2F8NB

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nB00
3RELC 5B0ZB 3UT9D 3B6FB 2NZDA 3LZ1A 3AV2A 5F99B 1AOIB 3X1UB 4Z5TD 2CV5D 3B6GD 5B32B 5B33B 3WKJD 4H9RB 2HIOD 4JJNB 4G92C 1S32D 5AV6B 4XZQB 4R8PB 1ID3C 3LJAA 1M19B 3AZJD 1P3LB 1KX3D 4Z2MG 1KX5A 4UUZB 3KSYA 5AVBA 2FJ7D 3RELA 3X1SC 3MGSD 2AROC 5B2JA 1P3PA 1ULYA 4QLCB 4ZUXB 3LZ1D 3AV1B 5B1MC 2PYOB 3W99B 4CSRB 3KXBD 3B6FC 3VH5A 2LY8A 1R4VA 5AVCC 5F99C 1AOIC 3AZGC 3LELC 3X1UC 3LJAD 4J8XA 3X1SA 5AVBD 3RELD 5AV6C 4XZQC 3C1BB 4R8PC 1M19C 4G91C 5B1MA 1HQ3B 5CPKB 5B1LB 2F8NK 5B0ZA 3B6FA 5GT3B 5F99A 5CP6C 4ZUXC 1AOIA 5GSUB 3X1UA 3LELA 3AV1C 1ID3D 3AYWB 3AZLB 2PYOC 4KHAB 5B32A 5B33A 4H9RA 5B31C 4JJNA 5AV6A 4XZQA 1P3OB 3X1SD 4R8PA 2AROD 3VH6W 1M19A 1P3LA 3REIB 2IO5B 3NQJB 4UUZA 5B1MD 4XUJB 3B0DC 1EQZC 3B6FD 3C1BC 4QLCA 4ZUXA 3AV1A 5F99D 5AVCD 3KUYB 3REJC 3AZKB 5CPJC 1AOID 3AZGD 2PYOA 3W99A 3LELD 3X1UD 5CPKC 4CSRA 4J8WB 5BS7C 3MGPB 4NFTA 5GSUC 5AV6D 4XZQD 4R8PD 1M19D 3C1CB 1M1AB 3V9RB 5AV8B 5DNNC 3B0BA 4ZBJB 1P3OC 3C1BA 4NE5A 5CP6D 3REIC 2IO5C 5CPJA 5AY8B 4ZUXD 1BH9B 1P3AB 1HQ3A 5CPKA 5B1LA 3AV1D 1P3BB 4Z66B 2F8NA 5BS7A 3VH5T 5B31D 5GSUA 3AN2B 3KUYC 3AYWA 2RVQC 3AZKC 4KHAA 4WU9B 2HUEB 3MGPC 1P3KB 1P3OA 5FUGA 4KGCB 3REIA 3AZEB 1P3FB 3C1BD 3NQJA 1EQZB 3C1CC 1M1AC 1P34C 4XUJA 1B6WA 3REJD 5CPJD 5AV8C 4ZBJC 5CPKD 5E5AC 3AFAB 2F8ND 2NZDC 3KUYA 3AV2C 3AZKA 1P3BC 4NE3A 5GSUD 3B0CT 4H9SC 4Z66C 4J8WA 5B40D 3MGPA 5JA4B 5DNND 1TAFB 1P3OD 3AN2C 3C1CA 1M1AA 4WU9C 4AWLB 3REID 2HUEC 3V9RA 3R45B 5AV8A 1KX5C 1A7WA 3AZHC 1F66B 4KGCC 1BH8B 3MVDB 3AZEC 1P3FC 2NQBB 5B2IB 5AY8A 5B2JC 1BH9A 1P3AA 5B0YB 1P3BA 1N1JB 4H9SA 3A6NB 4Z66A 3KUYD 1P3PC 4LD9C 2RVQD 3AZKD 3REKB 3MGPD 3AN2A 4H9QB 4YS3B 4WU9A 5GT0B 3C1CD 1M1AD 1P34D 3AZHA 4J8XC 4KGCA 5AV8D 5E5AD 3AZEA 1P3FA 1EQZA 5G49B 2NZDD 4LD9A 3AV2D 1P3BD 4WNNB 5DNMB 4Z66D 3AFAA 5B0ZC 5B2IC 3W98B 3AN2D 3A6NC 5GXQB 4WU9D 5JA4A 5B32C 3REKC 3UTBB 5B33C 1KX5D 3AZHD 1TAFA 4H9NB 4JJNC 4KGCD 3NQUA 3AZED 1P3FD 4KUDB 1P3LC 5CHLB 3R45A 5B2JD 1P3PD 1EQZD 4LD9D 2BYKB 1F66A 2F8NH 1BH8A 3MVDA 3AZNB 2NQBA 3MGRB 3AZMB 1KX4B 5B2IA 3W97B 4QLCC 3A6NA 3MNNB 5DNMC 3TU4B 3W99C 3REKA 1WWIA 5B24B 4J8XD 4H9QA 4YS3A 4WU8B 3W98C 3VH6T 5GT0A 4J8UB 4WZSB 3UTBC 5B0ZD 5G49A 5B2ID 4WNNA 5DNMA 2YFWB 4H9OB 3AZFB 1HQ3C 5B1LC 1TZYB 5B32D 5GT3C 3REKD 5B33D 3MGQB 3AZMC 3X1TB 3W98A 3W97C 4JJND 5BT1C 5GXQA 4DRAA 3MNNC 3AYWC 3AZLC 1P3LD 3UTBA 4M6BA 3LZ0B 5B24C 4H9NA 4H9PB 3O62B 4WU8C 4KUDA 3UT9B 4EO5B 4QLCD 4J8UC 4XUJC 5DNMD 2PYOD 3W99D 5GT3A 3MGRA 3AZMA 1KX4A 3B6GB 3W97A 1P3MB 5BO0B 3MNNA 3W98D 3AZLA 3AZFC 1TZYC 5BNVB 4J8WC 5B24A 1ZLAB 3W96B 3UTBD 1P3GB 3X1TC 4WU8A 5JRGB 3MGSB 4J8UA 5BNXB 3LZ0C 1HQ3D 5B1LD 3O62C 5GT3D 3X1VB 3KXBB 3AZMD 3W97D 4WV4B 2YFWA 3REHB 5AY8C 1P3AC 4H9OA 3AZFA 1TZYA 3MNND 3AYWD 3AZLD 3MGQA 3UTAB 3X1TA 5B24D 1P3MC 4WU8D 3VH6A 1HTAA 3LZ0A 4J8UD 3W96C 1ZLAC 4H9PA 2L5AA 4XUJD 3O62A 1P3GC 1P3KC 5JRGC 4HGAB 4G92B 3AZFD 1ID3B 3B6GA 1TZYD 3AFAC 5KDMB 4J8WD 1P3MA 4YM6B 5BO0A 3X1VC 3X1TD 2CWEA 3REHC 2AROB 3W96A 1ZLAA 1P3KA 1P3GA 3LZ0D 3UTAC 5JRGA 3O62D 3MGSA 4AWLC 4Z2MH 5BNXA 1P3AD 5AY8D 5AVCB 5AV9B 2YFVB 3AZGB 1F66C 3LELB 3X1VA 3MVDC 4NE6A 3KXBA 1H3OB 2NQBC 4HGAC 1P3MD 3REHA 5B0YC 1B67A 4CAYB 4G91B 3UTAA 4YM6C 1ZLAD 1P3KD 3W96D 5CPIB 1P3GD 3WA9B 4YS3C 5JRGD 5B31G 2BYMB 5GT0C 1P3IB 5CP6B 3AFAD 5AV5B 3X1VD 5B0YA 1N1JA 5B31B 3REHD 1ID3A 5AV9C 5KDMA 4YM6A 3KWQB 3UTAD 4E45A 2F8NG 2AROA 3B0DB 5GXQC 1U35B 4X23B 3REJB 5CPJB 5CPIC 3WTPB 1F66D 3WA9C 3MVDD 3WAAB 2F8NB 2NQBD 4KUDC 5AVCA 1P3IC 5B0YD 5AV9A 3A6ND 1JFIB 2YFVA 3AZGA 3AZIB 3AZNC 1M18B 1H3OA 5B40B 3MGRC 4YM6D 1KX4C 5AV5C 5DNNB 4YS3D 3WTPE 5FUGB 4CAYA 3TU4C 5GT0D 4J8VB 3KWQC 5CPIA 3WA9A 2BYMA 1P3IA 5CP6A 2BYKA 1U35C 5AV9D 3AZNA 4X23C 4Z5TB 2CV5B 3WTPC 1F1EA 5AV5A 3WAAC 3WKJB 5B31A 1BFMA 2HIOB 3TU4A 1S32B 5GXQD 3AZJB 3KWQA 3AZIC 1KX3B 1M18C 5B40C 1P34B 3MGQC 2FJ7B 5CPID 3WA9D 5E5AB 5C3IB 4KUDD 1U35A 2NZDB 1P3ID 3LZ1B 4J8VC 3AV2B 4X23A 3REJA 3WTPA 3WAAA 3AZND 3VH5W 4E44A 3MGRD 3UT9C 1KX4D 4EO5C 5AV5D 1JFIA 5BT1D 3AZIA 3TU4D 1M18A 5B40A 4Z5TC 3LJAB 2CV5C 3B6GC 3KWQD 5DNNA 1KX5B 3WKJC 1Q9CA 5AVBB 2HIOC 3AZHB 4DRBA 3RELB 1S32C 1KU5A 4J8VA 3AZJC 5B2JB 1KX3C 1P3PB 1U35D 4LD9B 2FJ7C 4X23D 3WTPD 3UT9A 3MGSC 3WAAD 5C3IC 3LZ1C 3B0CW 4Z5TA 2CV5A 3AZID 1M18D 3WKJA 2JSSA 3MGQD 2HIOA 3KXBC 4J8XB 1S32A 3X1SB 3AZJA 5BNVA 1KX3A 3NQUB 1WWSA 3LJAC 4J8VD 1P34A 2FJ7A 5B1MB 5B32G 5E5AA 5AVBC
chains in the Genus database with same CATH superfamily
3RELC 5B0ZB 3UT9D 3B6FB 2NZDA 3LZ1A 3AV2A 5F99B 1AOIB 3X1UB 4Z5TD 2CV5D 3B6GD 5B32B 5B33B 3WKJD 4H9RB 3H0MC 2HIOD 4JJNB 4G92C 1S32D 5AV6B 4XZQB 4R8PB 1ID3C 3LJAA 1M19B 3AZJD 1P3LB 1KX3D 4Z2MG 1KX5A 4UUZB 3KSYA 5AVBA 2FJ7D 3RELA 3X1SC 3MGSD 2AROC 5B2JA 1P3PA 1ULYA 4QLCB 4ZUXB 3LZ1D 3AV1B 5B1MC 2VQRA 2PYOB 3W99B 4CSRB 3KXBD 3B6FC 3VH5A 2FFFB 2LY8A 1R4VA 5AVCC 5F99C 1AOIC 3AZGC 3LELC 3X1UC 3LJAD 2J8PA 4J8XA 3X1SA 2JCHA 5AVBD 3RELD 5AV6C 4XZQC 3C1BB 4R8PC 1M19C 4G91C 5B1MA 1HQ3B 5CPKB 5B1LB 2F8NK 5B0ZA 3B6FA 5GT3B 5F99A 5CP6C 4ZUXC 1AOIA 5GSUB 3X1UA 3LELA 3AV1C 1ID3D 3AYWB 3AZLB 2PYOC 4KHAB 5B32A 5B33A 4H9RA 5B31C 1W2EA 4JJNA 5AV6A 4XZQA 1P3OB 3X1SD 4R8PA 2AROD 3VH6W 1M19A 1P3LA 3REIB 2IO5B 3NQJB 4UUZA 5B1MD 4XUJB 3B0DC 1EQZC 3B6FD 3C1BC 4QLCA 4ZUXA 3AV1A 5F99D 5AVCD 3KUYB 3REJC 3AZKB 5CPJC 1AOID 3AZGD 2PYOA 3W99A 3LELD 3X1UD 5CPKC 4CSRA 4J8WB 5BS7C 3MGPB 4NFTA 2XD1A 5GSUC 5AV6D 4XZQD 4R8PD 2G5HC 1M19D 3C1CB 1M1AB 2W8SA 3V9RB 5AV8B 3B0BA 4ZBJB 5DNNC 1P3OC 3C1BA 3F6TA 2UWXA 4NE5A 5CP6D 3REIC 2IO5C 5CPJA 4ZUXD 5AY8B 1BH9B 2ZM5A 1HQ3A 5CPKA 5B1LA 3AV1D 2Y2LA 4Z66B 2F8NA 5BS7A 3VH5T 5B31D 5GSUA 3AN2B 2Y2HA 3KUYC 3AYWA 2RVQC 3AZKC 4KHAA 4WU9B 2HUEB 3MGPC 1P3KB 1P3OA 5FUGA 4KGCB 3FDDA 3REIA 3AZEB 1P3FB 3C1BD 3NQJA 1EQZB 2JE5A 3C1CC 1M1AC 3EPLA 1P34C 4XUJA 1B6WA 3REJD 5CPJD 5AV8C 4ZBJC 5CPKD 5E5AC 3AFAB 2F8ND 2F2AC 2NZDC 3KUYA 3AV2C 3AZKA 2XD5A 1P3BC 4NE3A 5GSUD 3B0CT 4H9SC 4Z66C 4J8WA 5B40D 3MGPA 5JA4B 5DNND 1TAFB 1P3OD 3AN2C 4UPKA 3C1CA 1M1AA 4WU9C 4AWLB 3REID 2HUEC 3V9RA 3R45B 5AV8A 1KX5C 1A7WA 3AZHC 1F66B 4KGCC 1BH8B 3MVDB 3AZEC 1P3FC 2NQBB 5B2IB 5AY8A 5B2JC 1BH9A 1P3AA 5B0YB 1P3BA 1N1JB 4H9SA 3A6NB 4Z66A 3KUYD 1P3PC 4LD9C 2RVQD 3AZKD 3REKB 3MGPD 2Y2IA 3AN2A 4H9QB 4YS3B 4WU9A 5GT0B 3C1CD 1M1AD 1P34D 3AZHA 4J8XC 4KGCA 5AV8D 5E5AD 3AZEA 1P3FA 3P5JB 1EQZA 5G49B 2NZDD 4LD9A 3AV2D 2Y2QA 1P3BD 4WNNB 5DNMB 3EPHA 4Z66D 3AFAA 5B0ZC 5B2IC 3W98B 3AN2D 3A6NC 5GXQB 4WU9D 5JA4A 5B32C 3REKC 3UTBB 5B33C 1KX5D 3AZHD 1TAFA 4H9NB 4JJNC 4KGCD 3NQUA 3AZED 1P3FD 2ZY4A 4KUDB 1P3LC 5CHLB 3R45A 5B2JD 1P3PD 1EQZD 4LD9D 2BYKB 1F66A 2F8NH 3IP4C 1BH8A 3AL0C 3MVDA 3AZNB 2NQBA 3MGRB 3AZMB 1KX4B 5B2IA 3W97B 4QLCC 3A6NA 3MNNB 5DNMC 3TU4B 3EPKA 3W99C 3REKA 1WWIA 5B24B 4J8XD 4H9QA 4YS3A 3EG5B 4WU8B 3W98C 3VH6T 5GT0A 4J8UB 4WJ3C 4WZSB 3UTBC 2DF4C 5B0ZD 5G49A 3EPJA 5B2ID 4WNNA 5DNMA 2YFWB 4H9OB 3AZFB 1HQ3C 2BG1A 5B1LC 1TZYB 5B32D 5GT3C 3REKD 5B33D 3MGQB 3AZMC 3X1TB 3W98A 3W97C 4JJND 5BT1C 5GXQA 4DRAA 3MNNC 3AYWC 3AZLC 3KFUG 1P3LD 3UTBA 4M6BA 2DQNC 3LZ0B 5B24C 4H9NA 4H9PB 3O62B 4WU8C 4KUDA 3UT9B 4EO5B 4QLCD 4J8UC 4XUJC 5DNMD 2PYOD 3W99D 5GT3A 3MGRA 3AZMA 1KX4A 3B6GB 3W97A 1P3MB 1P3BB 5BO0B 3MNNA 3W98D 3AZLA 3AZFC 1TZYC 5BNVB 4J8WC 5B24A 1ZLAB 3W96B 3UTBD 2Y2PA 1P3GB 3X1TC 4WU8A 5JRGB 3MGSB 4J8UA 5BNXB 3LZ0C 2Y2JA 1HQ3D 5B1LD 3O62C 1Z2CB 5GT3D 3X1VB 3KXBB 3AZMD 3W97D 4WV4B 2YFWA 3REHB 5AY8C 1P3AC 4H9OA 3AZFA 1TZYA 3MNND 3AYWD 3AZLD 3MGQA 3UTAB 3X1TA 5B24D 1P3MC 4WU8D 3VH6A 1HTAA 3LZ0A 4J8UD 3W96C 1ZLAC 4H9PA 2L5AA 4XUJD 3O62A 1P3GC 1P3KC 1T3UA 5JRGC 4HGAB 4G92B 3AZFD 1ID3B 3B6GA 1TZYD 3AFAC 5KDMB 4J8WD 1P3MA 3H0RC 5BO0A 4YM6B 3X1VC 3X1TD 2ZY3A 2CWEA 3REHC 2AROB 3W96A 1ZLAA 1P3KA 1P3GA 3LZ0D 3UTAC 3A1IA 5JRGA 3O62D 3MGSA 4AWLC 4Z2MH 2RIQA 5BNXA 1P3AD 5AY8D 5AVCB 5AV9B 2YFVB 3AZGB 1F66C 3LELB 3X1VA 3MVDC 4NE6A 3KXBA 1H3OB 2Y2NA 2NQBC 4HGAC 1P3MD 3REHA 5B0YC 1B67A 4CAYB 4G91B 3UTAA 4YM6C 1ZLAD 1P3KD 3W96D 2Y2KA 5CPIB 1P3GD 3WA9B 4YS3C 5JRGD 5B31G 2BYMB 5GT0C 1P3IB 5CP6B 2ZY2A 3AFAD 5AV5B 3X1VD 5B0YA 1N1JA 5B31B 3REHD 1ID3A 5AV9C 5KDMA 4YM6A 3KWQB 3UTAD 4E45A 2F8NG 2AROA 3B0DB 5GXQC 1U35B 4X23B 3REJB 5CPJB 5CPIC 3WTPB 1F66D 3WA9C 3MVDD 3WAAB 2F8NB 2NQBD 4KUDC 5AVCA 1P3IC 2Y2GA 5B0YD 5AV9A 3A6ND 1JFIB 2YFVA 3AZGA 3AZIB 3AZNC 1M18B 1H3OA 5B40B 3MGRC 4YM6D 1KX4C 5AV5C 5DNNB 4YS3D 3WTPE 5FUGB 4CAYA 3TU4C 1P3AB 5GT0D 4J8VB 3KWQC 5CPIA 3WA9A 3H0LC 2BYMA 1P3IA 5CP6A 2Y2MA 2BYKA 1U35C 5AV9D 3AZNA 4X23C 4Z5TB 2CV5B 3WTPC 1F1EA 5AV5A 3WAAC 3WKJB 5B31A 1BFMA 2HIOB 3TU4A 1S32B 5GXQD 3AZJB 3KWQA 3AZIC 1KX3B 1M18C 5B40C 1P34B 3MGQC 2FJ7B 5CPID 3WA9D 5E5AB 5C3IB 4KUDD 1U35A 2NZDB 1P3ID 3LZ1B 4J8VC 3AV2B 4X23A 3REJA 3WTPA 3WAAA 3AZND 3VH5W 2ZY5A 4E44A 3MGRD 3UT9C 4EO5C 1KX4D 5AV5D 1JFIA 5BT1D 3AZIA 3TU4D 1M18A 5B40A 4Z5TC 3LJAB 2CV5C 3B6GC 3KWQD 5DNNA 1KX5B 3WKJC 1Q9CA 2G5IC 2HIOC 5AVBB 3AZHB 4DRBA 3RELB 1S32C 1KU5A 4J8VA 3AZJC 5B2JB 1KX3C 1P3PB 1U35D 4LD9B 2FJ7C 4X23D 2Y2OA 3WTPD 3UT9A 3MGSC 3WAAD 5C3IC 3LZ1C 3A1KA 3B0CW 4Z5TA 2CV5A 3AZID 1M18D 3WKJA 2JSSA 3MGQD 2HIOA 3KXBC 4J8XB 1S32A 3X1SB 3AZJA 4DQYB 5BNVA 1KX3A 3NQUB 1WWSA 1PZRA 3LJAC 4J8VD 1P34A 2FJ7A 5B1MB 5B32G 5E5AA 5AVBC
chains in the Genus database with same CATH topology
3RELC 5B0ZB 3UT9D 3B6FB 2NZDA 3LZ1A 3AV2A 5F99B 1AOIB 3X1UB 4Z5TD 2CV5D 3B6GD 5B32B 5B33B 3WKJD 4H9RB 3H0MC 2HIOD 4JJNB 4G92C 1S32D 5AV6B 4XZQB 4R8PB 1ID3C 3LJAA 1M19B 3AZJD 1P3LB 1KX3D 4Z2MG 1KX5A 4UUZB 3KSYA 5AVBA 2FJ7D 3RELA 3X1SC 3MGSD 2AROC 5B2JA 1P3PA 1ULYA 4QLCB 4ZUXB 3LZ1D 3AV1B 5B1MC 2VQRA 2PYOB 3W99B 4CSRB 3KXBD 3B6FC 3VH5A 2FFFB 2LY8A 1R4VA 5AVCC 5F99C 1AOIC 3AZGC 3LELC 3X1UC 3LJAD 2J8PA 4J8XA 3X1SA 2JCHA 5AVBD 3RELD 5AV6C 4XZQC 3C1BB 4R8PC 1M19C 4G91C 5B1MA 1HQ3B 5CPKB 5B1LB 2F8NK 5B0ZA 3B6FA 5GT3B 5F99A 5CP6C 4ZUXC 1AOIA 5GSUB 3X1UA 3LELA 3AV1C 1ID3D 3AYWB 3AZLB 2PYOC 4KHAB 5B32A 5B33A 4H9RA 5B31C 1W2EA 4JJNA 5AV6A 4XZQA 1P3OB 3X1SD 4R8PA 2AROD 3VH6W 1M19A 1P3LA 3REIB 2IO5B 3NQJB 4UUZA 5B1MD 4XUJB 3B0DC 1EQZC 3B6FD 3C1BC 4QLCA 4ZUXA 3AV1A 5F99D 5AVCD 3KUYB 3REJC 3AZKB 5CPJC 1AOID 3AZGD 2PYOA 3W99A 3LELD 3X1UD 5CPKC 4CSRA 4J8WB 5BS7C 3MGPB 4NFTA 2XD1A 5GSUC 5AV6D 4XZQD 4R8PD 2G5HC 1M19D 3C1CB 1M1AB 2W8SA 3V9RB 5AV8B 3B0BA 4ZBJB 5DNNC 1P3OC 3C1BA 3F6TA 2UWXA 4NE5A 5CP6D 3REIC 2IO5C 5CPJA 4ZUXD 5AY8B 1BH9B 2ZM5A 1HQ3A 5CPKA 5B1LA 3AV1D 2Y2LA 4Z66B 2F8NA 5BS7A 3VH5T 5B31D 5GSUA 3AN2B 2Y2HA 3KUYC 3AYWA 2RVQC 3AZKC 4KHAA 4WU9B 2HUEB 3MGPC 1P3KB 1P3OA 5FUGA 4KGCB 3FDDA 3REIA 3AZEB 1P3FB 3C1BD 3NQJA 1EQZB 2JE5A 3C1CC 1M1AC 3EPLA 1P34C 4XUJA 1B6WA 3REJD 5CPJD 5AV8C 4ZBJC 5CPKD 5E5AC 3AFAB 2F8ND 2F2AC 2NZDC 3KUYA 3AV2C 3AZKA 2XD5A 1P3BC 4NE3A 5GSUD 3B0CT 4H9SC 4Z66C 4J8WA 5B40D 3MGPA 5JA4B 5DNND 1TAFB 1P3OD 3AN2C 4UPKA 3C1CA 1M1AA 4WU9C 4AWLB 3REID 2HUEC 3V9RA 3R45B 5AV8A 1KX5C 1A7WA 3AZHC 1F66B 4KGCC 1BH8B 3MVDB 3AZEC 1P3FC 2NQBB 5B2IB 5AY8A 5B2JC 1BH9A 1P3AA 5B0YB 1P3BA 1N1JB 4H9SA 3A6NB 4Z66A 3KUYD 1P3PC 4LD9C 2RVQD 3AZKD 3REKB 3MGPD 2Y2IA 3AN2A 4H9QB 4YS3B 4WU9A 5GT0B 3C1CD 1M1AD 1P34D 3AZHA 4J8XC 4KGCA 5AV8D 5E5AD 3AZEA 1P3FA 3P5JB 1EQZA 5G49B 2NZDD 4LD9A 3AV2D 2Y2QA 1P3BD 4WNNB 5DNMB 3EPHA 4Z66D 3AFAA 5B0ZC 5B2IC 3W98B 3AN2D 3A6NC 5GXQB 4WU9D 5JA4A 5B32C 3REKC 3UTBB 5B33C 1KX5D 3AZHD 1TAFA 4H9NB 4JJNC 4KGCD 3NQUA 3AZED 1P3FD 2ZY4A 4KUDB 1P3LC 5CHLB 3R45A 5B2JD 1P3PD 1EQZD 4LD9D 2BYKB 1F66A 2F8NH 3IP4C 1BH8A 3AL0C 3MVDA 3AZNB 2NQBA 3MGRB 3AZMB 1KX4B 5B2IA 3W97B 4QLCC 3A6NA 3MNNB 5DNMC 3TU4B 3EPKA 3W99C 3REKA 1WWIA 5B24B 4J8XD 4H9QA 4YS3A 3EG5B 4WU8B 3W98C 3VH6T 5GT0A 4J8UB 4WJ3C 4WZSB 3UTBC 2DF4C 5B0ZD 5G49A 3EPJA 5B2ID 4WNNA 5DNMA 2YFWB 4H9OB 3AZFB 1HQ3C 2BG1A 5B1LC 1TZYB 5B32D 5GT3C 3REKD 5B33D 3MGQB 3AZMC 3X1TB 3W98A 3W97C 4JJND 5BT1C 5GXQA 4DRAA 3MNNC 3AYWC 3AZLC 3KFUG 1P3LD 3UTBA 4M6BA 2DQNC 3LZ0B 5B24C 4H9NA 4H9PB 3O62B 4WU8C 4KUDA 3UT9B 4EO5B 4QLCD 4J8UC 4XUJC 5DNMD 2PYOD 3W99D 5GT3A 3MGRA 3AZMA 1KX4A 3B6GB 3W97A 1P3MB 1P3BB 5BO0B 3MNNA 3W98D 3AZLA 3AZFC 1TZYC 5BNVB 4J8WC 5B24A 1ZLAB 3W96B 3UTBD 2Y2PA 1P3GB 3X1TC 4WU8A 5JRGB 3MGSB 4J8UA 5BNXB 3LZ0C 2Y2JA 1HQ3D 5B1LD 3O62C 1Z2CB 5GT3D 3X1VB 3KXBB 3AZMD 3W97D 4WV4B 2YFWA 3REHB 5AY8C 1P3AC 4H9OA 3AZFA 1TZYA 3MNND 3AYWD 3AZLD 3MGQA 3UTAB 3X1TA 5B24D 1P3MC 4WU8D 3VH6A 1HTAA 3LZ0A 4J8UD 3W96C 1ZLAC 4H9PA 2L5AA 4XUJD 3O62A 1P3GC 1P3KC 1T3UA 5JRGC 4HGAB 4G92B 3AZFD 1ID3B 3B6GA 1TZYD 3AFAC 5KDMB 4J8WD 1P3MA 3H0RC 5BO0A 4YM6B 3X1VC 3X1TD 2ZY3A 2CWEA 3REHC 2AROB 3W96A 1ZLAA 1P3KA 1P3GA 3LZ0D 3UTAC 3A1IA 5JRGA 3O62D 3MGSA 4AWLC 4Z2MH 2RIQA 5BNXA 1P3AD 5AY8D 5AVCB 5AV9B 2YFVB 3AZGB 1F66C 3LELB 3X1VA 3MVDC 4NE6A 3KXBA 1H3OB 2Y2NA 2NQBC 4HGAC 1P3MD 3REHA 5B0YC 1B67A 4CAYB 4G91B 3UTAA 4YM6C 1ZLAD 1P3KD 3W96D 2Y2KA 5CPIB 1P3GD 3WA9B 4YS3C 5JRGD 5B31G 2BYMB 5GT0C 1P3IB 5CP6B 2ZY2A 3AFAD 5AV5B 3X1VD 5B0YA 1N1JA 5B31B 3REHD 1ID3A 5AV9C 5KDMA 4YM6A 3KWQB 3UTAD 4E45A 2F8NG 2AROA 3B0DB 5GXQC 1U35B 4X23B 3REJB 5CPJB 5CPIC 3WTPB 1F66D 3WA9C 3MVDD 3WAAB 2F8NB 2NQBD 4KUDC 5AVCA 1P3IC 2Y2GA 5B0YD 5AV9A 3A6ND 1JFIB 2YFVA 3AZGA 3AZIB 3AZNC 1M18B 1H3OA 5B40B 3MGRC 4YM6D 1KX4C 5AV5C 5DNNB 4YS3D 3WTPE 5FUGB 4CAYA 3TU4C 1P3AB 5GT0D 4J8VB 3KWQC 5CPIA 3WA9A 3H0LC 2BYMA 1P3IA 5CP6A 2Y2MA 2BYKA 1U35C 5AV9D 3AZNA 4X23C 4Z5TB 2CV5B 3WTPC 1F1EA 5AV5A 3WAAC 3WKJB 5B31A 1BFMA 2HIOB 3TU4A 1S32B 5GXQD 3AZJB 3KWQA 3AZIC 1KX3B 1M18C 5B40C 1P34B 3MGQC 2FJ7B 5CPID 3WA9D 5E5AB 5C3IB 4KUDD 1U35A 2NZDB 1P3ID 3LZ1B 4J8VC 3AV2B 4X23A 3REJA 3WTPA 3WAAA 3AZND 3VH5W 2ZY5A 4E44A 3MGRD 3UT9C 4EO5C 1KX4D 5AV5D 1JFIA 5BT1D 3AZIA 3TU4D 1M18A 5B40A 4Z5TC 3LJAB 2CV5C 3B6GC 3KWQD 5DNNA 1KX5B 3WKJC 1Q9CA 2G5IC 2HIOC 5AVBB 3AZHB 4DRBA 3RELB 1S32C 1KU5A 4J8VA 3AZJC 5B2JB 1KX3C 1P3PB 1U35D 4LD9B 2FJ7C 4X23D 2Y2OA 3WTPD 3UT9A 3MGSC 3WAAD 5C3IC 3LZ1C 3A1KA 3B0CW 4Z5TA 2CV5A 3AZID 1M18D 3WKJA 2JSSA 3MGQD 2HIOA 3KXBC 4J8XB 1S32A 3X1SB 3AZJA 4DQYB 5BNVA 1KX3A 3NQUB 1WWSA 1PZRA 3LJAC 4J8VD 1P34A 2FJ7A 5B1MB 5B32G 5E5AA 5AVBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REL C;  5B0Z B;  3UT9 D;  3B6F B;  2NZD A;  3LZ1 A;  3AV2 A;  5F99 B;  1AOI B;  3X1U B;  4Z5T D;  2CV5 D;  3B6G D;  5B32 B;  5B33 B;  3WKJ D;  4H9R B;  2HIO D;  4JJN B;  4G92 C;  1S32 D;  5AV6 B;  4XZQ B;  4R8P B;  1ID3 C;  3LJA A;  1M19 B;  3AZJ D;  1P3L B;  1KX3 D;  4Z2M G;  1KX5 A;  4UUZ B;  3KSY A;  5AVB A;  2FJ7 D;  3REL A;  3X1S C;  3MGS D;  2ARO C;  5B2J A;  1P3P A;  1ULY A;  4QLC B;  4ZUX B;  3LZ1 D;  3AV1 B;  5B1M C;  2PYO B;  3W99 B;  4CSR B;  3KXB D;  3B6F C;  3VH5 A;  2LY8 A;  1R4V A;  5AVC C;  5F99 C;  1AOI C;  3AZG C;  3LEL C;  3X1U C;  3LJA D;  4J8X A;  3X1S A;  5AVB D;  3REL D;  5AV6 C;  4XZQ C;  3C1B B;  4R8P C;  1M19 C;  4G91 C;  5B1M A;  1HQ3 B;  5CPK B;  5B1L B;  2F8N K;  5B0Z A;  3B6F A;  5GT3 B;  5F99 A;  5CP6 C;  4ZUX C;  1AOI A;  5GSU B;  3X1U A;  3LEL A;  3AV1 C;  1ID3 D;  3AYW B;  3AZL B;  2PYO C;  4KHA B;  5B32 A;  5B33 A;  4H9R A;  5B31 C;  4JJN A;  5AV6 A;  4XZQ A;  1P3O B;  3X1S D;  4R8P A;  2ARO D;  3VH6 W;  1M19 A;  1P3L A;  3REI B;  2IO5 B;  3NQJ B;  4UUZ A;  5B1M D;  4XUJ B;  3B0D C;  1EQZ C;  3B6F D;  3C1B C;  4QLC A;  4ZUX A;  3AV1 A;  5F99 D;  5AVC D;  3KUY B;  3REJ C;  3AZK B;  5CPJ C;  1AOI D;  3AZG D;  2PYO A;  3W99 A;  3LEL D;  3X1U D;  5CPK C;  4CSR A;  4J8W B;  5BS7 C;  3MGP B;  4NFT A;  5GSU C;  5AV6 D;  4XZQ D;  4R8P D;  1M19 D;  3C1C B;  1M1A B;  3V9R B;  5AV8 B;  5DNN C;  3B0B A;  4ZBJ B;  1P3O C;  3C1B A;  4NE5 A;  5CP6 D;  3REI C;  2IO5 C;  5CPJ A;  5AY8 B;  4ZUX D;  1BH9 B;  1P3A B;  1HQ3 A;  5CPK A;  5B1L A;  3AV1 D;  1P3B B;  4Z66 B;  2F8N A;  5BS7 A;  3VH5 T;  5B31 D;  5GSU A;  3AN2 B;  3KUY C;  3AYW A;  2RVQ C;  3AZK C;  4KHA A;  4WU9 B;  2HUE B;  3MGP C;  1P3K B;  1P3O A;  5FUG A;  4KGC B;  3REI A;  3AZE B;  1P3F B;  3C1B D;  3NQJ A;  1EQZ B;  3C1C C;  1M1A C;  1P34 C;  4XUJ A;  1B6W A;  3REJ D;  5CPJ D;  5AV8 C;  4ZBJ C;  5CPK D;  5E5A C;  3AFA B;  2F8N D;  2NZD C;  3KUY A;  3AV2 C;  3AZK A;  1P3B C;  4NE3 A;  5GSU D;  3B0C T;  4H9S C;  4Z66 C;  4J8W A;  5B40 D;  3MGP A;  5JA4 B;  5DNN D;  1TAF B;  1P3O D;  3AN2 C;  3C1C A;  1M1A A;  4WU9 C;  4AWL B;  3REI D;  2HUE C;  3V9R A;  3R45 B;  5AV8 A;  1KX5 C;  1A7W A;  3AZH C;  1F66 B;  4KGC C;  1BH8 B;  3MVD B;  3AZE C;  1P3F C;  2NQB B;  5B2I B;  5AY8 A;  5B2J C;  1BH9 A;  1P3A A;  5B0Y B;  1P3B A;  1N1J B;  4H9S A;  3A6N B;  4Z66 A;  3KUY D;  1P3P C;  4LD9 C;  2RVQ D;  3AZK D;  3REK B;  3MGP D;  3AN2 A;  4H9Q B;  4YS3 B;  4WU9 A;  5GT0 B;  3C1C D;  1M1A D;  1P34 D;  3AZH A;  4J8X C;  4KGC A;  5AV8 D;  5E5A D;  3AZE A;  1P3F A;  1EQZ A;  5G49 B;  2NZD D;  4LD9 A;  3AV2 D;  1P3B D;  4WNN B;  5DNM B;  4Z66 D;  3AFA A;  5B0Z C;  5B2I C;  3W98 B;  3AN2 D;  3A6N C;  5GXQ B;  4WU9 D;  5JA4 A;  5B32 C;  3REK C;  3UTB B;  5B33 C;  1KX5 D;  3AZH D;  1TAF A;  4H9N B;  4JJN C;  4KGC D;  3NQU A;  3AZE D;  1P3F D;  4KUD B;  1P3L C;  5CHL B;  3R45 A;  5B2J D;  1P3P D;  1EQZ D;  4LD9 D;  2BYK B;  1F66 A;  2F8N H;  1BH8 A;  3MVD A;  3AZN B;  2NQB A;  3MGR B;  3AZM B;  1KX4 B;  5B2I A;  3W97 B;  4QLC C;  3A6N A;  3MNN B;  5DNM C;  3TU4 B;  3W99 C;  3REK A;  1WWI A;  5B24 B;  4J8X D;  4H9Q A;  4YS3 A;  4WU8 B;  3W98 C;  3VH6 T;  5GT0 A;  4J8U B;  4WZS B;  3UTB C;  5B0Z D;  5G49 A;  5B2I D;  4WNN A;  5DNM A;  2YFW B;  4H9O B;  3AZF B;  1HQ3 C;  5B1L C;  1TZY B;  5B32 D;  5GT3 C;  3REK D;  5B33 D;  3MGQ B;  3AZM C;  3X1T B;  3W98 A;  3W97 C;  4JJN D;  5BT1 C;  5GXQ A;  4DRA A;  3MNN C;  3AYW C;  3AZL C;  1P3L D;  3UTB A;  4M6B A;  3LZ0 B;  5B24 C;  4H9N A;  4H9P B;  3O62 B;  4WU8 C;  4KUD A;  3UT9 B;  4EO5 B;  4QLC D;  4J8U C;  4XUJ C;  5DNM D;  2PYO D;  3W99 D;  5GT3 A;  3MGR A;  3AZM A;  1KX4 A;  3B6G B;  3W97 A;  1P3M B;  5BO0 B;  3MNN A;  3W98 D;  3AZL A;  3AZF C;  1TZY C;  5BNV B;  4J8W C;  5B24 A;  1ZLA B;  3W96 B;  3UTB D;  1P3G B;  3X1T C;  4WU8 A;  5JRG B;  3MGS B;  4J8U A;  5BNX B;  3LZ0 C;  1HQ3 D;  5B1L D;  3O62 C;  5GT3 D;  3X1V B;  3KXB B;  3AZM D;  3W97 D;  4WV4 B;  2YFW A;  3REH B;  5AY8 C;  1P3A C;  4H9O A;  3AZF A;  1TZY A;  3MNN D;  3AYW D;  3AZL D;  3MGQ A;  3UTA B;  3X1T A;  5B24 D;  1P3M C;  4WU8 D;  3VH6 A;  1HTA A;  3LZ0 A;  4J8U D;  3W96 C;  1ZLA C;  4H9P A;  2L5A A;  4XUJ D;  3O62 A;  1P3G C;  1P3K C;  5JRG C;  4HGA B;  4G92 B;  3AZF D;  1ID3 B;  3B6G A;  1TZY D;  3AFA C;  5KDM B;  4J8W D;  1P3M A;  4YM6 B;  5BO0 A;  3X1V C;  3X1T D;  2CWE A;  3REH C;  2ARO B;  3W96 A;  1ZLA A;  1P3K A;  1P3G A;  3LZ0 D;  3UTA C;  5JRG A;  3O62 D;  3MGS A;  4AWL C;  4Z2M H;  5BNX A;  1P3A D;  5AY8 D;  5AVC B;  5AV9 B;  2YFV B;  3AZG B;  1F66 C;  3LEL B;  3X1V A;  3MVD C;  4NE6 A;  3KXB A;  1H3O B;  2NQB C;  4HGA C;  1P3M D;  3REH A;  5B0Y C;  1B67 A;  4CAY B;  4G91 B;  3UTA A;  4YM6 C;  1ZLA D;  1P3K D;  3W96 D;  5CPI B;  1P3G D;  3WA9 B;  4YS3 C;  5JRG D;  5B31 G;  2BYM B;  5GT0 C;  1P3I B;  5CP6 B;  3AFA D;  5AV5 B;  3X1V D;  5B0Y A;  1N1J A;  5B31 B;  3REH D;  1ID3 A;  5AV9 C;  5KDM A;  4YM6 A;  3KWQ B;  3UTA D;  4E45 A;  2F8N G;  2ARO A;  3B0D B;  5GXQ C;  1U35 B;  4X23 B;  3REJ B;  5CPJ B;  5CPI C;  3WTP B;  1F66 D;  3WA9 C;  3MVD D;  3WAA B;  2F8N B;  2NQB D;  4KUD C;  5AVC A;  1P3I C;  5B0Y D;  5AV9 A;  3A6N D;  1JFI B;  2YFV A;  3AZG A;  3AZI B;  3AZN C;  1M18 B;  1H3O A;  5B40 B;  3MGR C;  4YM6 D;  1KX4 C;  5AV5 C;  5DNN B;  4YS3 D;  3WTP E;  5FUG B;  4CAY A;  3TU4 C;  5GT0 D;  4J8V B;  3KWQ C;  5CPI A;  3WA9 A;  2BYM A;  1P3I A;  5CP6 A;  2BYK A;  1U35 C;  5AV9 D;  3AZN A;  4X23 C;  4Z5T B;  2CV5 B;  3WTP C;  1F1E A;  5AV5 A;  3WAA C;  3WKJ B;  5B31 A;  1BFM A;  2HIO B;  3TU4 A;  1S32 B;  5GXQ D;  3AZJ B;  3KWQ A;  3AZI C;  1KX3 B;  1M18 C;  5B40 C;  1P34 B;  3MGQ C;  2FJ7 B;  5CPI D;  3WA9 D;  5E5A B;  5C3I B;  4KUD D;  1U35 A;  2NZD B;  1P3I D;  3LZ1 B;  4J8V C;  3AV2 B;  4X23 A;  3REJ A;  3WTP A;  3WAA A;  3AZN D;  3VH5 W;  4E44 A;  3MGR D;  3UT9 C;  1KX4 D;  4EO5 C;  5AV5 D;  1JFI A;  5BT1 D;  3AZI A;  3TU4 D;  1M18 A;  5B40 A;  4Z5T C;  3LJA B;  2CV5 C;  3B6G C;  3KWQ D;  5DNN A;  1KX5 B;  3WKJ C;  1Q9C A;  5AVB B;  2HIO C;  3AZH B;  4DRB A;  3REL B;  1S32 C;  1KU5 A;  4J8V A;  3AZJ C;  5B2J B;  1KX3 C;  1P3P B;  1U35 D;  4LD9 B;  2FJ7 C;  4X23 D;  3WTP D;  3UT9 A;  3MGS C;  3WAA D;  5C3I C;  3LZ1 C;  3B0C W;  4Z5T A;  2CV5 A;  3AZI D;  1M18 D;  3WKJ A;  2JSS A;  3MGQ D;  2HIO A;  3KXB C;  4J8X B;  1S32 A;  3X1S B;  3AZJ A;  5BNV A;  1KX3 A;  3NQU B;  1WWS A;  3LJA C;  4J8V D;  1P34 A;  2FJ7 A;  5B1M B;  5B32 G;  5E5A A;  5AVB C; 
#chains in the Genus database with same CATH topology
 3REL C;  5B0Z B;  3UT9 D;  3B6F B;  2NZD A;  3LZ1 A;  3AV2 A;  5F99 B;  1AOI B;  3X1U B;  4Z5T D;  2CV5 D;  3B6G D;  5B32 B;  5B33 B;  3WKJ D;  4H9R B;  3H0M C;  2HIO D;  4JJN B;  4G92 C;  1S32 D;  5AV6 B;  4XZQ B;  4R8P B;  1ID3 C;  3LJA A;  1M19 B;  3AZJ D;  1P3L B;  1KX3 D;  4Z2M G;  1KX5 A;  4UUZ B;  3KSY A;  5AVB A;  2FJ7 D;  3REL A;  3X1S C;  3MGS D;  2ARO C;  5B2J A;  1P3P A;  1ULY A;  4QLC B;  4ZUX B;  3LZ1 D;  3AV1 B;  5B1M C;  2VQR A;  2PYO B;  3W99 B;  4CSR B;  3KXB D;  3B6F C;  3VH5 A;  2FFF B;  2LY8 A;  1R4V A;  5AVC C;  5F99 C;  1AOI C;  3AZG C;  3LEL C;  3X1U C;  3LJA D;  2J8P A;  4J8X A;  3X1S A;  2JCH A;  5AVB D;  3REL D;  5AV6 C;  4XZQ C;  3C1B B;  4R8P C;  1M19 C;  4G91 C;  5B1M A;  1HQ3 B;  5CPK B;  5B1L B;  2F8N K;  5B0Z A;  3B6F A;  5GT3 B;  5F99 A;  5CP6 C;  4ZUX C;  1AOI A;  5GSU B;  3X1U A;  3LEL A;  3AV1 C;  1ID3 D;  3AYW B;  3AZL B;  2PYO C;  4KHA B;  5B32 A;  5B33 A;  4H9R A;  5B31 C;  1W2E A;  4JJN A;  5AV6 A;  4XZQ A;  1P3O B;  3X1S D;  4R8P A;  2ARO D;  3VH6 W;  1M19 A;  1P3L A;  3REI B;  2IO5 B;  3NQJ B;  4UUZ A;  5B1M D;  4XUJ B;  3B0D C;  1EQZ C;  3B6F D;  3C1B C;  4QLC A;  4ZUX A;  3AV1 A;  5F99 D;  5AVC D;  3KUY B;  3REJ C;  3AZK B;  5CPJ C;  1AOI D;  3AZG D;  2PYO A;  3W99 A;  3LEL D;  3X1U D;  5CPK C;  4CSR A;  4J8W B;  5BS7 C;  3MGP B;  4NFT A;  2XD1 A;  5GSU C;  5AV6 D;  4XZQ D;  4R8P D;  2G5H C;  1M19 D;  3C1C B;  1M1A B;  2W8S A;  3V9R B;  5AV8 B;  3B0B A;  4ZBJ B;  5DNN C;  1P3O C;  3C1B A;  3F6T A;  2UWX A;  4NE5 A;  5CP6 D;  3REI C;  2IO5 C;  5CPJ A;  4ZUX D;  5AY8 B;  1BH9 B;  2ZM5 A;  1HQ3 A;  5CPK A;  5B1L A;  3AV1 D;  2Y2L A;  4Z66 B;  2F8N A;  5BS7 A;  3VH5 T;  5B31 D;  5GSU A;  3AN2 B;  2Y2H A;  3KUY C;  3AYW A;  2RVQ C;  3AZK C;  4KHA A;  4WU9 B;  2HUE B;  3MGP C;  1P3K B;  1P3O A;  5FUG A;  4KGC B;  3FDD A;  3REI A;  3AZE B;  1P3F B;  3C1B D;  3NQJ A;  1EQZ B;  2JE5 A;  3C1C C;  1M1A C;  3EPL A;  1P34 C;  4XUJ A;  1B6W A;  3REJ D;  5CPJ D;  5AV8 C;  4ZBJ C;  5CPK D;  5E5A C;  3AFA B;  2F8N D;  2F2A C;  2NZD C;  3KUY A;  3AV2 C;  3AZK A;  2XD5 A;  1P3B C;  4NE3 A;  5GSU D;  3B0C T;  4H9S C;  4Z66 C;  4J8W A;  5B40 D;  3MGP A;  5JA4 B;  5DNN D;  1TAF B;  1P3O D;  3AN2 C;  4UPK A;  3C1C A;  1M1A A;  4WU9 C;  4AWL B;  3REI D;  2HUE C;  3V9R A;  3R45 B;  5AV8 A;  1KX5 C;  1A7W A;  3AZH C;  1F66 B;  4KGC C;  1BH8 B;  3MVD B;  3AZE C;  1P3F C;  2NQB B;  5B2I B;  5AY8 A;  5B2J C;  1BH9 A;  1P3A A;  5B0Y B;  1P3B A;  1N1J B;  4H9S A;  3A6N B;  4Z66 A;  3KUY D;  1P3P C;  4LD9 C;  2RVQ D;  3AZK D;  3REK B;  3MGP D;  2Y2I A;  3AN2 A;  4H9Q B;  4YS3 B;  4WU9 A;  5GT0 B;  3C1C D;  1M1A D;  1P34 D;  3AZH A;  4J8X C;  4KGC A;  5AV8 D;  5E5A D;  3AZE A;  1P3F A;  3P5J B;  1EQZ A;  5G49 B;  2NZD D;  4LD9 A;  3AV2 D;  2Y2Q A;  1P3B D;  4WNN B;  5DNM B;  3EPH A;  4Z66 D;  3AFA A;  5B0Z C;  5B2I C;  3W98 B;  3AN2 D;  3A6N C;  5GXQ B;  4WU9 D;  5JA4 A;  5B32 C;  3REK C;  3UTB B;  5B33 C;  1KX5 D;  3AZH D;  1TAF A;  4H9N B;  4JJN C;  4KGC D;  3NQU A;  3AZE D;  1P3F D;  2ZY4 A;  4KUD B;  1P3L C;  5CHL B;  3R45 A;  5B2J D;  1P3P D;  1EQZ D;  4LD9 D;  2BYK B;  1F66 A;  2F8N H;  3IP4 C;  1BH8 A;  3AL0 C;  3MVD A;  3AZN B;  2NQB A;  3MGR B;  3AZM B;  1KX4 B;  5B2I A;  3W97 B;  4QLC C;  3A6N A;  3MNN B;  5DNM C;  3TU4 B;  3EPK A;  3W99 C;  3REK A;  1WWI A;  5B24 B;  4J8X D;  4H9Q A;  4YS3 A;  3EG5 B;  4WU8 B;  3W98 C;  3VH6 T;  5GT0 A;  4J8U B;  4WJ3 C;  4WZS B;  3UTB C;  2DF4 C;  5B0Z D;  5G49 A;  3EPJ A;  5B2I D;  4WNN A;  5DNM A;  2YFW B;  4H9O B;  3AZF B;  1HQ3 C;  2BG1 A;  5B1L C;  1TZY B;  5B32 D;  5GT3 C;  3REK D;  5B33 D;  3MGQ B;  3AZM C;  3X1T B;  3W98 A;  3W97 C;  4JJN D;  5BT1 C;  5GXQ A;  4DRA A;  3MNN C;  3AYW C;  3AZL C;  3KFU G;  1P3L D;  3UTB A;  4M6B A;  2DQN C;  3LZ0 B;  5B24 C;  4H9N A;  4H9P B;  3O62 B;  4WU8 C;  4KUD A;  3UT9 B;  4EO5 B;  4QLC D;  4J8U C;  4XUJ C;  5DNM D;  2PYO D;  3W99 D;  5GT3 A;  3MGR A;  3AZM A;  1KX4 A;  3B6G B;  3W97 A;  1P3M B;  1P3B B;  5BO0 B;  3MNN A;  3W98 D;  3AZL A;  3AZF C;  1TZY C;  5BNV B;  4J8W C;  5B24 A;  1ZLA B;  3W96 B;  3UTB D;  2Y2P A;  1P3G B;  3X1T C;  4WU8 A;  5JRG B;  3MGS B;  4J8U A;  5BNX B;  3LZ0 C;  2Y2J A;  1HQ3 D;  5B1L D;  3O62 C;  1Z2C B;  5GT3 D;  3X1V B;  3KXB B;  3AZM D;  3W97 D;  4WV4 B;  2YFW A;  3REH B;  5AY8 C;  1P3A C;  4H9O A;  3AZF A;  1TZY A;  3MNN D;  3AYW D;  3AZL D;  3MGQ A;  3UTA B;  3X1T A;  5B24 D;  1P3M C;  4WU8 D;  3VH6 A;  1HTA A;  3LZ0 A;  4J8U D;  3W96 C;  1ZLA C;  4H9P A;  2L5A A;  4XUJ D;  3O62 A;  1P3G C;  1P3K C;  1T3U A;  5JRG C;  4HGA B;  4G92 B;  3AZF D;  1ID3 B;  3B6G A;  1TZY D;  3AFA C;  5KDM B;  4J8W D;  1P3M A;  3H0R C;  5BO0 A;  4YM6 B;  3X1V C;  3X1T D;  2ZY3 A;  2CWE A;  3REH C;  2ARO B;  3W96 A;  1ZLA A;  1P3K A;  1P3G A;  3LZ0 D;  3UTA C;  3A1I A;  5JRG A;  3O62 D;  3MGS A;  4AWL C;  4Z2M H;  2RIQ A;  5BNX A;  1P3A D;  5AY8 D;  5AVC B;  5AV9 B;  2YFV B;  3AZG B;  1F66 C;  3LEL B;  3X1V A;  3MVD C;  4NE6 A;  3KXB A;  1H3O B;  2Y2N A;  2NQB C;  4HGA C;  1P3M D;  3REH A;  5B0Y C;  1B67 A;  4CAY B;  4G91 B;  3UTA A;  4YM6 C;  1ZLA D;  1P3K D;  3W96 D;  2Y2K A;  5CPI B;  1P3G D;  3WA9 B;  4YS3 C;  5JRG D;  5B31 G;  2BYM B;  5GT0 C;  1P3I B;  5CP6 B;  2ZY2 A;  3AFA D;  5AV5 B;  3X1V D;  5B0Y A;  1N1J A;  5B31 B;  3REH D;  1ID3 A;  5AV9 C;  5KDM A;  4YM6 A;  3KWQ B;  3UTA D;  4E45 A;  2F8N G;  2ARO A;  3B0D B;  5GXQ C;  1U35 B;  4X23 B;  3REJ B;  5CPJ B;  5CPI C;  3WTP B;  1F66 D;  3WA9 C;  3MVD D;  3WAA B;  2F8N B;  2NQB D;  4KUD C;  5AVC A;  1P3I C;  2Y2G A;  5B0Y D;  5AV9 A;  3A6N D;  1JFI B;  2YFV A;  3AZG A;  3AZI B;  3AZN C;  1M18 B;  1H3O A;  5B40 B;  3MGR C;  4YM6 D;  1KX4 C;  5AV5 C;  5DNN B;  4YS3 D;  3WTP E;  5FUG B;  4CAY A;  3TU4 C;  1P3A B;  5GT0 D;  4J8V B;  3KWQ C;  5CPI A;  3WA9 A;  3H0L C;  2BYM A;  1P3I A;  5CP6 A;  2Y2M A;  2BYK A;  1U35 C;  5AV9 D;  3AZN A;  4X23 C;  4Z5T B;  2CV5 B;  3WTP C;  1F1E A;  5AV5 A;  3WAA C;  3WKJ B;  5B31 A;  1BFM A;  2HIO B;  3TU4 A;  1S32 B;  5GXQ D;  3AZJ B;  3KWQ A;  3AZI C;  1KX3 B;  1M18 C;  5B40 C;  1P34 B;  3MGQ C;  2FJ7 B;  5CPI D;  3WA9 D;  5E5A B;  5C3I B;  4KUD D;  1U35 A;  2NZD B;  1P3I D;  3LZ1 B;  4J8V C;  3AV2 B;  4X23 A;  3REJ A;  3WTP A;  3WAA A;  3AZN D;  3VH5 W;  2ZY5 A;  4E44 A;  3MGR D;  3UT9 C;  4EO5 C;  1KX4 D;  5AV5 D;  1JFI A;  5BT1 D;  3AZI A;  3TU4 D;  1M18 A;  5B40 A;  4Z5T C;  3LJA B;  2CV5 C;  3B6G C;  3KWQ D;  5DNN A;  1KX5 B;  3WKJ C;  1Q9C A;  2G5I C;  2HIO C;  5AVB B;  3AZH B;  4DRB A;  3REL B;  1S32 C;  1KU5 A;  4J8V A;  3AZJ C;  5B2J B;  1KX3 C;  1P3P B;  1U35 D;  4LD9 B;  2FJ7 C;  4X23 D;  2Y2O A;  3WTP D;  3UT9 A;  3MGS C;  3WAA D;  5C3I C;  3LZ1 C;  3A1K A;  3B0C W;  4Z5T A;  2CV5 A;  3AZI D;  1M18 D;  3WKJ A;  2JSS A;  3MGQ D;  2HIO A;  3KXB C;  4J8X B;  1S32 A;  3X1S B;  3AZJ A;  4DQY B;  5BNV A;  1KX3 A;  3NQU B;  1WWS A;  1PZR A;  3LJA C;  4J8V D;  1P34 A;  2FJ7 A;  5B1M B;  5B32 G;  5E5A A;  5AVB C; 
#chains in the Genus database with same CATH homology
 3REL C;  5B0Z B;  3UT9 D;  3B6F B;  2NZD A;  3LZ1 A;  3AV2 A;  5F99 B;  1AOI B;  3X1U B;  4Z5T D;  2CV5 D;  3B6G D;  5B32 B;  5B33 B;  3WKJ D;  4H9R B;  3H0M C;  2HIO D;  4JJN B;  4G92 C;  1S32 D;  5AV6 B;  4XZQ B;  4R8P B;  1ID3 C;  3LJA A;  1M19 B;  3AZJ D;  1P3L B;  1KX3 D;  4Z2M G;  1KX5 A;  4UUZ B;  3KSY A;  5AVB A;  2FJ7 D;  3REL A;  3X1S C;  3MGS D;  2ARO C;  5B2J A;  1P3P A;  1ULY A;  4QLC B;  4ZUX B;  3LZ1 D;  3AV1 B;  5B1M C;  2VQR A;  2PYO B;  3W99 B;  4CSR B;  3KXB D;  3B6F C;  3VH5 A;  2FFF B;  2LY8 A;  1R4V A;  5AVC C;  5F99 C;  1AOI C;  3AZG C;  3LEL C;  3X1U C;  3LJA D;  2J8P A;  4J8X A;  3X1S A;  2JCH A;  5AVB D;  3REL D;  5AV6 C;  4XZQ C;  3C1B B;  4R8P C;  1M19 C;  4G91 C;  5B1M A;  1HQ3 B;  5CPK B;  5B1L B;  2F8N K;  5B0Z A;  3B6F A;  5GT3 B;  5F99 A;  5CP6 C;  4ZUX C;  1AOI A;  5GSU B;  3X1U A;  3LEL A;  3AV1 C;  1ID3 D;  3AYW B;  3AZL B;  2PYO C;  4KHA B;  5B32 A;  5B33 A;  4H9R A;  5B31 C;  1W2E A;  4JJN A;  5AV6 A;  4XZQ A;  1P3O B;  3X1S D;  4R8P A;  2ARO D;  3VH6 W;  1M19 A;  1P3L A;  3REI B;  2IO5 B;  3NQJ B;  4UUZ A;  5B1M D;  4XUJ B;  3B0D C;  1EQZ C;  3B6F D;  3C1B C;  4QLC A;  4ZUX A;  3AV1 A;  5F99 D;  5AVC D;  3KUY B;  3REJ C;  3AZK B;  5CPJ C;  1AOI D;  3AZG D;  2PYO A;  3W99 A;  3LEL D;  3X1U D;  5CPK C;  4CSR A;  4J8W B;  5BS7 C;  3MGP B;  4NFT A;  2XD1 A;  5GSU C;  5AV6 D;  4XZQ D;  4R8P D;  2G5H C;  1M19 D;  3C1C B;  1M1A B;  2W8S A;  3V9R B;  5AV8 B;  3B0B A;  4ZBJ B;  5DNN C;  1P3O C;  3C1B A;  3F6T A;  2UWX A;  4NE5 A;  5CP6 D;  3REI C;  2IO5 C;  5CPJ A;  4ZUX D;  5AY8 B;  1BH9 B;  2ZM5 A;  1HQ3 A;  5CPK A;  5B1L A;  3AV1 D;  2Y2L A;  4Z66 B;  2F8N A;  5BS7 A;  3VH5 T;  5B31 D;  5GSU A;  3AN2 B;  2Y2H A;  3KUY C;  3AYW A;  2RVQ C;  3AZK C;  4KHA A;  4WU9 B;  2HUE B;  3MGP C;  1P3K B;  1P3O A;  5FUG A;  4KGC B;  3FDD A;  3REI A;  3AZE B;  1P3F B;  3C1B D;  3NQJ A;  1EQZ B;  2JE5 A;  3C1C C;  1M1A C;  3EPL A;  1P34 C;  4XUJ A;  1B6W A;  3REJ D;  5CPJ D;  5AV8 C;  4ZBJ C;  5CPK D;  5E5A C;  3AFA B;  2F8N D;  2F2A C;  2NZD C;  3KUY A;  3AV2 C;  3AZK A;  2XD5 A;  1P3B C;  4NE3 A;  5GSU D;  3B0C T;  4H9S C;  4Z66 C;  4J8W A;  5B40 D;  3MGP A;  5JA4 B;  5DNN D;  1TAF B;  1P3O D;  3AN2 C;  4UPK A;  3C1C A;  1M1A A;  4WU9 C;  4AWL B;  3REI D;  2HUE C;  3V9R A;  3R45 B;  5AV8 A;  1KX5 C;  1A7W A;  3AZH C;  1F66 B;  4KGC C;  1BH8 B;  3MVD B;  3AZE C;  1P3F C;  2NQB B;  5B2I B;  5AY8 A;  5B2J C;  1BH9 A;  1P3A A;  5B0Y B;  1P3B A;  1N1J B;  4H9S A;  3A6N B;  4Z66 A;  3KUY D;  1P3P C;  4LD9 C;  2RVQ D;  3AZK D;  3REK B;  3MGP D;  2Y2I A;  3AN2 A;  4H9Q B;  4YS3 B;  4WU9 A;  5GT0 B;  3C1C D;  1M1A D;  1P34 D;  3AZH A;  4J8X C;  4KGC A;  5AV8 D;  5E5A D;  3AZE A;  1P3F A;  3P5J B;  1EQZ A;  5G49 B;  2NZD D;  4LD9 A;  3AV2 D;  2Y2Q A;  1P3B D;  4WNN B;  5DNM B;  3EPH A;  4Z66 D;  3AFA A;  5B0Z C;  5B2I C;  3W98 B;  3AN2 D;  3A6N C;  5GXQ B;  4WU9 D;  5JA4 A;  5B32 C;  3REK C;  3UTB B;  5B33 C;  1KX5 D;  3AZH D;  1TAF A;  4H9N B;  4JJN C;  4KGC D;  3NQU A;  3AZE D;  1P3F D;  2ZY4 A;  4KUD B;  1P3L C;  5CHL B;  3R45 A;  5B2J D;  1P3P D;  1EQZ D;  4LD9 D;  2BYK B;  1F66 A;  2F8N H;  3IP4 C;  1BH8 A;  3AL0 C;  3MVD A;  3AZN B;  2NQB A;  3MGR B;  3AZM B;  1KX4 B;  5B2I A;  3W97 B;  4QLC C;  3A6N A;  3MNN B;  5DNM C;  3TU4 B;  3EPK A;  3W99 C;  3REK A;  1WWI A;  5B24 B;  4J8X D;  4H9Q A;  4YS3 A;  3EG5 B;  4WU8 B;  3W98 C;  3VH6 T;  5GT0 A;  4J8U B;  4WJ3 C;  4WZS B;  3UTB C;  2DF4 C;  5B0Z D;  5G49 A;  3EPJ A;  5B2I D;  4WNN A;  5DNM A;  2YFW B;  4H9O B;  3AZF B;  1HQ3 C;  2BG1 A;  5B1L C;  1TZY B;  5B32 D;  5GT3 C;  3REK D;  5B33 D;  3MGQ B;  3AZM C;  3X1T B;  3W98 A;  3W97 C;  4JJN D;  5BT1 C;  5GXQ A;  4DRA A;  3MNN C;  3AYW C;  3AZL C;  3KFU G;  1P3L D;  3UTB A;  4M6B A;  2DQN C;  3LZ0 B;  5B24 C;  4H9N A;  4H9P B;  3O62 B;  4WU8 C;  4KUD A;  3UT9 B;  4EO5 B;  4QLC D;  4J8U C;  4XUJ C;  5DNM D;  2PYO D;  3W99 D;  5GT3 A;  3MGR A;  3AZM A;  1KX4 A;  3B6G B;  3W97 A;  1P3M B;  1P3B B;  5BO0 B;  3MNN A;  3W98 D;  3AZL A;  3AZF C;  1TZY C;  5BNV B;  4J8W C;  5B24 A;  1ZLA B;  3W96 B;  3UTB D;  2Y2P A;  1P3G B;  3X1T C;  4WU8 A;  5JRG B;  3MGS B;  4J8U A;  5BNX B;  3LZ0 C;  2Y2J A;  1HQ3 D;  5B1L D;  3O62 C;  1Z2C B;  5GT3 D;  3X1V B;  3KXB B;  3AZM D;  3W97 D;  4WV4 B;  2YFW A;  3REH B;  5AY8 C;  1P3A C;  4H9O A;  3AZF A;  1TZY A;  3MNN D;  3AYW D;  3AZL D;  3MGQ A;  3UTA B;  3X1T A;  5B24 D;  1P3M C;  4WU8 D;  3VH6 A;  1HTA A;  3LZ0 A;  4J8U D;  3W96 C;  1ZLA C;  4H9P A;  2L5A A;  4XUJ D;  3O62 A;  1P3G C;  1P3K C;  1T3U A;  5JRG C;  4HGA B;  4G92 B;  3AZF D;  1ID3 B;  3B6G A;  1TZY D;  3AFA C;  5KDM B;  4J8W D;  1P3M A;  3H0R C;  5BO0 A;  4YM6 B;  3X1V C;  3X1T D;  2ZY3 A;  2CWE A;  3REH C;  2ARO B;  3W96 A;  1ZLA A;  1P3K A;  1P3G A;  3LZ0 D;  3UTA C;  3A1I A;  5JRG A;  3O62 D;  3MGS A;  4AWL C;  4Z2M H;  2RIQ A;  5BNX A;  1P3A D;  5AY8 D;  5AVC B;  5AV9 B;  2YFV B;  3AZG B;  1F66 C;  3LEL B;  3X1V A;  3MVD C;  4NE6 A;  3KXB A;  1H3O B;  2Y2N A;  2NQB C;  4HGA C;  1P3M D;  3REH A;  5B0Y C;  1B67 A;  4CAY B;  4G91 B;  3UTA A;  4YM6 C;  1ZLA D;  1P3K D;  3W96 D;  2Y2K A;  5CPI B;  1P3G D;  3WA9 B;  4YS3 C;  5JRG D;  5B31 G;  2BYM B;  5GT0 C;  1P3I B;  5CP6 B;  2ZY2 A;  3AFA D;  5AV5 B;  3X1V D;  5B0Y A;  1N1J A;  5B31 B;  3REH D;  1ID3 A;  5AV9 C;  5KDM A;  4YM6 A;  3KWQ B;  3UTA D;  4E45 A;  2F8N G;  2ARO A;  3B0D B;  5GXQ C;  1U35 B;  4X23 B;  3REJ B;  5CPJ B;  5CPI C;  3WTP B;  1F66 D;  3WA9 C;  3MVD D;  3WAA B;  2F8N B;  2NQB D;  4KUD C;  5AVC A;  1P3I C;  2Y2G A;  5B0Y D;  5AV9 A;  3A6N D;  1JFI B;  2YFV A;  3AZG A;  3AZI B;  3AZN C;  1M18 B;  1H3O A;  5B40 B;  3MGR C;  4YM6 D;  1KX4 C;  5AV5 C;  5DNN B;  4YS3 D;  3WTP E;  5FUG B;  4CAY A;  3TU4 C;  1P3A B;  5GT0 D;  4J8V B;  3KWQ C;  5CPI A;  3WA9 A;  3H0L C;  2BYM A;  1P3I A;  5CP6 A;  2Y2M A;  2BYK A;  1U35 C;  5AV9 D;  3AZN A;  4X23 C;  4Z5T B;  2CV5 B;  3WTP C;  1F1E A;  5AV5 A;  3WAA C;  3WKJ B;  5B31 A;  1BFM A;  2HIO B;  3TU4 A;  1S32 B;  5GXQ D;  3AZJ B;  3KWQ A;  3AZI C;  1KX3 B;  1M18 C;  5B40 C;  1P34 B;  3MGQ C;  2FJ7 B;  5CPI D;  3WA9 D;  5E5A B;  5C3I B;  4KUD D;  1U35 A;  2NZD B;  1P3I D;  3LZ1 B;  4J8V C;  3AV2 B;  4X23 A;  3REJ A;  3WTP A;  3WAA A;  3AZN D;  3VH5 W;  2ZY5 A;  4E44 A;  3MGR D;  3UT9 C;  4EO5 C;  1KX4 D;  5AV5 D;  1JFI A;  5BT1 D;  3AZI A;  3TU4 D;  1M18 A;  5B40 A;  4Z5T C;  3LJA B;  2CV5 C;  3B6G C;  3KWQ D;  5DNN A;  1KX5 B;  3WKJ C;  1Q9C A;  2G5I C;  2HIO C;  5AVB B;  3AZH B;  4DRB A;  3REL B;  1S32 C;  1KU5 A;  4J8V A;  3AZJ C;  5B2J B;  1KX3 C;  1P3P B;  1U35 D;  4LD9 B;  2FJ7 C;  4X23 D;  2Y2O A;  3WTP D;  3UT9 A;  3MGS C;  3WAA D;  5C3I C;  3LZ1 C;  3A1K A;  3B0C W;  4Z5T A;  2CV5 A;  3AZI D;  1M18 D;  3WKJ A;  2JSS A;  3MGQ D;  2HIO A;  3KXB C;  4J8X B;  1S32 A;  3X1S B;  3AZJ A;  4DQY B;  5BNV A;  1KX3 A;  3NQU B;  1WWS A;  1PZR A;  3LJA C;  4J8V D;  1P34 A;  2FJ7 A;  5B1M B;  5B32 G;  5E5A A;  5AVB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...