFI A;  2FJ7 A;  4KUD A;  1N1J B;  2F8N H;  5AV9 D;  3AV1 C;  3AV1 A;  4ZUX D;  2RIQ A;  3W96 A;  4H9R A;  5B32 D;  4J8U A;  4J8U C;  2NZD D;  3AZE A;  3AZE C;  4XZQ B;  3LEL B;  3NQU B;  2NQB D;  5B2I A;  3REK B;  3V9R A;  1P3P B;  3W99 B;  5CPK B;  1ZLA D;  4R8P D;  4KGC B;  4KHA B;  3AZK C;  1TAF A;  5B32 G;  1P3K C;  4JJN D;  4HGA B;  4WZS B;  3KSY A;  3B6G A;  1KX3 B;  3B6G C;  4YS3 D;  3AZH D;  3LZ0 A;  1ID3 A;  3AYW B;  1BH8 B;  5B33 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...