5GSUB

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuB00
4J8UC 5GSUB 3MGQB 2F8NH 3REJD 2NQBA 5DNMD 3NQJB 4KHAA 3W97A 4X23A 3RELD 1P3BB 3MGRA 3VH6A 5B33A 5B31G 3C1BA 1P3AB 2PYOA 3AZIB 2HIOD 5B2IB 1JFIB 3WKJD 1KX3D 2F8NB 1AOIB 2HUEC 5AV5A 1M1AD 4H9NA 4G92B 1P3PD 3LJAB 5B1LD 3KUYC 3KWQA 3AZGA 3AV1C 4XZQC 1P3GC 3REIA 1B67A 5B0ZB 4KUDC 4JJNB 2NQBC 3R45A 3AV2A 3AZFA 4X23C 5GXQC 4WU8B 4ZUXC 3MGRC 3AZLA 5JA4B 3UT9A 3UTAD 5B32A 4YS3C 1ZLAB 1TZYA 4G91B 5DNNA 5B2JD 4WU9D 3W96A 3W99D 3X1UB 4J8VB 5G49A 3C1CC 3B6GB 5B1MC 3KWQC 3AZGC 2CV5A 3REIC 5B31D 1F1EA 3LZ1C 3AZFC 5CPJC 5B24A 2RVQD 5F99A 4R8PB 4LD9C 4J8WD 3KXBC 3UT9C 4Z5TD 5CPIA 5B0YB 1KU5A 1HQ3D 2IO5C 1HTAA 3AN2B 4KGCC 1BH8A 2CV5C 1P3OC 1M18B 3AZEA 3MGPA 5AV8A 2CWEA 4J8XA 4EO5B 5F99C 1F66D 4E44A 4CAYA 5GSUD 5CPIC 3MGQD 5KDMA 3A6NB 3MGSB 4Z66C 5GT3C 1U35B 4H9RB 1P3BD 5E5AD 1EQZC 1P34C 4QLCB 2NZDA 3AFAA 1P3AD 3W98D 3AZID 5B2ID 3AZEC 4YM6A 1H3OB 1P3KA 1S32B 2F8ND 3REKB 5B40C 5BO0A 1AOID 3B0CT 3AZJA 4UUZB 3X1VA 1R4VA 5BNVA 3LJAD 3LELA 3B6FD 5GT0A 3VH5T 5B0ZD 3WAAD 4JJND 4XUJB 3REJA 3AZKB 1P3IA 3AYWA 3O62C 4WU9B 5DNMA 4WU8D 3RELA 3WA9C 2BYKB 2YFWA 3AZHC 1P3GB 2NZDC 1WWSA 3REHA 4E45A 2HIOA 5CPKD 1P3KC 1ZLAD 3WKJA 1KX3A 4HGAC 2AROA 4WNNB 3X1VC 3X1UD 1M1AA 4J8VD 3LZ0C 3MVDA 1P3PA 3B6GD 3LELC 5B1LA 5GT0C 4M6BA 5AV9C 3REJC 1P3IC 3AYWC 2HUEB 4NE3A 4R8PD 4WV4B 3TU4C 3V9RA 3KUYB 3AV1B 3MNND 1KX4C 5CP6C 4XZQB 3UTAA 5B0YD 3REHC 4KUDB 1M19C 2BYMA 2AROC 3WTPC 5GXQB 4X23B 4ZUXB 3MGRB 3AN2D 3MVDC 1B6WA 4DRAA 1ID3C 5AV6A 1M18D 4YS3B 5E5AB 3X1SC 5AVCC 3UTBC 3C1CB 4J8WA 1P3FA 1TAFB 5B1MB 3KWQB 4Z5TA 3W98B 3UTAC 4ZBJC 3A6ND 3MGSD 3REIB 4AWLC 1HQ3A 4H9OA 3LZ1B 3AZFB 1Q9CA 5AVBB 1U35D 5JRGC 5CPJB 3B6FB 4QLCD 5BNXA 4LD9B 3UT9B 5AV6C 3KXBB 1BH9A 3WAAB 1S32D 3REKD 3W97C 2IO5B 5B33C 1F66A 4KGCB 3C1BC 1P3FC 2PYOC 5GSUA 1P3LA 3MGQA 5CPKB 1P3OB 1ULYA 2JSSA 4XUJD 1N1JB 3AZKD 3NQJA 4CSRA 3VH5A 5AV5C 5BT1D 1P3GD 5AY8B 4J8UD 1P3AA 4H9QB 3AZIA 5B2IA 1JFIA 3AV2C 4Z66B 2F8NA 3AZLC 1AOIA 5GT3B 4NE6A 1EQZB 1KX5A 1P34B 3B0CW 3MNNB 1P3LC 5B32C 5FUGB 1TZYC 5DNNC 2FJ7A 3VH5W 3W96C 5B40B 5JA4A 1P3MA 4H9PB 3KUYD 5B32G 4CAYB 3AV1D 4XZQD 4KUDD 1ZLAA 3B0DB 3O62B 5B24C 4X23D 5GXQD 4ZUXD 3X1UA 3MGRD 4J8VA 1KX5C 3WA9B 3B6GA 3AZHB 2LY8A 4YS3D 1P3KB 2FJ7C 1P3MC 3LZ0B 3C1CD 3LELB 5B1MD 3KWQD 3AZGD 3X1TB 5B0YA 3REID 4H9SA 2YFVB 3VH6T 3MGPC 5AV9B 3AYWB 5BS7A 3LZ1D 3AZFD 5AVBD 5AV8C 4J8XC 5CPJD 3AN2A 3AZNA 3B6GC 3TU4B 4LD9D 3UT9D 3KXBD 1KX4B 5CP6B 1M18A 4Z2MH 3REHB 3AZMB 1M19B 3WTPE 2L5AA 2AROB 3WTPB 5C3IC 4KGCD 3MVDB 3AFAC 4J8UB 2CV5D 1ID3B 3A6NA 4YM6C 3MGSA 1P3OD 5BS7C 3AZJC 1U35A 4H9RA 3AN2C 3X1SB 3AZNC 5AVCB 5F99D 4QLCA 5AY8D 3UTBB 3V9RB 1S32A 5DNMC 4Z66D 3REKA 5GT3D 3RELC 4UUZA 1EQZD 4EO5C 5JRGB 1P34D 5AV6B 2HIOC 3WKJC 3AZED 3AZKA 1KX3C 2NQBB 5B2JA 4WU9A 4KHAB 5B40D 3W97B 3W99A 1M1AC 2BYKA 1P3PC 5B1LC 5B33B 3C1BB 1P3FB 2PYOB 5B31A 3O62D 4WNNA 3WA9D 5AV5B 4H9NB 3AZHD 3AZGB 2NZDD 4Z2MG 3NQUA 1P3KD 3R45B 5B2JC 4WU9C 3AV2B 3AZLB 3W99C 3X1VD 3LZ0D 3LELD 3KUYA 5GT0D 3AV1A 4XZQA 3X1TD 5B31C 1P3LB 5B32B 4KUDA 5AV9D 1P3ID 1TZYB 3AYWD 5DNNB 4CSRB 3W96B 5GXQA 4ZUXA 1BFMA 2RVQC 5G49B 4J8WC 3TU4D 2CV5B 4Z5TC 1KX4D 5CP6D 3REHD 1HQ3C 4YS3A 3AZMD 5CHLB 1M19D 1P3BA 5E5AA 2AROD 5B24B 3WTPD 5F99B 1KX5B 3MVDD 3C1CA 1TAFA 5B1MA 3W98A 5CPIB 1ID3D 3LZ1A 2FJ7B 5AVBA 3VH6W 3X1SD 5CPJA 1F66C 5AVCD 3LJAA 1WWIA 3UTBD 1P3MB 1BH8B 3B6FA 5GSUC 4LD9A 3KXBA 3MGQC 5B0ZA 3WAAA 4JJNA 3AZEB 3MGPB 1P3BC 5E5AC 4WU8A 5AV8B 4J8XB 5JRGD 4KGCA 1P3AC 3W98C 3AZIC 5AV6D 5KDMB 5B2IC 1A7WA 5CPKA 1P3OA 1N1JA 2NQBD 1AOIC 3W97D 5AVBC 4G92C 3LJAC 5C3IB 5B33D 3B6FC 5AY8A 2NZDB 3AFAB 3C1BD 1P3FD 2PYOD 4H9QA 3WAAC 5B0ZC 2F8NG 4JJNC 4YM6B 4Z66A 5BO0B 4HGAB 5GT3A 3AZJB 4WU8C 5AV5D 4NFTA 3X1VB 1EQZA 2F8NK 4R8PA 1P34A 3AZNB 5BNVB 5GT0B 3MNNA 5CPKC 1ZLAC 5FUGA 3REJB 1P3IB 4G91C 3AV2D 5DNMB 5B40A 3AZLD 3X1UC 4DRBA 3RELB 4J8VC 4H9PA 2YFWB 5AY8C 1P3LD 2HIOB 5B32D 3WKJB 1TZYD 1KX3B 5DNND 3O62A 3W96D 3WA9A 1M1AB 4R8PC 1P3PB 5B1LB 3AZHA 3MNNC 5B0YC 4H9SC 5B24D 3KSYA 1KX5D 3LZ0A 4WZSB 5CPID 3X1TA 3UTAB 4ZBJB 1M18C 2YFVA 1H3OA 4AWLB 3B0DC 2BYMB 5AV9A 5B2JB 2FJ7D 3W99B 1P3MD 3TU4A 1KX4A 3A6NC 3MGSC 5CP6A 5B31B 4XUJA 3AZMA 1M19A 3MGPD 1U35C 5AV8D 3WTPA 4J8XD 4QLCC 4NE5A 1P3GA 4J8UA 4J8WB 4Z5TB 3X1TC 1ID3A 1HQ3B 3NQUB 1S32C 3REKC 4H9OB 3X1SA 5AVCA 3UTBA 5BNXB 3AFAD 1BH9B 4XUJC 4YM6D 3AZKC 3AZMC 3AZJD 3B0BA 5BT1C 5JRGA 1F66B 3AZND
chains in the Genus database with same CATH superfamily
4J8UC 5GSUB 3MGQB 2F8NH 3REJD 2NQBA 5DNMD 3NQJB 4KHAA 3W97A 4X23A 3RELD 1P3BB 3MGRA 3VH6A 5B33A 5B31G 3C1BA 1P3AB 2Y2PA 2PYOA 3AZIB 2HIOD 5B2IB 1JFIB 3WKJD 3H0LC 1KX3D 2F8NB 1AOIB 2HUEC 5AV5A 1M1AD 4H9NA 4G92B 1P3PD 2ZY5A 3LJAB 5B1LD 3KUYC 3KWQA 2ZM5A 3AZGA 3AV1C 4XZQC 1P3GC 3REIA 3FDDA 1B67A 5B0ZB 4KUDC 4JJNB 2NQBC 3R45A 3AV2A 3AZFA 4X23C 5GXQC 4WU8B 4ZUXC 3MGRC 3AZLA 5JA4B 3EG5B 3UT9A 3UTAD 5B32A 4YS3C 1ZLAB 1TZYA 4G91B 5DNNA 5B2JD 4WU9D 3W96A 3W99D 3X1UB 2Y2LA 4J8VB 5G49A 3C1CC 3B6GB 5B1MC 3KWQC 3AZGC 2CV5A 3REIC 5B31D 1F1EA 3LZ1C 3AZFC 5CPJC 5B24A 2VQRA 2RVQD 5F99A 4R8PB 2XD1A 4LD9C 4J8WD 3KXBC 3UT9C 4Z5TD 5CPIA 5B0YB 1KU5A 2ZY2A 3P5JB 1HQ3D 2IO5C 1HTAA 3AN2B 4KGCC 1BH8A 2CV5C 1P3OC 1M18B 3AZEA 3MGPA 5AV8A 2CWEA 4J8XA 4EO5B 5F99C 1F66D 4E44A 4CAYA 5GSUD 5CPIC 3MGQD 5KDMA 3A6NB 3MGSB 4Z66C 5GT3C 1U35B 4H9RB 1P3BD 5E5AD 1EQZC 2J8PA 1P34C 4QLCB 2NZDA 3AFAA 1P3AD 3W98D 3AZID 5B2ID 3AZEC 4YM6A 1H3OB 1P3KA 1S32B 2F8ND 3REKB 5B40C 5BO0A 1AOID 3B0CT 3AZJA 4UUZB 3X1VA 1R4VA 5BNVA 3LJAD 3LELA 3B6FD 5GT0A 2RIQA 3VH5T 5B0ZD 2Y2JA 3WAAD 4JJND 4XUJB 2FFFB 3REJA 3AZKB 1P3IA 3AYWA 3O62C 4WU9B 5DNMA 4WU8D 3RELA 3WA9C 2BYKB 2YFWA 3AZHC 1P3GB 2NZDC 1WWSA 3REHA 4E45A 2HIOA 5CPKD 1P3KC 1ZLAD 3WKJA 1KX3A 4HGAC 2AROA 4WNNB 3X1VC 3X1UD 1M1AA 4J8VD 3LZ0C 3MVDA 1P3PA 3B6GD 3LELC 5B1LA 5GT0C 4M6BA 5AV9C 3REJC 1P3IC 3AYWC 2HUEB 2UWXA 4NE3A 4R8PD 4WV4B 3TU4C 3V9RA 3KUYB 3AV1B 3MNND 1KX4C 4UPKA 4XZQB 5CP6C 5B0YD 3REHC 3UTAA 4KUDB 1M19C 2BYMA 2AROC 3WTPC 5GXQB 4X23B 4ZUXB 3MGRB 3AN2D 3MVDC 1B6WA 4DRAA 1ID3C 5AV6A 1M18D 4YS3B 5E5AB 3X1SC 5AVCC 3UTBC 3C1CB 4J8WA 1P3FA 1TAFB 5B1MB 3KWQB 2BG1A 4Z5TA 3UTAC 4ZBJC 3W98B 3A6ND 3MGSD 3REIB 4AWLC 1HQ3A 4H9OA 3LZ1B 3AZFB 1Q9CA 5AVBB 1U35D 5JRGC 5CPJB 1W2EA 3B6FB 4QLCD 5BNXA 4LD9B 3UT9B 5AV6C 3KXBB 1BH9A 3WAAB 1S32D 3REKD 3W97C 2IO5B 5B33C 1F66A 4KGCB 2ZY4A 3C1BC 1P3FC 5GSUA 2PYOC 1P3LA 3MGQA 5CPKB 1P3OB 1ULYA 2JSSA 4XUJD 1N1JB 3AZKD 3NQJA 4CSRA 3VH5A 5AV5C 5BT1D 2Y2KA 1P3GD 5AY8B 4J8UD 1P3AA 4H9QB 3AZIA 5B2IA 1JFIA 3AV2C 4Z66B 2F8NA 3AZLC 1AOIA 3A1KA 5GT3B 4NE6A 1EQZB 1KX5A 1P34B 2DF4C 3B0CW 3MNNB 1P3LC 5B32C 3IP4C 5FUGB 1TZYC 5DNNC 2FJ7A 3VH5W 3W96C 5B40B 5JA4A 1P3MA 4H9PB 3KUYD 5B32G 4CAYB 3AV1D 4XZQD 4KUDD 1ZLAA 3B0DB 3O62B 5B24C 4X23D 5GXQD 4ZUXD 3X1UA 3MGRD 4J8VA 1KX5C 3WA9B 3B6GA 3AZHB 2LY8A 4YS3D 1P3KB 2FJ7C 1P3MC 3EPHA 3LZ0B 3C1CD 3LELB 5B1MD 3KWQD 3AZGD 3X1TB 5B0YA 3REID 4H9SA 2YFVB 3VH6T 3MGPC 5AV9B 3AYWB 5BS7A 3LZ1D 3AZFD 2Y2MA 5AVBD 5AV8C 4J8XC 5CPJD 3AN2A 3AZNA 3B6GC 3TU4B 4LD9D 3UT9D 3KXBD 1KX4B 5CP6B 1M18A 4Z2MH 3REHB 3AZMB 1M19B 3WTPE 2L5AA 2AROB 3WTPB 5C3IC 2Y2HA 4KGCD 3MVDB 3AFAC 4J8UB 2CV5D 1ID3B 3EPKA 3A6NA 4YM6C 3MGSA 1T3UA 1P3OD 5BS7C 3AZJC 1U35A 4H9RA 3AN2C 3X1SB 3AZNC 5AVCB 5F99D 4QLCA 5AY8D 3UTBB 3V9RB 1S32A 5DNMC 4Z66D 3REKA 2Y2IA 5GT3D 3RELC 4UUZA 1EQZD 4EO5C 5JRGB 4DQYB 1P34D 5AV6B 2HIOC 3WKJC 3AZED 3AZKA 1KX3C 2NQBB 5B2JA 4WU9A 3AL0C 4KHAB 5B40D 3W97B 3W99A 1M1AC 2BYKA 1P3PC 5B1LC 5B33B 3C1BB 1P3FB 2PYOB 5B31A 2Y2QA 3O62D 4WNNA 3WA9D 5AV5B 4H9NB 3AZHD 3AZGB 2NZDD 4Z2MG 4WJ3C 3NQUA 1P3KD 3R45B 5B2JC 4WU9C 3AV2B 3AZLB 3W99C 3X1VD 2XD5A 3LZ0D 3LELD 3KUYA 5GT0D 3AV1A 4XZQA 3X1TD 1PZRA 5B31C 1P3LB 5B32B 4KUDA 5AV9D 1P3ID 2G5IC 1TZYB 3AYWD 5DNNB 2JCHA 4CSRB 3W96B 5GXQA 4ZUXA 1BFMA 2RVQC 5G49B 4J8WC 3TU4D 2CV5B 4Z5TC 1KX4D 5CP6D 3REHD 3H0MC 1HQ3C 4YS3A 3AZMD 2Y2OA 5CHLB 1M19D 1P3BA 5E5AA 2AROD 5B24B 3WTPD 5F99B 1KX5B 3MVDD 3C1CA 1TAFA 5B1MA 3W98A 5CPIB 1ID3D 2DQNC 1Z2CB 3LZ1A 2FJ7B 5AVBA 3VH6W 3X1SD 5CPJA 1F66C 5AVCD 3LJAA 1WWIA 3UTBD 1P3MB 1BH8B 3B6FA 5GSUC 4LD9A 3KXBA 3MGQC 5B0ZA 3WAAA 4JJNA 3AZEB 3MGPB 1P3BC 5E5AC 4WU8A 5AV8B 4J8XB 5JRGD 4KGCA 1P3AC 3W98C 3AZIC 5AV6D 5KDMB 5B2IC 1A7WA 5CPKA 1P3OA 1N1JA 3EPLA 2NQBD 1AOIC 3W97D 5AVBC 4G92C 3LJAC 5C3IB 5B33D 3B6FC 5AY8A 2NZDB 3AFAB 3C1BD 1P3FD 2PYOD 4H9QA 3WAAC 3F6TA 5B0ZC 2F8NG 4JJNC 4YM6B 3EPJA 2F2AC 4Z66A 5BO0B 4HGAB 5GT3A 3AZJB 4WU8C 5AV5D 4NFTA 3X1VB 1EQZA 2F8NK 4R8PA 1P34A 3AZNB 2G5HC 5BNVB 5GT0B 3MNNA 5CPKC 1ZLAC 5FUGA 3REJB 1P3IB 4G91C 3AV2D 5DNMB 5B40A 2ZY3A 3AZLD 3X1UC 4DRBA 3RELB 4J8VC 4H9PA 2YFWB 5AY8C 1P3LD 2HIOB 5B32D 3WKJB 1TZYD 1KX3B 5DNND 3O62A 3W96D 3WA9A 1M1AB 4R8PC 1P3PB 5B1LB 3AZHA 3MNNC 5B0YC 4H9SC 2Y2NA 5B24D 3KSYA 1KX5D 3LZ0A 4WZSB 5CPID 3X1TA 3UTAB 4ZBJB 1M18C 3H0RC 2YFVA 1H3OA 4AWLB 3B0DC 2BYMB 2W8SA 5AV9A 5B2JB 2FJ7D 3W99B 1P3MD 3TU4A 1KX4A 3A6NC 3MGSC 5CP6A 5B31B 4XUJA 2JE5A 3KFUG 3AZMA 1M19A 3MGPD 1U35C 5AV8D 3WTPA 4J8XD 2Y2GA 4QLCC 4NE5A 1P3GA 4J8UA 4J8WB 4Z5TB 3X1TC 1ID3A 1HQ3B 3NQUB 1S32C 3REKC 4H9OB 3A1IA 3X1SA 5AVCA 3UTBA 5BNXB 3AFAD 1BH9B 4XUJC 4YM6D 3AZKC 3AZMC 3AZJD 3B0BA 5BT1C 5JRGA 1F66B 3AZND
chains in the Genus database with same CATH topology
4J8UC 5GSUB 3MGQB 2F8NH 3REJD 2NQBA 5DNMD 3NQJB 4KHAA 3W97A 4X23A 3RELD 1P3BB 3MGRA 3VH6A 5B33A 5B31G 3C1BA 1P3AB 2Y2PA 2PYOA 3AZIB 2HIOD 5B2IB 1JFIB 3WKJD 3H0LC 1KX3D 2F8NB 1AOIB 2HUEC 5AV5A 1M1AD 4H9NA 4G92B 1P3PD 2ZY5A 3LJAB 5B1LD 3KUYC 3KWQA 2ZM5A 3AZGA 3AV1C 4XZQC 1P3GC 3REIA 3FDDA 1B67A 5B0ZB 4KUDC 4JJNB 2NQBC 3R45A 3AV2A 3AZFA 4X23C 5GXQC 4WU8B 4ZUXC 3MGRC 3AZLA 5JA4B 3EG5B 3UT9A 3UTAD 5B32A 4YS3C 1ZLAB 1TZYA 4G91B 5DNNA 5B2JD 4WU9D 3W96A 3W99D 3X1UB 2Y2LA 4J8VB 5G49A 3C1CC 3B6GB 5B1MC 3KWQC 3AZGC 2CV5A 3REIC 5B31D 1F1EA 3LZ1C 3AZFC 5CPJC 5B24A 2VQRA 2RVQD 5F99A 4R8PB 2XD1A 4LD9C 4J8WD 3KXBC 3UT9C 4Z5TD 5CPIA 5B0YB 1KU5A 2ZY2A 3P5JB 1HQ3D 2IO5C 1HTAA 3AN2B 4KGCC 1BH8A 2CV5C 1P3OC 1M18B 3AZEA 3MGPA 5AV8A 2CWEA 4J8XA 4EO5B 5F99C 1F66D 4E44A 4CAYA 5GSUD 5CPIC 3MGQD 5KDMA 3A6NB 3MGSB 4Z66C 5GT3C 1U35B 4H9RB 1P3BD 5E5AD 1EQZC 2J8PA 1P34C 4QLCB 2NZDA 3AFAA 1P3AD 3W98D 3AZID 5B2ID 3AZEC 4YM6A 1H3OB 1P3KA 1S32B 2F8ND 3REKB 5B40C 5BO0A 1AOID 3B0CT 3AZJA 4UUZB 3X1VA 1R4VA 5BNVA 3LJAD 3LELA 3B6FD 5GT0A 2RIQA 3VH5T 5B0ZD 2Y2JA 3WAAD 4JJND 4XUJB 2FFFB 3REJA 3AZKB 1P3IA 3AYWA 3O62C 4WU9B 5DNMA 4WU8D 3RELA 3WA9C 2BYKB 2YFWA 3AZHC 1P3GB 2NZDC 1WWSA 3REHA 4E45A 2HIOA 5CPKD 1P3KC 1ZLAD 3WKJA 1KX3A 4HGAC 2AROA 4WNNB 3X1VC 3X1UD 1M1AA 4J8VD 3LZ0C 3MVDA 1P3PA 3B6GD 3LELC 5B1LA 5GT0C 4M6BA 5AV9C 3REJC 1P3IC 3AYWC 2HUEB 2UWXA 4NE3A 4R8PD 4WV4B 3TU4C 3V9RA 3KUYB 3AV1B 3MNND 1KX4C 4UPKA 4XZQB 5CP6C 5B0YD 3REHC 3UTAA 4KUDB 1M19C 2BYMA 2AROC 3WTPC 5GXQB 4X23B 4ZUXB 3MGRB 3AN2D 3MVDC 1B6WA 4DRAA 1ID3C 5AV6A 1M18D 4YS3B 5E5AB 3X1SC 5AVCC 3UTBC 3C1CB 4J8WA 1P3FA 1TAFB 5B1MB 3KWQB 2BG1A 4Z5TA 3UTAC 4ZBJC 3W98B 3A6ND 3MGSD 3REIB 4AWLC 1HQ3A 4H9OA 3LZ1B 3AZFB 1Q9CA 5AVBB 1U35D 5JRGC 5CPJB 1W2EA 3B6FB 4QLCD 5BNXA 4LD9B 3UT9B 5AV6C 3KXBB 1BH9A 3WAAB 1S32D 3REKD 3W97C 2IO5B 5B33C 1F66A 4KGCB 2ZY4A 3C1BC 1P3FC 5GSUA 2PYOC 1P3LA 3MGQA 5CPKB 1P3OB 1ULYA 2JSSA 4XUJD 1N1JB 3AZKD 3NQJA 4CSRA 3VH5A 5AV5C 5BT1D 2Y2KA 1P3GD 5AY8B 4J8UD 1P3AA 4H9QB 3AZIA 5B2IA 1JFIA 3AV2C 4Z66B 2F8NA 3AZLC 1AOIA 3A1KA 5GT3B 4NE6A 1EQZB 1KX5A 1P34B 2DF4C 3B0CW 3MNNB 1P3LC 5B32C 3IP4C 5FUGB 1TZYC 5DNNC 2FJ7A 3VH5W 3W96C 5B40B 5JA4A 1P3MA 4H9PB 3KUYD 5B32G 4CAYB 3AV1D 4XZQD 4KUDD 1ZLAA 3B0DB 3O62B 5B24C 4X23D 5GXQD 4ZUXD 3X1UA 3MGRD 4J8VA 1KX5C 3WA9B 3B6GA 3AZHB 2LY8A 4YS3D 1P3KB 2FJ7C 1P3MC 3EPHA 3LZ0B 3C1CD 3LELB 5B1MD 3KWQD 3AZGD 3X1TB 5B0YA 3REID 4H9SA 2YFVB 3VH6T 3MGPC 5AV9B 3AYWB 5BS7A 3LZ1D 3AZFD 2Y2MA 5AVBD 5AV8C 4J8XC 5CPJD 3AN2A 3AZNA 3B6GC 3TU4B 4LD9D 3UT9D 3KXBD 1KX4B 5CP6B 1M18A 4Z2MH 3REHB 3AZMB 1M19B 3WTPE 2L5AA 2AROB 3WTPB 5C3IC 2Y2HA 4KGCD 3MVDB 3AFAC 4J8UB 2CV5D 1ID3B 3EPKA 3A6NA 4YM6C 3MGSA 1T3UA 1P3OD 5BS7C 3AZJC 1U35A 4H9RA 3AN2C 3X1SB 3AZNC 5AVCB 5F99D 4QLCA 5AY8D 3UTBB 3V9RB 1S32A 5DNMC 4Z66D 3REKA 2Y2IA 5GT3D 3RELC 4UUZA 1EQZD 4EO5C 5JRGB 4DQYB 1P34D 5AV6B 2HIOC 3WKJC 3AZED 3AZKA 1KX3C 2NQBB 5B2JA 4WU9A 3AL0C 4KHAB 5B40D 3W97B 3W99A 1M1AC 2BYKA 1P3PC 5B1LC 5B33B 3C1BB 1P3FB 2PYOB 5B31A 2Y2QA 3O62D 4WNNA 3WA9D 5AV5B 4H9NB 3AZHD 3AZGB 2NZDD 4Z2MG 4WJ3C 3NQUA 1P3KD 3R45B 5B2JC 4WU9C 3AV2B 3AZLB 3W99C 3X1VD 2XD5A 3LZ0D 3LELD 3KUYA 5GT0D 3AV1A 4XZQA 3X1TD 1PZRA 5B31C 1P3LB 5B32B 4KUDA 5AV9D 1P3ID 2G5IC 1TZYB 3AYWD 5DNNB 2JCHA 4CSRB 3W96B 5GXQA 4ZUXA 1BFMA 2RVQC 5G49B 4J8WC 3TU4D 2CV5B 4Z5TC 1KX4D 5CP6D 3REHD 3H0MC 1HQ3C 4YS3A 3AZMD 2Y2OA 5CHLB 1M19D 1P3BA 5E5AA 2AROD 5B24B 3WTPD 5F99B 1KX5B 3MVDD 3C1CA 1TAFA 5B1MA 3W98A 5CPIB 1ID3D 2DQNC 1Z2CB 3LZ1A 2FJ7B 5AVBA 3VH6W 3X1SD 5CPJA 1F66C 5AVCD 3LJAA 1WWIA 3UTBD 1P3MB 1BH8B 3B6FA 5GSUC 4LD9A 3KXBA 3MGQC 5B0ZA 3WAAA 4JJNA 3AZEB 3MGPB 1P3BC 5E5AC 4WU8A 5AV8B 4J8XB 5JRGD 4KGCA 1P3AC 3W98C 3AZIC 5AV6D 5KDMB 5B2IC 1A7WA 5CPKA 1P3OA 1N1JA 3EPLA 2NQBD 1AOIC 3W97D 5AVBC 4G92C 3LJAC 5C3IB 5B33D 3B6FC 5AY8A 2NZDB 3AFAB 3C1BD 1P3FD 2PYOD 4H9QA 3WAAC 3F6TA 5B0ZC 2F8NG 4JJNC 4YM6B 3EPJA 2F2AC 4Z66A 5BO0B 4HGAB 5GT3A 3AZJB 4WU8C 5AV5D 4NFTA 3X1VB 1EQZA 2F8NK 4R8PA 1P34A 3AZNB 2G5HC 5BNVB 5GT0B 3MNNA 5CPKC 1ZLAC 5FUGA 3REJB 1P3IB 4G91C 3AV2D 5DNMB 5B40A 2ZY3A 3AZLD 3X1UC 4DRBA 3RELB 4J8VC 4H9PA 2YFWB 5AY8C 1P3LD 2HIOB 5B32D 3WKJB 1TZYD 1KX3B 5DNND 3O62A 3W96D 3WA9A 1M1AB 4R8PC 1P3PB 5B1LB 3AZHA 3MNNC 5B0YC 4H9SC 2Y2NA 5B24D 3KSYA 1KX5D 3LZ0A 4WZSB 5CPID 3X1TA 3UTAB 4ZBJB 1M18C 3H0RC 2YFVA 1H3OA 4AWLB 3B0DC 2BYMB 2W8SA 5AV9A 5B2JB 2FJ7D 3W99B 1P3MD 3TU4A 1KX4A 3A6NC 3MGSC 5CP6A 5B31B 4XUJA 2JE5A 3KFUG 3AZMA 1M19A 3MGPD 1U35C 5AV8D 3WTPA 4J8XD 2Y2GA 4QLCC 4NE5A 1P3GA 4J8UA 4J8WB 4Z5TB 3X1TC 1ID3A 1HQ3B 3NQUB 1S32C 3REKC 4H9OB 3A1IA 3X1SA 5AVCA 3UTBA 5BNXB 3AFAD 1BH9B 4XUJC 4YM6D 3AZKC 3AZMC 3AZJD 3B0BA 5BT1C 5JRGA 1F66B 3AZND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U C;  5GSU B;  3MGQ B;  2F8N H;  3REJ D;  2NQB A;  5DNM D;  3NQJ B;  4KHA A;  3W97 A;  4X23 A;  3REL D;  1P3B B;  3MGR A;  3VH6 A;  5B33 A;  5B31 G;  3C1B A;  1P3A B;  2PYO A;  3AZI B;  2HIO D;  5B2I B;  1JFI B;  3WKJ D;  1KX3 D;  2F8N B;  1AOI B;  2HUE C;  5AV5 A;  1M1A D;  4H9N A;  4G92 B;  1P3P D;  3LJA B;  5B1L D;  3KUY C;  3KWQ A;  3AZG A;  3AV1 C;  4XZQ C;  1P3G C;  3REI A;  1B67 A;  5B0Z B;  4KUD C;  4JJN B;  2NQB C;  3R45 A;  3AV2 A;  3AZF A;  4X23 C;  5GXQ C;  4WU8 B;  4ZUX C;  3MGR C;  3AZL A;  5JA4 B;  3UT9 A;  3UTA D;  5B32 A;  4YS3 C;  1ZLA B;  1TZY A;  4G91 B;  5DNN A;  5B2J D;  4WU9 D;  3W96 A;  3W99 D;  3X1U B;  4J8V B;  5G49 A;  3C1C C;  3B6G B;  5B1M C;  3KWQ C;  3AZG C;  2CV5 A;  3REI C;  5B31 D;  1F1E A;  3LZ1 C;  3AZF C;  5CPJ C;  5B24 A;  2RVQ D;  5F99 A;  4R8P B;  4LD9 C;  4J8W D;  3KXB C;  3UT9 C;  4Z5T D;  5CPI A;  5B0Y B;  1KU5 A;  1HQ3 D;  2IO5 C;  1HTA A;  3AN2 B;  4KGC C;  1BH8 A;  2CV5 C;  1P3O C;  1M18 B;  3AZE A;  3MGP A;  5AV8 A;  2CWE A;  4J8X A;  4EO5 B;  5F99 C;  1F66 D;  4E44 A;  4CAY A;  5GSU D;  5CPI C;  3MGQ D;  5KDM A;  3A6N B;  3MGS B;  4Z66 C;  5GT3 C;  1U35 B;  4H9R B;  1P3B D;  5E5A D;  1EQZ C;  1P34 C;  4QLC B;  2NZD A;  3AFA A;  1P3A D;  3W98 D;  3AZI D;  5B2I D;  3AZE C;  4YM6 A;  1H3O B;  1P3K A;  1S32 B;  2F8N D;  3REK B;  5B40 C;  5BO0 A;  1AOI D;  3B0C T;  3AZJ A;  4UUZ B;  3X1V A;  1R4V A;  5BNV A;  3LJA D;  3LEL A;  3B6F D;  5GT0 A;  3VH5 T;  5B0Z D;  3WAA D;  4JJN D;  4XUJ B;  3REJ A;  3AZK B;  1P3I A;  3AYW A;  3O62 C;  4WU9 B;  5DNM A;  4WU8 D;  3REL A;  3WA9 C;  2BYK B;  2YFW A;  3AZH C;  1P3G B;  2NZD C;  1WWS A;  3REH A;  4E45 A;  2HIO A;  5CPK D;  1P3K C;  1ZLA D;  3WKJ A;  1KX3 A;  4HGA C;  2ARO A;  4WNN B;  3X1V C;  3X1U D;  1M1A A;  4J8V D;  3LZ0 C;  3MVD A;  1P3P A;  3B6G D;  3LEL C;  5B1L A;  5GT0 C;  4M6B A;  5AV9 C;  3REJ C;  1P3I C;  3AYW C;  2HUE B;  4NE3 A;  4R8P D;  4WV4 B;  3TU4 C;  3V9R A;  3KUY B;  3AV1 B;  3MNN D;  1KX4 C;  5CP6 C;  4XZQ B;  3UTA A;  5B0Y D;  3REH C;  4KUD B;  1M19 C;  2BYM A;  2ARO C;  3WTP C;  5GXQ B;  4X23 B;  4ZUX B;  3MGR B;  3AN2 D;  3MVD C;  1B6W A;  4DRA A;  1ID3 C;  5AV6 A;  1M18 D;  4YS3 B;  5E5A B;  3X1S C;  5AVC C;  3UTB C;  3C1C B;  4J8W A;  1P3F A;  1TAF B;  5B1M B;  3KWQ B;  4Z5T A;  3W98 B;  3UTA C;  4ZBJ C;  3A6N D;  3MGS D;  3REI B;  4AWL C;  1HQ3 A;  4H9O A;  3LZ1 B;  3AZF B;  1Q9C A;  5AVB B;  1U35 D;  5JRG C;  5CPJ B;  3B6F B;  4QLC D;  5BNX A;  4LD9 B;  3UT9 B;  5AV6 C;  3KXB B;  1BH9 A;  3WAA B;  1S32 D;  3REK D;  3W97 C;  2IO5 B;  5B33 C;  1F66 A;  4KGC B;  3C1B C;  1P3F C;  2PYO C;  5GSU A;  1P3L A;  3MGQ A;  5CPK B;  1P3O B;  1ULY A;  2JSS A;  4XUJ D;  1N1J B;  3AZK D;  3NQJ A;  4CSR A;  3VH5 A;  5AV5 C;  5BT1 D;  1P3G D;  5AY8 B;  4J8U D;  1P3A A;  4H9Q B;  3AZI A;  5B2I A;  1JFI A;  3AV2 C;  4Z66 B;  2F8N A;  3AZL C;  1AOI A;  5GT3 B;  4NE6 A;  1EQZ B;  1KX5 A;  1P34 B;  3B0C W;  3MNN B;  1P3L C;  5B32 C;  5FUG B;  1TZY C;  5DNN C;  2FJ7 A;  3VH5 W;  3W96 C;  5B40 B;  5JA4 A;  1P3M A;  4H9P B;  3KUY D;  5B32 G;  4CAY B;  3AV1 D;  4XZQ D;  4KUD D;  1ZLA A;  3B0D B;  3O62 B;  5B24 C;  4X23 D;  5GXQ D;  4ZUX D;  3X1U A;  3MGR D;  4J8V A;  1KX5 C;  3WA9 B;  3B6G A;  3AZH B;  2LY8 A;  4YS3 D;  1P3K B;  2FJ7 C;  1P3M C;  3LZ0 B;  3C1C D;  3LEL B;  5B1M D;  3KWQ D;  3AZG D;  3X1T B;  5B0Y A;  3REI D;  4H9S A;  2YFV B;  3VH6 T;  3MGP C;  5AV9 B;  3AYW B;  5BS7 A;  3LZ1 D;  3AZF D;  5AVB D;  5AV8 C;  4J8X C;  5CPJ D;  3AN2 A;  3AZN A;  3B6G C;  3TU4 B;  4LD9 D;  3UT9 D;  3KXB D;  1KX4 B;  5CP6 B;  1M18 A;  4Z2M H;  3REH B;  3AZM B;  1M19 B;  3WTP E;  2L5A A;  2ARO B;  3WTP B;  5C3I C;  4KGC D;  3MVD B;  3AFA C;  4J8U B;  2CV5 D;  1ID3 B;  3A6N A;  4YM6 C;  3MGS A;  1P3O D;  5BS7 C;  3AZJ C;  1U35 A;  4H9R A;  3AN2 C;  3X1S B;  3AZN C;  5AVC B;  5F99 D;  4QLC A;  5AY8 D;  3UTB B;  3V9R B;  1S32 A;  5DNM C;  4Z66 D;  3REK A;  5GT3 D;  3REL C;  4UUZ A;  1EQZ D;  4EO5 C;  5JRG B;  1P34 D;  5AV6 B;  2HIO C;  3WKJ C;  3AZE D;  3AZK A;  1KX3 C;  2NQB B;  5B2J A;  4WU9 A;  4KHA B;  5B40 D;  3W97 B;  3W99 A;  1M1A C;  2BYK A;  1P3P C;  5B1L C;  5B33 B;  3C1B B;  1P3F B;  2PYO B;  5B31 A;  3O62 D;  4WNN A;  3WA9 D;  5AV5 B;  4H9N B;  3AZH D;  3AZG B;  2NZD D;  4Z2M G;  3NQU A;  1P3K D;  3R45 B;  5B2J C;  4WU9 C;  3AV2 B;  3AZL B;  3W99 C;  3X1V D;  3LZ0 D;  3LEL D;  3KUY A;  5GT0 D;  3AV1 A;  4XZQ A;  3X1T D;  5B31 C;  1P3L B;  5B32 B;  4KUD A;  5AV9 D;  1P3I D;  1TZY B;  3AYW D;  5DNN B;  4CSR B;  3W96 B;  5GXQ A;  4ZUX A;  1BFM A;  2RVQ C;  5G49 B;  4J8W C;  3TU4 D;  2CV5 B;  4Z5T C;  1KX4 D;  5CP6 D;  3REH D;  1HQ3 C;  4YS3 A;  3AZM D;  5CHL B;  1M19 D;  1P3B A;  5E5A A;  2ARO D;  5B24 B;  3WTP D;  5F99 B;  1KX5 B;  3MVD D;  3C1C A;  1TAF A;  5B1M A;  3W98 A;  5CPI B;  1ID3 D;  3LZ1 A;  2FJ7 B;  5AVB A;  3VH6 W;  3X1S D;  5CPJ A;  1F66 C;  5AVC D;  3LJA A;  1WWI A;  3UTB D;  1P3M B;  1BH8 B;  3B6F A;  5GSU C;  4LD9 A;  3KXB A;  3MGQ C;  5B0Z A;  3WAA A;  4JJN A;  3AZE B;  3MGP B;  1P3B C;  5E5A C;  4WU8 A;  5AV8 B;  4J8X B;  5JRG D;  4KGC A;  1P3A C;  3W98 C;  3AZI C;  5AV6 D;  5KDM B;  5B2I C;  1A7W A;  5CPK A;  1P3O A;  1N1J A;  2NQB D;  1AOI C;  3W97 D;  5AVB C;  4G92 C;  3LJA C;  5C3I B;  5B33 D;  3B6F C;  5AY8 A;  2NZD B;  3AFA B;  3C1B D;  1P3F D;  2PYO D;  4H9Q A;  3WAA C;  5B0Z C;  2F8N G;  4JJN C;  4YM6 B;  4Z66 A;  5BO0 B;  4HGA B;  5GT3 A;  3AZJ B;  4WU8 C;  5AV5 D;  4NFT A;  3X1V B;  1EQZ A;  2F8N K;  4R8P A;  1P34 A;  3AZN B;  5BNV B;  5GT0 B;  3MNN A;  5CPK C;  1ZLA C;  5FUG A;  3REJ B;  1P3I B;  4G91 C;  3AV2 D;  5DNM B;  5B40 A;  3AZL D;  3X1U C;  4DRB A;  3REL B;  4J8V C;  4H9P A;  2YFW B;  5AY8 C;  1P3L D;  2HIO B;  5B32 D;  3WKJ B;  1TZY D;  1KX3 B;  5DNN D;  3O62 A;  3W96 D;  3WA9 A;  1M1A B;  4R8P C;  1P3P B;  5B1L B;  3AZH A;  3MNN C;  5B0Y C;  4H9S C;  5B24 D;  3KSY A;  1KX5 D;  3LZ0 A;  4WZS B;  5CPI D;  3X1T A;  3UTA B;  4ZBJ B;  1M18 C;  2YFV A;  1H3O A;  4AWL B;  3B0D C;  2BYM B;  5AV9 A;  5B2J B;  2FJ7 D;  3W99 B;  1P3M D;  3TU4 A;  1KX4 A;  3A6N C;  3MGS C;  5CP6 A;  5B31 B;  4XUJ A;  3AZM A;  1M19 A;  3MGP D;  1U35 C;  5AV8 D;  3WTP A;  4J8X D;  4QLC C;  4NE5 A;  1P3G A;  4J8U A;  4J8W B;  4Z5T B;  3X1T C;  1ID3 A;  1HQ3 B;  3NQU B;  1S32 C;  3REK C;  4H9O B;  3X1S A;  5AVC A;  3UTB A;  5BNX B;  3AFA D;  1BH9 B;  4XUJ C;  4YM6 D;  3AZK C;  3AZM C;  3AZJ D;  3B0B A;  5BT1 C;  5JRG A;  1F66 B;  3AZN D; 
#chains in the Genus database with same CATH topology
 4J8U C;  5GSU B;  3MGQ B;  2F8N H;  3REJ D;  2NQB A;  5DNM D;  3NQJ B;  4KHA A;  3W97 A;  4X23 A;  3REL D;  1P3B B;  3MGR A;  3VH6 A;  5B33 A;  5B31 G;  3C1B A;  1P3A B;  2Y2P A;  2PYO A;  3AZI B;  2HIO D;  5B2I B;  1JFI B;  3WKJ D;  3H0L C;  1KX3 D;  2F8N B;  1AOI B;  2HUE C;  5AV5 A;  1M1A D;  4H9N A;  4G92 B;  1P3P D;  2ZY5 A;  3LJA B;  5B1L D;  3KUY C;  3KWQ A;  2ZM5 A;  3AZG A;  3AV1 C;  4XZQ C;  1P3G C;  3REI A;  3FDD A;  1B67 A;  5B0Z B;  4KUD C;  4JJN B;  2NQB C;  3R45 A;  3AV2 A;  3AZF A;  4X23 C;  5GXQ C;  4WU8 B;  4ZUX C;  3MGR C;  3AZL A;  5JA4 B;  3EG5 B;  3UT9 A;  3UTA D;  5B32 A;  4YS3 C;  1ZLA B;  1TZY A;  4G91 B;  5DNN A;  5B2J D;  4WU9 D;  3W96 A;  3W99 D;  3X1U B;  2Y2L A;  4J8V B;  5G49 A;  3C1C C;  3B6G B;  5B1M C;  3KWQ C;  3AZG C;  2CV5 A;  3REI C;  5B31 D;  1F1E A;  3LZ1 C;  3AZF C;  5CPJ C;  5B24 A;  2VQR A;  2RVQ D;  5F99 A;  4R8P B;  2XD1 A;  4LD9 C;  4J8W D;  3KXB C;  3UT9 C;  4Z5T D;  5CPI A;  5B0Y B;  1KU5 A;  2ZY2 A;  3P5J B;  1HQ3 D;  2IO5 C;  1HTA A;  3AN2 B;  4KGC C;  1BH8 A;  2CV5 C;  1P3O C;  1M18 B;  3AZE A;  3MGP A;  5AV8 A;  2CWE A;  4J8X A;  4EO5 B;  5F99 C;  1F66 D;  4E44 A;  4CAY A;  5GSU D;  5CPI C;  3MGQ D;  5KDM A;  3A6N B;  3MGS B;  4Z66 C;  5GT3 C;  1U35 B;  4H9R B;  1P3B D;  5E5A D;  1EQZ C;  2J8P A;  1P34 C;  4QLC B;  2NZD A;  3AFA A;  1P3A D;  3W98 D;  3AZI D;  5B2I D;  3AZE C;  4YM6 A;  1H3O B;  1P3K A;  1S32 B;  2F8N D;  3REK B;  5B40 C;  5BO0 A;  1AOI D;  3B0C T;  3AZJ A;  4UUZ B;  3X1V A;  1R4V A;  5BNV A;  3LJA D;  3LEL A;  3B6F D;  5GT0 A;  2RIQ A;  3VH5 T;  5B0Z D;  2Y2J A;  3WAA D;  4JJN D;  4XUJ B;  2FFF B;  3REJ A;  3AZK B;  1P3I A;  3AYW A;  3O62 C;  4WU9 B;  5DNM A;  4WU8 D;  3REL A;  3WA9 C;  2BYK B;  2YFW A;  3AZH C;  1P3G B;  2NZD C;  1WWS A;  3REH A;  4E45 A;  2HIO A;  5CPK D;  1P3K C;  1ZLA D;  3WKJ A;  1KX3 A;  4HGA C;  2ARO A;  4WNN B;  3X1V C;  3X1U D;  1M1A A;  4J8V D;  3LZ0 C;  3MVD A;  1P3P A;  3B6G D;  3LEL C;  5B1L A;  5GT0 C;  4M6B A;  5AV9 C;  3REJ C;  1P3I C;  3AYW C;  2HUE B;  2UWX A;  4NE3 A;  4R8P D;  4WV4 B;  3TU4 C;  3V9R A;  3KUY B;  3AV1 B;  3MNN D;  1KX4 C;  4UPK A;  4XZQ B;  5CP6 C;  5B0Y D;  3REH C;  3UTA A;  4KUD B;  1M19 C;  2BYM A;  2ARO C;  3WTP C;  5GXQ B;  4X23 B;  4ZUX B;  3MGR B;  3AN2 D;  3MVD C;  1B6W A;  4DRA A;  1ID3 C;  5AV6 A;  1M18 D;  4YS3 B;  5E5A B;  3X1S C;  5AVC C;  3UTB C;  3C1C B;  4J8W A;  1P3F A;  1TAF B;  5B1M B;  3KWQ B;  2BG1 A;  4Z5T A;  3UTA C;  4ZBJ C;  3W98 B;  3A6N D;  3MGS D;  3REI B;  4AWL C;  1HQ3 A;  4H9O A;  3LZ1 B;  3AZF B;  1Q9C A;  5AVB B;  1U35 D;  5JRG C;  5CPJ B;  1W2E A;  3B6F B;  4QLC D;  5BNX A;  4LD9 B;  3UT9 B;  5AV6 C;  3KXB B;  1BH9 A;  3WAA B;  1S32 D;  3REK D;  3W97 C;  2IO5 B;  5B33 C;  1F66 A;  4KGC B;  2ZY4 A;  3C1B C;  1P3F C;  5GSU A;  2PYO C;  1P3L A;  3MGQ A;  5CPK B;  1P3O B;  1ULY A;  2JSS A;  4XUJ D;  1N1J B;  3AZK D;  3NQJ A;  4CSR A;  3VH5 A;  5AV5 C;  5BT1 D;  2Y2K A;  1P3G D;  5AY8 B;  4J8U D;  1P3A A;  4H9Q B;  3AZI A;  5B2I A;  1JFI A;  3AV2 C;  4Z66 B;  2F8N A;  3AZL C;  1AOI A;  3A1K A;  5GT3 B;  4NE6 A;  1EQZ B;  1KX5 A;  1P34 B;  2DF4 C;  3B0C W;  3MNN B;  1P3L C;  5B32 C;  3IP4 C;  5FUG B;  1TZY C;  5DNN C;  2FJ7 A;  3VH5 W;  3W96 C;  5B40 B;  5JA4 A;  1P3M A;  4H9P B;  3KUY D;  5B32 G;  4CAY B;  3AV1 D;  4XZQ D;  4KUD D;  1ZLA A;  3B0D B;  3O62 B;  5B24 C;  4X23 D;  5GXQ D;  4ZUX D;  3X1U A;  3MGR D;  4J8V A;  1KX5 C;  3WA9 B;  3B6G A;  3AZH B;  2LY8 A;  4YS3 D;  1P3K B;  2FJ7 C;  1P3M C;  3EPH A;  3LZ0 B;  3C1C D;  3LEL B;  5B1M D;  3KWQ D;  3AZG D;  3X1T B;  5B0Y A;  3REI D;  4H9S A;  2YFV B;  3VH6 T;  3MGP C;  5AV9 B;  3AYW B;  5BS7 A;  3LZ1 D;  3AZF D;  2Y2M A;  5AVB D;  5AV8 C;  4J8X C;  5CPJ D;  3AN2 A;  3AZN A;  3B6G C;  3TU4 B;  4LD9 D;  3UT9 D;  3KXB D;  1KX4 B;  5CP6 B;  1M18 A;  4Z2M H;  3REH B;  3AZM B;  1M19 B;  3WTP E;  2L5A A;  2ARO B;  3WTP B;  5C3I C;  2Y2H A;  4KGC D;  3MVD B;  3AFA C;  4J8U B;  2CV5 D;  1ID3 B;  3EPK A;  3A6N A;  4YM6 C;  3MGS A;  1T3U A;  1P3O D;  5BS7 C;  3AZJ C;  1U35 A;  4H9R A;  3AN2 C;  3X1S B;  3AZN C;  5AVC B;  5F99 D;  4QLC A;  5AY8 D;  3UTB B;  3V9R B;  1S32 A;  5DNM C;  4Z66 D;  3REK A;  2Y2I A;  5GT3 D;  3REL C;  4UUZ A;  1EQZ D;  4EO5 C;  5JRG B;  4DQY B;  1P34 D;  5AV6 B;  2HIO C;  3WKJ C;  3AZE D;  3AZK A;  1KX3 C;  2NQB B;  5B2J A;  4WU9 A;  3AL0 C;  4KHA B;  5B40 D;  3W97 B;  3W99 A;  1M1A C;  2BYK A;  1P3P C;  5B1L C;  5B33 B;  3C1B B;  1P3F B;  2PYO B;  5B31 A;  2Y2Q A;  3O62 D;  4WNN A;  3WA9 D;  5AV5 B;  4H9N B;  3AZH D;  3AZG B;  2NZD D;  4Z2M G;  4WJ3 C;  3NQU A;  1P3K D;  3R45 B;  5B2J C;  4WU9 C;  3AV2 B;  3AZL B;  3W99 C;  3X1V D;  2XD5 A;  3LZ0 D;  3LEL D;  3KUY A;  5GT0 D;  3AV1 A;  4XZQ A;  3X1T D;  1PZR A;  5B31 C;  1P3L B;  5B32 B;  4KUD A;  5AV9 D;  1P3I D;  2G5I C;  1TZY B;  3AYW D;  5DNN B;  2JCH A;  4CSR B;  3W96 B;  5GXQ A;  4ZUX A;  1BFM A;  2RVQ C;  5G49 B;  4J8W C;  3TU4 D;  2CV5 B;  4Z5T C;  1KX4 D;  5CP6 D;  3REH D;  3H0M C;  1HQ3 C;  4YS3 A;  3AZM D;  2Y2O A;  5CHL B;  1M19 D;  1P3B A;  5E5A A;  2ARO D;  5B24 B;  3WTP D;  5F99 B;  1KX5 B;  3MVD D;  3C1C A;  1TAF A;  5B1M A;  3W98 A;  5CPI B;  1ID3 D;  2DQN C;  1Z2C B;  3LZ1 A;  2FJ7 B;  5AVB A;  3VH6 W;  3X1S D;  5CPJ A;  1F66 C;  5AVC D;  3LJA A;  1WWI A;  3UTB D;  1P3M B;  1BH8 B;  3B6F A;  5GSU C;  4LD9 A;  3KXB A;  3MGQ C;  5B0Z A;  3WAA A;  4JJN A;  3AZE B;  3MGP B;  1P3B C;  5E5A C;  4WU8 A;  5AV8 B;  4J8X B;  5JRG D;  4KGC A;  1P3A C;  3W98 C;  3AZI C;  5AV6 D;  5KDM B;  5B2I C;  1A7W A;  5CPK A;  1P3O A;  1N1J A;  3EPL A;  2NQB D;  1AOI C;  3W97 D;  5AVB C;  4G92 C;  3LJA C;  5C3I B;  5B33 D;  3B6F C;  5AY8 A;  2NZD B;  3AFA B;  3C1B D;  1P3F D;  2PYO D;  4H9Q A;  3WAA C;  3F6T A;  5B0Z C;  2F8N G;  4JJN C;  4YM6 B;  3EPJ A;  2F2A C;  4Z66 A;  5BO0 B;  4HGA B;  5GT3 A;  3AZJ B;  4WU8 C;  5AV5 D;  4NFT A;  3X1V B;  1EQZ A;  2F8N K;  4R8P A;  1P34 A;  3AZN B;  2G5H C;  5BNV B;  5GT0 B;  3MNN A;  5CPK C;  1ZLA C;  5FUG A;  3REJ B;  1P3I B;  4G91 C;  3AV2 D;  5DNM B;  5B40 A;  2ZY3 A;  3AZL D;  3X1U C;  4DRB A;  3REL B;  4J8V C;  4H9P A;  2YFW B;  5AY8 C;  1P3L D;  2HIO B;  5B32 D;  3WKJ B;  1TZY D;  1KX3 B;  5DNN D;  3O62 A;  3W96 D;  3WA9 A;  1M1A B;  4R8P C;  1P3P B;  5B1L B;  3AZH A;  3MNN C;  5B0Y C;  4H9S C;  2Y2N A;  5B24 D;  3KSY A;  1KX5 D;  3LZ0 A;  4WZS B;  5CPI D;  3X1T A;  3UTA B;  4ZBJ B;  1M18 C;  3H0R C;  2YFV A;  1H3O A;  4AWL B;  3B0D C;  2BYM B;  2W8S A;  5AV9 A;  5B2J B;  2FJ7 D;  3W99 B;  1P3M D;  3TU4 A;  1KX4 A;  3A6N C;  3MGS C;  5CP6 A;  5B31 B;  4XUJ A;  2JE5 A;  3KFU G;  3AZM A;  1M19 A;  3MGP D;  1U35 C;  5AV8 D;  3WTP A;  4J8X D;  2Y2G A;  4QLC C;  4NE5 A;  1P3G A;  4J8U A;  4J8W B;  4Z5T B;  3X1T C;  1ID3 A;  1HQ3 B;  3NQU B;  1S32 C;  3REK C;  4H9O B;  3A1I A;  3X1S A;  5AVC A;  3UTB A;  5BNX B;  3AFA D;  1BH9 B;  4XUJ C;  4YM6 D;  3AZK C;  3AZM C;  3AZJ D;  3B0B A;  5BT1 C;  5JRG A;  1F66 B;  3AZN D; 
#chains in the Genus database with same CATH homology
 4J8U C;  5GSU B;  3MGQ B;  2F8N H;  3REJ D;  2NQB A;  5DNM D;  3NQJ B;  4KHA A;  3W97 A;  4X23 A;  3REL D;  1P3B B;  3MGR A;  3VH6 A;  5B33 A;  5B31 G;  3C1B A;  1P3A B;  2Y2P A;  2PYO A;  3AZI B;  2HIO D;  5B2I B;  1JFI B;  3WKJ D;  3H0L C;  1KX3 D;  2F8N B;  1AOI B;  2HUE C;  5AV5 A;  1M1A D;  4H9N A;  4G92 B;  1P3P D;  2ZY5 A;  3LJA B;  5B1L D;  3KUY C;  3KWQ A;  2ZM5 A;  3AZG A;  3AV1 C;  4XZQ C;  1P3G C;  3REI A;  3FDD A;  1B67 A;  5B0Z B;  4KUD C;  4JJN B;  2NQB C;  3R45 A;  3AV2 A;  3AZF A;  4X23 C;  5GXQ C;  4WU8 B;  4ZUX C;  3MGR C;  3AZL A;  5JA4 B;  3EG5 B;  3UT9 A;  3UTA D;  5B32 A;  4YS3 C;  1ZLA B;  1TZY A;  4G91 B;  5DNN A;  5B2J D;  4WU9 D;  3W96 A;  3W99 D;  3X1U B;  2Y2L A;  4J8V B;  5G49 A;  3C1C C;  3B6G B;  5B1M C;  3KWQ C;  3AZG C;  2CV5 A;  3REI C;  5B31 D;  1F1E A;  3LZ1 C;  3AZF C;  5CPJ C;  5B24 A;  2VQR A;  2RVQ D;  5F99 A;  4R8P B;  2XD1 A;  4LD9 C;  4J8W D;  3KXB C;  3UT9 C;  4Z5T D;  5CPI A;  5B0Y B;  1KU5 A;  2ZY2 A;  3P5J B;  1HQ3 D;  2IO5 C;  1HTA A;  3AN2 B;  4KGC C;  1BH8 A;  2CV5 C;  1P3O C;  1M18 B;  3AZE A;  3MGP A;  5AV8 A;  2CWE A;  4J8X A;  4EO5 B;  5F99 C;  1F66 D;  4E44 A;  4CAY A;  5GSU D;  5CPI C;  3MGQ D;  5KDM A;  3A6N B;  3MGS B;  4Z66 C;  5GT3 C;  1U35 B;  4H9R B;  1P3B D;  5E5A D;  1EQZ C;  2J8P A;  1P34 C;  4QLC B;  2NZD A;  3AFA A;  1P3A D;  3W98 D;  3AZI D;  5B2I D;  3AZE C;  4YM6 A;  1H3O B;  1P3K A;  1S32 B;  2F8N D;  3REK B;  5B40 C;  5BO0 A;  1AOI D;  3B0C T;  3AZJ A;  4UUZ B;  3X1V A;  1R4V A;  5BNV A;  3LJA D;  3LEL A;  3B6F D;  5GT0 A;  2RIQ A;  3VH5 T;  5B0Z D;  2Y2J A;  3WAA D;  4JJN D;  4XUJ B;  2FFF B;  3REJ A;  3AZK B;  1P3I A;  3AYW A;  3O62 C;  4WU9 B;  5DNM A;  4WU8 D;  3REL A;  3WA9 C;  2BYK B;  2YFW A;  3AZH C;  1P3G B;  2NZD C;  1WWS A;  3REH A;  4E45 A;  2HIO A;  5CPK D;  1P3K C;  1ZLA D;  3WKJ A;  1KX3 A;  4HGA C;  2ARO A;  4WNN B;  3X1V C;  3X1U D;  1M1A A;  4J8V D;  3LZ0 C;  3MVD A;  1P3P A;  3B6G D;  3LEL C;  5B1L A;  5GT0 C;  4M6B A;  5AV9 C;  3REJ C;  1P3I C;  3AYW C;  2HUE B;  2UWX A;  4NE3 A;  4R8P D;  4WV4 B;  3TU4 C;  3V9R A;  3KUY B;  3AV1 B;  3MNN D;  1KX4 C;  4UPK A;  4XZQ B;  5CP6 C;  5B0Y D;  3REH C;  3UTA A;  4KUD B;  1M19 C;  2BYM A;  2ARO C;  3WTP C;  5GXQ B;  4X23 B;  4ZUX B;  3MGR B;  3AN2 D;  3MVD C;  1B6W A;  4DRA A;  1ID3 C;  5AV6 A;  1M18 D;  4YS3 B;  5E5A B;  3X1S C;  5AVC C;  3UTB C;  3C1C B;  4J8W A;  1P3F A;  1TAF B;  5B1M B;  3KWQ B;  2BG1 A;  4Z5T A;  3UTA C;  4ZBJ C;  3W98 B;  3A6N D;  3MGS D;  3REI B;  4AWL C;  1HQ3 A;  4H9O A;  3LZ1 B;  3AZF B;  1Q9C A;  5AVB B;  1U35 D;  5JRG C;  5CPJ B;  1W2E A;  3B6F B;  4QLC D;  5BNX A;  4LD9 B;  3UT9 B;  5AV6 C;  3KXB B;  1BH9 A;  3WAA B;  1S32 D;  3REK D;  3W97 C;  2IO5 B;  5B33 C;  1F66 A;  4KGC B;  2ZY4 A;  3C1B C;  1P3F C;  5GSU A;  2PYO C;  1P3L A;  3MGQ A;  5CPK B;  1P3O B;  1ULY A;  2JSS A;  4XUJ D;  1N1J B;  3AZK D;  3NQJ A;  4CSR A;  3VH5 A;  5AV5 C;  5BT1 D;  2Y2K A;  1P3G D;  5AY8 B;  4J8U D;  1P3A A;  4H9Q B;  3AZI A;  5B2I A;  1JFI A;  3AV2 C;  4Z66 B;  2F8N A;  3AZL C;  1AOI A;  3A1K A;  5GT3 B;  4NE6 A;  1EQZ B;  1KX5 A;  1P34 B;  2DF4 C;  3B0C W;  3MNN B;  1P3L C;  5B32 C;  3IP4 C;  5FUG B;  1TZY C;  5DNN C;  2FJ7 A;  3VH5 W;  3W96 C;  5B40 B;  5JA4 A;  1P3M A;  4H9P B;  3KUY D;  5B32 G;  4CAY B;  3AV1 D;  4XZQ D;  4KUD D;  1ZLA A;  3B0D B;  3O62 B;  5B24 C;  4X23 D;  5GXQ D;  4ZUX D;  3X1U A;  3MGR D;  4J8V A;  1KX5 C;  3WA9 B;  3B6G A;  3AZH B;  2LY8 A;  4YS3 D;  1P3K B;  2FJ7 C;  1P3M C;  3EPH A;  3LZ0 B;  3C1C D;  3LEL B;  5B1M D;  3KWQ D;  3AZG D;  3X1T B;  5B0Y A;  3REI D;  4H9S A;  2YFV B;  3VH6 T;  3MGP C;  5AV9 B;  3AYW B;  5BS7 A;  3LZ1 D;  3AZF D;  2Y2M A;  5AVB D;  5AV8 C;  4J8X C;  5CPJ D;  3AN2 A;  3AZN A;  3B6G C;  3TU4 B;  4LD9 D;  3UT9 D;  3KXB D;  1KX4 B;  5CP6 B;  1M18 A;  4Z2M H;  3REH B;  3AZM B;  1M19 B;  3WTP E;  2L5A A;  2ARO B;  3WTP B;  5C3I C;  2Y2H A;  4KGC D;  3MVD B;  3AFA C;  4J8U B;  2CV5 D;  1ID3 B;  3EPK A;  3A6N A;  4YM6 C;  3MGS A;  1T3U A;  1P3O D;  5BS7 C;  3AZJ C;  1U35 A;  4H9R A;  3AN2 C;  3X1S B;  3AZN C;  5AVC B;  5F99 D;  4QLC A;  5AY8 D;  3UTB B;  3V9R B;  1S32 A;  5DNM C;  4Z66 D;  3REK A;  2Y2I A;  5GT3 D;  3REL C;  4UUZ A;  1EQZ D;  4EO5 C;  5JRG B;  4DQY B;  1P34 D;  5AV6 B;  2HIO C;  3WKJ C;  3AZE D;  3AZK A;  1KX3 C;  2NQB B;  5B2J A;  4WU9 A;  3AL0 C;  4KHA B;  5B40 D;  3W97 B;  3W99 A;  1M1A C;  2BYK A;  1P3P C;  5B1L C;  5B33 B;  3C1B B;  1P3F B;  2PYO B;  5B31 A;  2Y2Q A;  3O62 D;  4WNN A;  3WA9 D;  5AV5 B;  4H9N B;  3AZH D;  3AZG B;  2NZD D;  4Z2M G;  4WJ3 C;  3NQU A;  1P3K D;  3R45 B;  5B2J C;  4WU9 C;  3AV2 B;  3AZL B;  3W99 C;  3X1V D;  2XD5 A;  3LZ0 D;  3LEL D;  3KUY A;  5GT0 D;  3AV1 A;  4XZQ A;  3X1T D;  1PZR A;  5B31 C;  1P3L B;  5B32 B;  4KUD A;  5AV9 D;  1P3I D;  2G5I C;  1TZY B;  3AYW D;  5DNN B;  2JCH A;  4CSR B;  3W96 B;  5GXQ A;  4ZUX A;  1BFM A;  2RVQ C;  5G49 B;  4J8W C;  3TU4 D;  2CV5 B;  4Z5T C;  1KX4 D;  5CP6 D;  3REH D;  3H0M C;  1HQ3 C;  4YS3 A;  3AZM D;  2Y2O A;  5CHL B;  1M19 D;  1P3B A;  5E5A A;  2ARO D;  5B24 B;  3WTP D;  5F99 B;  1KX5 B;  3MVD D;  3C1C A;  1TAF A;  5B1M A;  3W98 A;  5CPI B;  1ID3 D;  2DQN C;  1Z2C B;  3LZ1 A;  2FJ7 B;  5AVB A;  3VH6 W;  3X1S D;  5CPJ A;  1F66 C;  5AVC D;  3LJA A;  1WWI A;  3UTB D;  1P3M B;  1BH8 B;  3B6F A;  5GSU C;  4LD9 A;  3KXB A;  3MGQ C;  5B0Z A;  3WAA A;  4JJN A;  3AZE B;  3MGP B;  1P3B C;  5E5A C;  4WU8 A;  5AV8 B;  4J8X B;  5JRG D;  4KGC A;  1P3A C;  3W98 C;  3AZI C;  5AV6 D;  5KDM B;  5B2I C;  1A7W A;  5CPK A;  1P3O A;  1N1J A;  3EPL A;  2NQB D;  1AOI C;  3W97 D;  5AVB C;  4G92 C;  3LJA C;  5C3I B;  5B33 D;  3B6F C;  5AY8 A;  2NZD B;  3AFA B;  3C1B D;  1P3F D;  2PYO D;  4H9Q A;  3WAA C;  3F6T A;  5B0Z C;  2F8N G;  4JJN C;  4YM6 B;  3EPJ A;  2F2A C;  4Z66 A;  5BO0 B;  4HGA B;  5GT3 A;  3AZJ B;  4WU8 C;  5AV5 D;  4NFT A;  3X1V B;  1EQZ A;  2F8N K;  4R8P A;  1P34 A;  3AZN B;  2G5H C;  5BNV B;  5GT0 B;  3MNN A;  5CPK C;  1ZLA C;  5FUG A;  3REJ B;  1P3I B;  4G91 C;  3AV2 D;  5DNM B;  5B40 A;  2ZY3 A;  3AZL D;  3X1U C;  4DRB A;  3REL B;  4J8V C;  4H9P A;  2YFW B;  5AY8 C;  1P3L D;  2HIO B;  5B32 D;  3WKJ B;  1TZY D;  1KX3 B;  5DNN D;  3O62 A;  3W96 D;  3WA9 A;  1M1A B;  4R8P C;  1P3P B;  5B1L B;  3AZH A;  3MNN C;  5B0Y C;  4H9S C;  2Y2N A;  5B24 D;  3KSY A;  1KX5 D;  3LZ0 A;  4WZS B;  5CPI D;  3X1T A;  3UTA B;  4ZBJ B;  1M18 C;  3H0R C;  2YFV A;  1H3O A;  4AWL B;  3B0D C;  2BYM B;  2W8S A;  5AV9 A;  5B2J B;  2FJ7 D;  3W99 B;  1P3M D;  3TU4 A;  1KX4 A;  3A6N C;  3MGS C;  5CP6 A;  5B31 B;  4XUJ A;  2JE5 A;  3KFU G;  3AZM A;  1M19 A;  3MGP D;  1U35 C;  5AV8 D;  3WTP A;  4J8X D;  2Y2G A;  4QLC C;  4NE5 A;  1P3G A;  4J8U A;  4J8W B;  4Z5T B;  3X1T C;  1ID3 A;  1HQ3 B;  3NQU B;  1S32 C;  3REK C;  4H9O B;  3A1I A;  3X1S A;  5AVC A;  3UTB A;  5BNX B;  3AFA D;  1BH9 B;  4XUJ C;  4YM6 D;  3AZK C;  3AZM C;  3AZJ D;  3B0B A;  5BT1 C;  5JRG A;  1F66 B;  3AZN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...