2F8NB

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nB00
5B40C 1M1AC 1P3MA 1F66A 4Z66D 2YFVA 4XZQB 5B2JD 3MGPB 4G92B 3X1TA 4UUZA 1P3OC 3W99D 1ID3C 5CPJA 3X1SD 3WAAC 5GT0C 3AZGA 4ZUXB 4J8XD 3WKJA 5B1LC 5B31B 1P3AD 3LZ1D 3AN2D 3B6GD 3TU4D 3W96D 3V9RA 4Z5TC 5CHLB 3KWQC 5B0ZC 3AFAD 4EO5C 1M19D 1P3OB 1ID3B 3LELC 5AV6A 1P3BA 3A6ND 1P3PB 3W98D 1TAFA 5GT3D 4Z5TB 5AVCB 3KWQB 4WV4B 5B2JC 4EO5B 4J8UD 3W99C 4H9QB 1P34D 3X1SC 4QLCA 3X1VA 4NE5A 1B67A 3LZ1C 5B33A 1P3MD 3AN2C 3TU4C 1BH8B 3W96C 2RVQD 4M6BA 4Z66B 5B2JB 3AFAC 2YFWA 3W99B 5CPJD 3X1SB 2HIOD 4H9SA 1F1EA 4J8XB 3REKA 1KX3A 1P3AB 3LZ1B 3MVDC 3AZKA 3AN2B 3B6GB 2IO5B 3TU4B 3AV1D 5GT3C 3WTPE 5F99D 5E5AD 4H9PA 5KDMB 3AFAB 4NE6A 2HUEB 5DNNA 4J8UC 3AZEA 1P3GC 1M19B 5AV6D 3REIA 1P3BD 4Z2MG 5FUGA 2CV5A 3LZ0A 3A6NB 3R45A 3AZJA 5CP6B 5AV5A 3AZID 1P3MC 3W98B 5BNXA 5GT3B 2RVQC 3NQUB 5JA4A 3NQJB 4H9NB 1N1JB 5DNMA 3RELA 4J8UB 2NZDD 5CPJC 1P34B 2HIOC 1HQ3A 4LD9D 4J8WA 3KUYA 1P3MB 2FJ7D 1ZLAD 3AV1C 1F66B 3B6FD 2YFVB 5F99C 5E5AC 3AZFD 4UUZB 1P3ID 2F8ND 4J8VA 5CPJB 5AV6C 2HIOB 2F8NK 4XZQD 4X23D 3LJAA 5BO0A 3REKD 1KX3D 5AVBD 3KXBA 3AZKD 3AZIC 3AV2A 1P3FA 4JJND 3AV1B 5F99B 4H9OB 5E5AB 4WU8A 4XUJD 5BNVA 2NZDC 5AV6B 1P3BB 3MGSA 2CV5D 4LD9C 3UTAD 5B24A 3AZIB 2FJ7C 2AROC 4WNNA 1ZLAC 1TAFB 3MGRA 3B6FC 5AY8C 3WTPC 4R8PC 3RELD 3AZFC 2NZDB 1P3IC 1HQ3D 4XZQC 4E44A 4X23C 3MGPC 2F8NG 4J8WD 5AVBC 4NE3A 2FJ7B 4WZSB 1M18A 1ZLAB 4JJNC 4KUDD 3B6FB 4ZUXC 3AYWD 5GXQD 5B31C 3WA9D 5B1MA 4XUJC 3AZFB 1P3IB 4J8VD 2F8NB 5CPIA 5B31G 1BH9A 1S32A 4X23B 3LJAD 3REKB 1KX3B 5AVBB 3UTAC 3AZKB 4YS3A 3REHA 4JJNB 5CPKD 1U35A 4WU8D 1WWSA 4H9PB 1P3PC 4XUJB 4KHAB 1EQZD 5BS7A 5BT1C 5AVCC 2CV5B 1KX4D 3AZJB 3B0DC 5B24D 3UTAB 1B6WA 3MGRD 5BNXB 4KUDC 3UTBA 1R4VA 3AYWC 1TZYD 3VH6T 5JA4B 5GXQC 3AZLA 3WA9C 5CP6D 3RELB 4Z66C 1HQ3B 1P3KA 1P3LA 4J8WB 3W97A 3B0DB 5B2IA 2NQBA 5G49A 1M18D 4KUDB 4CSRA 4J8XC 5B0YA 5CPKC 3AYWB 5GXQB 3MNNA 1P3AC 3WA9B 2L5AA 1EQZC 1A7WA 5JRGA 2BYKA 2IO5C 4J8VB 3B6GC 1F66D 1KX4C 3LJAB 5BO0B 3X1TD 3REJA 4YS3D 2HUEC 1M19C 3AZMA 3AZGD 4H9RA 1AOIA 3MGRC 3WKJD 1U35D 5CPKB 4KGCA 4WU8B 1TZYC 3A6NC 5CP6C 1EQZB 5B32A 3W98C 4WU9A 1KX4B 1ULYA 5B24B 3UT9A 1KX5A 2BYMA 4WNNB 1M18C 1P34C 5AV8A 3MGRB 1TZYB 5GSUA 4HGAB 4ZBJC 3VH6A 1F66C 3B0BA 1P3KD 5AV9A 3X1TC 1P3LD 3W97D 5B2ID 1JFIB 2NQBD 2LY8A 4DRBA 1M18B 3AZGC 3WKJC 4QLCD 5B0YD 1U35C 4Z2MH 3X1VD 3VH6W 3MNND 5B33D 5JRGD 5B40A 1M1AA 4CAYA 4ZBJB 4G91B 1BH9B 2PYOA 3X1TB 4YS3B 3AZMD 3AZGB 1P3BC 1H3OA 1AOID 3WAAA 5GT0A 3WKJB 4KGCD 3C1CA 1U35B 5B1LA 4YM6A 3V9RB 4WU9D 4Z5TA 3KWQA 1P3KC 1P3LC 5B0ZA 3W97C 4NFTA 5DNND 5B2IC 3AZED 1KX5D 1BFMA 5C3IC 3REID 5AV8D 4H9QA 3LELA 4QLCC 5B0YC 3LZ0D 3X1VC 3AZJD 5AV5D 5B33C 5JRGC 1P3KB 5AV9D 1P3LB 5B2JA 5DNMD 3W97B 5B2IB 2NQBB 5C3IB 3W99A 1Q9CA 1AOIC 4H9SC 3X1SA 5B0YB 4QLCB 3X1VB 3REKC 1KX3C 3MNNB 3KUYD 5B33B 3AZKC 5JRGB 2BYKB 1M1AD 3TU4A 3W96A 2PYOD 5DNNC 3AZEC 2YFWB 3AZMB 1KX5C 4H9RB 3REIC 1AOIB 3WAAD 5GT0D 2CV5C 3C1CD 4KGCB 3LZ0C 5B1LD 4AWLB 4YM6D 3AZJC 3KXBD 5AV5C 2F8NH 3MVDA 3AV2D 1P3FD 4WU9B 5B0ZD 3NQUA 5DNMC 3RELC 5DNNB 3VH5T 3AZEB 1KX5B 2BYMB 1P3GA 4J8UA 3REIB 5AV8B 3LELD 3MGSD 5FUGB 1HQ3C 3LZ0B 3R45B 4J8WC 3KUYC 2JSSA 5AV5B 3O62A 2PYOC 5AV9B 4E45A 3AZNA 5DNMB 4J8VC 3C1CC 2HIOA 3LJAC 4YM6C 3KUYB 3KXBC 5B40B 1M1AB 4CAYB 3AV2C 1P3FC 3AV1A 2PYOB 4WU8C 4H9OA 5F99A 5B1MD 5E5AA 3X1UA 5CPID 3MGQA 1H3OB 3MGSC 1S32D 3WAAB 5GT0B 3C1CB 5B1LB 4YM6B 5B24C 3KXBB 3MVDD 3AZIA 3REHD 3AV2B 1P3FB 3C1BA 5B0ZB 5BNVB 4HGAC 1P3GD 2NZDA 3MGSB 3LELB 3AZHA 3VH5A 4LD9A 3O62D 2FJ7A 2AROA 3B0CW 1ZLAA 3UTBD 3B6FA 5AY8A 3WTPA 3AZLD 4R8PA 5B1MC 3AZND 3VH5W 3AZFA 5CPIC 1P3IA 2F8NA 4G91C 1S32C 4XZQA 4X23A 3MGPA 4YS3C 2CWEA 5AVBA 3REHC 3W96B 4JJNA 4ZUXA 3X1UD 5B1MB 5B31A 4XUJA 5BS7C 4KHAA 5CPIB 3MGQD 1S32B 3REJD 3MVDB 3UTAA 3O62C 3REHB 1P3OA 1ID3A 3UTBC 3C1BD 4DRAA 3AZLC 3AZNC 1P3PA 5B32D 1P3GB 3KSYA 3AZHD 5AVCA 3UT9D 2NQBC 3O62B 2AROD 3UTBB 4KUDA 3WTPD 5AY8D 1HTAA 3X1UC 5GSUD 4R8PD 3MNNC 5GXQA 3AYWA 3AZLB 3AZNB 3WA9A 1KU5A 3MGQC 1BH8A 4Z66A 3MGPD 3REJC 3AZMC 5G49B 4CSRB 3C1BC 1WWIA 4ZUXD 4KGCC 4J8XA 4AWLC 3X1UB 5CPKA 5B31D 5B40D 5B32C 3LZ1A 1P3AA 1EQZA 3AN2A 3MGQB 3B6GA 4WU9C 5B32G 3AZHC 1KX4A 3REJB 3UT9C 5KDMA 3AFAA 1M19A 1P3OD 1ID3D 5AV8C 3C1BB 5GSUC 1TZYA 3A6NA 1P3PD 5B32B 5CP6A 5BT1D 3W98A 3B0CT 4Z5TD 5GT3A 5AVCD 3KWQD 3AZHB 5AV9C 4G92C 4LD9B 3UT9B 1N1JA 3NQJA 4H9NA 1JFIA 2AROB 1P34A 3WTPB 5AY8B 4R8PB 5GSUB
chains in the Genus database with same CATH superfamily
5B40C 1M1AC 1P3MA 1F66A 4Z66D 2YFVA 4XZQB 5B2JD 3MGPB 4G92B 3X1TA 4UUZA 1P3OC 3W99D 1ID3C 5CPJA 3X1SD 3WAAC 5GT0C 3AZGA 4ZUXB 4J8XD 3WKJA 5B1LC 5B31B 1P3AD 3LZ1D 3AN2D 3B6GD 3TU4D 3W96D 3V9RA 4Z5TC 5CHLB 3KWQC 5B0ZC 3AFAD 3A1KA 4EO5C 1M19D 1P3OB 1ID3B 3LELC 5AV6A 1P3BA 2ZY5A 3A6ND 1P3PB 3W98D 1TAFA 2RIQA 5GT3D 4Z5TB 5AVCB 3KWQB 4WV4B 5B2JC 4EO5B 4J8UD 3W99C 4H9QB 1P34D 3X1SC 4QLCA 3X1VA 4NE5A 1B67A 3LZ1C 5B33A 1P3MD 3AN2C 3TU4C 1BH8B 3W96C 2RVQD 4M6BA 4Z66B 5B2JB 3AFAC 3EPHA 2YFWA 3W99B 5CPJD 3X1SB 2HIOD 4H9SA 1F1EA 4J8XB 3REKA 1KX3A 1P3AB 3A1IA 3LZ1B 3MVDC 3AZKA 3AN2B 3B6GB 2IO5B 3TU4B 3AV1D 5GT3C 3WTPE 5F99D 5E5AD 2ZY3A 4H9PA 5KDMB 3AFAB 4NE6A 2HUEB 5DNNA 4J8UC 3AZEA 1P3GC 1M19B 5AV6D 3REIA 1P3BD 2G5IC 4Z2MG 5FUGA 2CV5A 3EPLA 3LZ0A 3A6NB 3R45A 3AZJA 5CP6B 5AV5A 3AZID 1P3MC 3W98B 5BNXA 5GT3B 2RVQC 3NQUB 2W8SA 5JA4A 1N1JB 3NQJB 4H9NB 5DNMA 3RELA 4J8UB 2NZDD 5CPJC 1P34B 2HIOC 1HQ3A 4LD9D 4J8WA 3KUYA 2Y2LA 1P3MB 2FJ7D 1ZLAD 2JE5A 3AV1C 1F66B 3B6FD 2YFVB 5F99C 5E5AC 3AZFD 4UUZB 1P3ID 2F8ND 4J8VA 5CPJB 5AV6C 2HIOB 2F8NK 4XZQD 4X23D 3LJAA 5BO0A 3REKD 1KX3D 5AVBD 3KXBA 3AZKD 3AZIC 3H0RC 4UPKA 3AV2A 4JJND 3AV1B 1P3FA 2Y2HA 4H9OB 5F99B 5E5AB 4WU8A 3AL0C 4XUJD 5BNVA 2NZDC 5AV6B 1P3BB 3MGSA 2CV5D 4LD9C 3UTAD 5B24A 3AZIB 2FJ7C 2AROC 4WNNA 1ZLAC 1TAFB 3MGRA 3B6FC 5AY8C 3WTPC 4R8PC 2XD1A 3RELD 3AZFC 2NZDB 1P3IC 3P5JB 3H0MC 1HQ3D 4XZQC 2Y2JA 4E44A 4X23C 3MGPC 4J8WD 2F8NG 3H0LC 5AVBC 4NE3A 2FJ7B 4WZSB 1M18A 1ZLAB 4JJNC 4KUDD 2VQRA 3B6FB 4ZUXC 3AYWD 5GXQD 5B31C 3WA9D 5B1MA 4XUJC 3AZFB 1P3IB 4J8VD 2F8NB 5CPIA 5B31G 1BH9A 1S32A 4X23B 3LJAD 3REKB 1KX3B 5AVBB 3UTAC 3AZKB 4YS3A 3REHA 4JJNB 5CPKD 1U35A 4WU8D 1WWSA 4H9PB 1P3PC 4XUJB 4KHAB 1EQZD 5BS7A 5BT1C 5AVCC 2CV5B 1KX4D 3AZJB 3B0DC 5B24D 3UTAB 1B6WA 3MGRD 5BNXB 4KUDC 3UTBA 1R4VA 3AYWC 1TZYD 3VH6T 5JA4B 5GXQC 3AZLA 3WA9C 5CP6D 3RELB 4Z66C 1HQ3B 1P3KA 1P3LA 4J8WB 3W97A 3B0DB 5B2IA 2NQBA 5G49A 1M18D 4KUDB 4CSRA 4J8XC 5B0YA 5CPKC 3AYWB 5GXQB 3MNNA 1P3AC 3WA9B 2L5AA 1EQZC 1A7WA 5JRGA 2BYKA 2F2AC 2IO5C 4J8VB 3B6GC 1F66D 1KX4C 3LJAB 5BO0B 3X1TD 3REJA 4YS3D 4DQYB 2HUEC 1M19C 3AZMA 2Y2KA 3AZGD 4H9RA 1AOIA 3MGRC 3WKJD 1U35D 5CPKB 4KGCA 4WU8B 1TZYC 3A6NC 5CP6C 1EQZB 5B32A 3W98C 4WU9A 1KX4B 1ULYA 5B24B 3UT9A 1KX5A 2BYMA 4WNNB 1M18C 1P34C 5AV8A 3MGRB 1TZYB 2Y2NA 5GSUA 4HGAB 4ZBJC 3VH6A 1F66C 3B0BA 1P3KD 5AV9A 3X1TC 1P3LD 3W97D 2DF4C 5B2ID 1JFIB 2NQBD 2LY8A 4DRBA 1M18B 3AZGC 3WKJC 4QLCD 5B0YD 1U35C 4Z2MH 3X1VD 3VH6W 3MNND 5B33D 5JRGD 5B40A 1M1AA 4CAYA 4ZBJB 4G91B 1BH9B 2PYOA 3X1TB 4YS3B 3AZMD 3AZGB 1P3BC 1H3OA 1AOID 3WAAA 5GT0A 3WKJB 4KGCD 3C1CA 1U35B 5B1LA 4YM6A 2UWXA 3V9RB 4WU9D 4Z5TA 3KWQA 1P3KC 1P3LC 5B0ZA 3W97C 4NFTA 5DNND 5B2IC 3AZED 1KX5D 1BFMA 5C3IC 3REID 5AV8D 1T3UA 4H9QA 3LELA 4QLCC 5B0YC 3LZ0D 3X1VC 3AZJD 5AV5D 5B33C 5JRGC 3EPKA 3KFUG 1P3KB 5AV9D 1P3LB 5B2JA 5DNMD 3W97B 5B2IB 2NQBB 5C3IB 3W99A 1Q9CA 1AOIC 4H9SC 3X1SA 5B0YB 4QLCB 3X1VB 3REKC 1KX3C 3MNNB 3KUYD 5B33B 3AZKC 5JRGB 2BYKB 1M1AD 3TU4A 3W96A 2PYOD 5DNNC 3AZEC 2YFWB 3AZMB 1KX5C 4H9RB 3REIC 1AOIB 3WAAD 1PZRA 5GT0D 2CV5C 3C1CD 2DQNC 3FDDA 3LZ0C 4KGCB 5B1LD 4AWLB 4YM6D 3AZJC 3KXBD 5AV5C 2F8NH 3MVDA 3AV2D 1P3FD 4WU9B 5B0ZD 3NQUA 5DNMC 3RELC 5DNNB 3VH5T 3AZEB 1KX5B 2BYMB 1P3GA 4J8UA 3REIB 5AV8B 3LELD 3MGSD 5FUGB 1HQ3C 3LZ0B 3R45B 4J8WC 3KUYC 2JSSA 5AV5B 2XD5A 3O62A 4WJ3C 2PYOC 5AV9B 4E45A 3AZNA 5DNMB 4J8VC 3C1CC 2HIOA 3LJAC 2Y2GA 4YM6C 3KUYB 3KXBC 5B40B 1M1AB 4CAYB 3AV2C 1P3FC 2Y2IA 3AV1A 2PYOB 4WU8C 4H9OA 5F99A 5B1MD 5E5AA 3X1UA 5CPID 3MGQA 2JCHA 1H3OB 3MGSC 1S32D 3WAAB 5GT0B 3C1CB 5B1LB 4YM6B 5B24C 3KXBB 3MVDD 3AZIA 3REHD 3AV2B 1P3FB 3C1BA 5B0ZB 5BNVB 4HGAC 1P3GD 2NZDA 3MGSB 3LELB 2ZY4A 3AZHA 3VH5A 4LD9A 3O62D 2FJ7A 2AROA 3B0CW 1ZLAA 3UTBD 3B6FA 5AY8A 3WTPA 3AZLD 4R8PA 5B1MC 2G5HC 3AZND 3VH5W 3AZFA 5CPIC 1P3IA 2F8NA 4G91C 1S32C 4XZQA 4X23A 3MGPA 4YS3C 2CWEA 5AVBA 3REHC 3W96B 2BG1A 4JJNA 4ZUXA 3X1UD 5B1MB 5B31A 4XUJA 5BS7C 4KHAA 2Y2OA 3MGQD 5CPIB 1S32B 3EG5B 3REJD 3MVDB 3UTAA 2Y2PA 3O62C 3REHB 1P3OA 1ID3A 3UTBC 3C1BD 2FFFB 2Y2QA 4DRAA 3AZLC 3AZNC 1P3PA 5B32D 1P3GB 3F6TA 3KSYA 3AZHD 5AVCA 3UT9D 2NQBC 3O62B 2AROD 1W2EA 3UTBB 4KUDA 5AY8D 3WTPD 1HTAA 3X1UC 5GSUD 4R8PD 3MNNC 5GXQA 3AYWA 3AZLB 3AZNB 3WA9A 1KU5A 2ZM5A 3MGQC 1BH8A 4Z66A 3MGPD 3REJC 3AZMC 5G49B 2J8PA 4CSRB 3C1BC 1WWIA 4ZUXD 4KGCC 4J8XA 4AWLC 3X1UB 5CPKA 5B31D 5B40D 5B32C 3LZ1A 1P3AA 1EQZA 3AN2A 3MGQB 3B6GA 4WU9C 5B32G 3AZHC 2Y2MA 1KX4A 3REJB 3UT9C 5KDMA 3AFAA 1M19A 1P3OD 1ID3D 5AV8C 3C1BB 5GSUC 1TZYA 3A6NA 1P3PD 5B32B 5CP6A 5BT1D 3W98A 3B0CT 3EPJA 4Z5TD 5GT3A 5AVCD 3KWQD 3AZHB 5AV9C 4G92C 4LD9B 3UT9B 1N1JA 3NQJA 4H9NA 1JFIA 2AROB 2ZY2A 3IP4C 1P34A 3WTPB 5AY8B 1Z2CB 4R8PB 5GSUB
chains in the Genus database with same CATH topology
5B40C 1M1AC 1P3MA 1F66A 4Z66D 2YFVA 4XZQB 5B2JD 3MGPB 4G92B 3X1TA 4UUZA 1P3OC 3W99D 1ID3C 5CPJA 3X1SD 3WAAC 5GT0C 3AZGA 4ZUXB 4J8XD 3WKJA 5B1LC 5B31B 1P3AD 3LZ1D 3AN2D 3B6GD 3TU4D 3W96D 3V9RA 4Z5TC 5CHLB 3KWQC 5B0ZC 3AFAD 3A1KA 4EO5C 1M19D 1P3OB 1ID3B 3LELC 5AV6A 1P3BA 2ZY5A 3A6ND 1P3PB 3W98D 1TAFA 2RIQA 5GT3D 4Z5TB 5AVCB 3KWQB 4WV4B 5B2JC 4EO5B 4J8UD 3W99C 4H9QB 1P34D 3X1SC 4QLCA 3X1VA 4NE5A 1B67A 3LZ1C 5B33A 1P3MD 3AN2C 3TU4C 1BH8B 3W96C 2RVQD 4M6BA 4Z66B 5B2JB 3AFAC 3EPHA 2YFWA 3W99B 5CPJD 3X1SB 2HIOD 4H9SA 1F1EA 4J8XB 3REKA 1KX3A 1P3AB 3A1IA 3LZ1B 3MVDC 3AZKA 3AN2B 3B6GB 2IO5B 3TU4B 3AV1D 5GT3C 3WTPE 5F99D 5E5AD 2ZY3A 4H9PA 5KDMB 3AFAB 4NE6A 2HUEB 5DNNA 4J8UC 3AZEA 1P3GC 1M19B 5AV6D 3REIA 1P3BD 2G5IC 4Z2MG 5FUGA 2CV5A 3EPLA 3LZ0A 3A6NB 3R45A 3AZJA 5CP6B 5AV5A 3AZID 1P3MC 3W98B 5BNXA 5GT3B 2RVQC 3NQUB 2W8SA 5JA4A 1N1JB 3NQJB 4H9NB 5DNMA 3RELA 4J8UB 2NZDD 5CPJC 1P34B 2HIOC 1HQ3A 4LD9D 4J8WA 3KUYA 2Y2LA 1P3MB 2FJ7D 1ZLAD 2JE5A 3AV1C 1F66B 3B6FD 2YFVB 5F99C 5E5AC 3AZFD 4UUZB 1P3ID 2F8ND 4J8VA 5CPJB 5AV6C 2HIOB 2F8NK 4XZQD 4X23D 3LJAA 5BO0A 3REKD 1KX3D 5AVBD 3KXBA 3AZKD 3AZIC 3H0RC 4UPKA 3AV2A 4JJND 3AV1B 1P3FA 2Y2HA 4H9OB 5F99B 5E5AB 4WU8A 3AL0C 4XUJD 5BNVA 2NZDC 5AV6B 1P3BB 3MGSA 2CV5D 4LD9C 3UTAD 5B24A 3AZIB 2FJ7C 2AROC 4WNNA 1ZLAC 1TAFB 3MGRA 3B6FC 5AY8C 3WTPC 4R8PC 2XD1A 3RELD 3AZFC 2NZDB 1P3IC 3P5JB 3H0MC 1HQ3D 4XZQC 2Y2JA 4E44A 4X23C 3MGPC 4J8WD 2F8NG 3H0LC 5AVBC 4NE3A 2FJ7B 4WZSB 1M18A 1ZLAB 4JJNC 4KUDD 2VQRA 3B6FB 4ZUXC 3AYWD 5GXQD 5B31C 3WA9D 5B1MA 4XUJC 3AZFB 1P3IB 4J8VD 2F8NB 5CPIA 5B31G 1BH9A 1S32A 4X23B 3LJAD 3REKB 1KX3B 5AVBB 3UTAC 3AZKB 4YS3A 3REHA 4JJNB 5CPKD 1U35A 4WU8D 1WWSA 4H9PB 1P3PC 4XUJB 4KHAB 1EQZD 5BS7A 5BT1C 5AVCC 2CV5B 1KX4D 3AZJB 3B0DC 5B24D 3UTAB 1B6WA 3MGRD 5BNXB 4KUDC 3UTBA 1R4VA 3AYWC 1TZYD 3VH6T 5JA4B 5GXQC 3AZLA 3WA9C 5CP6D 3RELB 4Z66C 1HQ3B 1P3KA 1P3LA 4J8WB 3W97A 3B0DB 5B2IA 2NQBA 5G49A 1M18D 4KUDB 4CSRA 4J8XC 5B0YA 5CPKC 3AYWB 5GXQB 3MNNA 1P3AC 3WA9B 2L5AA 1EQZC 1A7WA 5JRGA 2BYKA 2F2AC 2IO5C 4J8VB 3B6GC 1F66D 1KX4C 3LJAB 5BO0B 3X1TD 3REJA 4YS3D 4DQYB 2HUEC 1M19C 3AZMA 2Y2KA 3AZGD 4H9RA 1AOIA 3MGRC 3WKJD 1U35D 5CPKB 4KGCA 4WU8B 1TZYC 3A6NC 5CP6C 1EQZB 5B32A 3W98C 4WU9A 1KX4B 1ULYA 5B24B 3UT9A 1KX5A 2BYMA 4WNNB 1M18C 1P34C 5AV8A 3MGRB 1TZYB 2Y2NA 5GSUA 4HGAB 4ZBJC 3VH6A 1F66C 3B0BA 1P3KD 5AV9A 3X1TC 1P3LD 3W97D 2DF4C 5B2ID 1JFIB 2NQBD 2LY8A 4DRBA 1M18B 3AZGC 3WKJC 4QLCD 5B0YD 1U35C 4Z2MH 3X1VD 3VH6W 3MNND 5B33D 5JRGD 5B40A 1M1AA 4CAYA 4ZBJB 4G91B 1BH9B 2PYOA 3X1TB 4YS3B 3AZMD 3AZGB 1P3BC 1H3OA 1AOID 3WAAA 5GT0A 3WKJB 4KGCD 3C1CA 1U35B 5B1LA 4YM6A 2UWXA 3V9RB 4WU9D 4Z5TA 3KWQA 1P3KC 1P3LC 5B0ZA 3W97C 4NFTA 5DNND 5B2IC 3AZED 1KX5D 1BFMA 5C3IC 3REID 5AV8D 1T3UA 4H9QA 3LELA 4QLCC 5B0YC 3LZ0D 3X1VC 3AZJD 5AV5D 5B33C 5JRGC 3EPKA 3KFUG 1P3KB 5AV9D 1P3LB 5B2JA 5DNMD 3W97B 5B2IB 2NQBB 5C3IB 3W99A 1Q9CA 1AOIC 4H9SC 3X1SA 5B0YB 4QLCB 3X1VB 3REKC 1KX3C 3MNNB 3KUYD 5B33B 3AZKC 5JRGB 2BYKB 1M1AD 3TU4A 3W96A 2PYOD 5DNNC 3AZEC 2YFWB 3AZMB 1KX5C 4H9RB 3REIC 1AOIB 3WAAD 1PZRA 5GT0D 2CV5C 3C1CD 2DQNC 3FDDA 3LZ0C 4KGCB 5B1LD 4AWLB 4YM6D 3AZJC 3KXBD 5AV5C 2F8NH 3MVDA 3AV2D 1P3FD 4WU9B 5B0ZD 3NQUA 5DNMC 3RELC 5DNNB 3VH5T 3AZEB 1KX5B 2BYMB 1P3GA 4J8UA 3REIB 5AV8B 3LELD 3MGSD 5FUGB 1HQ3C 3LZ0B 3R45B 4J8WC 3KUYC 2JSSA 5AV5B 2XD5A 3O62A 4WJ3C 2PYOC 5AV9B 4E45A 3AZNA 5DNMB 4J8VC 3C1CC 2HIOA 3LJAC 2Y2GA 4YM6C 3KUYB 3KXBC 5B40B 1M1AB 4CAYB 3AV2C 1P3FC 2Y2IA 3AV1A 2PYOB 4WU8C 4H9OA 5F99A 5B1MD 5E5AA 3X1UA 5CPID 3MGQA 2JCHA 1H3OB 3MGSC 1S32D 3WAAB 5GT0B 3C1CB 5B1LB 4YM6B 5B24C 3KXBB 3MVDD 3AZIA 3REHD 3AV2B 1P3FB 3C1BA 5B0ZB 5BNVB 4HGAC 1P3GD 2NZDA 3MGSB 3LELB 2ZY4A 3AZHA 3VH5A 4LD9A 3O62D 2FJ7A 2AROA 3B0CW 1ZLAA 3UTBD 3B6FA 5AY8A 3WTPA 3AZLD 4R8PA 5B1MC 2G5HC 3AZND 3VH5W 3AZFA 5CPIC 1P3IA 2F8NA 4G91C 1S32C 4XZQA 4X23A 3MGPA 4YS3C 2CWEA 5AVBA 3REHC 3W96B 2BG1A 4JJNA 4ZUXA 3X1UD 5B1MB 5B31A 4XUJA 5BS7C 4KHAA 2Y2OA 3MGQD 5CPIB 1S32B 3EG5B 3REJD 3MVDB 3UTAA 2Y2PA 3O62C 3REHB 1P3OA 1ID3A 3UTBC 3C1BD 2FFFB 2Y2QA 4DRAA 3AZLC 3AZNC 1P3PA 5B32D 1P3GB 3F6TA 3KSYA 3AZHD 5AVCA 3UT9D 2NQBC 3O62B 2AROD 1W2EA 3UTBB 4KUDA 5AY8D 3WTPD 1HTAA 3X1UC 5GSUD 4R8PD 3MNNC 5GXQA 3AYWA 3AZLB 3AZNB 3WA9A 1KU5A 2ZM5A 3MGQC 1BH8A 4Z66A 3MGPD 3REJC 3AZMC 5G49B 2J8PA 4CSRB 3C1BC 1WWIA 4ZUXD 4KGCC 4J8XA 4AWLC 3X1UB 5CPKA 5B31D 5B40D 5B32C 3LZ1A 1P3AA 1EQZA 3AN2A 3MGQB 3B6GA 4WU9C 5B32G 3AZHC 2Y2MA 1KX4A 3REJB 3UT9C 5KDMA 3AFAA 1M19A 1P3OD 1ID3D 5AV8C 3C1BB 5GSUC 1TZYA 3A6NA 1P3PD 5B32B 5CP6A 5BT1D 3W98A 3B0CT 3EPJA 4Z5TD 5GT3A 5AVCD 3KWQD 3AZHB 5AV9C 4G92C 4LD9B 3UT9B 1N1JA 3NQJA 4H9NA 1JFIA 2AROB 2ZY2A 3IP4C 1P34A 3WTPB 5AY8B 1Z2CB 4R8PB 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 C;  1M1A C;  1P3M A;  1F66 A;  4Z66 D;  2YFV A;  4XZQ B;  5B2J D;  3MGP B;  4G92 B;  3X1T A;  4UUZ A;  1P3O C;  3W99 D;  1ID3 C;  5CPJ A;  3X1S D;  3WAA C;  5GT0 C;  3AZG A;  4ZUX B;  4J8X D;  3WKJ A;  5B1L C;  5B31 B;  1P3A D;  3LZ1 D;  3AN2 D;  3B6G D;  3TU4 D;  3W96 D;  3V9R A;  4Z5T C;  5CHL B;  3KWQ C;  5B0Z C;  3AFA D;  4EO5 C;  1M19 D;  1P3O B;  1ID3 B;  3LEL C;  5AV6 A;  1P3B A;  3A6N D;  1P3P B;  3W98 D;  1TAF A;  5GT3 D;  4Z5T B;  5AVC B;  3KWQ B;  4WV4 B;  5B2J C;  4EO5 B;  4J8U D;  3W99 C;  4H9Q B;  1P34 D;  3X1S C;  4QLC A;  3X1V A;  4NE5 A;  1B67 A;  3LZ1 C;  5B33 A;  1P3M D;  3AN2 C;  3TU4 C;  1BH8 B;  3W96 C;  2RVQ D;  4M6B A;  4Z66 B;  5B2J B;  3AFA C;  2YFW A;  3W99 B;  5CPJ D;  3X1S B;  2HIO D;  4H9S A;  1F1E A;  4J8X B;  3REK A;  1KX3 A;  1P3A B;  3LZ1 B;  3MVD C;  3AZK A;  3AN2 B;  3B6G B;  2IO5 B;  3TU4 B;  3AV1 D;  5GT3 C;  3WTP E;  5F99 D;  5E5A D;  4H9P A;  5KDM B;  3AFA B;  4NE6 A;  2HUE B;  5DNN A;  4J8U C;  3AZE A;  1P3G C;  1M19 B;  5AV6 D;  3REI A;  1P3B D;  4Z2M G;  5FUG A;  2CV5 A;  3LZ0 A;  3A6N B;  3R45 A;  3AZJ A;  5CP6 B;  5AV5 A;  3AZI D;  1P3M C;  3W98 B;  5BNX A;  5GT3 B;  2RVQ C;  3NQU B;  5JA4 A;  3NQJ B;  4H9N B;  1N1J B;  5DNM A;  3REL A;  4J8U B;  2NZD D;  5CPJ C;  1P34 B;  2HIO C;  1HQ3 A;  4LD9 D;  4J8W A;  3KUY A;  1P3M B;  2FJ7 D;  1ZLA D;  3AV1 C;  1F66 B;  3B6F D;  2YFV B;  5F99 C;  5E5A C;  3AZF D;  4UUZ B;  1P3I D;  2F8N D;  4J8V A;  5CPJ B;  5AV6 C;  2HIO B;  2F8N K;  4XZQ D;  4X23 D;  3LJA A;  5BO0 A;  3REK D;  1KX3 D;  5AVB D;  3KXB A;  3AZK D;  3AZI C;  3AV2 A;  1P3F A;  4JJN D;  3AV1 B;  5F99 B;  4H9O B;  5E5A B;  4WU8 A;  4XUJ D;  5BNV A;  2NZD C;  5AV6 B;  1P3B B;  3MGS A;  2CV5 D;  4LD9 C;  3UTA D;  5B24 A;  3AZI B;  2FJ7 C;  2ARO C;  4WNN A;  1ZLA C;  1TAF B;  3MGR A;  3B6F C;  5AY8 C;  3WTP C;  4R8P C;  3REL D;  3AZF C;  2NZD B;  1P3I C;  1HQ3 D;  4XZQ C;  4E44 A;  4X23 C;  3MGP C;  2F8N G;  4J8W D;  5AVB C;  4NE3 A;  2FJ7 B;  4WZS B;  1M18 A;  1ZLA B;  4JJN C;  4KUD D;  3B6F B;  4ZUX C;  3AYW D;  5GXQ D;  5B31 C;  3WA9 D;  5B1M A;  4XUJ C;  3AZF B;  1P3I B;  4J8V D;  2F8N B;  5CPI A;  5B31 G;  1BH9 A;  1S32 A;  4X23 B;  3LJA D;  3REK B;  1KX3 B;  5AVB B;  3UTA C;  3AZK B;  4YS3 A;  3REH A;  4JJN B;  5CPK D;  1U35 A;  4WU8 D;  1WWS A;  4H9P B;  1P3P C;  4XUJ B;  4KHA B;  1EQZ D;  5BS7 A;  5BT1 C;  5AVC C;  2CV5 B;  1KX4 D;  3AZJ B;  3B0D C;  5B24 D;  3UTA B;  1B6W A;  3MGR D;  5BNX B;  4KUD C;  3UTB A;  1R4V A;  3AYW C;  1TZY D;  3VH6 T;  5JA4 B;  5GXQ C;  3AZL A;  3WA9 C;  5CP6 D;  3REL B;  4Z66 C;  1HQ3 B;  1P3K A;  1P3L A;  4J8W B;  3W97 A;  3B0D B;  5B2I A;  2NQB A;  5G49 A;  1M18 D;  4KUD B;  4CSR A;  4J8X C;  5B0Y A;  5CPK C;  3AYW B;  5GXQ B;  3MNN A;  1P3A C;  3WA9 B;  2L5A A;  1EQZ C;  1A7W A;  5JRG A;  2BYK A;  2IO5 C;  4J8V B;  3B6G C;  1F66 D;  1KX4 C;  3LJA B;  5BO0 B;  3X1T D;  3REJ A;  4YS3 D;  2HUE C;  1M19 C;  3AZM A;  3AZG D;  4H9R A;  1AOI A;  3MGR C;  3WKJ D;  1U35 D;  5CPK B;  4KGC A;  4WU8 B;  1TZY C;  3A6N C;  5CP6 C;  1EQZ B;  5B32 A;  3W98 C;  4WU9 A;  1KX4 B;  1ULY A;  5B24 B;  3UT9 A;  1KX5 A;  2BYM A;  4WNN B;  1M18 C;  1P34 C;  5AV8 A;  3MGR B;  1TZY B;  5GSU A;  4HGA B;  4ZBJ C;  3VH6 A;  1F66 C;  3B0B A;  1P3K D;  5AV9 A;  3X1T C;  1P3L D;  3W97 D;  5B2I D;  1JFI B;  2NQB D;  2LY8 A;  4DRB A;  1M18 B;  3AZG C;  3WKJ C;  4QLC D;  5B0Y D;  1U35 C;  4Z2M H;  3X1V D;  3VH6 W;  3MNN D;  5B33 D;  5JRG D;  5B40 A;  1M1A A;  4CAY A;  4ZBJ B;  4G91 B;  1BH9 B;  2PYO A;  3X1T B;  4YS3 B;  3AZM D;  3AZG B;  1P3B C;  1H3O A;  1AOI D;  3WAA A;  5GT0 A;  3WKJ B;  4KGC D;  3C1C A;  1U35 B;  5B1L A;  4YM6 A;  3V9R B;  4WU9 D;  4Z5T A;  3KWQ A;  1P3K C;  1P3L C;  5B0Z A;  3W97 C;  4NFT A;  5DNN D;  5B2I C;  3AZE D;  1KX5 D;  1BFM A;  5C3I C;  3REI D;  5AV8 D;  4H9Q A;  3LEL A;  4QLC C;  5B0Y C;  3LZ0 D;  3X1V C;  3AZJ D;  5AV5 D;  5B33 C;  5JRG C;  1P3K B;  5AV9 D;  1P3L B;  5B2J A;  5DNM D;  3W97 B;  5B2I B;  2NQB B;  5C3I B;  3W99 A;  1Q9C A;  1AOI C;  4H9S C;  3X1S A;  5B0Y B;  4QLC B;  3X1V B;  3REK C;  1KX3 C;  3MNN B;  3KUY D;  5B33 B;  3AZK C;  5JRG B;  2BYK B;  1M1A D;  3TU4 A;  3W96 A;  2PYO D;  5DNN C;  3AZE C;  2YFW B;  3AZM B;  1KX5 C;  4H9R B;  3REI C;  1AOI B;  3WAA D;  5GT0 D;  2CV5 C;  3C1C D;  4KGC B;  3LZ0 C;  5B1L D;  4AWL B;  4YM6 D;  3AZJ C;  3KXB D;  5AV5 C;  2F8N H;  3MVD A;  3AV2 D;  1P3F D;  4WU9 B;  5B0Z D;  3NQU A;  5DNM C;  3REL C;  5DNN B;  3VH5 T;  3AZE B;  1KX5 B;  2BYM B;  1P3G A;  4J8U A;  3REI B;  5AV8 B;  3LEL D;  3MGS D;  5FUG B;  1HQ3 C;  3LZ0 B;  3R45 B;  4J8W C;  3KUY C;  2JSS A;  5AV5 B;  3O62 A;  2PYO C;  5AV9 B;  4E45 A;  3AZN A;  5DNM B;  4J8V C;  3C1C C;  2HIO A;  3LJA C;  4YM6 C;  3KUY B;  3KXB C;  5B40 B;  1M1A B;  4CAY B;  3AV2 C;  1P3F C;  3AV1 A;  2PYO B;  4WU8 C;  4H9O A;  5F99 A;  5B1M D;  5E5A A;  3X1U A;  5CPI D;  3MGQ A;  1H3O B;  3MGS C;  1S32 D;  3WAA B;  5GT0 B;  3C1C B;  5B1L B;  4YM6 B;  5B24 C;  3KXB B;  3MVD D;  3AZI A;  3REH D;  3AV2 B;  1P3F B;  3C1B A;  5B0Z B;  5BNV B;  4HGA C;  1P3G D;  2NZD A;  3MGS B;  3LEL B;  3AZH A;  3VH5 A;  4LD9 A;  3O62 D;  2FJ7 A;  2ARO A;  3B0C W;  1ZLA A;  3UTB D;  3B6F A;  5AY8 A;  3WTP A;  3AZL D;  4R8P A;  5B1M C;  3AZN D;  3VH5 W;  3AZF A;  5CPI C;  1P3I A;  2F8N A;  4G91 C;  1S32 C;  4XZQ A;  4X23 A;  3MGP A;  4YS3 C;  2CWE A;  5AVB A;  3REH C;  3W96 B;  4JJN A;  4ZUX A;  3X1U D;  5B1M B;  5B31 A;  4XUJ A;  5BS7 C;  4KHA A;  5CPI B;  3MGQ D;  1S32 B;  3REJ D;  3MVD B;  3UTA A;  3O62 C;  3REH B;  1P3O A;  1ID3 A;  3UTB C;  3C1B D;  4DRA A;  3AZL C;  3AZN C;  1P3P A;  5B32 D;  1P3G B;  3KSY A;  3AZH D;  5AVC A;  3UT9 D;  2NQB C;  3O62 B;  2ARO D;  3UTB B;  4KUD A;  3WTP D;  5AY8 D;  1HTA A;  3X1U C;  5GSU D;  4R8P D;  3MNN C;  5GXQ A;  3AYW A;  3AZL B;  3AZN B;  3WA9 A;  1KU5 A;  3MGQ C;  1BH8 A;  4Z66 A;  3MGP D;  3REJ C;  3AZM C;  5G49 B;  4CSR B;  3C1B C;  1WWI A;  4ZUX D;  4KGC C;  4J8X A;  4AWL C;  3X1U B;  5CPK A;  5B31 D;  5B40 D;  5B32 C;  3LZ1 A;  1P3A A;  1EQZ A;  3AN2 A;  3MGQ B;  3B6G A;  4WU9 C;  5B32 G;  3AZH C;  1KX4 A;  3REJ B;  3UT9 C;  5KDM A;  3AFA A;  1M19 A;  1P3O D;  1ID3 D;  5AV8 C;  3C1B B;  5GSU C;  1TZY A;  3A6N A;  1P3P D;  5B32 B;  5CP6 A;  5BT1 D;  3W98 A;  3B0C T;  4Z5T D;  5GT3 A;  5AVC D;  3KWQ D;  3AZH B;  5AV9 C;  4G92 C;  4LD9 B;  3UT9 B;  1N1J A;  3NQJ A;  4H9N A;  1JFI A;  2ARO B;  1P34 A;  3WTP B;  5AY8 B;  4R8P B;  5GSU B; 
#chains in the Genus database with same CATH topology
 5B40 C;  1M1A C;  1P3M A;  1F66 A;  4Z66 D;  2YFV A;  4XZQ B;  5B2J D;  3MGP B;  4G92 B;  3X1T A;  4UUZ A;  1P3O C;  3W99 D;  1ID3 C;  5CPJ A;  3X1S D;  3WAA C;  5GT0 C;  3AZG A;  4ZUX B;  4J8X D;  3WKJ A;  5B1L C;  5B31 B;  1P3A D;  3LZ1 D;  3AN2 D;  3B6G D;  3TU4 D;  3W96 D;  3V9R A;  4Z5T C;  5CHL B;  3KWQ C;  5B0Z C;  3AFA D;  3A1K A;  4EO5 C;  1M19 D;  1P3O B;  1ID3 B;  3LEL C;  5AV6 A;  1P3B A;  2ZY5 A;  3A6N D;  1P3P B;  3W98 D;  1TAF A;  2RIQ A;  5GT3 D;  4Z5T B;  5AVC B;  3KWQ B;  4WV4 B;  5B2J C;  4EO5 B;  4J8U D;  3W99 C;  4H9Q B;  1P34 D;  3X1S C;  4QLC A;  3X1V A;  4NE5 A;  1B67 A;  3LZ1 C;  5B33 A;  1P3M D;  3AN2 C;  3TU4 C;  1BH8 B;  3W96 C;  2RVQ D;  4M6B A;  4Z66 B;  5B2J B;  3AFA C;  3EPH A;  2YFW A;  3W99 B;  5CPJ D;  3X1S B;  2HIO D;  4H9S A;  1F1E A;  4J8X B;  3REK A;  1KX3 A;  1P3A B;  3A1I A;  3LZ1 B;  3MVD C;  3AZK A;  3AN2 B;  3B6G B;  2IO5 B;  3TU4 B;  3AV1 D;  5GT3 C;  3WTP E;  5F99 D;  5E5A D;  2ZY3 A;  4H9P A;  5KDM B;  3AFA B;  4NE6 A;  2HUE B;  5DNN A;  4J8U C;  3AZE A;  1P3G C;  1M19 B;  5AV6 D;  3REI A;  1P3B D;  2G5I C;  4Z2M G;  5FUG A;  2CV5 A;  3EPL A;  3LZ0 A;  3A6N B;  3R45 A;  3AZJ A;  5CP6 B;  5AV5 A;  3AZI D;  1P3M C;  3W98 B;  5BNX A;  5GT3 B;  2RVQ C;  3NQU B;  2W8S A;  5JA4 A;  1N1J B;  3NQJ B;  4H9N B;  5DNM A;  3REL A;  4J8U B;  2NZD D;  5CPJ C;  1P34 B;  2HIO C;  1HQ3 A;  4LD9 D;  4J8W A;  3KUY A;  2Y2L A;  1P3M B;  2FJ7 D;  1ZLA D;  2JE5 A;  3AV1 C;  1F66 B;  3B6F D;  2YFV B;  5F99 C;  5E5A C;  3AZF D;  4UUZ B;  1P3I D;  2F8N D;  4J8V A;  5CPJ B;  5AV6 C;  2HIO B;  2F8N K;  4XZQ D;  4X23 D;  3LJA A;  5BO0 A;  3REK D;  1KX3 D;  5AVB D;  3KXB A;  3AZK D;  3AZI C;  3H0R C;  4UPK A;  3AV2 A;  4JJN D;  3AV1 B;  1P3F A;  2Y2H A;  4H9O B;  5F99 B;  5E5A B;  4WU8 A;  3AL0 C;  4XUJ D;  5BNV A;  2NZD C;  5AV6 B;  1P3B B;  3MGS A;  2CV5 D;  4LD9 C;  3UTA D;  5B24 A;  3AZI B;  2FJ7 C;  2ARO C;  4WNN A;  1ZLA C;  1TAF B;  3MGR A;  3B6F C;  5AY8 C;  3WTP C;  4R8P C;  2XD1 A;  3REL D;  3AZF C;  2NZD B;  1P3I C;  3P5J B;  3H0M C;  1HQ3 D;  4XZQ C;  2Y2J A;  4E44 A;  4X23 C;  3MGP C;  4J8W D;  2F8N G;  3H0L C;  5AVB C;  4NE3 A;  2FJ7 B;  4WZS B;  1M18 A;  1ZLA B;  4JJN C;  4KUD D;  2VQR A;  3B6F B;  4ZUX C;  3AYW D;  5GXQ D;  5B31 C;  3WA9 D;  5B1M A;  4XUJ C;  3AZF B;  1P3I B;  4J8V D;  2F8N B;  5CPI A;  5B31 G;  1BH9 A;  1S32 A;  4X23 B;  3LJA D;  3REK B;  1KX3 B;  5AVB B;  3UTA C;  3AZK B;  4YS3 A;  3REH A;  4JJN B;  5CPK D;  1U35 A;  4WU8 D;  1WWS A;  4H9P B;  1P3P C;  4XUJ B;  4KHA B;  1EQZ D;  5BS7 A;  5BT1 C;  5AVC C;  2CV5 B;  1KX4 D;  3AZJ B;  3B0D C;  5B24 D;  3UTA B;  1B6W A;  3MGR D;  5BNX B;  4KUD C;  3UTB A;  1R4V A;  3AYW C;  1TZY D;  3VH6 T;  5JA4 B;  5GXQ C;  3AZL A;  3WA9 C;  5CP6 D;  3REL B;  4Z66 C;  1HQ3 B;  1P3K A;  1P3L A;  4J8W B;  3W97 A;  3B0D B;  5B2I A;  2NQB A;  5G49 A;  1M18 D;  4KUD B;  4CSR A;  4J8X C;  5B0Y A;  5CPK C;  3AYW B;  5GXQ B;  3MNN A;  1P3A C;  3WA9 B;  2L5A A;  1EQZ C;  1A7W A;  5JRG A;  2BYK A;  2F2A C;  2IO5 C;  4J8V B;  3B6G C;  1F66 D;  1KX4 C;  3LJA B;  5BO0 B;  3X1T D;  3REJ A;  4YS3 D;  4DQY B;  2HUE C;  1M19 C;  3AZM A;  2Y2K A;  3AZG D;  4H9R A;  1AOI A;  3MGR C;  3WKJ D;  1U35 D;  5CPK B;  4KGC A;  4WU8 B;  1TZY C;  3A6N C;  5CP6 C;  1EQZ B;  5B32 A;  3W98 C;  4WU9 A;  1KX4 B;  1ULY A;  5B24 B;  3UT9 A;  1KX5 A;  2BYM A;  4WNN B;  1M18 C;  1P34 C;  5AV8 A;  3MGR B;  1TZY B;  2Y2N A;  5GSU A;  4HGA B;  4ZBJ C;  3VH6 A;  1F66 C;  3B0B A;  1P3K D;  5AV9 A;  3X1T C;  1P3L D;  3W97 D;  2DF4 C;  5B2I D;  1JFI B;  2NQB D;  2LY8 A;  4DRB A;  1M18 B;  3AZG C;  3WKJ C;  4QLC D;  5B0Y D;  1U35 C;  4Z2M H;  3X1V D;  3VH6 W;  3MNN D;  5B33 D;  5JRG D;  5B40 A;  1M1A A;  4CAY A;  4ZBJ B;  4G91 B;  1BH9 B;  2PYO A;  3X1T B;  4YS3 B;  3AZM D;  3AZG B;  1P3B C;  1H3O A;  1AOI D;  3WAA A;  5GT0 A;  3WKJ B;  4KGC D;  3C1C A;  1U35 B;  5B1L A;  4YM6 A;  2UWX A;  3V9R B;  4WU9 D;  4Z5T A;  3KWQ A;  1P3K C;  1P3L C;  5B0Z A;  3W97 C;  4NFT A;  5DNN D;  5B2I C;  3AZE D;  1KX5 D;  1BFM A;  5C3I C;  3REI D;  5AV8 D;  1T3U A;  4H9Q A;  3LEL A;  4QLC C;  5B0Y C;  3LZ0 D;  3X1V C;  3AZJ D;  5AV5 D;  5B33 C;  5JRG C;  3EPK A;  3KFU G;  1P3K B;  5AV9 D;  1P3L B;  5B2J A;  5DNM D;  3W97 B;  5B2I B;  2NQB B;  5C3I B;  3W99 A;  1Q9C A;  1AOI C;  4H9S C;  3X1S A;  5B0Y B;  4QLC B;  3X1V B;  3REK C;  1KX3 C;  3MNN B;  3KUY D;  5B33 B;  3AZK C;  5JRG B;  2BYK B;  1M1A D;  3TU4 A;  3W96 A;  2PYO D;  5DNN C;  3AZE C;  2YFW B;  3AZM B;  1KX5 C;  4H9R B;  3REI C;  1AOI B;  3WAA D;  1PZR A;  5GT0 D;  2CV5 C;  3C1C D;  2DQN C;  3FDD A;  3LZ0 C;  4KGC B;  5B1L D;  4AWL B;  4YM6 D;  3AZJ C;  3KXB D;  5AV5 C;  2F8N H;  3MVD A;  3AV2 D;  1P3F D;  4WU9 B;  5B0Z D;  3NQU A;  5DNM C;  3REL C;  5DNN B;  3VH5 T;  3AZE B;  1KX5 B;  2BYM B;  1P3G A;  4J8U A;  3REI B;  5AV8 B;  3LEL D;  3MGS D;  5FUG B;  1HQ3 C;  3LZ0 B;  3R45 B;  4J8W C;  3KUY C;  2JSS A;  5AV5 B;  2XD5 A;  3O62 A;  4WJ3 C;  2PYO C;  5AV9 B;  4E45 A;  3AZN A;  5DNM B;  4J8V C;  3C1C C;  2HIO A;  3LJA C;  2Y2G A;  4YM6 C;  3KUY B;  3KXB C;  5B40 B;  1M1A B;  4CAY B;  3AV2 C;  1P3F C;  2Y2I A;  3AV1 A;  2PYO B;  4WU8 C;  4H9O A;  5F99 A;  5B1M D;  5E5A A;  3X1U A;  5CPI D;  3MGQ A;  2JCH A;  1H3O B;  3MGS C;  1S32 D;  3WAA B;  5GT0 B;  3C1C B;  5B1L B;  4YM6 B;  5B24 C;  3KXB B;  3MVD D;  3AZI A;  3REH D;  3AV2 B;  1P3F B;  3C1B A;  5B0Z B;  5BNV B;  4HGA C;  1P3G D;  2NZD A;  3MGS B;  3LEL B;  2ZY4 A;  3AZH A;  3VH5 A;  4LD9 A;  3O62 D;  2FJ7 A;  2ARO A;  3B0C W;  1ZLA A;  3UTB D;  3B6F A;  5AY8 A;  3WTP A;  3AZL D;  4R8P A;  5B1M C;  2G5H C;  3AZN D;  3VH5 W;  3AZF A;  5CPI C;  1P3I A;  2F8N A;  4G91 C;  1S32 C;  4XZQ A;  4X23 A;  3MGP A;  4YS3 C;  2CWE A;  5AVB A;  3REH C;  3W96 B;  2BG1 A;  4JJN A;  4ZUX A;  3X1U D;  5B1M B;  5B31 A;  4XUJ A;  5BS7 C;  4KHA A;  2Y2O A;  3MGQ D;  5CPI B;  1S32 B;  3EG5 B;  3REJ D;  3MVD B;  3UTA A;  2Y2P A;  3O62 C;  3REH B;  1P3O A;  1ID3 A;  3UTB C;  3C1B D;  2FFF B;  2Y2Q A;  4DRA A;  3AZL C;  3AZN C;  1P3P A;  5B32 D;  1P3G B;  3F6T A;  3KSY A;  3AZH D;  5AVC A;  3UT9 D;  2NQB C;  3O62 B;  2ARO D;  1W2E A;  3UTB B;  4KUD A;  5AY8 D;  3WTP D;  1HTA A;  3X1U C;  5GSU D;  4R8P D;  3MNN C;  5GXQ A;  3AYW A;  3AZL B;  3AZN B;  3WA9 A;  1KU5 A;  2ZM5 A;  3MGQ C;  1BH8 A;  4Z66 A;  3MGP D;  3REJ C;  3AZM C;  5G49 B;  2J8P A;  4CSR B;  3C1B C;  1WWI A;  4ZUX D;  4KGC C;  4J8X A;  4AWL C;  3X1U B;  5CPK A;  5B31 D;  5B40 D;  5B32 C;  3LZ1 A;  1P3A A;  1EQZ A;  3AN2 A;  3MGQ B;  3B6G A;  4WU9 C;  5B32 G;  3AZH C;  2Y2M A;  1KX4 A;  3REJ B;  3UT9 C;  5KDM A;  3AFA A;  1M19 A;  1P3O D;  1ID3 D;  5AV8 C;  3C1B B;  5GSU C;  1TZY A;  3A6N A;  1P3P D;  5B32 B;  5CP6 A;  5BT1 D;  3W98 A;  3B0C T;  3EPJ A;  4Z5T D;  5GT3 A;  5AVC D;  3KWQ D;  3AZH B;  5AV9 C;  4G92 C;  4LD9 B;  3UT9 B;  1N1J A;  3NQJ A;  4H9N A;  1JFI A;  2ARO B;  2ZY2 A;  3IP4 C;  1P34 A;  3WTP B;  5AY8 B;  1Z2C B;  4R8P B;  5GSU B; 
#chains in the Genus database with same CATH homology
 5B40 C;  1M1A C;  1P3M A;  1F66 A;  4Z66 D;  2YFV A;  4XZQ B;  5B2J D;  3MGP B;  4G92 B;  3X1T A;  4UUZ A;  1P3O C;  3W99 D;  1ID3 C;  5CPJ A;  3X1S D;  3WAA C;  5GT0 C;  3AZG A;  4ZUX B;  4J8X D;  3WKJ A;  5B1L C;  5B31 B;  1P3A D;  3LZ1 D;  3AN2 D;  3B6G D;  3TU4 D;  3W96 D;  3V9R A;  4Z5T C;  5CHL B;  3KWQ C;  5B0Z C;  3AFA D;  3A1K A;  4EO5 C;  1M19 D;  1P3O B;  1ID3 B;  3LEL C;  5AV6 A;  1P3B A;  2ZY5 A;  3A6N D;  1P3P B;  3W98 D;  1TAF A;  2RIQ A;  5GT3 D;  4Z5T B;  5AVC B;  3KWQ B;  4WV4 B;  5B2J C;  4EO5 B;  4J8U D;  3W99 C;  4H9Q B;  1P34 D;  3X1S C;  4QLC A;  3X1V A;  4NE5 A;  1B67 A;  3LZ1 C;  5B33 A;  1P3M D;  3AN2 C;  3TU4 C;  1BH8 B;  3W96 C;  2RVQ D;  4M6B A;  4Z66 B;  5B2J B;  3AFA C;  3EPH A;  2YFW A;  3W99 B;  5CPJ D;  3X1S B;  2HIO D;  4H9S A;  1F1E A;  4J8X B;  3REK A;  1KX3 A;  1P3A B;  3A1I A;  3LZ1 B;  3MVD C;  3AZK A;  3AN2 B;  3B6G B;  2IO5 B;  3TU4 B;  3AV1 D;  5GT3 C;  3WTP E;  5F99 D;  5E5A D;  2ZY3 A;  4H9P A;  5KDM B;  3AFA B;  4NE6 A;  2HUE B;  5DNN A;  4J8U C;  3AZE A;  1P3G C;  1M19 B;  5AV6 D;  3REI A;  1P3B D;  2G5I C;  4Z2M G;  5FUG A;  2CV5 A;  3EPL A;  3LZ0 A;  3A6N B;  3R45 A;  3AZJ A;  5CP6 B;  5AV5 A;  3AZI D;  1P3M C;  3W98 B;  5BNX A;  5GT3 B;  2RVQ C;  3NQU B;  2W8S A;  5JA4 A;  1N1J B;  3NQJ B;  4H9N B;  5DNM A;  3REL A;  4J8U B;  2NZD D;  5CPJ C;  1P34 B;  2HIO C;  1HQ3 A;  4LD9 D;  4J8W A;  3KUY A;  2Y2L A;  1P3M B;  2FJ7 D;  1ZLA D;  2JE5 A;  3AV1 C;  1F66 B;  3B6F D;  2YFV B;  5F99 C;  5E5A C;  3AZF D;  4UUZ B;  1P3I D;  2F8N D;  4J8V A;  5CPJ B;  5AV6 C;  2HIO B;  2F8N K;  4XZQ D;  4X23 D;  3LJA A;  5BO0 A;  3REK D;  1KX3 D;  5AVB D;  3KXB A;  3AZK D;  3AZI C;  3H0R C;  4UPK A;  3AV2 A;  4JJN D;  3AV1 B;  1P3F A;  2Y2H A;  4H9O B;  5F99 B;  5E5A B;  4WU8 A;  3AL0 C;  4XUJ D;  5BNV A;  2NZD C;  5AV6 B;  1P3B B;  3MGS A;  2CV5 D;  4LD9 C;  3UTA D;  5B24 A;  3AZI B;  2FJ7 C;  2ARO C;  4WNN A;  1ZLA C;  1TAF B;  3MGR A;  3B6F C;  5AY8 C;  3WTP C;  4R8P C;  2XD1 A;  3REL D;  3AZF C;  2NZD B;  1P3I C;  3P5J B;  3H0M C;  1HQ3 D;  4XZQ C;  2Y2J A;  4E44 A;  4X23 C;  3MGP C;  4J8W D;  2F8N G;  3H0L C;  5AVB C;  4NE3 A;  2FJ7 B;  4WZS B;  1M18 A;  1ZLA B;  4JJN C;  4KUD D;  2VQR A;  3B6F B;  4ZUX C;  3AYW D;  5GXQ D;  5B31 C;  3WA9 D;  5B1M A;  4XUJ C;  3AZF B;  1P3I B;  4J8V D;  2F8N B;  5CPI A;  5B31 G;  1BH9 A;  1S32 A;  4X23 B;  3LJA D;  3REK B;  1KX3 B;  5AVB B;  3UTA C;  3AZK B;  4YS3 A;  3REH A;  4JJN B;  5CPK D;  1U35 A;  4WU8 D;  1WWS A;  4H9P B;  1P3P C;  4XUJ B;  4KHA B;  1EQZ D;  5BS7 A;  5BT1 C;  5AVC C;  2CV5 B;  1KX4 D;  3AZJ B;  3B0D C;  5B24 D;  3UTA B;  1B6W A;  3MGR D;  5BNX B;  4KUD C;  3UTB A;  1R4V A;  3AYW C;  1TZY D;  3VH6 T;  5JA4 B;  5GXQ C;  3AZL A;  3WA9 C;  5CP6 D;  3REL B;  4Z66 C;  1HQ3 B;  1P3K A;  1P3L A;  4J8W B;  3W97 A;  3B0D B;  5B2I A;  2NQB A;  5G49 A;  1M18 D;  4KUD B;  4CSR A;  4J8X C;  5B0Y A;  5CPK C;  3AYW B;  5GXQ B;  3MNN A;  1P3A C;  3WA9 B;  2L5A A;  1EQZ C;  1A7W A;  5JRG A;  2BYK A;  2F2A C;  2IO5 C;  4J8V B;  3B6G C;  1F66 D;  1KX4 C;  3LJA B;  5BO0 B;  3X1T D;  3REJ A;  4YS3 D;  4DQY B;  2HUE C;  1M19 C;  3AZM A;  2Y2K A;  3AZG D;  4H9R A;  1AOI A;  3MGR C;  3WKJ D;  1U35 D;  5CPK B;  4KGC A;  4WU8 B;  1TZY C;  3A6N C;  5CP6 C;  1EQZ B;  5B32 A;  3W98 C;  4WU9 A;  1KX4 B;  1ULY A;  5B24 B;  3UT9 A;  1KX5 A;  2BYM A;  4WNN B;  1M18 C;  1P34 C;  5AV8 A;  3MGR B;  1TZY B;  2Y2N A;  5GSU A;  4HGA B;  4ZBJ C;  3VH6 A;  1F66 C;  3B0B A;  1P3K D;  5AV9 A;  3X1T C;  1P3L D;  3W97 D;  2DF4 C;  5B2I D;  1JFI B;  2NQB D;  2LY8 A;  4DRB A;  1M18 B;  3AZG C;  3WKJ C;  4QLC D;  5B0Y D;  1U35 C;  4Z2M H;  3X1V D;  3VH6 W;  3MNN D;  5B33 D;  5JRG D;  5B40 A;  1M1A A;  4CAY A;  4ZBJ B;  4G91 B;  1BH9 B;  2PYO A;  3X1T B;  4YS3 B;  3AZM D;  3AZG B;  1P3B C;  1H3O A;  1AOI D;  3WAA A;  5GT0 A;  3WKJ B;  4KGC D;  3C1C A;  1U35 B;  5B1L A;  4YM6 A;  2UWX A;  3V9R B;  4WU9 D;  4Z5T A;  3KWQ A;  1P3K C;  1P3L C;  5B0Z A;  3W97 C;  4NFT A;  5DNN D;  5B2I C;  3AZE D;  1KX5 D;  1BFM A;  5C3I C;  3REI D;  5AV8 D;  1T3U A;  4H9Q A;  3LEL A;  4QLC C;  5B0Y C;  3LZ0 D;  3X1V C;  3AZJ D;  5AV5 D;  5B33 C;  5JRG C;  3EPK A;  3KFU G;  1P3K B;  5AV9 D;  1P3L B;  5B2J A;  5DNM D;  3W97 B;  5B2I B;  2NQB B;  5C3I B;  3W99 A;  1Q9C A;  1AOI C;  4H9S C;  3X1S A;  5B0Y B;  4QLC B;  3X1V B;  3REK C;  1KX3 C;  3MNN B;  3KUY D;  5B33 B;  3AZK C;  5JRG B;  2BYK B;  1M1A D;  3TU4 A;  3W96 A;  2PYO D;  5DNN C;  3AZE C;  2YFW B;  3AZM B;  1KX5 C;  4H9R B;  3REI C;  1AOI B;  3WAA D;  1PZR A;  5GT0 D;  2CV5 C;  3C1C D;  2DQN C;  3FDD A;  3LZ0 C;  4KGC B;  5B1L D;  4AWL B;  4YM6 D;  3AZJ C;  3KXB D;  5AV5 C;  2F8N H;  3MVD A;  3AV2 D;  1P3F D;  4WU9 B;  5B0Z D;  3NQU A;  5DNM C;  3REL C;  5DNN B;  3VH5 T;  3AZE B;  1KX5 B;  2BYM B;  1P3G A;  4J8U A;  3REI B;  5AV8 B;  3LEL D;  3MGS D;  5FUG B;  1HQ3 C;  3LZ0 B;  3R45 B;  4J8W C;  3KUY C;  2JSS A;  5AV5 B;  2XD5 A;  3O62 A;  4WJ3 C;  2PYO C;  5AV9 B;  4E45 A;  3AZN A;  5DNM B;  4J8V C;  3C1C C;  2HIO A;  3LJA C;  2Y2G A;  4YM6 C;  3KUY B;  3KXB C;  5B40 B;  1M1A B;  4CAY B;  3AV2 C;  1P3F C;  2Y2I A;  3AV1 A;  2PYO B;  4WU8 C;  4H9O A;  5F99 A;  5B1M D;  5E5A A;  3X1U A;  5CPI D;  3MGQ A;  2JCH A;  1H3O B;  3MGS C;  1S32 D;  3WAA B;  5GT0 B;  3C1C B;  5B1L B;  4YM6 B;  5B24 C;  3KXB B;  3MVD D;  3AZI A;  3REH D;  3AV2 B;  1P3F B;  3C1B A;  5B0Z B;  5BNV B;  4HGA C;  1P3G D;  2NZD A;  3MGS B;  3LEL B;  2ZY4 A;  3AZH A;  3VH5 A;  4LD9 A;  3O62 D;  2FJ7 A;  2ARO A;  3B0C W;  1ZLA A;  3UTB D;  3B6F A;  5AY8 A;  3WTP A;  3AZL D;  4R8P A;  5B1M C;  2G5H C;  3AZN D;  3VH5 W;  3AZF A;  5CPI C;  1P3I A;  2F8N A;  4G91 C;  1S32 C;  4XZQ A;  4X23 A;  3MGP A;  4YS3 C;  2CWE A;  5AVB A;  3REH C;  3W96 B;  2BG1 A;  4JJN A;  4ZUX A;  3X1U D;  5B1M B;  5B31 A;  4XUJ A;  5BS7 C;  4KHA A;  2Y2O A;  3MGQ D;  5CPI B;  1S32 B;  3EG5 B;  3REJ D;  3MVD B;  3UTA A;  2Y2P A;  3O62 C;  3REH B;  1P3O A;  1ID3 A;  3UTB C;  3C1B D;  2FFF B;  2Y2Q A;  4DRA A;  3AZL C;  3AZN C;  1P3P A;  5B32 D;  1P3G B;  3F6T A;  3KSY A;  3AZH D;  5AVC A;  3UT9 D;  2NQB C;  3O62 B;  2ARO D;  1W2E A;  3UTB B;  4KUD A;  5AY8 D;  3WTP D;  1HTA A;  3X1U C;  5GSU D;  4R8P D;  3MNN C;  5GXQ A;  3AYW A;  3AZL B;  3AZN B;  3WA9 A;  1KU5 A;  2ZM5 A;  3MGQ C;  1BH8 A;  4Z66 A;  3MGP D;  3REJ C;  3AZM C;  5G49 B;  2J8P A;  4CSR B;  3C1B C;  1WWI A;  4ZUX D;  4KGC C;  4J8X A;  4AWL C;  3X1U B;  5CPK A;  5B31 D;  5B40 D;  5B32 C;  3LZ1 A;  1P3A A;  1EQZ A;  3AN2 A;  3MGQ B;  3B6G A;  4WU9 C;  5B32 G;  3AZH C;  2Y2M A;  1KX4 A;  3REJ B;  3UT9 C;  5KDM A;  3AFA A;  1M19 A;  1P3O D;  1ID3 D;  5AV8 C;  3C1B B;  5GSU C;  1TZY A;  3A6N A;  1P3P D;  5B32 B;  5CP6 A;  5BT1 D;  3W98 A;  3B0C T;  3EPJ A;  4Z5T D;  5GT3 A;  5AVC D;  3KWQ D;  3AZH B;  5AV9 C;  4G92 C;  4LD9 B;  3UT9 B;  1N1J A;  3NQJ A;  4H9N A;  1JFI A;  2ARO B;  2ZY2 A;  3IP4 C;  1P34 A;  3WTP B;  5AY8 B;  1Z2C B;  4R8P B;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...