2F8NB

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nB00
3R45A 3AZNC 1S32D 1ZLAC 5GT3D 2NQBC 4J8VC 1EQZA 3C1BB 3AZHD 1P3KB 5E5AB 3LZ1D 3X1VD 1F66D 5GSUB 3AV2B 4KUDB 3C1BC 3TU4D 4WU8D 1P3KC 5E5AC 4H9SA 3B6GB 3AZMA 5GSUC 3AV2C 4KUDC 3W96A 5G49A 1P34D 4KHAA 1P3BB 2NZDD 3B6GC 5CPJB 1F1EA 3UTBD 2BYKA 4XUJB 1P3FB 1P3BC 5AV6D 4UUZA 2JSSA 5BT1D 5CPJC 2AROA 3KXBD 4XUJC 1AOIA 3AZGD 3B6FB 3AZIB 3AZNA 1P3OA 4Z5TB 1M19B 4YM6D 1ZLAD 2NQBD 3WKJB 1M18B 3B6FC 4J8VD 3AZIC 3KWQB 3MGRB 4HGAB 4CSRB 4G91B 4Z5TC 1M19C 4Z66B 3WKJC 3UTAA 1M18C 3KWQC 3MGRC 3C1BD 5B33A 3AZKB 3WTPB 1P3KD 4HGAC 5E5AD 5BS7A 4G91C 5GSUD 4Z66C 1HTAA 1TAFB 3AV2D 5B2JB 4KUDD 5B31A 3AZKC 4H9OB 3WTPC 4J8UA 1HQ3A 5AV9B 3VH6W 3NQUA 3B6GD 3AZFA 3C1CA 5AV9C 1P3BD 1R4VA 4CAYA 5B32A 5FUGB 5JRGA 4YS3B 5CPJD 2F8NA 3WA9B 4R8PB 4JJNA 1BH9B 2CV5A 4XUJD 1P3FD 3W98A 5BO0B 1P3AA 4YS3C 3REIB 4J8XA 3B0CW 3WA9C 4R8PC 4H9NB 3AYWB 4XZQA 1WWSA 5B0ZA 3AZEA 3A6NA 5JA4A 1P3LA 4DRBA 2PYOA 3AZID 3B6FD 3REIC 4H9PA 5AVBB 4ZUXA 3AYWC 3MGPB 3W97A 3W99B 4Z5TD 1M19D 1U35B 3AZLA 3WKJD 1KX3A 4H9RB 1M18D 1M1AB 3KWQD 3MGRD 5AVBC 3LZ0A 3MGPC 3W99C 5AV5A 3WTPE 4Z66D 3AV1A 1U35C 5AV8A 3O62B 3B0CT 5F99B 5CHLB 3AZKD 3WTPD 3KUYB 3V9RA 4WU9B 1H3OB 5B2JD 5CPKA 3O62C 5F99C 5BNVB 3MGSA 5DNNB 5AV9D 3KUYC 4WU9C 5DNNC 1N1JA 3REKA 2YFWA 4YS3D 1TZYA 5GXQA 1P3IA 5B2IA 4KHAB 5B0YA 4ZBJB 3WA9D 4R8PD 3AN2A 1P3MB 1S32A 5GT3A 1KX4B 4YM6C 3REID 3AZHA 4ZBJC 5DNMB 3AYWD 3LZ1A 3X1VA 3REJB 1P3MC 1F66A 4X23B 5B1LB 5CPIB 1KX4C 3NQJB 4WNNB 5DNMC 5AVBD 4WU8A 3TU4A 3MGPD 5AVCB 1WWIA 3W99D 3REJC 4X23C 5B1LC 1U35D 5CPIC 1M1AD 4WZSB 1P34A 1A7WA 2YFVB 5AVCC 2FJ7B 2NZDA 4M6BA 3VH5T 4Z2MG 4H9QB 3O62D 5F99D 3UTBA 3AFAB 2FJ7C 3KUYD 5AV6A 4WU9D 4DRAA 4J8WB 3KXBA 5DNND 3AFAC 4AWLB 3AZGA 1P3FC 4J8WC 3AZJB 4AWLC 1JFIA 4YM6A 1ZLAA 2NQBA 4J8VA 4KGCB 5BNXA 3X1UB 3RELB 3AZJC 1P3MD 3X1TB 1KX4D 3C1BA 3X1UC 5DNMD 3REHB 1P3KA 3RELC 5E5AA 5KDMB 5B40B 3X1TC 3REJD 5GSUA 4X23D 2HIOB 5B1LD 3MVDB 3AV2A 5CPID 4KUDA 1P3PB 3REHC 5AVCD 5B24B 5B40C 4QLCB 3B6GA 5C3IB 2HIOC 3MVDC 5AY8B 1P3PC 5B2JC 2BYMB 5B24C 1P3BA 4QLCC 2FJ7D 5C3IC 5AY8C 5CP6B 5CPJA 3LELB 4XUJA 3AFAD 1P3FA 4NFTA 5CP6C 3MNNB 4LD9B 3LELC 4J8WD 3LJAB 1KU5A 3X1SB 3VH6T 3B6FA 5B1MB 3AZIA 3MNNC 3UT9B 4LD9C 3AZJD 1P3GB 4Z5TA 5B31G 3LJAC 1M19A 3X1SC 3WKJA 3WAAB 1M18A 5B1MC 4KGCD 3KWQA 3MGRA 3X1UD 3UT9C 1BH8B 3RELD 1P3GC 1ID3B 3X1TD 4CSRA 1KX5B 5B0YB 4Z66A 3WAAC 3MGQB 5GT0B 3AZKA 3WTPA 3REHD 1M1AC 5B32G 3R45B 5B40D 1ID3C 1KX5C 3MGQC 1TAFA 2HIOD 3MVDD 5B2JA 2F8NG 1EQZB 1P3PD 4H9OA 5AV9A 5B24D 4QLCD 4G92B 1EQZC 5AY8D 3AZMB 4G92C 4YS3A 5FUGA 3W96B 5CP6D 5G49B 3WA9A 4R8PA 3LELD 3VH5A 1BH9A 4H9SC 5BO0A 3AZMC 4E45A 3W96C 3REIA 3MNND 4LD9D 2BYKB 4NE6A 4H9NA 3AYWA 3LJAD 4UUZB 3X1SD 5B1MD 2AROB 3UT9D 5AVBA 3B0BA 3MGPA 1AOIB 1P3GD 3W99A 1U35A 3WAAD 4H9RA 1M1AA 2AROC 3AZNB 1P3OB 1AOIC 1ID3D 1KX5D 5B0YD 3MGQD 3O62A 5GT0D 5F99A 1P3OC 4NE5A 3KUYA 4WU9A 1H3OA 3UTAB 1EQZD 1B6WA 2L5AA 5B33B 5BNVA 5DNNA 3UTAC 5B31B 5B33C 4J8UB 1HQ3B 5BS7C 3NQUB 3AZMD 3AZFB 3C1CB 3W96D 5B31C 4J8UC 2F8NH 1HQ3C 1P3MA 4CAYB 2F8NK 5JRGB 5B32B 3AZFC 1KX4A 3C1CC 2F8NB 5DNMA 4KGCC 4JJNB 2CV5B 3W98B 3REJA 1P3AB 5JRGC 5B32C 5B1LA 4X23A 5CPIA 4J8XB 3NQJA 2AROD 4WNNA 4XZQB 4JJNC 2CV5C 5AVCA 5B0ZB 3AZEB 1AOID 3VH6A 3A6NB 3W98C 1P3AC 5JA4B 1P3LB 2PYOB 4J8XC 4H9PB 3AZND 4ZUXB 1P3OD 2HUEB 1Q9CA 4XZQC 3AZEC 1ULYA 2YFVA 4WV4B 5B0ZC 3A6NC 2FJ7A 3W97B 3AZLB 1KX3B 1P3LC 2PYOC 4H9QA 4ZUXC 3LZ0B 2HUEC 3AFAA 3W97C 5AV5B 3AV1B 3AZLC 5AV8B 1KX3C 3UTAD 5B33D 4J8WA 3LZ0C 3V9RB 5AV5C 3AV1C 5AV8C 5CPKB 5B31D 4J8UD 1HQ3D 3MGSB 3AZJA 4Z2MH 3AZFD 3C1CD 5CPKC 4KGCA 3X1UA 1BFMA 3MGSC 3RELA 3X1TA 1N1JB 3REKB 2YFWB 5JRGD 1TZYB 5GXQB 5B32D 5B2IB 1P3IB 2F8ND 3REHA 4JJND 5KDMA 3AN2B 2CV5D 5B40A 3W98D 2LY8A 2RVQC 1P3AD 4EO5B 3REKC 1S32B 5GT3B 1P3IC 1TZYC 2HIOA 5GXQC 5B2IC 3MVDA 1P3PA 4J8XD 3KSYA 5B0YC 3AZHB 4XZQD 5GT0C 3AN2C 3LZ1B 5B0ZD 5B24A 4QLCA 3AZED 3A6ND 3X1VB 1F66B 4EO5C 1S32C 5GT3C 1P3LD 2PYOD 3B0DB 5AY8A 3AZHC 3TU4B 4ZUXD 4WU8B 2BYMA 2CWEA 3X1VC 3LZ1C 3W97D 1F66C 3AZLD 1KX3D 3B0DC 5CP6A 3LELA 3TU4C 4WU8C 2IO5B 3LZ0D 1P34B 2NZDB 5AV5D 3AV1D 4E44A 5AV8D 3MNNA 4LD9A 3UTBB 2IO5C 1P34C 2NZDC 3LJAA 5AV6B 3X1SA 5CPKD 5B1MA 3UT9A 3UTBC 3KXBB 3MGSD 1P3GA 5AV6C 3AZGB 1B67A 3WAAA 5BT1C 3KXBC 1BH8A 4NE3A 1ID3A 2RVQD 1KX5A 1JFIB 4YM6B 3REKD 3AZGC 3MGQA 1P3ID 1TZYD 5GXQD 1ZLAB 5B2ID 4J8VB 2NQBB 5BNXB 5GT0A 3VH5W 3AN2D
chains in the Genus database with same CATH superfamily
3R45A 3AZNC 1S32D 1ZLAC 5GT3D 2NQBC 4J8VC 3EG5B 3C1BB 1EQZA 3AZHD 1P3KB 5E5AB 3LZ1D 3X1VD 1F66D 5GSUB 3AV2B 4KUDB 3C1BC 3TU4D 2VQRA 4WU8D 5E5AC 1P3KC 4H9SA 3B6GB 3AZMA 3IP4C 2Y2GA 5GSUC 2Y2KA 3AV2C 4KUDC 3W96A 5G49A 2Y2LA 1P34D 4KHAA 1P3BB 2NZDD 3B6GC 5CPJB 1F1EA 3UTBD 2BYKA 4XUJB 1P3FB 1P3BC 5AV6D 2Y2OA 4UUZA 2JSSA 5BT1D 5CPJC 2AROA 3KXBD 4XUJC 1AOIA 2JE5A 3AZGD 3B6FB 3AZIB 3AZNA 1P3OA 4Z5TB 1M19B 4YM6D 1ZLAD 2NQBD 3WKJB 1M18B 3B6FC 4J8VD 3AZIC 3KWQB 3MGRB 2ZM5A 4HGAB 4CSRB 4G91B 4Z5TC 1M19C 4Z66B 3WKJC 3UTAA 1M18C 3KWQC 3MGRC 3C1BD 5B33A 3AZKB 3WTPB 1P3KD 4HGAC 5E5AD 5BS7A 4G91C 5GSUD 1HTAA 1TAFB 4Z66C 3AV2D 5B2JB 4KUDD 5B31A 3AZKC 4H9OB 3WTPC 4J8UA 1HQ3A 5AV9B 3VH6W 3NQUA 3B6GD 3AZFA 3C1CA 5AV9C 2J8PA 1P3BD 1R4VA 4CAYA 5B32A 5FUGB 5JRGA 4YS3B 5CPJD 2F8NA 3WA9B 4R8PB 4JJNA 1BH9B 2CV5A 4XUJD 1P3FD 3W98A 5BO0B 1P3AA 4YS3C 3REIB 4J8XA 2W8SA 3B0CW 3WA9C 4R8PC 4H9NB 3AYWB 4XZQA 1WWSA 5B0ZA 3AZEA 3A6NA 2BG1A 5JA4A 1P3LA 4DRBA 2PYOA 3AZID 3B6FD 3REIC 4H9PA 5AVBB 4ZUXA 3AYWC 3MGPB 3W97A 3W99B 4Z5TD 1M19D 1U35B 3AZLA 3WKJD 1KX3A 4H9RB 1M18D 1M1AB 3KWQD 3MGRD 5AVBC 3LZ0A 3MGPC 3W99C 5AV5A 3WTPE 4Z66D 3AV1A 1U35C 5AV8A 3O62B 3B0CT 5F99B 5CHLB 3AZKD 3WTPD 3KUYB 3V9RA 2Y2QA 4WU9B 1H3OB 5B2JD 5CPKA 3O62C 5F99C 5BNVB 3MGSA 5DNNB 5AV9D 3KUYC 4WU9C 1PZRA 5DNNC 1N1JA 3REKA 2YFWA 4YS3D 1TZYA 5GXQA 1P3IA 5B2IA 4KHAB 5B0YA 4ZBJB 3WA9D 4R8PD 3AN2A 1P3MB 2NQBB 2UWXA 1S32A 5GT3A 1KX4B 4YM6C 3REID 3AZHA 4ZBJC 5DNMB 3AYWD 3LZ1A 3X1VA 3REJB 1P3MC 1F66A 2Y2MA 4X23B 5B1LB 5CPIB 1KX4C 2Y2IA 3NQJB 4WNNB 5DNMC 5AVBD 4WU8A 3TU4A 4DQYB 3MGPD 5AVCB 1WWIA 3W99D 3REJC 4X23C 5B1LC 1U35D 5CPIC 1M1AD 2XD1A 4WZSB 1P34A 1A7WA 2YFVB 5AVCC 2FJ7B 2NZDA 4M6BA 3VH5T 4Z2MG 4H9QB 3O62D 5F99D 3UTBA 3AFAB 2FJ7C 3KUYD 5AV6A 4WU9D 4DRAA 4J8WB 3KXBA 3H0RC 5DNND 3AFAC 4AWLB 3AZGA 2ZY5A 1P3FC 4J8WC 3AZJB 4AWLC 1JFIA 4YM6A 1ZLAA 2NQBA 4J8VA 4KGCB 5BNXA 3X1UB 3RELB 3AZJC 1P3MD 3X1TB 1KX4D 3C1BA 3X1UC 5DNMD 3REHB 1P3KA 3RELC 5E5AA 5KDMB 5B40B 3X1TC 3REJD 2G5HC 5GSUA 4X23D 2HIOB 5B1LD 3MVDB 3AV2A 5CPID 4KUDA 1P3PB 3A1KA 3REHC 5AVCD 5B24B 5B40C 4QLCB 3B6GA 5C3IB 2HIOC 3MVDC 5AY8B 1P3PC 4WJ3C 5B2JC 2BYMB 5B24C 1P3BA 4QLCC 2FJ7D 5C3IC 5AY8C 5CP6B 5CPJA 3LELB 4XUJA 3AFAD 1P3FA 4NFTA 2JCHA 5CP6C 3MNNB 4LD9B 3LELC 4J8WD 2F2AC 3LJAB 1KU5A 3X1SB 3VH6T 3B6FA 5B1MB 3AZIA 3MNNC 3UT9B 4LD9C 3AZJD 1P3GB 2FFFB 4Z5TA 5B31G 3LJAC 1M19A 3X1SC 3WKJA 3WAAB 1M18A 5B1MC 4KGCD 3KWQA 3MGRA 3X1UD 3UT9C 1BH8B 3RELD 1P3GC 1ID3B 3X1TD 4CSRA 1KX5B 5B0YB 4Z66A 3WAAC 3MGQB 5GT0B 3AZKA 3EPHA 3WTPA 3REHD 2XD5A 5B32G 1M1AC 3R45B 5B40D 1ID3C 1KX5C 3MGQC 1TAFA 2HIOD 3MVDD 5B2JA 2F8NG 1EQZB 1P3PD 4H9OA 5AV9A 5B24D 4QLCD 4G92B 2ZY4A 5AY8D 1EQZC 3AZMB 4G92C 1Z2CB 5FUGA 4YS3A 3W96B 5CP6D 3FDDA 5G49B 3WA9A 4R8PA 3LELD 3VH5A 1BH9A 3A1IA 4H9SC 5BO0A 3AZMC 4E45A 3W96C 3AL0C 3REIA 3MNND 4LD9D 2BYKB 4NE6A 4H9NA 3AYWA 3LJAD 4UUZB 3X1SD 5B1MD 2AROB 3UT9D 5AVBA 3B0BA 3MGPA 1AOIB 1P3GD 3W99A 1U35A 3WAAD 4H9RA 1M1AA 2AROC 3AZNB 1P3OB 3EPLA 1AOIC 1ID3D 1KX5D 2DQNC 5B0YD 3MGQD 3EPJA 3O62A 5GT0D 5F99A 1P3OC 4NE5A 3KUYA 4WU9A 1H3OA 3UTAB 2ZY2A 1EQZD 1B6WA 5B33B 2DF4C 2L5AA 5BNVA 5DNNA 3UTAC 5B31B 5B33C 1T3UA 4J8UB 1HQ3B 5BS7C 3NQUB 3AZMD 3AZFB 3C1CB 3W96D 5B31C 4J8UC 2F8NH 1HQ3C 1P3MA 2G5IC 4CAYB 2F8NK 5JRGB 5B32B 3AZFC 1KX4A 3C1CC 2F8NB 5DNMA 4KGCC 4JJNB 2CV5B 3W98B 3REJA 1P3AB 5JRGC 5B32C 5B1LA 4X23A 5CPIA 4J8XB 3NQJA 2AROD 4WNNA 4XZQB 4JJNC 2CV5C 5AVCA 5B0ZB 3AZEB 1AOID 3VH6A 3A6NB 3W98C 1P3AC 5JA4B 1P3LB 2PYOB 4J8XC 4H9PB 3AZND 4ZUXB 1P3OD 2HUEB 1Q9CA 4XZQC 3AZEC 1ULYA 2YFVA 4WV4B 5B0ZC 3A6NC 2FJ7A 3W97B 3AZLB 1KX3B 1P3LC 2PYOC 4H9QA 4ZUXC 3LZ0B 2HUEC 3AFAA 3W97C 5AV5B 3AV1B 3AZLC 3H0LC 5AV8B 3UTAD 1KX3C 5B33D 4J8WA 3LZ0C 3V9RB 5AV5C 3AV1C 5AV8C 5CPKB 5B31D 4J8UD 1HQ3D 3MGSB 3AZJA 4Z2MH 3AZFD 3C1CD 5CPKC 4KGCA 3X1UA 3EPKA 1BFMA 3MGSC 3RELA 1W2EA 3X1TA 1N1JB 3REKB 5B32D 2YFWB 5JRGD 1TZYB 5GXQB 5B2IB 1P3IB 2F8ND 3REHA 4JJND 5KDMA 3AN2B 2CV5D 5B40A 3W98D 2LY8A 2RVQC 1P3AD 4EO5B 3REKC 1S32B 5GT3B 1P3IC 1TZYC 2HIOA 5GXQC 5B2IC 3MVDA 1P3PA 4J8XD 3KSYA 5B0YC 3AZHB 4XZQD 5GT0C 3AN2C 3P5JB 5B0ZD 5B24A 4QLCA 3LZ1B 3A6ND 3AZED 3X1VB 1F66B 4EO5C 1S32C 5GT3C 1P3LD 2PYOD 3B0DB 5AY8A 3AZHC 3TU4B 4ZUXD 4WU8B 2BYMA 2CWEA 3X1VC 3LZ1C 3W97D 2Y2NA 1F66C 3KFUG 2Y2PA 3AZLD 1KX3D 3B0DC 5CP6A 3LELA 3TU4C 4WU8C 2IO5B 3LZ0D 1P34B 2NZDB 2ZY3A 5AV5D 3AV1D 4E44A 5AV8D 3MNNA 4LD9A 3UTBB 2IO5C 1P34C 2NZDC 3LJAA 5AV6B 3X1SA 5CPKD 5B1MA 3UT9A 3UTBC 3KXBB 2RIQA 3MGSD 1P3GA 2Y2HA 5AV6C 3AZGB 1B67A 3WAAA 5BT1C 3H0MC 4UPKA 3KXBC 1BH8A 4NE3A 1ID3A 2RVQD 1KX5A 1JFIB 4YM6B 2Y2JA 3REKD 3MGQA 3AZGC 1TZYD 5GXQD 1P3ID 3F6TA 5B2ID 4J8VB 1ZLAB 5BNXB 5GT0A 3VH5W 3AN2D
chains in the Genus database with same CATH topology
3R45A 3AZNC 1S32D 1ZLAC 5GT3D 2NQBC 4J8VC 3EG5B 3C1BB 1EQZA 3AZHD 1P3KB 5E5AB 3LZ1D 3X1VD 1F66D 5GSUB 3AV2B 4KUDB 3C1BC 3TU4D 2VQRA 4WU8D 5E5AC 1P3KC 4H9SA 3B6GB 3AZMA 3IP4C 2Y2GA 5GSUC 2Y2KA 3AV2C 4KUDC 3W96A 5G49A 2Y2LA 1P34D 4KHAA 1P3BB 2NZDD 3B6GC 5CPJB 1F1EA 3UTBD 2BYKA 4XUJB 1P3FB 1P3BC 5AV6D 2Y2OA 4UUZA 2JSSA 5BT1D 5CPJC 2AROA 3KXBD 4XUJC 1AOIA 2JE5A 3AZGD 3B6FB 3AZIB 3AZNA 1P3OA 4Z5TB 1M19B 4YM6D 1ZLAD 2NQBD 3WKJB 1M18B 3B6FC 4J8VD 3AZIC 3KWQB 3MGRB 2ZM5A 4HGAB 4CSRB 4G91B 4Z5TC 1M19C 4Z66B 3WKJC 3UTAA 1M18C 3KWQC 3MGRC 3C1BD 5B33A 3AZKB 3WTPB 1P3KD 4HGAC 5E5AD 5BS7A 4G91C 5GSUD 1HTAA 1TAFB 4Z66C 3AV2D 5B2JB 4KUDD 5B31A 3AZKC 4H9OB 3WTPC 4J8UA 1HQ3A 5AV9B 3VH6W 3NQUA 3B6GD 3AZFA 3C1CA 5AV9C 2J8PA 1P3BD 1R4VA 4CAYA 5B32A 5FUGB 5JRGA 4YS3B 5CPJD 2F8NA 3WA9B 4R8PB 4JJNA 1BH9B 2CV5A 4XUJD 1P3FD 3W98A 5BO0B 1P3AA 4YS3C 3REIB 4J8XA 2W8SA 3B0CW 3WA9C 4R8PC 4H9NB 3AYWB 4XZQA 1WWSA 5B0ZA 3AZEA 3A6NA 2BG1A 5JA4A 1P3LA 4DRBA 2PYOA 3AZID 3B6FD 3REIC 4H9PA 5AVBB 4ZUXA 3AYWC 3MGPB 3W97A 3W99B 4Z5TD 1M19D 1U35B 3AZLA 3WKJD 1KX3A 4H9RB 1M18D 1M1AB 3KWQD 3MGRD 5AVBC 3LZ0A 3MGPC 3W99C 5AV5A 3WTPE 4Z66D 3AV1A 1U35C 5AV8A 3O62B 3B0CT 5F99B 5CHLB 3AZKD 3WTPD 3KUYB 3V9RA 2Y2QA 4WU9B 1H3OB 5B2JD 5CPKA 3O62C 5F99C 5BNVB 3MGSA 5DNNB 5AV9D 3KUYC 4WU9C 1PZRA 5DNNC 1N1JA 3REKA 2YFWA 4YS3D 1TZYA 5GXQA 1P3IA 5B2IA 4KHAB 5B0YA 4ZBJB 3WA9D 4R8PD 3AN2A 1P3MB 2NQBB 2UWXA 1S32A 5GT3A 1KX4B 4YM6C 3REID 3AZHA 4ZBJC 5DNMB 3AYWD 3LZ1A 3X1VA 3REJB 1P3MC 1F66A 2Y2MA 4X23B 5B1LB 5CPIB 1KX4C 2Y2IA 3NQJB 4WNNB 5DNMC 5AVBD 4WU8A 3TU4A 4DQYB 3MGPD 5AVCB 1WWIA 3W99D 3REJC 4X23C 5B1LC 1U35D 5CPIC 1M1AD 2XD1A 4WZSB 1P34A 1A7WA 2YFVB 5AVCC 2FJ7B 2NZDA 4M6BA 3VH5T 4Z2MG 4H9QB 3O62D 5F99D 3UTBA 3AFAB 2FJ7C 3KUYD 5AV6A 4WU9D 4DRAA 4J8WB 3KXBA 3H0RC 5DNND 3AFAC 4AWLB 3AZGA 2ZY5A 1P3FC 4J8WC 3AZJB 4AWLC 1JFIA 4YM6A 1ZLAA 2NQBA 4J8VA 4KGCB 5BNXA 3X1UB 3RELB 3AZJC 1P3MD 3X1TB 1KX4D 3C1BA 3X1UC 5DNMD 3REHB 1P3KA 3RELC 5E5AA 5KDMB 5B40B 3X1TC 3REJD 2G5HC 5GSUA 4X23D 2HIOB 5B1LD 3MVDB 3AV2A 5CPID 4KUDA 1P3PB 3A1KA 3REHC 5AVCD 5B24B 5B40C 4QLCB 3B6GA 5C3IB 2HIOC 3MVDC 5AY8B 1P3PC 4WJ3C 5B2JC 2BYMB 5B24C 1P3BA 4QLCC 2FJ7D 5C3IC 5AY8C 5CP6B 5CPJA 3LELB 4XUJA 3AFAD 1P3FA 4NFTA 2JCHA 5CP6C 3MNNB 4LD9B 3LELC 4J8WD 2F2AC 3LJAB 1KU5A 3X1SB 3VH6T 3B6FA 5B1MB 3AZIA 3MNNC 3UT9B 4LD9C 3AZJD 1P3GB 2FFFB 4Z5TA 5B31G 3LJAC 1M19A 3X1SC 3WKJA 3WAAB 1M18A 5B1MC 4KGCD 3KWQA 3MGRA 3X1UD 3UT9C 1BH8B 3RELD 1P3GC 1ID3B 3X1TD 4CSRA 1KX5B 5B0YB 4Z66A 3WAAC 3MGQB 5GT0B 3AZKA 3EPHA 3WTPA 3REHD 2XD5A 5B32G 1M1AC 3R45B 5B40D 1ID3C 1KX5C 3MGQC 1TAFA 2HIOD 3MVDD 5B2JA 2F8NG 1EQZB 1P3PD 4H9OA 5AV9A 5B24D 4QLCD 4G92B 2ZY4A 5AY8D 1EQZC 3AZMB 4G92C 1Z2CB 5FUGA 4YS3A 3W96B 5CP6D 3FDDA 5G49B 3WA9A 4R8PA 3LELD 3VH5A 1BH9A 3A1IA 4H9SC 5BO0A 3AZMC 4E45A 3W96C 3AL0C 3REIA 3MNND 4LD9D 2BYKB 4NE6A 4H9NA 3AYWA 3LJAD 4UUZB 3X1SD 5B1MD 2AROB 3UT9D 5AVBA 3B0BA 3MGPA 1AOIB 1P3GD 3W99A 1U35A 3WAAD 4H9RA 1M1AA 2AROC 3AZNB 1P3OB 3EPLA 1AOIC 1ID3D 1KX5D 2DQNC 5B0YD 3MGQD 3EPJA 3O62A 5GT0D 5F99A 1P3OC 4NE5A 3KUYA 4WU9A 1H3OA 3UTAB 2ZY2A 1EQZD 1B6WA 5B33B 2DF4C 2L5AA 5BNVA 5DNNA 3UTAC 5B31B 5B33C 1T3UA 4J8UB 1HQ3B 5BS7C 3NQUB 3AZMD 3AZFB 3C1CB 3W96D 5B31C 4J8UC 2F8NH 1HQ3C 1P3MA 2G5IC 4CAYB 2F8NK 5JRGB 5B32B 3AZFC 1KX4A 3C1CC 2F8NB 5DNMA 4KGCC 4JJNB 2CV5B 3W98B 3REJA 1P3AB 5JRGC 5B32C 5B1LA 4X23A 5CPIA 4J8XB 3NQJA 2AROD 4WNNA 4XZQB 4JJNC 2CV5C 5AVCA 5B0ZB 3AZEB 1AOID 3VH6A 3A6NB 3W98C 1P3AC 5JA4B 1P3LB 2PYOB 4J8XC 4H9PB 3AZND 4ZUXB 1P3OD 2HUEB 1Q9CA 4XZQC 3AZEC 1ULYA 2YFVA 4WV4B 5B0ZC 3A6NC 2FJ7A 3W97B 3AZLB 1KX3B 1P3LC 2PYOC 4H9QA 4ZUXC 3LZ0B 2HUEC 3AFAA 3W97C 5AV5B 3AV1B 3AZLC 3H0LC 5AV8B 3UTAD 1KX3C 5B33D 4J8WA 3LZ0C 3V9RB 5AV5C 3AV1C 5AV8C 5CPKB 5B31D 4J8UD 1HQ3D 3MGSB 3AZJA 4Z2MH 3AZFD 3C1CD 5CPKC 4KGCA 3X1UA 3EPKA 1BFMA 3MGSC 3RELA 1W2EA 3X1TA 1N1JB 3REKB 5B32D 2YFWB 5JRGD 1TZYB 5GXQB 5B2IB 1P3IB 2F8ND 3REHA 4JJND 5KDMA 3AN2B 2CV5D 5B40A 3W98D 2LY8A 2RVQC 1P3AD 4EO5B 3REKC 1S32B 5GT3B 1P3IC 1TZYC 2HIOA 5GXQC 5B2IC 3MVDA 1P3PA 4J8XD 3KSYA 5B0YC 3AZHB 4XZQD 5GT0C 3AN2C 3P5JB 5B0ZD 5B24A 4QLCA 3LZ1B 3A6ND 3AZED 3X1VB 1F66B 4EO5C 1S32C 5GT3C 1P3LD 2PYOD 3B0DB 5AY8A 3AZHC 3TU4B 4ZUXD 4WU8B 2BYMA 2CWEA 3X1VC 3LZ1C 3W97D 2Y2NA 1F66C 3KFUG 2Y2PA 3AZLD 1KX3D 3B0DC 5CP6A 3LELA 3TU4C 4WU8C 2IO5B 3LZ0D 1P34B 2NZDB 2ZY3A 5AV5D 3AV1D 4E44A 5AV8D 3MNNA 4LD9A 3UTBB 2IO5C 1P34C 2NZDC 3LJAA 5AV6B 3X1SA 5CPKD 5B1MA 3UT9A 3UTBC 3KXBB 2RIQA 3MGSD 1P3GA 2Y2HA 5AV6C 3AZGB 1B67A 3WAAA 5BT1C 3H0MC 4UPKA 3KXBC 1BH8A 4NE3A 1ID3A 2RVQD 1KX5A 1JFIB 4YM6B 2Y2JA 3REKD 3MGQA 3AZGC 1TZYD 5GXQD 1P3ID 3F6TA 5B2ID 4J8VB 1ZLAB 5BNXB 5GT0A 3VH5W 3AN2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 A;  3AZN C;  1S32 D;  1ZLA C;  5GT3 D;  2NQB C;  4J8V C;  1EQZ A;  3C1B B;  3AZH D;  1P3K B;  5E5A B;  3LZ1 D;  3X1V D;  1F66 D;  5GSU B;  3AV2 B;  4KUD B;  3C1B C;  3TU4 D;  4WU8 D;  1P3K C;  5E5A C;  4H9S A;  3B6G B;  3AZM A;  5GSU C;  3AV2 C;  4KUD C;  3W96 A;  5G49 A;  1P34 D;  4KHA A;  1P3B B;  2NZD D;  3B6G C;  5CPJ B;  1F1E A;  3UTB D;  2BYK A;  4XUJ B;  1P3F B;  1P3B C;  5AV6 D;  4UUZ A;  2JSS A;  5BT1 D;  5CPJ C;  2ARO A;  3KXB D;  4XUJ C;  1AOI A;  3AZG D;  3B6F B;  3AZI B;  3AZN A;  1P3O A;  4Z5T B;  1M19 B;  4YM6 D;  1ZLA D;  2NQB D;  3WKJ B;  1M18 B;  3B6F C;  4J8V D;  3AZI C;  3KWQ B;  3MGR B;  4HGA B;  4CSR B;  4G91 B;  4Z5T C;  1M19 C;  4Z66 B;  3WKJ C;  3UTA A;  1M18 C;  3KWQ C;  3MGR C;  3C1B D;  5B33 A;  3AZK B;  3WTP B;  1P3K D;  4HGA C;  5E5A D;  5BS7 A;  4G91 C;  5GSU D;  4Z66 C;  1HTA A;  1TAF B;  3AV2 D;  5B2J B;  4KUD D;  5B31 A;  3AZK C;  4H9O B;  3WTP C;  4J8U A;  1HQ3 A;  5AV9 B;  3VH6 W;  3NQU A;  3B6G D;  3AZF A;  3C1C A;  5AV9 C;  1P3B D;  1R4V A;  4CAY A;  5B32 A;  5FUG B;  5JRG A;  4YS3 B;  5CPJ D;  2F8N A;  3WA9 B;  4R8P B;  4JJN A;  1BH9 B;  2CV5 A;  4XUJ D;  1P3F D;  3W98 A;  5BO0 B;  1P3A A;  4YS3 C;  3REI B;  4J8X A;  3B0C W;  3WA9 C;  4R8P C;  4H9N B;  3AYW B;  4XZQ A;  1WWS A;  5B0Z A;  3AZE A;  3A6N A;  5JA4 A;  1P3L A;  4DRB A;  2PYO A;  3AZI D;  3B6F D;  3REI C;  4H9P A;  5AVB B;  4ZUX A;  3AYW C;  3MGP B;  3W97 A;  3W99 B;  4Z5T D;  1M19 D;  1U35 B;  3AZL A;  3WKJ D;  1KX3 A;  4H9R B;  1M18 D;  1M1A B;  3KWQ D;  3MGR D;  5AVB C;  3LZ0 A;  3MGP C;  3W99 C;  5AV5 A;  3WTP E;  4Z66 D;  3AV1 A;  1U35 C;  5AV8 A;  3O62 B;  3B0C T;  5F99 B;  5CHL B;  3AZK D;  3WTP D;  3KUY B;  3V9R A;  4WU9 B;  1H3O B;  5B2J D;  5CPK A;  3O62 C;  5F99 C;  5BNV B;  3MGS A;  5DNN B;  5AV9 D;  3KUY C;  4WU9 C;  5DNN C;  1N1J A;  3REK A;  2YFW A;  4YS3 D;  1TZY A;  5GXQ A;  1P3I A;  5B2I A;  4KHA B;  5B0Y A;  4ZBJ B;  3WA9 D;  4R8P D;  3AN2 A;  1P3M B;  1S32 A;  5GT3 A;  1KX4 B;  4YM6 C;  3REI D;  3AZH A;  4ZBJ C;  5DNM B;  3AYW D;  3LZ1 A;  3X1V A;  3REJ B;  1P3M C;  1F66 A;  4X23 B;  5B1L B;  5CPI B;  1KX4 C;  3NQJ B;  4WNN B;  5DNM C;  5AVB D;  4WU8 A;  3TU4 A;  3MGP D;  5AVC B;  1WWI A;  3W99 D;  3REJ C;  4X23 C;  5B1L C;  1U35 D;  5CPI C;  1M1A D;  4WZS B;  1P34 A;  1A7W A;  2YFV B;  5AVC C;  2FJ7 B;  2NZD A;  4M6B A;  3VH5 T;  4Z2M G;  4H9Q B;  3O62 D;  5F99 D;  3UTB A;  3AFA B;  2FJ7 C;  3KUY D;  5AV6 A;  4WU9 D;  4DRA A;  4J8W B;  3KXB A;  5DNN D;  3AFA C;  4AWL B;  3AZG A;  1P3F C;  4J8W C;  3AZJ B;  4AWL C;  1JFI A;  4YM6 A;  1ZLA A;  2NQB A;  4J8V A;  4KGC B;  5BNX A;  3X1U B;  3REL B;  3AZJ C;  1P3M D;  3X1T B;  1KX4 D;  3C1B A;  3X1U C;  5DNM D;  3REH B;  1P3K A;  3REL C;  5E5A A;  5KDM B;  5B40 B;  3X1T C;  3REJ D;  5GSU A;  4X23 D;  2HIO B;  5B1L D;  3MVD B;  3AV2 A;  5CPI D;  4KUD A;  1P3P B;  3REH C;  5AVC D;  5B24 B;  5B40 C;  4QLC B;  3B6G A;  5C3I B;  2HIO C;  3MVD C;  5AY8 B;  1P3P C;  5B2J C;  2BYM B;  5B24 C;  1P3B A;  4QLC C;  2FJ7 D;  5C3I C;  5AY8 C;  5CP6 B;  5CPJ A;  3LEL B;  4XUJ A;  3AFA D;  1P3F A;  4NFT A;  5CP6 C;  3MNN B;  4LD9 B;  3LEL C;  4J8W D;  3LJA B;  1KU5 A;  3X1S B;  3VH6 T;  3B6F A;  5B1M B;  3AZI A;  3MNN C;  3UT9 B;  4LD9 C;  3AZJ D;  1P3G B;  4Z5T A;  5B31 G;  3LJA C;  1M19 A;  3X1S C;  3WKJ A;  3WAA B;  1M18 A;  5B1M C;  4KGC D;  3KWQ A;  3MGR A;  3X1U D;  3UT9 C;  1BH8 B;  3REL D;  1P3G C;  1ID3 B;  3X1T D;  4CSR A;  1KX5 B;  5B0Y B;  4Z66 A;  3WAA C;  3MGQ B;  5GT0 B;  3AZK A;  3WTP A;  3REH D;  1M1A C;  5B32 G;  3R45 B;  5B40 D;  1ID3 C;  1KX5 C;  3MGQ C;  1TAF A;  2HIO D;  3MVD D;  5B2J A;  2F8N G;  1EQZ B;  1P3P D;  4H9O A;  5AV9 A;  5B24 D;  4QLC D;  4G92 B;  1EQZ C;  5AY8 D;  3AZM B;  4G92 C;  4YS3 A;  5FUG A;  3W96 B;  5CP6 D;  5G49 B;  3WA9 A;  4R8P A;  3LEL D;  3VH5 A;  1BH9 A;  4H9S C;  5BO0 A;  3AZM C;  4E45 A;  3W96 C;  3REI A;  3MNN D;  4LD9 D;  2BYK B;  4NE6 A;  4H9N A;  3AYW A;  3LJA D;  4UUZ B;  3X1S D;  5B1M D;  2ARO B;  3UT9 D;  5AVB A;  3B0B A;  3MGP A;  1AOI B;  1P3G D;  3W99 A;  1U35 A;  3WAA D;  4H9R A;  1M1A A;  2ARO C;  3AZN B;  1P3O B;  1AOI C;  1ID3 D;  1KX5 D;  5B0Y D;  3MGQ D;  3O62 A;  5GT0 D;  5F99 A;  1P3O C;  4NE5 A;  3KUY A;  4WU9 A;  1H3O A;  3UTA B;  1EQZ D;  1B6W A;  2L5A A;  5B33 B;  5BNV A;  5DNN A;  3UTA C;  5B31 B;  5B33 C;  4J8U B;  1HQ3 B;  5BS7 C;  3NQU B;  3AZM D;  3AZF B;  3C1C B;  3W96 D;  5B31 C;  4J8U C;  2F8N H;  1HQ3 C;  1P3M A;  4CAY B;  2F8N K;  5JRG B;  5B32 B;  3AZF C;  1KX4 A;  3C1C C;  2F8N B;  5DNM A;  4KGC C;  4JJN B;  2CV5 B;  3W98 B;  3REJ A;  1P3A B;  5JRG C;  5B32 C;  5B1L A;  4X23 A;  5CPI A;  4J8X B;  3NQJ A;  2ARO D;  4WNN A;  4XZQ B;  4JJN C;  2CV5 C;  5AVC A;  5B0Z B;  3AZE B;  1AOI D;  3VH6 A;  3A6N B;  3W98 C;  1P3A C;  5JA4 B;  1P3L B;  2PYO B;  4J8X C;  4H9P B;  3AZN D;  4ZUX B;  1P3O D;  2HUE B;  1Q9C A;  4XZQ C;  3AZE C;  1ULY A;  2YFV A;  4WV4 B;  5B0Z C;  3A6N C;  2FJ7 A;  3W97 B;  3AZL B;  1KX3 B;  1P3L C;  2PYO C;  4H9Q A;  4ZUX C;  3LZ0 B;  2HUE C;  3AFA A;  3W97 C;  5AV5 B;  3AV1 B;  3AZL C;  5AV8 B;  1KX3 C;  3UTA D;  5B33 D;  4J8W A;  3LZ0 C;  3V9R B;  5AV5 C;  3AV1 C;  5AV8 C;  5CPK B;  5B31 D;  4J8U D;  1HQ3 D;  3MGS B;  3AZJ A;  4Z2M H;  3AZF D;  3C1C D;  5CPK C;  4KGC A;  3X1U A;  1BFM A;  3MGS C;  3REL A;  3X1T A;  1N1J B;  3REK B;  2YFW B;  5JRG D;  1TZY B;  5GXQ B;  5B32 D;  5B2I B;  1P3I B;  2F8N D;  3REH A;  4JJN D;  5KDM A;  3AN2 B;  2CV5 D;  5B40 A;  3W98 D;  2LY8 A;  2RVQ C;  1P3A D;  4EO5 B;  3REK C;  1S32 B;  5GT3 B;  1P3I C;  1TZY C;  2HIO A;  5GXQ C;  5B2I C;  3MVD A;  1P3P A;  4J8X D;  3KSY A;  5B0Y C;  3AZH B;  4XZQ D;  5GT0 C;  3AN2 C;  3LZ1 B;  5B0Z D;  5B24 A;  4QLC A;  3AZE D;  3A6N D;  3X1V B;  1F66 B;  4EO5 C;  1S32 C;  5GT3 C;  1P3L D;  2PYO D;  3B0D B;  5AY8 A;  3AZH C;  3TU4 B;  4ZUX D;  4WU8 B;  2BYM A;  2CWE A;  3X1V C;  3LZ1 C;  3W97 D;  1F66 C;  3AZL D;  1KX3 D;  3B0D C;  5CP6 A;  3LEL A;  3TU4 C;  4WU8 C;  2IO5 B;  3LZ0 D;  1P34 B;  2NZD B;  5AV5 D;  3AV1 D;  4E44 A;  5AV8 D;  3MNN A;  4LD9 A;  3UTB B;  2IO5 C;  1P34 C;  2NZD C;  3LJA A;  5AV6 B;  3X1S A;  5CPK D;  5B1M A;  3UT9 A;  3UTB C;  3KXB B;  3MGS D;  1P3G A;  5AV6 C;  3AZG B;  1B67 A;  3WAA A;  5BT1 C;  3KXB C;  1BH8 A;  4NE3 A;  1ID3 A;  2RVQ D;  1KX5 A;  1JFI B;  4YM6 B;  3REK D;  3AZG C;  3MGQ A;  1P3I D;  1TZY D;  5GXQ D;  1ZLA B;  5B2I D;  4J8V B;  2NQB B;  5BNX B;  5GT0 A;  3VH5 W;  3AN2 D; 
#chains in the Genus database with same CATH topology
 3R45 A;  3AZN C;  1S32 D;  1ZLA C;  5GT3 D;  2NQB C;  4J8V C;  3EG5 B;  3C1B B;  1EQZ A;  3AZH D;  1P3K B;  5E5A B;  3LZ1 D;  3X1V D;  1F66 D;  5GSU B;  3AV2 B;  4KUD B;  3C1B C;  3TU4 D;  2VQR A;  4WU8 D;  5E5A C;  1P3K C;  4H9S A;  3B6G B;  3AZM A;  3IP4 C;  2Y2G A;  5GSU C;  2Y2K A;  3AV2 C;  4KUD C;  3W96 A;  5G49 A;  2Y2L A;  1P34 D;  4KHA A;  1P3B B;  2NZD D;  3B6G C;  5CPJ B;  1F1E A;  3UTB D;  2BYK A;  4XUJ B;  1P3F B;  1P3B C;  5AV6 D;  2Y2O A;  4UUZ A;  2JSS A;  5BT1 D;  5CPJ C;  2ARO A;  3KXB D;  4XUJ C;  1AOI A;  2JE5 A;  3AZG D;  3B6F B;  3AZI B;  3AZN A;  1P3O A;  4Z5T B;  1M19 B;  4YM6 D;  1ZLA D;  2NQB D;  3WKJ B;  1M18 B;  3B6F C;  4J8V D;  3AZI C;  3KWQ B;  3MGR B;  2ZM5 A;  4HGA B;  4CSR B;  4G91 B;  4Z5T C;  1M19 C;  4Z66 B;  3WKJ C;  3UTA A;  1M18 C;  3KWQ C;  3MGR C;  3C1B D;  5B33 A;  3AZK B;  3WTP B;  1P3K D;  4HGA C;  5E5A D;  5BS7 A;  4G91 C;  5GSU D;  1HTA A;  1TAF B;  4Z66 C;  3AV2 D;  5B2J B;  4KUD D;  5B31 A;  3AZK C;  4H9O B;  3WTP C;  4J8U A;  1HQ3 A;  5AV9 B;  3VH6 W;  3NQU A;  3B6G D;  3AZF A;  3C1C A;  5AV9 C;  2J8P A;  1P3B D;  1R4V A;  4CAY A;  5B32 A;  5FUG B;  5JRG A;  4YS3 B;  5CPJ D;  2F8N A;  3WA9 B;  4R8P B;  4JJN A;  1BH9 B;  2CV5 A;  4XUJ D;  1P3F D;  3W98 A;  5BO0 B;  1P3A A;  4YS3 C;  3REI B;  4J8X A;  2W8S A;  3B0C W;  3WA9 C;  4R8P C;  4H9N B;  3AYW B;  4XZQ A;  1WWS A;  5B0Z A;  3AZE A;  3A6N A;  2BG1 A;  5JA4 A;  1P3L A;  4DRB A;  2PYO A;  3AZI D;  3B6F D;  3REI C;  4H9P A;  5AVB B;  4ZUX A;  3AYW C;  3MGP B;  3W97 A;  3W99 B;  4Z5T D;  1M19 D;  1U35 B;  3AZL A;  3WKJ D;  1KX3 A;  4H9R B;  1M18 D;  1M1A B;  3KWQ D;  3MGR D;  5AVB C;  3LZ0 A;  3MGP C;  3W99 C;  5AV5 A;  3WTP E;  4Z66 D;  3AV1 A;  1U35 C;  5AV8 A;  3O62 B;  3B0C T;  5F99 B;  5CHL B;  3AZK D;  3WTP D;  3KUY B;  3V9R A;  2Y2Q A;  4WU9 B;  1H3O B;  5B2J D;  5CPK A;  3O62 C;  5F99 C;  5BNV B;  3MGS A;  5DNN B;  5AV9 D;  3KUY C;  4WU9 C;  1PZR A;  5DNN C;  1N1J A;  3REK A;  2YFW A;  4YS3 D;  1TZY A;  5GXQ A;  1P3I A;  5B2I A;  4KHA B;  5B0Y A;  4ZBJ B;  3WA9 D;  4R8P D;  3AN2 A;  1P3M B;  2NQB B;  2UWX A;  1S32 A;  5GT3 A;  1KX4 B;  4YM6 C;  3REI D;  3AZH A;  4ZBJ C;  5DNM B;  3AYW D;  3LZ1 A;  3X1V A;  3REJ B;  1P3M C;  1F66 A;  2Y2M A;  4X23 B;  5B1L B;  5CPI B;  1KX4 C;  2Y2I A;  3NQJ B;  4WNN B;  5DNM C;  5AVB D;  4WU8 A;  3TU4 A;  4DQY B;  3MGP D;  5AVC B;  1WWI A;  3W99 D;  3REJ C;  4X23 C;  5B1L C;  1U35 D;  5CPI C;  1M1A D;  2XD1 A;  4WZS B;  1P34 A;  1A7W A;  2YFV B;  5AVC C;  2FJ7 B;  2NZD A;  4M6B A;  3VH5 T;  4Z2M G;  4H9Q B;  3O62 D;  5F99 D;  3UTB A;  3AFA B;  2FJ7 C;  3KUY D;  5AV6 A;  4WU9 D;  4DRA A;  4J8W B;  3KXB A;  3H0R C;  5DNN D;  3AFA C;  4AWL B;  3AZG A;  2ZY5 A;  1P3F C;  4J8W C;  3AZJ B;  4AWL C;  1JFI A;  4YM6 A;  1ZLA A;  2NQB A;  4J8V A;  4KGC B;  5BNX A;  3X1U B;  3REL B;  3AZJ C;  1P3M D;  3X1T B;  1KX4 D;  3C1B A;  3X1U C;  5DNM D;  3REH B;  1P3K A;  3REL C;  5E5A A;  5KDM B;  5B40 B;  3X1T C;  3REJ D;  2G5H C;  5GSU A;  4X23 D;  2HIO B;  5B1L D;  3MVD B;  3AV2 A;  5CPI D;  4KUD A;  1P3P B;  3A1K A;  3REH C;  5AVC D;  5B24 B;  5B40 C;  4QLC B;  3B6G A;  5C3I B;  2HIO C;  3MVD C;  5AY8 B;  1P3P C;  4WJ3 C;  5B2J C;  2BYM B;  5B24 C;  1P3B A;  4QLC C;  2FJ7 D;  5C3I C;  5AY8 C;  5CP6 B;  5CPJ A;  3LEL B;  4XUJ A;  3AFA D;  1P3F A;  4NFT A;  2JCH A;  5CP6 C;  3MNN B;  4LD9 B;  3LEL C;  4J8W D;  2F2A C;  3LJA B;  1KU5 A;  3X1S B;  3VH6 T;  3B6F A;  5B1M B;  3AZI A;  3MNN C;  3UT9 B;  4LD9 C;  3AZJ D;  1P3G B;  2FFF B;  4Z5T A;  5B31 G;  3LJA C;  1M19 A;  3X1S C;  3WKJ A;  3WAA B;  1M18 A;  5B1M C;  4KGC D;  3KWQ A;  3MGR A;  3X1U D;  3UT9 C;  1BH8 B;  3REL D;  1P3G C;  1ID3 B;  3X1T D;  4CSR A;  1KX5 B;  5B0Y B;  4Z66 A;  3WAA C;  3MGQ B;  5GT0 B;  3AZK A;  3EPH A;  3WTP A;  3REH D;  2XD5 A;  5B32 G;  1M1A C;  3R45 B;  5B40 D;  1ID3 C;  1KX5 C;  3MGQ C;  1TAF A;  2HIO D;  3MVD D;  5B2J A;  2F8N G;  1EQZ B;  1P3P D;  4H9O A;  5AV9 A;  5B24 D;  4QLC D;  4G92 B;  2ZY4 A;  5AY8 D;  1EQZ C;  3AZM B;  4G92 C;  1Z2C B;  5FUG A;  4YS3 A;  3W96 B;  5CP6 D;  3FDD A;  5G49 B;  3WA9 A;  4R8P A;  3LEL D;  3VH5 A;  1BH9 A;  3A1I A;  4H9S C;  5BO0 A;  3AZM C;  4E45 A;  3W96 C;  3AL0 C;  3REI A;  3MNN D;  4LD9 D;  2BYK B;  4NE6 A;  4H9N A;  3AYW A;  3LJA D;  4UUZ B;  3X1S D;  5B1M D;  2ARO B;  3UT9 D;  5AVB A;  3B0B A;  3MGP A;  1AOI B;  1P3G D;  3W99 A;  1U35 A;  3WAA D;  4H9R A;  1M1A A;  2ARO C;  3AZN B;  1P3O B;  3EPL A;  1AOI C;  1ID3 D;  1KX5 D;  2DQN C;  5B0Y D;  3MGQ D;  3EPJ A;  3O62 A;  5GT0 D;  5F99 A;  1P3O C;  4NE5 A;  3KUY A;  4WU9 A;  1H3O A;  3UTA B;  2ZY2 A;  1EQZ D;  1B6W A;  5B33 B;  2DF4 C;  2L5A A;  5BNV A;  5DNN A;  3UTA C;  5B31 B;  5B33 C;  1T3U A;  4J8U B;  1HQ3 B;  5BS7 C;  3NQU B;  3AZM D;  3AZF B;  3C1C B;  3W96 D;  5B31 C;  4J8U C;  2F8N H;  1HQ3 C;  1P3M A;  2G5I C;  4CAY B;  2F8N K;  5JRG B;  5B32 B;  3AZF C;  1KX4 A;  3C1C C;  2F8N B;  5DNM A;  4KGC C;  4JJN B;  2CV5 B;  3W98 B;  3REJ A;  1P3A B;  5JRG C;  5B32 C;  5B1L A;  4X23 A;  5CPI A;  4J8X B;  3NQJ A;  2ARO D;  4WNN A;  4XZQ B;  4JJN C;  2CV5 C;  5AVC A;  5B0Z B;  3AZE B;  1AOI D;  3VH6 A;  3A6N B;  3W98 C;  1P3A C;  5JA4 B;  1P3L B;  2PYO B;  4J8X C;  4H9P B;  3AZN D;  4ZUX B;  1P3O D;  2HUE B;  1Q9C A;  4XZQ C;  3AZE C;  1ULY A;  2YFV A;  4WV4 B;  5B0Z C;  3A6N C;  2FJ7 A;  3W97 B;  3AZL B;  1KX3 B;  1P3L C;  2PYO C;  4H9Q A;  4ZUX C;  3LZ0 B;  2HUE C;  3AFA A;  3W97 C;  5AV5 B;  3AV1 B;  3AZL C;  3H0L C;  5AV8 B;  3UTA D;  1KX3 C;  5B33 D;  4J8W A;  3LZ0 C;  3V9R B;  5AV5 C;  3AV1 C;  5AV8 C;  5CPK B;  5B31 D;  4J8U D;  1HQ3 D;  3MGS B;  3AZJ A;  4Z2M H;  3AZF D;  3C1C D;  5CPK C;  4KGC A;  3X1U A;  3EPK A;  1BFM A;  3MGS C;  3REL A;  1W2E A;  3X1T A;  1N1J B;  3REK B;  5B32 D;  2YFW B;  5JRG D;  1TZY B;  5GXQ B;  5B2I B;  1P3I B;  2F8N D;  3REH A;  4JJN D;  5KDM A;  3AN2 B;  2CV5 D;  5B40 A;  3W98 D;  2LY8 A;  2RVQ C;  1P3A D;  4EO5 B;  3REK C;  1S32 B;  5GT3 B;  1P3I C;  1TZY C;  2HIO A;  5GXQ C;  5B2I C;  3MVD A;  1P3P A;  4J8X D;  3KSY A;  5B0Y C;  3AZH B;  4XZQ D;  5GT0 C;  3AN2 C;  3P5J B;  5B0Z D;  5B24 A;  4QLC A;  3LZ1 B;  3A6N D;  3AZE D;  3X1V B;  1F66 B;  4EO5 C;  1S32 C;  5GT3 C;  1P3L D;  2PYO D;  3B0D B;  5AY8 A;  3AZH C;  3TU4 B;  4ZUX D;  4WU8 B;  2BYM A;  2CWE A;  3X1V C;  3LZ1 C;  3W97 D;  2Y2N A;  1F66 C;  3KFU G;  2Y2P A;  3AZL D;  1KX3 D;  3B0D C;  5CP6 A;  3LEL A;  3TU4 C;  4WU8 C;  2IO5 B;  3LZ0 D;  1P34 B;  2NZD B;  2ZY3 A;  5AV5 D;  3AV1 D;  4E44 A;  5AV8 D;  3MNN A;  4LD9 A;  3UTB B;  2IO5 C;  1P34 C;  2NZD C;  3LJA A;  5AV6 B;  3X1S A;  5CPK D;  5B1M A;  3UT9 A;  3UTB C;  3KXB B;  2RIQ A;  3MGS D;  1P3G A;  2Y2H A;  5AV6 C;  3AZG B;  1B67 A;  3WAA A;  5BT1 C;  3H0M C;  4UPK A;  3KXB C;  1BH8 A;  4NE3 A;  1ID3 A;  2RVQ D;  1KX5 A;  1JFI B;  4YM6 B;  2Y2J A;  3REK D;  3MGQ A;  3AZG C;  1TZY D;  5GXQ D;  1P3I D;  3F6T A;  5B2I D;  4J8V B;  1ZLA B;  5BNX B;  5GT0 A;  3VH5 W;  3AN2 D; 
#chains in the Genus database with same CATH homology
 3R45 A;  3AZN C;  1S32 D;  1ZLA C;  5GT3 D;  2NQB C;  4J8V C;  3EG5 B;  3C1B B;  1EQZ A;  3AZH D;  1P3K B;  5E5A B;  3LZ1 D;  3X1V D;  1F66 D;  5GSU B;  3AV2 B;  4KUD B;  3C1B C;  3TU4 D;  2VQR A;  4WU8 D;  5E5A C;  1P3K C;  4H9S A;  3B6G B;  3AZM A;  3IP4 C;  2Y2G A;  5GSU C;  2Y2K A;  3AV2 C;  4KUD C;  3W96 A;  5G49 A;  2Y2L A;  1P34 D;  4KHA A;  1P3B B;  2NZD D;  3B6G C;  5CPJ B;  1F1E A;  3UTB D;  2BYK A;  4XUJ B;  1P3F B;  1P3B C;  5AV6 D;  2Y2O A;  4UUZ A;  2JSS A;  5BT1 D;  5CPJ C;  2ARO A;  3KXB D;  4XUJ C;  1AOI A;  2JE5 A;  3AZG D;  3B6F B;  3AZI B;  3AZN A;  1P3O A;  4Z5T B;  1M19 B;  4YM6 D;  1ZLA D;  2NQB D;  3WKJ B;  1M18 B;  3B6F C;  4J8V D;  3AZI C;  3KWQ B;  3MGR B;  2ZM5 A;  4HGA B;  4CSR B;  4G91 B;  4Z5T C;  1M19 C;  4Z66 B;  3WKJ C;  3UTA A;  1M18 C;  3KWQ C;  3MGR C;  3C1B D;  5B33 A;  3AZK B;  3WTP B;  1P3K D;  4HGA C;  5E5A D;  5BS7 A;  4G91 C;  5GSU D;  1HTA A;  1TAF B;  4Z66 C;  3AV2 D;  5B2J B;  4KUD D;  5B31 A;  3AZK C;  4H9O B;  3WTP C;  4J8U A;  1HQ3 A;  5AV9 B;  3VH6 W;  3NQU A;  3B6G D;  3AZF A;  3C1C A;  5AV9 C;  2J8P A;  1P3B D;  1R4V A;  4CAY A;  5B32 A;  5FUG B;  5JRG A;  4YS3 B;  5CPJ D;  2F8N A;  3WA9 B;  4R8P B;  4JJN A;  1BH9 B;  2CV5 A;  4XUJ D;  1P3F D;  3W98 A;  5BO0 B;  1P3A A;  4YS3 C;  3REI B;  4J8X A;  2W8S A;  3B0C W;  3WA9 C;  4R8P C;  4H9N B;  3AYW B;  4XZQ A;  1WWS A;  5B0Z A;  3AZE A;  3A6N A;  2BG1 A;  5JA4 A;  1P3L A;  4DRB A;  2PYO A;  3AZI D;  3B6F D;  3REI C;  4H9P A;  5AVB B;  4ZUX A;  3AYW C;  3MGP B;  3W97 A;  3W99 B;  4Z5T D;  1M19 D;  1U35 B;  3AZL A;  3WKJ D;  1KX3 A;  4H9R B;  1M18 D;  1M1A B;  3KWQ D;  3MGR D;  5AVB C;  3LZ0 A;  3MGP C;  3W99 C;  5AV5 A;  3WTP E;  4Z66 D;  3AV1 A;  1U35 C;  5AV8 A;  3O62 B;  3B0C T;  5F99 B;  5CHL B;  3AZK D;  3WTP D;  3KUY B;  3V9R A;  2Y2Q A;  4WU9 B;  1H3O B;  5B2J D;  5CPK A;  3O62 C;  5F99 C;  5BNV B;  3MGS A;  5DNN B;  5AV9 D;  3KUY C;  4WU9 C;  1PZR A;  5DNN C;  1N1J A;  3REK A;  2YFW A;  4YS3 D;  1TZY A;  5GXQ A;  1P3I A;  5B2I A;  4KHA B;  5B0Y A;  4ZBJ B;  3WA9 D;  4R8P D;  3AN2 A;  1P3M B;  2NQB B;  2UWX A;  1S32 A;  5GT3 A;  1KX4 B;  4YM6 C;  3REI D;  3AZH A;  4ZBJ C;  5DNM B;  3AYW D;  3LZ1 A;  3X1V A;  3REJ B;  1P3M C;  1F66 A;  2Y2M A;  4X23 B;  5B1L B;  5CPI B;  1KX4 C;  2Y2I A;  3NQJ B;  4WNN B;  5DNM C;  5AVB D;  4WU8 A;  3TU4 A;  4DQY B;  3MGP D;  5AVC B;  1WWI A;  3W99 D;  3REJ C;  4X23 C;  5B1L C;  1U35 D;  5CPI C;  1M1A D;  2XD1 A;  4WZS B;  1P34 A;  1A7W A;  2YFV B;  5AVC C;  2FJ7 B;  2NZD A;  4M6B A;  3VH5 T;  4Z2M G;  4H9Q B;  3O62 D;  5F99 D;  3UTB A;  3AFA B;  2FJ7 C;  3KUY D;  5AV6 A;  4WU9 D;  4DRA A;  4J8W B;  3KXB A;  3H0R C;  5DNN D;  3AFA C;  4AWL B;  3AZG A;  2ZY5 A;  1P3F C;  4J8W C;  3AZJ B;  4AWL C;  1JFI A;  4YM6 A;  1ZLA A;  2NQB A;  4J8V A;  4KGC B;  5BNX A;  3X1U B;  3REL B;  3AZJ C;  1P3M D;  3X1T B;  1KX4 D;  3C1B A;  3X1U C;  5DNM D;  3REH B;  1P3K A;  3REL C;  5E5A A;  5KDM B;  5B40 B;  3X1T C;  3REJ D;  2G5H C;  5GSU A;  4X23 D;  2HIO B;  5B1L D;  3MVD B;  3AV2 A;  5CPI D;  4KUD A;  1P3P B;  3A1K A;  3REH C;  5AVC D;  5B24 B;  5B40 C;  4QLC B;  3B6G A;  5C3I B;  2HIO C;  3MVD C;  5AY8 B;  1P3P C;  4WJ3 C;  5B2J C;  2BYM B;  5B24 C;  1P3B A;  4QLC C;  2FJ7 D;  5C3I C;  5AY8 C;  5CP6 B;  5CPJ A;  3LEL B;  4XUJ A;  3AFA D;  1P3F A;  4NFT A;  2JCH A;  5CP6 C;  3MNN B;  4LD9 B;  3LEL C;  4J8W D;  2F2A C;  3LJA B;  1KU5 A;  3X1S B;  3VH6 T;  3B6F A;  5B1M B;  3AZI A;  3MNN C;  3UT9 B;  4LD9 C;  3AZJ D;  1P3G B;  2FFF B;  4Z5T A;  5B31 G;  3LJA C;  1M19 A;  3X1S C;  3WKJ A;  3WAA B;  1M18 A;  5B1M C;  4KGC D;  3KWQ A;  3MGR A;  3X1U D;  3UT9 C;  1BH8 B;  3REL D;  1P3G C;  1ID3 B;  3X1T D;  4CSR A;  1KX5 B;  5B0Y B;  4Z66 A;  3WAA C;  3MGQ B;  5GT0 B;  3AZK A;  3EPH A;  3WTP A;  3REH D;  2XD5 A;  5B32 G;  1M1A C;  3R45 B;  5B40 D;  1ID3 C;  1KX5 C;  3MGQ C;  1TAF A;  2HIO D;  3MVD D;  5B2J A;  2F8N G;  1EQZ B;  1P3P D;  4H9O A;  5AV9 A;  5B24 D;  4QLC D;  4G92 B;  2ZY4 A;  5AY8 D;  1EQZ C;  3AZM B;  4G92 C;  1Z2C B;  5FUG A;  4YS3 A;  3W96 B;  5CP6 D;  3FDD A;  5G49 B;  3WA9 A;  4R8P A;  3LEL D;  3VH5 A;  1BH9 A;  3A1I A;  4H9S C;  5BO0 A;  3AZM C;  4E45 A;  3W96 C;  3AL0 C;  3REI A;  3MNN D;  4LD9 D;  2BYK B;  4NE6 A;  4H9N A;  3AYW A;  3LJA D;  4UUZ B;  3X1S D;  5B1M D;  2ARO B;  3UT9 D;  5AVB A;  3B0B A;  3MGP A;  1AOI B;  1P3G D;  3W99 A;  1U35 A;  3WAA D;  4H9R A;  1M1A A;  2ARO C;  3AZN B;  1P3O B;  3EPL A;  1AOI C;  1ID3 D;  1KX5 D;  2DQN C;  5B0Y D;  3MGQ D;  3EPJ A;  3O62 A;  5GT0 D;  5F99 A;  1P3O C;  4NE5 A;  3KUY A;  4WU9 A;  1H3O A;  3UTA B;  2ZY2 A;  1EQZ D;  1B6W A;  5B33 B;  2DF4 C;  2L5A A;  5BNV A;  5DNN A;  3UTA C;  5B31 B;  5B33 C;  1T3U A;  4J8U B;  1HQ3 B;  5BS7 C;  3NQU B;  3AZM D;  3AZF B;  3C1C B;  3W96 D;  5B31 C;  4J8U C;  2F8N H;  1HQ3 C;  1P3M A;  2G5I C;  4CAY B;  2F8N K;  5JRG B;  5B32 B;  3AZF C;  1KX4 A;  3C1C C;  2F8N B;  5DNM A;  4KGC C;  4JJN B;  2CV5 B;  3W98 B;  3REJ A;  1P3A B;  5JRG C;  5B32 C;  5B1L A;  4X23 A;  5CPI A;  4J8X B;  3NQJ A;  2ARO D;  4WNN A;  4XZQ B;  4JJN C;  2CV5 C;  5AVC A;  5B0Z B;  3AZE B;  1AOI D;  3VH6 A;  3A6N B;  3W98 C;  1P3A C;  5JA4 B;  1P3L B;  2PYO B;  4J8X C;  4H9P B;  3AZN D;  4ZUX B;  1P3O D;  2HUE B;  1Q9C A;  4XZQ C;  3AZE C;  1ULY A;  2YFV A;  4WV4 B;  5B0Z C;  3A6N C;  2FJ7 A;  3W97 B;  3AZL B;  1KX3 B;  1P3L C;  2PYO C;  4H9Q A;  4ZUX C;  3LZ0 B;  2HUE C;  3AFA A;  3W97 C;  5AV5 B;  3AV1 B;  3AZL C;  3H0L C;  5AV8 B;  3UTA D;  1KX3 C;  5B33 D;  4J8W A;  3LZ0 C;  3V9R B;  5AV5 C;  3AV1 C;  5AV8 C;  5CPK B;  5B31 D;  4J8U D;  1HQ3 D;  3MGS B;  3AZJ A;  4Z2M H;  3AZF D;  3C1C D;  5CPK C;  4KGC A;  3X1U A;  3EPK A;  1BFM A;  3MGS C;  3REL A;  1W2E A;  3X1T A;  1N1J B;  3REK B;  5B32 D;  2YFW B;  5JRG D;  1TZY B;  5GXQ B;  5B2I B;  1P3I B;  2F8N D;  3REH A;  4JJN D;  5KDM A;  3AN2 B;  2CV5 D;  5B40 A;  3W98 D;  2LY8 A;  2RVQ C;  1P3A D;  4EO5 B;  3REK C;  1S32 B;  5GT3 B;  1P3I C;  1TZY C;  2HIO A;  5GXQ C;  5B2I C;  3MVD A;  1P3P A;  4J8X D;  3KSY A;  5B0Y C;  3AZH B;  4XZQ D;  5GT0 C;  3AN2 C;  3P5J B;  5B0Z D;  5B24 A;  4QLC A;  3LZ1 B;  3A6N D;  3AZE D;  3X1V B;  1F66 B;  4EO5 C;  1S32 C;  5GT3 C;  1P3L D;  2PYO D;  3B0D B;  5AY8 A;  3AZH C;  3TU4 B;  4ZUX D;  4WU8 B;  2BYM A;  2CWE A;  3X1V C;  3LZ1 C;  3W97 D;  2Y2N A;  1F66 C;  3KFU G;  2Y2P A;  3AZL D;  1KX3 D;  3B0D C;  5CP6 A;  3LEL A;  3TU4 C;  4WU8 C;  2IO5 B;  3LZ0 D;  1P34 B;  2NZD B;  2ZY3 A;  5AV5 D;  3AV1 D;  4E44 A;  5AV8 D;  3MNN A;  4LD9 A;  3UTB B;  2IO5 C;  1P34 C;  2NZD C;  3LJA A;  5AV6 B;  3X1S A;  5CPK D;  5B1M A;  3UT9 A;  3UTB C;  3KXB B;  2RIQ A;  3MGS D;  1P3G A;  2Y2H A;  5AV6 C;  3AZG B;  1B67 A;  3WAA A;  5BT1 C;  3H0M C;  4UPK A;  3KXB C;  1BH8 A;  4NE3 A;  1ID3 A;  2RVQ D;  1KX5 A;  1JFI B;  4YM6 B;  2Y2J A;  3REK D;  3MGQ A;  3AZG C;  1TZY D;  5GXQ D;  1P3I D;  3F6T A;  5B2I D;  4J8V B;  1ZLA B;  5BNX B;  5GT0 A;  3VH5 W;  3AN2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...