5GT0C

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0C00
3X1UC 2HIOA 3KWQB 4NE3A 4NE6A 1M18D 4JJNB 5AY8C 3V9RB 4LD9C 1P3MD 5AV8B 1N1JB 3AZGA 5G49A 3O62B 5B33D 1AOIA 3W99D 3REJC 5B2JC 3W96D 4XZQC 4WU9D 4ZUXA 5DNNA 3MVDD 3AZNC 1M19D 3UTBD 2IO5B 5CPJC 1WWSA 5GT0A 3B6GD 3MNNB 4WU8B 5E5AA 4Z66B 3TU4A 3WA9D 3C1CD 3AYWB 2YFWB 2HUEB 3B0DC 1M18C 3B6GA 4R8PB 2FJ7B 5CPJD 5BT1C 5GXQD 5JRGC 4YM6C 3AZIA 5BO0B 5B31B 3LZ1B 3REJD 2AROD 5B2JA 1KX3D 4KUDB 1P3AA 4J8UB 1P3PB 5B40B 5B1MA 4ZUXD 1BH8A 5AY8D 5CPIC 3X1SD 5B0ZB 3NQUA 3MGQA 4Z5TB 1A7WA 3REIA 1BFMA 3NQJA 3AZKB 5F99C 4UUZB 1TAFA 3RELB 3REHC 3LELC 3MGSA 1H3OB 1KX5D 1TZYC 3KUYB 3UTAC 1P3LC 3B6FD 4H9PB 4YM6A 4J8UC 3AZNB 5B32A 1P34C 1KU5A 3W99A 2YFVB 5CP6A 5BNVB 4YS3B 1P3IB 5B31C 2F8NG 2F8NB 5AV9D 3AZEA 1HQ3D 2NZDC 3UTBA 1P3LB 1U35C 5B1LC 3REKB 1JFIA 3A6NB 4NFTA 4J8VA 3REIC 5B32D 1TZYB 4H9QA 1ID3A 3VH5W 4H9OB 4H9NB 1ULYA 1KX3B 5F99B 1ZLAA 5B31D 3AZFC 2CV5D 2BYKA 4J8VD 5GSUD 3AZJD 3AFAC 1P3LD 3WTPD 4XZQB 3WKJB 5B32C 1P3PC 3LJAD 3AZHC 3X1VB 5DNMA 5CP6D 3W97B 3C1BA 3UTAB 5GSUB 3AZJB 1BH9B 3MGQD 1M19B 3LELB 3W98A 2BYMB 2L5AA 3C1CC 3MGPC 5CPKD 5B33B 1TZYD 5AVCA 3W98B 5JA4B 3B6GC 4CAYA 2FJ7C 1P3FB 3A6NC 3B0CW 5B0ZD 3X1SB 3W98D 3W97A 4YS3D 3X1VA 4KUDD 3KWQD 3MGPD 3MGQC 4DRBA 4KGCB 3WA9C 2BYKB 4H9RA 5B2IC 5AV6C 3W98C 3MGRB 5F99A 3MGPA 3W96C 5B2JD 1KX3A 4H9OA 4XZQD 5DNND 3MVDA 4Z66C 4H9QB 3WA9B 1TZYA 5AVCD 3MNNC 4J8VB 3AFAD 3A6NA 2PYOB 3AZMA 4WU8D 5CHLB 5B31G 1JFIB 4NE5A 1P3LA 3UTBB 5F99D 3X1TC 4YS3C 3REHD 5AV6D 4DRAA 3LZ0A 3VH5A 1P3IA 5BNVA 5AV5D 2NQBB 3W99B 5B32B 3X1SC 3AZNA 5AV8C 4H9PA 4YM6B 3REKD 5B1LA 5AVBB 5B2IA 3KUYA 5B33C 3B0CT 1P3ID 1H3OA 2AROC 1TAFB 4UUZA 3RELA 3AZND 1M19C 3MVDC 5C3IB 3KXBA 3AZFD 4AWLC 2RVQC 3REIB 1S32A 1EQZB 4EO5C 3NQUB 1BH8B 2NQBC 3AZIC 3X1TA 1P3PA 4H9SA 3RELD 1P3IC 3X1TB 5DNMC 3AZKD 3LZ1A 1ZLAD 5BO0A 3AZIB 1EQZA 1S32B 5JRGD 1F66D 4JJND 3KXBB 5B24C 4R8PA 2FJ7A 1P3PD 5B2ID 4J8UD 5C3IC 4J8XD 2HIOC 2YFWA 3RELC 5DNMD 4G91C 5B2IB 5AVBA 5B1LB 3REKC 1P3MC 4WU8A 3AZMD 5GT0B 2NQBA 3VH6A 5DNNB 3LZ0B 3AV2C 5CP6C 4J8VC 1P3BC 1AOIB 4Z2MH 3O62A 3WAAD 5G49B 4EO5B 3AZMB 5GT0C 1HTAA 3AZGB 1P3GD 1KX4D 2PYOA 4KGCD 4ZBJC 1P3OC 3WA9A 5B0YD 3V9RA 3MVDB 4JJNA 2HUEC 3B0DB 3MGPB 3MGRA 3KWQA 3O62D 1ZLAC 4H9RB 3KXBD 3AZFA 4KGCA 5AVBD 4CSRB 4WU8C 3AZID 1B67A 4M6BA 4KUDC 3TU4D 2F8NK 5FUGB 1P3BD 1P3AC 3LELD 1P3KD 3X1SA 5CPID 3WAAA 1P3FA 1EQZD 4CAYB 3AZGD 1P3OA 1F66A 5JA4A 4J8WC 5AVCB 4G91B 5BS7C 5B33A 3W97D 4WV4B 4WNNA 1M1AC 3LZ0D 2BYMA 3KWQC 3LELA 5GT3C 1M19A 2HIOD 3X1UB 5AVCC 4QLCB 4XUJC 3KXBC 1BH9A 4LD9A 5GSUA 3AZJA 5BNXB 4YM6D 5KDMA 3C1BB 3UTAA 5DNMB 3AZLB 3W97C 3W99C 3X1VC 4J8XB 3WKJA 4XZQA 5GT3D 5DNNC 3AZEC 3MGSD 3AN2B 1R4VA 4LD9D 3UTBC 5JRGB 1U35D 3AFAB 2PYOD 1F66C 1P3FD 5B0YA 1B6WA 5E5AD 1ZLAB 4XUJB 3X1TD 3B6FA 4H9NA 1ID3B 1M1AB 3LJAC 5AVBC 4Z5TC 3REKA 4J8WB 5GSUC 3AZJC 4J8WD 3AZEB 2F8NA 5GXQA 1KX5B 5CP6B 4YS3A 2YFVA 5B32G 1P3BA 3UT9C 4XUJD 3C1BC 5CPKC 5CPIA 5B1MD 2PYOC 4Z5TD 5AY8B 5B0YC 2CV5B 3MGSB 3AN2D 2NQBD 3WTPA 3AV1A 3C1CA 5AV5C 3AYWC 3REHB 2AROB 3AZKA 3UT9D 3NQJB 3AZLD 3LJAA 4WU9C 4Z5TA 3R45B 3MGQB 5B0ZA 2IO5C 5B1MB 3UTAD 5B40A 1WWIA 1HQ3B 4X23B 4J8UA 3AV1D 1P3AB 3AN2C 4QLCD 3X1VD 4KUDA 5B2JB 3REJA 3AZHB 3MGRD 5B31A 3WKJD 4X23D 3LZ1C 3AZLC 4HGAB 5CPKA 5AV9A 3VH6T 1EQZC 1P3FC 1U35A 3B6GB 5E5AC 3KUYD 5B24A 4WU9B 4QLCC 3AV1C 4E44A 1F1EA 1ID3D 3AYWA 3W96B 3W96A 1KX3C 3AZKC 3TU4B 4WU9A 4Z66A 2CWEA 5E5AB 3B0BA 4ZBJB 3MNNA 2CV5C 5B24B 5B0ZC 5AV8D 5B24D 1U35B 4ZUXB 5AV9B 5CPKB 4E45A 3WKJC 3AZHA 3REJB 1KX5C 4WZSB 5B1MC 3AZED 1N1JA 5AV8A 4X23A 1HQ3A 3C1BD 3VH5T 3R45A 1AOID 3LJAB 2HIOB 3X1UD 3AZHD 2AROA 3MGRC 3REHA 3MGSC 3C1CB 3AYWD 3AV1B 1P3AD 1P3KA 3WTPB 4KGCC 2CV5A 1S32C 4Z66D 5AY8A 2NZDB 4G92B 5B1LD 5CPIB 5B40D 2F8NH 3UT9B 5GXQC 4HGAC 2LY8A 1AOIC 1P34A 4H9SC 1P3BB 4J8XC 4KHAA 1KX5A 5GXQB 3A6ND 4X23C 5CPJA 3WTPE 4AWLB 4R8PD 2FJ7D 4J8WA 3TU4C 5BS7A 5AV6A 2F8ND 1ID3C 3WTPC 1M1AA 5AV5A 3AV2D 5GT3A 3KSYA 1P3KC 4XUJA 1M18A 3B6FB 5B0YB 1P3MA 3AZMC 2RVQD 3AFAA 1P3GB 1KX4B 5JRGA 5B40C 1M1AD 3AN2A 1Q9CA 3LZ0C 3AV2B 3AV2A 4J8XA 3AZLA 4G92C 3O62C 1P3GA 1KX4A 5AV9C 1P3MB 5KDMB 5BNXA 4LD9B 1M18B 3KUYC 4JJNC 5GT3B 3B6FC 4QLCA 3X1UA 5AV5B 3LZ1D 5AV6B 4WNNB 3VH6W 5BT1D 2NZDD 5CPJB 1S32D 1P3OB 1F66B 3AZGC 3WAAB 4KHAB 1P34D 2JSSA 1P34B 5FUGA 4Z2MG 3UT9A 4ZUXC 5GT0D 1P3GC 1KX4C 2NZDA 1HQ3C 1P3OD 3WAAC 3MNND 3REID 4CSRA 1P3KB 4R8PC 3AZFB
chains in the Genus database with same CATH superfamily
3EPHA 3X1UC 2HIOA 3KWQB 2ZM5A 4NE3A 4NE6A 1M18D 4JJNB 5AY8C 3V9RB 4LD9C 1P3MD 5AV8B 1N1JB 3AZGA 2VQRA 5G49A 3O62B 5B33D 1AOIA 3W99D 3REJC 5B2JC 3W96D 4XZQC 4WU9D 4ZUXA 5DNNA 3MVDD 3AZNC 1M19D 3UTBD 2IO5B 5CPJC 1WWSA 5GT0A 3B6GD 3MNNB 4WU8B 2J8PA 5E5AA 4Z66B 3TU4A 3WA9D 3C1CD 3AYWB 2YFWB 2Y2NA 2HUEB 3B0DC 1M18C 3B6GA 4R8PB 2FJ7B 5CPJD 5BT1C 5GXQD 5JRGC 4YM6C 2ZY4A 3AZIA 5BO0B 5B31B 3LZ1B 3REJD 2AROD 5B2JA 1KX3D 4KUDB 1P3AA 4J8UB 1P3PB 5B40B 5B1MA 4ZUXD 1BH8A 5AY8D 5CPIC 3X1SD 5B0ZB 3NQUA 3MGQA 4Z5TB 1A7WA 3REIA 1BFMA 3NQJA 3AZKB 5F99C 4UUZB 1TAFA 3RELB 3REHC 3LELC 3MGSA 1H3OB 1KX5D 3H0MC 1TZYC 3KUYB 2F2AC 3UTAC 1P3LC 3B6FD 4H9PB 4YM6A 4J8UC 2JCHA 3AZNB 5B32A 1P34C 1KU5A 3W99A 2YFVB 5CP6A 5BNVB 4YS3B 1P3IB 5B31C 2F8NG 2F8NB 2ZY5A 5AV9D 3AZEA 1HQ3D 2NZDC 3UTBA 1P3LB 1U35C 5B1LC 3REKB 1JFIA 3A6NB 4NFTA 4J8VA 3REIC 5B32D 1TZYB 4H9QA 1ID3A 3VH5W 4H9OB 4H9NB 1ULYA 1KX3B 5F99B 1ZLAA 5B31D 3AZFC 2CV5D 3H0LC 2BYKA 4J8VD 5GSUD 3AZJD 3AFAC 1P3LD 1W2EA 3WTPD 4XZQB 2Y2LA 3WKJB 5B32C 1P3PC 3LJAD 3AZHC 3X1VB 5DNMA 5CP6D 3W97B 2G5IC 3C1BA 3UTAB 5GSUB 3AZJB 4WJ3C 1BH9B 3MGQD 1M19B 3LELB 3W98A 2BYMB 2L5AA 3C1CC 3MGPC 5CPKD 5B33B 1TZYD 5AVCA 3W98B 5JA4B 3B6GC 3EPJA 4CAYA 2FJ7C 1P3FB 3A6NC 3B0CW 5B0ZD 3X1SB 3EG5B 3W98D 2BG1A 3W97A 4YS3D 3X1VA 4KUDD 3KWQD 2RIQA 3MGPD 2ZY3A 3MGQC 4DRBA 4KGCB 3WA9C 2BYKB 4H9RA 5B2IC 5AV6C 3W98C 3MGRB 5F99A 3MGPA 3W96C 5B2JD 1KX3A 4H9OA 4XZQD 5DNND 3MVDA 4Z66C 4H9QB 3WA9B 1TZYA 5AVCD 3MNNC 4J8VB 3AFAD 3A6NA 2PYOB 3AZMA 4WU8D 5CHLB 5B31G 1JFIB 4NE5A 1P3LA 3UTBB 5F99D 3X1TC 4YS3C 3REHD 5AV6D 4DRAA 3LZ0A 3VH5A 1P3IA 5BNVA 2ZY2A 5AV5D 2NQBB 3W99B 5B32B 3X1SC 4UPKA 3AZNA 2G5HC 5AV8C 4H9PA 4YM6B 3REKD 5B1LA 5AVBB 5B2IA 3KUYA 5B33C 3B0CT 1P3ID 1H3OA 2AROC 1TAFB 4UUZA 3RELA 3AZND 1M19C 3KFUG 3MVDC 5C3IB 3KXBA 3AZFD 4AWLC 2RVQC 3REIB 1S32A 1EQZB 2DQNC 4EO5C 3NQUB 1BH8B 2NQBC 3AZIC 3X1TA 1P3PA 4H9SA 3RELD 1P3IC 3X1TB 5DNMC 3AZKD 3LZ1A 1ZLAD 5BO0A 3AZIB 1EQZA 1S32B 5JRGD 1F66D 4JJND 3KXBB 5B24C 4R8PA 2FJ7A 1P3PD 5B2ID 4J8UD 5C3IC 4J8XD 2HIOC 2YFWA 3RELC 5DNMD 4G91C 5B2IB 5AVBA 5B1LB 3REKC 1P3MC 4WU8A 3AZMD 5GT0B 2NQBA 2XD5A 3VH6A 5DNNB 3LZ0B 3AV2C 5CP6C 4J8VC 1P3BC 1AOIB 2Y2GA 4Z2MH 3O62A 3WAAD 5G49B 4EO5B 3AZMB 5GT0C 1HTAA 3AZGB 1P3GD 1KX4D 2PYOA 4KGCD 4ZBJC 1P3OC 3WA9A 5B0YD 3V9RA 3MVDB 4JJNA 2W8SA 2HUEC 2Y2QA 3B0DB 3MGPB 3MGRA 3KWQA 3O62D 1ZLAC 4H9RB 3KXBD 3AZFA 4KGCA 5AVBD 4CSRB 4WU8C 3AZID 1B67A 3H0RC 4M6BA 4KUDC 3TU4D 2F8NK 5FUGB 2Y2IA 1P3BD 1P3AC 3LELD 1P3KD 3X1SA 5CPID 3WAAA 1P3FA 1EQZD 4CAYB 3AZGD 1P3OA 1F66A 5JA4A 4J8WC 5AVCB 4G91B 5BS7C 5B33A 3W97D 4WV4B 4WNNA 1M1AC 3LZ0D 2BYMA 3KWQC 3LELA 5GT3C 1M19A 2HIOD 3X1UB 5AVCC 4QLCB 4XUJC 1T3UA 3KXBC 1BH9A 4LD9A 5GSUA 3AZJA 5BNXB 1Z2CB 3AL0C 4YM6D 5KDMA 3C1BB 3UTAA 5DNMB 3AZLB 3W97C 2XD1A 3W99C 3X1VC 4J8XB 3WKJA 4XZQA 2DF4C 2Y2PA 5GT3D 5DNNC 3AZEC 3MGSD 3AN2B 1R4VA 4LD9D 3UTBC 5JRGB 1U35D 3AFAB 2PYOD 1F66C 1P3FD 5B0YA 1B6WA 5E5AD 1ZLAB 4XUJB 3X1TD 3B6FA 4H9NA 1ID3B 1M1AB 3LJAC 5AVBC 4Z5TC 3REKA 4J8WB 5GSUC 3AZJC 4J8WD 3AZEB 2F8NA 5GXQA 1KX5B 5CP6B 4YS3A 2FFFB 2YFVA 5B32G 1P3BA 3UT9C 4XUJD 3C1BC 5CPKC 5CPIA 5B1MD 2PYOC 4Z5TD 5AY8B 5B0YC 4DQYB 2CV5B 3MGSB 3AN2D 2NQBD 3WTPA 3AV1A 3C1CA 5AV5C 3AYWC 3REHB 2AROB 3AZKA 3UT9D 3NQJB 3AZLD 3LJAA 4WU9C 4Z5TA 3R45B 3MGQB 5B0ZA 2IO5C 3EPLA 5B1MB 3UTAD 5B40A 1WWIA 1HQ3B 3A1IA 4X23B 4J8UA 3AV1D 3AN2C 4QLCD 3X1VD 1P3AB 4KUDA 5B2JB 3REJA 3AZHB 3MGRD 5B31A 3WKJD 4X23D 3LZ1C 3AZLC 4HGAB 5CPKA 5AV9A 3VH6T 1EQZC 1P3FC 1U35A 3B6GB 5E5AC 3KUYD 5B24A 4WU9B 4QLCC 3AV1C 4E44A 1F1EA 1ID3D 3AYWA 3W96B 3W96A 1KX3C 3AZKC 3TU4B 4WU9A 4Z66A 2CWEA 5E5AB 3B0BA 4ZBJB 3MNNA 2CV5C 5B24B 5B0ZC 3FDDA 5AV8D 5B24D 1U35B 4ZUXB 5AV9B 5CPKB 4E45A 3WKJC 3AZHA 3REJB 1KX5C 4WZSB 5B1MC 3AZED 1N1JA 5AV8A 4X23A 1HQ3A 3C1BD 2UWXA 3VH5T 3R45A 1AOID 3LJAB 2HIOB 3X1UD 3AZHD 2AROA 3MGRC 3REHA 3MGSC 3C1CB 3AYWD 3AV1B 1P3AD 1P3KA 3WTPB 4KGCC 2CV5A 1S32C 4Z66D 5AY8A 2Y2HA 2NZDB 1PZRA 4G92B 5B1LD 5CPIB 5B40D 2F8NH 3UT9B 5GXQC 4HGAC 2LY8A 1AOIC 1P34A 4H9SC 1P3BB 4J8XC 4KHAA 1KX5A 3EPKA 5GXQB 3A6ND 4X23C 5CPJA 3WTPE 4AWLB 4R8PD 2FJ7D 4J8WA 3TU4C 5BS7A 5AV6A 2F8ND 1ID3C 3WTPC 1M1AA 5AV5A 3AV2D 2Y2MA 3P5JB 5GT3A 3KSYA 1P3KC 4XUJA 1M18A 3B6FB 5B0YB 1P3MA 3AZMC 2RVQD 3AFAA 1P3GB 1KX4B 5JRGA 5B40C 1M1AD 3AN2A 1Q9CA 3LZ0C 3AV2B 2Y2KA 3AV2A 4J8XA 3AZLA 4G92C 3O62C 1P3GA 3F6TA 1KX4A 5AV9C 2Y2OA 1P3MB 5KDMB 2JE5A 5BNXA 4LD9B 1M18B 3KUYC 4JJNC 5GT3B 3B6FC 4QLCA 3X1UA 5AV5B 3A1KA 3LZ1D 5AV6B 3IP4C 4WNNB 3VH6W 5BT1D 2NZDD 5CPJB 1S32D 1P3OB 1F66B 3AZGC 3WAAB 4KHAB 2Y2JA 1P34D 2JSSA 1P34B 5FUGA 4Z2MG 3UT9A 4ZUXC 5GT0D 1P3GC 1KX4C 2NZDA 1HQ3C 1P3OD 3WAAC 3MNND 3REID 4CSRA 1P3KB 4R8PC 3AZFB
chains in the Genus database with same CATH topology
3EPHA 3X1UC 2HIOA 3KWQB 2ZM5A 4NE3A 4NE6A 1M18D 4JJNB 5AY8C 3V9RB 4LD9C 1P3MD 5AV8B 1N1JB 3AZGA 2VQRA 5G49A 3O62B 5B33D 1AOIA 3W99D 3REJC 5B2JC 3W96D 4XZQC 4WU9D 4ZUXA 5DNNA 3MVDD 3AZNC 1M19D 3UTBD 2IO5B 5CPJC 1WWSA 5GT0A 3B6GD 3MNNB 4WU8B 2J8PA 5E5AA 4Z66B 3TU4A 3WA9D 3C1CD 3AYWB 2YFWB 2Y2NA 2HUEB 3B0DC 1M18C 3B6GA 4R8PB 2FJ7B 5CPJD 5BT1C 5GXQD 5JRGC 4YM6C 2ZY4A 3AZIA 5BO0B 5B31B 3LZ1B 3REJD 2AROD 5B2JA 1KX3D 4KUDB 1P3AA 4J8UB 1P3PB 5B40B 5B1MA 4ZUXD 1BH8A 5AY8D 5CPIC 3X1SD 5B0ZB 3NQUA 3MGQA 4Z5TB 1A7WA 3REIA 1BFMA 3NQJA 3AZKB 5F99C 4UUZB 1TAFA 3RELB 3REHC 3LELC 3MGSA 1H3OB 1KX5D 3H0MC 1TZYC 3KUYB 2F2AC 3UTAC 1P3LC 3B6FD 4H9PB 4YM6A 4J8UC 2JCHA 3AZNB 5B32A 1P34C 1KU5A 3W99A 2YFVB 5CP6A 5BNVB 4YS3B 1P3IB 5B31C 2F8NG 2F8NB 2ZY5A 5AV9D 3AZEA 1HQ3D 2NZDC 3UTBA 1P3LB 1U35C 5B1LC 3REKB 1JFIA 3A6NB 4NFTA 4J8VA 3REIC 5B32D 1TZYB 4H9QA 1ID3A 3VH5W 4H9OB 4H9NB 1ULYA 1KX3B 5F99B 1ZLAA 5B31D 3AZFC 2CV5D 3H0LC 2BYKA 4J8VD 5GSUD 3AZJD 3AFAC 1P3LD 1W2EA 3WTPD 4XZQB 2Y2LA 3WKJB 5B32C 1P3PC 3LJAD 3AZHC 3X1VB 5DNMA 5CP6D 3W97B 2G5IC 3C1BA 3UTAB 5GSUB 3AZJB 4WJ3C 1BH9B 3MGQD 1M19B 3LELB 3W98A 2BYMB 2L5AA 3C1CC 3MGPC 5CPKD 5B33B 1TZYD 5AVCA 3W98B 5JA4B 3B6GC 3EPJA 4CAYA 2FJ7C 1P3FB 3A6NC 3B0CW 5B0ZD 3X1SB 3EG5B 3W98D 2BG1A 3W97A 4YS3D 3X1VA 4KUDD 3KWQD 2RIQA 3MGPD 2ZY3A 3MGQC 4DRBA 4KGCB 3WA9C 2BYKB 4H9RA 5B2IC 5AV6C 3W98C 3MGRB 5F99A 3MGPA 3W96C 5B2JD 1KX3A 4H9OA 4XZQD 5DNND 3MVDA 4Z66C 4H9QB 3WA9B 1TZYA 5AVCD 3MNNC 4J8VB 3AFAD 3A6NA 2PYOB 3AZMA 4WU8D 5CHLB 5B31G 1JFIB 4NE5A 1P3LA 3UTBB 5F99D 3X1TC 4YS3C 3REHD 5AV6D 4DRAA 3LZ0A 3VH5A 1P3IA 5BNVA 2ZY2A 5AV5D 2NQBB 3W99B 5B32B 3X1SC 4UPKA 3AZNA 2G5HC 5AV8C 4H9PA 4YM6B 3REKD 5B1LA 5AVBB 5B2IA 3KUYA 5B33C 3B0CT 1P3ID 1H3OA 2AROC 1TAFB 4UUZA 3RELA 3AZND 1M19C 3KFUG 3MVDC 5C3IB 3KXBA 3AZFD 4AWLC 2RVQC 3REIB 1S32A 1EQZB 2DQNC 4EO5C 3NQUB 1BH8B 2NQBC 3AZIC 3X1TA 1P3PA 4H9SA 3RELD 1P3IC 3X1TB 5DNMC 3AZKD 3LZ1A 1ZLAD 5BO0A 3AZIB 1EQZA 1S32B 5JRGD 1F66D 4JJND 3KXBB 5B24C 4R8PA 2FJ7A 1P3PD 5B2ID 4J8UD 5C3IC 4J8XD 2HIOC 2YFWA 3RELC 5DNMD 4G91C 5B2IB 5AVBA 5B1LB 3REKC 1P3MC 4WU8A 3AZMD 5GT0B 2NQBA 2XD5A 3VH6A 5DNNB 3LZ0B 3AV2C 5CP6C 4J8VC 1P3BC 1AOIB 2Y2GA 4Z2MH 3O62A 3WAAD 5G49B 4EO5B 3AZMB 5GT0C 1HTAA 3AZGB 1P3GD 1KX4D 2PYOA 4KGCD 4ZBJC 1P3OC 3WA9A 5B0YD 3V9RA 3MVDB 4JJNA 2W8SA 2HUEC 2Y2QA 3B0DB 3MGPB 3MGRA 3KWQA 3O62D 1ZLAC 4H9RB 3KXBD 3AZFA 4KGCA 5AVBD 4CSRB 4WU8C 3AZID 1B67A 3H0RC 4M6BA 4KUDC 3TU4D 2F8NK 5FUGB 2Y2IA 1P3BD 1P3AC 3LELD 1P3KD 3X1SA 5CPID 3WAAA 1P3FA 1EQZD 4CAYB 3AZGD 1P3OA 1F66A 5JA4A 4J8WC 5AVCB 4G91B 5BS7C 5B33A 3W97D 4WV4B 4WNNA 1M1AC 3LZ0D 2BYMA 3KWQC 3LELA 5GT3C 1M19A 2HIOD 3X1UB 5AVCC 4QLCB 4XUJC 1T3UA 3KXBC 1BH9A 4LD9A 5GSUA 3AZJA 5BNXB 1Z2CB 3AL0C 4YM6D 5KDMA 3C1BB 3UTAA 5DNMB 3AZLB 3W97C 2XD1A 3W99C 3X1VC 4J8XB 3WKJA 4XZQA 2DF4C 2Y2PA 5GT3D 5DNNC 3AZEC 3MGSD 3AN2B 1R4VA 4LD9D 3UTBC 5JRGB 1U35D 3AFAB 2PYOD 1F66C 1P3FD 5B0YA 1B6WA 5E5AD 1ZLAB 4XUJB 3X1TD 3B6FA 4H9NA 1ID3B 1M1AB 3LJAC 5AVBC 4Z5TC 3REKA 4J8WB 5GSUC 3AZJC 4J8WD 3AZEB 2F8NA 5GXQA 1KX5B 5CP6B 4YS3A 2FFFB 2YFVA 5B32G 1P3BA 3UT9C 4XUJD 3C1BC 5CPKC 5CPIA 5B1MD 2PYOC 4Z5TD 5AY8B 5B0YC 4DQYB 2CV5B 3MGSB 3AN2D 2NQBD 3WTPA 3AV1A 3C1CA 5AV5C 3AYWC 3REHB 2AROB 3AZKA 3UT9D 3NQJB 3AZLD 3LJAA 4WU9C 4Z5TA 3R45B 3MGQB 5B0ZA 2IO5C 3EPLA 5B1MB 3UTAD 5B40A 1WWIA 1HQ3B 3A1IA 4X23B 4J8UA 3AV1D 3AN2C 4QLCD 3X1VD 1P3AB 4KUDA 5B2JB 3REJA 3AZHB 3MGRD 5B31A 3WKJD 4X23D 3LZ1C 3AZLC 4HGAB 5CPKA 5AV9A 3VH6T 1EQZC 1P3FC 1U35A 3B6GB 5E5AC 3KUYD 5B24A 4WU9B 4QLCC 3AV1C 4E44A 1F1EA 1ID3D 3AYWA 3W96B 3W96A 1KX3C 3AZKC 3TU4B 4WU9A 4Z66A 2CWEA 5E5AB 3B0BA 4ZBJB 3MNNA 2CV5C 5B24B 5B0ZC 3FDDA 5AV8D 5B24D 1U35B 4ZUXB 5AV9B 5CPKB 4E45A 3WKJC 3AZHA 3REJB 1KX5C 4WZSB 5B1MC 3AZED 1N1JA 5AV8A 4X23A 1HQ3A 3C1BD 2UWXA 3VH5T 3R45A 1AOID 3LJAB 2HIOB 3X1UD 3AZHD 2AROA 3MGRC 3REHA 3MGSC 3C1CB 3AYWD 3AV1B 1P3AD 1P3KA 3WTPB 4KGCC 2CV5A 1S32C 4Z66D 5AY8A 2Y2HA 2NZDB 1PZRA 4G92B 5B1LD 5CPIB 5B40D 2F8NH 3UT9B 5GXQC 4HGAC 2LY8A 1AOIC 1P34A 4H9SC 1P3BB 4J8XC 4KHAA 1KX5A 3EPKA 5GXQB 3A6ND 4X23C 5CPJA 3WTPE 4AWLB 4R8PD 2FJ7D 4J8WA 3TU4C 5BS7A 5AV6A 2F8ND 1ID3C 3WTPC 1M1AA 5AV5A 3AV2D 2Y2MA 3P5JB 5GT3A 3KSYA 1P3KC 4XUJA 1M18A 3B6FB 5B0YB 1P3MA 3AZMC 2RVQD 3AFAA 1P3GB 1KX4B 5JRGA 5B40C 1M1AD 3AN2A 1Q9CA 3LZ0C 3AV2B 2Y2KA 3AV2A 4J8XA 3AZLA 4G92C 3O62C 1P3GA 3F6TA 1KX4A 5AV9C 2Y2OA 1P3MB 5KDMB 2JE5A 5BNXA 4LD9B 1M18B 3KUYC 4JJNC 5GT3B 3B6FC 4QLCA 3X1UA 5AV5B 3A1KA 3LZ1D 5AV6B 3IP4C 4WNNB 3VH6W 5BT1D 2NZDD 5CPJB 1S32D 1P3OB 1F66B 3AZGC 3WAAB 4KHAB 2Y2JA 1P34D 2JSSA 1P34B 5FUGA 4Z2MG 3UT9A 4ZUXC 5GT0D 1P3GC 1KX4C 2NZDA 1HQ3C 1P3OD 3WAAC 3MNND 3REID 4CSRA 1P3KB 4R8PC 3AZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U C;  2HIO A;  3KWQ B;  4NE3 A;  4NE6 A;  1M18 D;  4JJN B;  5AY8 C;  3V9R B;  4LD9 C;  1P3M D;  5AV8 B;  1N1J B;  3AZG A;  5G49 A;  3O62 B;  5B33 D;  1AOI A;  3W99 D;  3REJ C;  5B2J C;  3W96 D;  4XZQ C;  4WU9 D;  4ZUX A;  5DNN A;  3MVD D;  3AZN C;  1M19 D;  3UTB D;  2IO5 B;  5CPJ C;  1WWS A;  5GT0 A;  3B6G D;  3MNN B;  4WU8 B;  5E5A A;  4Z66 B;  3TU4 A;  3WA9 D;  3C1C D;  3AYW B;  2YFW B;  2HUE B;  3B0D C;  1M18 C;  3B6G A;  4R8P B;  2FJ7 B;  5CPJ D;  5BT1 C;  5GXQ D;  5JRG C;  4YM6 C;  3AZI A;  5BO0 B;  5B31 B;  3LZ1 B;  3REJ D;  2ARO D;  5B2J A;  1KX3 D;  4KUD B;  1P3A A;  4J8U B;  1P3P B;  5B40 B;  5B1M A;  4ZUX D;  1BH8 A;  5AY8 D;  5CPI C;  3X1S D;  5B0Z B;  3NQU A;  3MGQ A;  4Z5T B;  1A7W A;  3REI A;  1BFM A;  3NQJ A;  3AZK B;  5F99 C;  4UUZ B;  1TAF A;  3REL B;  3REH C;  3LEL C;  3MGS A;  1H3O B;  1KX5 D;  1TZY C;  3KUY B;  3UTA C;  1P3L C;  3B6F D;  4H9P B;  4YM6 A;  4J8U C;  3AZN B;  5B32 A;  1P34 C;  1KU5 A;  3W99 A;  2YFV B;  5CP6 A;  5BNV B;  4YS3 B;  1P3I B;  5B31 C;  2F8N G;  2F8N B;  5AV9 D;  3AZE A;  1HQ3 D;  2NZD C;  3UTB A;  1P3L B;  1U35 C;  5B1L C;  3REK B;  1JFI A;  3A6N B;  4NFT A;  4J8V A;  3REI C;  5B32 D;  1TZY B;  4H9Q A;  1ID3 A;  3VH5 W;  4H9O B;  4H9N B;  1ULY A;  1KX3 B;  5F99 B;  1ZLA A;  5B31 D;  3AZF C;  2CV5 D;  2BYK A;  4J8V D;  5GSU D;  3AZJ D;  3AFA C;  1P3L D;  3WTP D;  4XZQ B;  3WKJ B;  5B32 C;  1P3P C;  3LJA D;  3AZH C;  3X1V B;  5DNM A;  5CP6 D;  3W97 B;  3C1B A;  3UTA B;  5GSU B;  3AZJ B;  1BH9 B;  3MGQ D;  1M19 B;  3LEL B;  3W98 A;  2BYM B;  2L5A A;  3C1C C;  3MGP C;  5CPK D;  5B33 B;  1TZY D;  5AVC A;  3W98 B;  5JA4 B;  3B6G C;  4CAY A;  2FJ7 C;  1P3F B;  3A6N C;  3B0C W;  5B0Z D;  3X1S B;  3W98 D;  3W97 A;  4YS3 D;  3X1V A;  4KUD D;  3KWQ D;  3MGP D;  3MGQ C;  4DRB A;  4KGC B;  3WA9 C;  2BYK B;  4H9R A;  5B2I C;  5AV6 C;  3W98 C;  3MGR B;  5F99 A;  3MGP A;  3W96 C;  5B2J D;  1KX3 A;  4H9O A;  4XZQ D;  5DNN D;  3MVD A;  4Z66 C;  4H9Q B;  3WA9 B;  1TZY A;  5AVC D;  3MNN C;  4J8V B;  3AFA D;  3A6N A;  2PYO B;  3AZM A;  4WU8 D;  5CHL B;  5B31 G;  1JFI B;  4NE5 A;  1P3L A;  3UTB B;  5F99 D;  3X1T C;  4YS3 C;  3REH D;  5AV6 D;  4DRA A;  3LZ0 A;  3VH5 A;  1P3I A;  5BNV A;  5AV5 D;  2NQB B;  3W99 B;  5B32 B;  3X1S C;  3AZN A;  5AV8 C;  4H9P A;  4YM6 B;  3REK D;  5B1L A;  5AVB B;  5B2I A;  3KUY A;  5B33 C;  3B0C T;  1P3I D;  1H3O A;  2ARO C;  1TAF B;  4UUZ A;  3REL A;  3AZN D;  1M19 C;  3MVD C;  5C3I B;  3KXB A;  3AZF D;  4AWL C;  2RVQ C;  3REI B;  1S32 A;  1EQZ B;  4EO5 C;  3NQU B;  1BH8 B;  2NQB C;  3AZI C;  3X1T A;  1P3P A;  4H9S A;  3REL D;  1P3I C;  3X1T B;  5DNM C;  3AZK D;  3LZ1 A;  1ZLA D;  5BO0 A;  3AZI B;  1EQZ A;  1S32 B;  5JRG D;  1F66 D;  4JJN D;  3KXB B;  5B24 C;  4R8P A;  2FJ7 A;  1P3P D;  5B2I D;  4J8U D;  5C3I C;  4J8X D;  2HIO C;  2YFW A;  3REL C;  5DNM D;  4G91 C;  5B2I B;  5AVB A;  5B1L B;  3REK C;  1P3M C;  4WU8 A;  3AZM D;  5GT0 B;  2NQB A;  3VH6 A;  5DNN B;  3LZ0 B;  3AV2 C;  5CP6 C;  4J8V C;  1P3B C;  1AOI B;  4Z2M H;  3O62 A;  3WAA D;  5G49 B;  4EO5 B;  3AZM B;  5GT0 C;  1HTA A;  3AZG B;  1P3G D;  1KX4 D;  2PYO A;  4KGC D;  4ZBJ C;  1P3O C;  3WA9 A;  5B0Y D;  3V9R A;  3MVD B;  4JJN A;  2HUE C;  3B0D B;  3MGP B;  3MGR A;  3KWQ A;  3O62 D;  1ZLA C;  4H9R B;  3KXB D;  3AZF A;  4KGC A;  5AVB D;  4CSR B;  4WU8 C;  3AZI D;  1B67 A;  4M6B A;  4KUD C;  3TU4 D;  2F8N K;  5FUG B;  1P3B D;  1P3A C;  3LEL D;  1P3K D;  3X1S A;  5CPI D;  3WAA A;  1P3F A;  1EQZ D;  4CAY B;  3AZG D;  1P3O A;  1F66 A;  5JA4 A;  4J8W C;  5AVC B;  4G91 B;  5BS7 C;  5B33 A;  3W97 D;  4WV4 B;  4WNN A;  1M1A C;  3LZ0 D;  2BYM A;  3KWQ C;  3LEL A;  5GT3 C;  1M19 A;  2HIO D;  3X1U B;  5AVC C;  4QLC B;  4XUJ C;  3KXB C;  1BH9 A;  4LD9 A;  5GSU A;  3AZJ A;  5BNX B;  4YM6 D;  5KDM A;  3C1B B;  3UTA A;  5DNM B;  3AZL B;  3W97 C;  3W99 C;  3X1V C;  4J8X B;  3WKJ A;  4XZQ A;  5GT3 D;  5DNN C;  3AZE C;  3MGS D;  3AN2 B;  1R4V A;  4LD9 D;  3UTB C;  5JRG B;  1U35 D;  3AFA B;  2PYO D;  1F66 C;  1P3F D;  5B0Y A;  1B6W A;  5E5A D;  1ZLA B;  4XUJ B;  3X1T D;  3B6F A;  4H9N A;  1ID3 B;  1M1A B;  3LJA C;  5AVB C;  4Z5T C;  3REK A;  4J8W B;  5GSU C;  3AZJ C;  4J8W D;  3AZE B;  2F8N A;  5GXQ A;  1KX5 B;  5CP6 B;  4YS3 A;  2YFV A;  5B32 G;  1P3B A;  3UT9 C;  4XUJ D;  3C1B C;  5CPK C;  5CPI A;  5B1M D;  2PYO C;  4Z5T D;  5AY8 B;  5B0Y C;  2CV5 B;  3MGS B;  3AN2 D;  2NQB D;  3WTP A;  3AV1 A;  3C1C A;  5AV5 C;  3AYW C;  3REH B;  2ARO B;  3AZK A;  3UT9 D;  3NQJ B;  3AZL D;  3LJA A;  4WU9 C;  4Z5T A;  3R45 B;  3MGQ B;  5B0Z A;  2IO5 C;  5B1M B;  3UTA D;  5B40 A;  1WWI A;  1HQ3 B;  4X23 B;  4J8U A;  3AV1 D;  1P3A B;  3AN2 C;  4QLC D;  3X1V D;  4KUD A;  5B2J B;  3REJ A;  3AZH B;  3MGR D;  5B31 A;  3WKJ D;  4X23 D;  3LZ1 C;  3AZL C;  4HGA B;  5CPK A;  5AV9 A;  3VH6 T;  1EQZ C;  1P3F C;  1U35 A;  3B6G B;  5E5A C;  3KUY D;  5B24 A;  4WU9 B;  4QLC C;  3AV1 C;  4E44 A;  1F1E A;  1ID3 D;  3AYW A;  3W96 B;  3W96 A;  1KX3 C;  3AZK C;  3TU4 B;  4WU9 A;  4Z66 A;  2CWE A;  5E5A B;  3B0B A;  4ZBJ B;  3MNN A;  2CV5 C;  5B24 B;  5B0Z C;  5AV8 D;  5B24 D;  1U35 B;  4ZUX B;  5AV9 B;  5CPK B;  4E45 A;  3WKJ C;  3AZH A;  3REJ B;  1KX5 C;  4WZS B;  5B1M C;  3AZE D;  1N1J A;  5AV8 A;  4X23 A;  1HQ3 A;  3C1B D;  3VH5 T;  3R45 A;  1AOI D;  3LJA B;  2HIO B;  3X1U D;  3AZH D;  2ARO A;  3MGR C;  3REH A;  3MGS C;  3C1C B;  3AYW D;  3AV1 B;  1P3A D;  1P3K A;  3WTP B;  4KGC C;  2CV5 A;  1S32 C;  4Z66 D;  5AY8 A;  2NZD B;  4G92 B;  5B1L D;  5CPI B;  5B40 D;  2F8N H;  3UT9 B;  5GXQ C;  4HGA C;  2LY8 A;  1AOI C;  1P34 A;  4H9S C;  1P3B B;  4J8X C;  4KHA A;  1KX5 A;  5GXQ B;  3A6N D;  4X23 C;  5CPJ A;  3WTP E;  4AWL B;  4R8P D;  2FJ7 D;  4J8W A;  3TU4 C;  5BS7 A;  5AV6 A;  2F8N D;  1ID3 C;  3WTP C;  1M1A A;  5AV5 A;  3AV2 D;  5GT3 A;  3KSY A;  1P3K C;  4XUJ A;  1M18 A;  3B6F B;  5B0Y B;  1P3M A;  3AZM C;  2RVQ D;  3AFA A;  1P3G B;  1KX4 B;  5JRG A;  5B40 C;  1M1A D;  3AN2 A;  1Q9C A;  3LZ0 C;  3AV2 B;  3AV2 A;  4J8X A;  3AZL A;  4G92 C;  3O62 C;  1P3G A;  1KX4 A;  5AV9 C;  1P3M B;  5KDM B;  5BNX A;  4LD9 B;  1M18 B;  3KUY C;  4JJN C;  5GT3 B;  3B6F C;  4QLC A;  3X1U A;  5AV5 B;  3LZ1 D;  5AV6 B;  4WNN B;  3VH6 W;  5BT1 D;  2NZD D;  5CPJ B;  1S32 D;  1P3O B;  1F66 B;  3AZG C;  3WAA B;  4KHA B;  1P34 D;  2JSS A;  1P34 B;  5FUG A;  4Z2M G;  3UT9 A;  4ZUX C;  5GT0 D;  1P3G C;  1KX4 C;  2NZD A;  1HQ3 C;  1P3O D;  3WAA C;  3MNN D;  3REI D;  4CSR A;  1P3K B;  4R8P C;  3AZF B; 
#chains in the Genus database with same CATH topology
 3EPH A;  3X1U C;  2HIO A;  3KWQ B;  2ZM5 A;  4NE3 A;  4NE6 A;  1M18 D;  4JJN B;  5AY8 C;  3V9R B;  4LD9 C;  1P3M D;  5AV8 B;  1N1J B;  3AZG A;  2VQR A;  5G49 A;  3O62 B;  5B33 D;  1AOI A;  3W99 D;  3REJ C;  5B2J C;  3W96 D;  4XZQ C;  4WU9 D;  4ZUX A;  5DNN A;  3MVD D;  3AZN C;  1M19 D;  3UTB D;  2IO5 B;  5CPJ C;  1WWS A;  5GT0 A;  3B6G D;  3MNN B;  4WU8 B;  2J8P A;  5E5A A;  4Z66 B;  3TU4 A;  3WA9 D;  3C1C D;  3AYW B;  2YFW B;  2Y2N A;  2HUE B;  3B0D C;  1M18 C;  3B6G A;  4R8P B;  2FJ7 B;  5CPJ D;  5BT1 C;  5GXQ D;  5JRG C;  4YM6 C;  2ZY4 A;  3AZI A;  5BO0 B;  5B31 B;  3LZ1 B;  3REJ D;  2ARO D;  5B2J A;  1KX3 D;  4KUD B;  1P3A A;  4J8U B;  1P3P B;  5B40 B;  5B1M A;  4ZUX D;  1BH8 A;  5AY8 D;  5CPI C;  3X1S D;  5B0Z B;  3NQU A;  3MGQ A;  4Z5T B;  1A7W A;  3REI A;  1BFM A;  3NQJ A;  3AZK B;  5F99 C;  4UUZ B;  1TAF A;  3REL B;  3REH C;  3LEL C;  3MGS A;  1H3O B;  1KX5 D;  3H0M C;  1TZY C;  3KUY B;  2F2A C;  3UTA C;  1P3L C;  3B6F D;  4H9P B;  4YM6 A;  4J8U C;  2JCH A;  3AZN B;  5B32 A;  1P34 C;  1KU5 A;  3W99 A;  2YFV B;  5CP6 A;  5BNV B;  4YS3 B;  1P3I B;  5B31 C;  2F8N G;  2F8N B;  2ZY5 A;  5AV9 D;  3AZE A;  1HQ3 D;  2NZD C;  3UTB A;  1P3L B;  1U35 C;  5B1L C;  3REK B;  1JFI A;  3A6N B;  4NFT A;  4J8V A;  3REI C;  5B32 D;  1TZY B;  4H9Q A;  1ID3 A;  3VH5 W;  4H9O B;  4H9N B;  1ULY A;  1KX3 B;  5F99 B;  1ZLA A;  5B31 D;  3AZF C;  2CV5 D;  3H0L C;  2BYK A;  4J8V D;  5GSU D;  3AZJ D;  3AFA C;  1P3L D;  1W2E A;  3WTP D;  4XZQ B;  2Y2L A;  3WKJ B;  5B32 C;  1P3P C;  3LJA D;  3AZH C;  3X1V B;  5DNM A;  5CP6 D;  3W97 B;  2G5I C;  3C1B A;  3UTA B;  5GSU B;  3AZJ B;  4WJ3 C;  1BH9 B;  3MGQ D;  1M19 B;  3LEL B;  3W98 A;  2BYM B;  2L5A A;  3C1C C;  3MGP C;  5CPK D;  5B33 B;  1TZY D;  5AVC A;  3W98 B;  5JA4 B;  3B6G C;  3EPJ A;  4CAY A;  2FJ7 C;  1P3F B;  3A6N C;  3B0C W;  5B0Z D;  3X1S B;  3EG5 B;  3W98 D;  2BG1 A;  3W97 A;  4YS3 D;  3X1V A;  4KUD D;  3KWQ D;  2RIQ A;  3MGP D;  2ZY3 A;  3MGQ C;  4DRB A;  4KGC B;  3WA9 C;  2BYK B;  4H9R A;  5B2I C;  5AV6 C;  3W98 C;  3MGR B;  5F99 A;  3MGP A;  3W96 C;  5B2J D;  1KX3 A;  4H9O A;  4XZQ D;  5DNN D;  3MVD A;  4Z66 C;  4H9Q B;  3WA9 B;  1TZY A;  5AVC D;  3MNN C;  4J8V B;  3AFA D;  3A6N A;  2PYO B;  3AZM A;  4WU8 D;  5CHL B;  5B31 G;  1JFI B;  4NE5 A;  1P3L A;  3UTB B;  5F99 D;  3X1T C;  4YS3 C;  3REH D;  5AV6 D;  4DRA A;  3LZ0 A;  3VH5 A;  1P3I A;  5BNV A;  2ZY2 A;  5AV5 D;  2NQB B;  3W99 B;  5B32 B;  3X1S C;  4UPK A;  3AZN A;  2G5H C;  5AV8 C;  4H9P A;  4YM6 B;  3REK D;  5B1L A;  5AVB B;  5B2I A;  3KUY A;  5B33 C;  3B0C T;  1P3I D;  1H3O A;  2ARO C;  1TAF B;  4UUZ A;  3REL A;  3AZN D;  1M19 C;  3KFU G;  3MVD C;  5C3I B;  3KXB A;  3AZF D;  4AWL C;  2RVQ C;  3REI B;  1S32 A;  1EQZ B;  2DQN C;  4EO5 C;  3NQU B;  1BH8 B;  2NQB C;  3AZI C;  3X1T A;  1P3P A;  4H9S A;  3REL D;  1P3I C;  3X1T B;  5DNM C;  3AZK D;  3LZ1 A;  1ZLA D;  5BO0 A;  3AZI B;  1EQZ A;  1S32 B;  5JRG D;  1F66 D;  4JJN D;  3KXB B;  5B24 C;  4R8P A;  2FJ7 A;  1P3P D;  5B2I D;  4J8U D;  5C3I C;  4J8X D;  2HIO C;  2YFW A;  3REL C;  5DNM D;  4G91 C;  5B2I B;  5AVB A;  5B1L B;  3REK C;  1P3M C;  4WU8 A;  3AZM D;  5GT0 B;  2NQB A;  2XD5 A;  3VH6 A;  5DNN B;  3LZ0 B;  3AV2 C;  5CP6 C;  4J8V C;  1P3B C;  1AOI B;  2Y2G A;  4Z2M H;  3O62 A;  3WAA D;  5G49 B;  4EO5 B;  3AZM B;  5GT0 C;  1HTA A;  3AZG B;  1P3G D;  1KX4 D;  2PYO A;  4KGC D;  4ZBJ C;  1P3O C;  3WA9 A;  5B0Y D;  3V9R A;  3MVD B;  4JJN A;  2W8S A;  2HUE C;  2Y2Q A;  3B0D B;  3MGP B;  3MGR A;  3KWQ A;  3O62 D;  1ZLA C;  4H9R B;  3KXB D;  3AZF A;  4KGC A;  5AVB D;  4CSR B;  4WU8 C;  3AZI D;  1B67 A;  3H0R C;  4M6B A;  4KUD C;  3TU4 D;  2F8N K;  5FUG B;  2Y2I A;  1P3B D;  1P3A C;  3LEL D;  1P3K D;  3X1S A;  5CPI D;  3WAA A;  1P3F A;  1EQZ D;  4CAY B;  3AZG D;  1P3O A;  1F66 A;  5JA4 A;  4J8W C;  5AVC B;  4G91 B;  5BS7 C;  5B33 A;  3W97 D;  4WV4 B;  4WNN A;  1M1A C;  3LZ0 D;  2BYM A;  3KWQ C;  3LEL A;  5GT3 C;  1M19 A;  2HIO D;  3X1U B;  5AVC C;  4QLC B;  4XUJ C;  1T3U A;  3KXB C;  1BH9 A;  4LD9 A;  5GSU A;  3AZJ A;  5BNX B;  1Z2C B;  3AL0 C;  4YM6 D;  5KDM A;  3C1B B;  3UTA A;  5DNM B;  3AZL B;  3W97 C;  2XD1 A;  3W99 C;  3X1V C;  4J8X B;  3WKJ A;  4XZQ A;  2DF4 C;  2Y2P A;  5GT3 D;  5DNN C;  3AZE C;  3MGS D;  3AN2 B;  1R4V A;  4LD9 D;  3UTB C;  5JRG B;  1U35 D;  3AFA B;  2PYO D;  1F66 C;  1P3F D;  5B0Y A;  1B6W A;  5E5A D;  1ZLA B;  4XUJ B;  3X1T D;  3B6F A;  4H9N A;  1ID3 B;  1M1A B;  3LJA C;  5AVB C;  4Z5T C;  3REK A;  4J8W B;  5GSU C;  3AZJ C;  4J8W D;  3AZE B;  2F8N A;  5GXQ A;  1KX5 B;  5CP6 B;  4YS3 A;  2FFF B;  2YFV A;  5B32 G;  1P3B A;  3UT9 C;  4XUJ D;  3C1B C;  5CPK C;  5CPI A;  5B1M D;  2PYO C;  4Z5T D;  5AY8 B;  5B0Y C;  4DQY B;  2CV5 B;  3MGS B;  3AN2 D;  2NQB D;  3WTP A;  3AV1 A;  3C1C A;  5AV5 C;  3AYW C;  3REH B;  2ARO B;  3AZK A;  3UT9 D;  3NQJ B;  3AZL D;  3LJA A;  4WU9 C;  4Z5T A;  3R45 B;  3MGQ B;  5B0Z A;  2IO5 C;  3EPL A;  5B1M B;  3UTA D;  5B40 A;  1WWI A;  1HQ3 B;  3A1I A;  4X23 B;  4J8U A;  3AV1 D;  3AN2 C;  4QLC D;  3X1V D;  1P3A B;  4KUD A;  5B2J B;  3REJ A;  3AZH B;  3MGR D;  5B31 A;  3WKJ D;  4X23 D;  3LZ1 C;  3AZL C;  4HGA B;  5CPK A;  5AV9 A;  3VH6 T;  1EQZ C;  1P3F C;  1U35 A;  3B6G B;  5E5A C;  3KUY D;  5B24 A;  4WU9 B;  4QLC C;  3AV1 C;  4E44 A;  1F1E A;  1ID3 D;  3AYW A;  3W96 B;  3W96 A;  1KX3 C;  3AZK C;  3TU4 B;  4WU9 A;  4Z66 A;  2CWE A;  5E5A B;  3B0B A;  4ZBJ B;  3MNN A;  2CV5 C;  5B24 B;  5B0Z C;  3FDD A;  5AV8 D;  5B24 D;  1U35 B;  4ZUX B;  5AV9 B;  5CPK B;  4E45 A;  3WKJ C;  3AZH A;  3REJ B;  1KX5 C;  4WZS B;  5B1M C;  3AZE D;  1N1J A;  5AV8 A;  4X23 A;  1HQ3 A;  3C1B D;  2UWX A;  3VH5 T;  3R45 A;  1AOI D;  3LJA B;  2HIO B;  3X1U D;  3AZH D;  2ARO A;  3MGR C;  3REH A;  3MGS C;  3C1C B;  3AYW D;  3AV1 B;  1P3A D;  1P3K A;  3WTP B;  4KGC C;  2CV5 A;  1S32 C;  4Z66 D;  5AY8 A;  2Y2H A;  2NZD B;  1PZR A;  4G92 B;  5B1L D;  5CPI B;  5B40 D;  2F8N H;  3UT9 B;  5GXQ C;  4HGA C;  2LY8 A;  1AOI C;  1P34 A;  4H9S C;  1P3B B;  4J8X C;  4KHA A;  1KX5 A;  3EPK A;  5GXQ B;  3A6N D;  4X23 C;  5CPJ A;  3WTP E;  4AWL B;  4R8P D;  2FJ7 D;  4J8W A;  3TU4 C;  5BS7 A;  5AV6 A;  2F8N D;  1ID3 C;  3WTP C;  1M1A A;  5AV5 A;  3AV2 D;  2Y2M A;  3P5J B;  5GT3 A;  3KSY A;  1P3K C;  4XUJ A;  1M18 A;  3B6F B;  5B0Y B;  1P3M A;  3AZM C;  2RVQ D;  3AFA A;  1P3G B;  1KX4 B;  5JRG A;  5B40 C;  1M1A D;  3AN2 A;  1Q9C A;  3LZ0 C;  3AV2 B;  2Y2K A;  3AV2 A;  4J8X A;  3AZL A;  4G92 C;  3O62 C;  1P3G A;  3F6T A;  1KX4 A;  5AV9 C;  2Y2O A;  1P3M B;  5KDM B;  2JE5 A;  5BNX A;  4LD9 B;  1M18 B;  3KUY C;  4JJN C;  5GT3 B;  3B6F C;  4QLC A;  3X1U A;  5AV5 B;  3A1K A;  3LZ1 D;  5AV6 B;  3IP4 C;  4WNN B;  3VH6 W;  5BT1 D;  2NZD D;  5CPJ B;  1S32 D;  1P3O B;  1F66 B;  3AZG C;  3WAA B;  4KHA B;  2Y2J A;  1P34 D;  2JSS A;  1P34 B;  5FUG A;  4Z2M G;  3UT9 A;  4ZUX C;  5GT0 D;  1P3G C;  1KX4 C;  2NZD A;  1HQ3 C;  1P3O D;  3WAA C;  3MNN D;  3REI D;  4CSR A;  1P3K B;  4R8P C;  3AZF B; 
#chains in the Genus database with same CATH homology
 3EPH A;  3X1U C;  2HIO A;  3KWQ B;  2ZM5 A;  4NE3 A;  4NE6 A;  1M18 D;  4JJN B;  5AY8 C;  3V9R B;  4LD9 C;  1P3M D;  5AV8 B;  1N1J B;  3AZG A;  2VQR A;  5G49 A;  3O62 B;  5B33 D;  1AOI A;  3W99 D;  3REJ C;  5B2J C;  3W96 D;  4XZQ C;  4WU9 D;  4ZUX A;  5DNN A;  3MVD D;  3AZN C;  1M19 D;  3UTB D;  2IO5 B;  5CPJ C;  1WWS A;  5GT0 A;  3B6G D;  3MNN B;  4WU8 B;  2J8P A;  5E5A A;  4Z66 B;  3TU4 A;  3WA9 D;  3C1C D;  3AYW B;  2YFW B;  2Y2N A;  2HUE B;  3B0D C;  1M18 C;  3B6G A;  4R8P B;  2FJ7 B;  5CPJ D;  5BT1 C;  5GXQ D;  5JRG C;  4YM6 C;  2ZY4 A;  3AZI A;  5BO0 B;  5B31 B;  3LZ1 B;  3REJ D;  2ARO D;  5B2J A;  1KX3 D;  4KUD B;  1P3A A;  4J8U B;  1P3P B;  5B40 B;  5B1M A;  4ZUX D;  1BH8 A;  5AY8 D;  5CPI C;  3X1S D;  5B0Z B;  3NQU A;  3MGQ A;  4Z5T B;  1A7W A;  3REI A;  1BFM A;  3NQJ A;  3AZK B;  5F99 C;  4UUZ B;  1TAF A;  3REL B;  3REH C;  3LEL C;  3MGS A;  1H3O B;  1KX5 D;  3H0M C;  1TZY C;  3KUY B;  2F2A C;  3UTA C;  1P3L C;  3B6F D;  4H9P B;  4YM6 A;  4J8U C;  2JCH A;  3AZN B;  5B32 A;  1P34 C;  1KU5 A;  3W99 A;  2YFV B;  5CP6 A;  5BNV B;  4YS3 B;  1P3I B;  5B31 C;  2F8N G;  2F8N B;  2ZY5 A;  5AV9 D;  3AZE A;  1HQ3 D;  2NZD C;  3UTB A;  1P3L B;  1U35 C;  5B1L C;  3REK B;  1JFI A;  3A6N B;  4NFT A;  4J8V A;  3REI C;  5B32 D;  1TZY B;  4H9Q A;  1ID3 A;  3VH5 W;  4H9O B;  4H9N B;  1ULY A;  1KX3 B;  5F99 B;  1ZLA A;  5B31 D;  3AZF C;  2CV5 D;  3H0L C;  2BYK A;  4J8V D;  5GSU D;  3AZJ D;  3AFA C;  1P3L D;  1W2E A;  3WTP D;  4XZQ B;  2Y2L A;  3WKJ B;  5B32 C;  1P3P C;  3LJA D;  3AZH C;  3X1V B;  5DNM A;  5CP6 D;  3W97 B;  2G5I C;  3C1B A;  3UTA B;  5GSU B;  3AZJ B;  4WJ3 C;  1BH9 B;  3MGQ D;  1M19 B;  3LEL B;  3W98 A;  2BYM B;  2L5A A;  3C1C C;  3MGP C;  5CPK D;  5B33 B;  1TZY D;  5AVC A;  3W98 B;  5JA4 B;  3B6G C;  3EPJ A;  4CAY A;  2FJ7 C;  1P3F B;  3A6N C;  3B0C W;  5B0Z D;  3X1S B;  3EG5 B;  3W98 D;  2BG1 A;  3W97 A;  4YS3 D;  3X1V A;  4KUD D;  3KWQ D;  2RIQ A;  3MGP D;  2ZY3 A;  3MGQ C;  4DRB A;  4KGC B;  3WA9 C;  2BYK B;  4H9R A;  5B2I C;  5AV6 C;  3W98 C;  3MGR B;  5F99 A;  3MGP A;  3W96 C;  5B2J D;  1KX3 A;  4H9O A;  4XZQ D;  5DNN D;  3MVD A;  4Z66 C;  4H9Q B;  3WA9 B;  1TZY A;  5AVC D;  3MNN C;  4J8V B;  3AFA D;  3A6N A;  2PYO B;  3AZM A;  4WU8 D;  5CHL B;  5B31 G;  1JFI B;  4NE5 A;  1P3L A;  3UTB B;  5F99 D;  3X1T C;  4YS3 C;  3REH D;  5AV6 D;  4DRA A;  3LZ0 A;  3VH5 A;  1P3I A;  5BNV A;  2ZY2 A;  5AV5 D;  2NQB B;  3W99 B;  5B32 B;  3X1S C;  4UPK A;  3AZN A;  2G5H C;  5AV8 C;  4H9P A;  4YM6 B;  3REK D;  5B1L A;  5AVB B;  5B2I A;  3KUY A;  5B33 C;  3B0C T;  1P3I D;  1H3O A;  2ARO C;  1TAF B;  4UUZ A;  3REL A;  3AZN D;  1M19 C;  3KFU G;  3MVD C;  5C3I B;  3KXB A;  3AZF D;  4AWL C;  2RVQ C;  3REI B;  1S32 A;  1EQZ B;  2DQN C;  4EO5 C;  3NQU B;  1BH8 B;  2NQB C;  3AZI C;  3X1T A;  1P3P A;  4H9S A;  3REL D;  1P3I C;  3X1T B;  5DNM C;  3AZK D;  3LZ1 A;  1ZLA D;  5BO0 A;  3AZI B;  1EQZ A;  1S32 B;  5JRG D;  1F66 D;  4JJN D;  3KXB B;  5B24 C;  4R8P A;  2FJ7 A;  1P3P D;  5B2I D;  4J8U D;  5C3I C;  4J8X D;  2HIO C;  2YFW A;  3REL C;  5DNM D;  4G91 C;  5B2I B;  5AVB A;  5B1L B;  3REK C;  1P3M C;  4WU8 A;  3AZM D;  5GT0 B;  2NQB A;  2XD5 A;  3VH6 A;  5DNN B;  3LZ0 B;  3AV2 C;  5CP6 C;  4J8V C;  1P3B C;  1AOI B;  2Y2G A;  4Z2M H;  3O62 A;  3WAA D;  5G49 B;  4EO5 B;  3AZM B;  5GT0 C;  1HTA A;  3AZG B;  1P3G D;  1KX4 D;  2PYO A;  4KGC D;  4ZBJ C;  1P3O C;  3WA9 A;  5B0Y D;  3V9R A;  3MVD B;  4JJN A;  2W8S A;  2HUE C;  2Y2Q A;  3B0D B;  3MGP B;  3MGR A;  3KWQ A;  3O62 D;  1ZLA C;  4H9R B;  3KXB D;  3AZF A;  4KGC A;  5AVB D;  4CSR B;  4WU8 C;  3AZI D;  1B67 A;  3H0R C;  4M6B A;  4KUD C;  3TU4 D;  2F8N K;  5FUG B;  2Y2I A;  1P3B D;  1P3A C;  3LEL D;  1P3K D;  3X1S A;  5CPI D;  3WAA A;  1P3F A;  1EQZ D;  4CAY B;  3AZG D;  1P3O A;  1F66 A;  5JA4 A;  4J8W C;  5AVC B;  4G91 B;  5BS7 C;  5B33 A;  3W97 D;  4WV4 B;  4WNN A;  1M1A C;  3LZ0 D;  2BYM A;  3KWQ C;  3LEL A;  5GT3 C;  1M19 A;  2HIO D;  3X1U B;  5AVC C;  4QLC B;  4XUJ C;  1T3U A;  3KXB C;  1BH9 A;  4LD9 A;  5GSU A;  3AZJ A;  5BNX B;  1Z2C B;  3AL0 C;  4YM6 D;  5KDM A;  3C1B B;  3UTA A;  5DNM B;  3AZL B;  3W97 C;  2XD1 A;  3W99 C;  3X1V C;  4J8X B;  3WKJ A;  4XZQ A;  2DF4 C;  2Y2P A;  5GT3 D;  5DNN C;  3AZE C;  3MGS D;  3AN2 B;  1R4V A;  4LD9 D;  3UTB C;  5JRG B;  1U35 D;  3AFA B;  2PYO D;  1F66 C;  1P3F D;  5B0Y A;  1B6W A;  5E5A D;  1ZLA B;  4XUJ B;  3X1T D;  3B6F A;  4H9N A;  1ID3 B;  1M1A B;  3LJA C;  5AVB C;  4Z5T C;  3REK A;  4J8W B;  5GSU C;  3AZJ C;  4J8W D;  3AZE B;  2F8N A;  5GXQ A;  1KX5 B;  5CP6 B;  4YS3 A;  2FFF B;  2YFV A;  5B32 G;  1P3B A;  3UT9 C;  4XUJ D;  3C1B C;  5CPK C;  5CPI A;  5B1M D;  2PYO C;  4Z5T D;  5AY8 B;  5B0Y C;  4DQY B;  2CV5 B;  3MGS B;  3AN2 D;  2NQB D;  3WTP A;  3AV1 A;  3C1C A;  5AV5 C;  3AYW C;  3REH B;  2ARO B;  3AZK A;  3UT9 D;  3NQJ B;  3AZL D;  3LJA A;  4WU9 C;  4Z5T A;  3R45 B;  3MGQ B;  5B0Z A;  2IO5 C;  3EPL A;  5B1M B;  3UTA D;  5B40 A;  1WWI A;  1HQ3 B;  3A1I A;  4X23 B;  4J8U A;  3AV1 D;  3AN2 C;  4QLC D;  3X1V D;  1P3A B;  4KUD A;  5B2J B;  3REJ A;  3AZH B;  3MGR D;  5B31 A;  3WKJ D;  4X23 D;  3LZ1 C;  3AZL C;  4HGA B;  5CPK A;  5AV9 A;  3VH6 T;  1EQZ C;  1P3F C;  1U35 A;  3B6G B;  5E5A C;  3KUY D;  5B24 A;  4WU9 B;  4QLC C;  3AV1 C;  4E44 A;  1F1E A;  1ID3 D;  3AYW A;  3W96 B;  3W96 A;  1KX3 C;  3AZK C;  3TU4 B;  4WU9 A;  4Z66 A;  2CWE A;  5E5A B;  3B0B A;  4ZBJ B;  3MNN A;  2CV5 C;  5B24 B;  5B0Z C;  3FDD A;  5AV8 D;  5B24 D;  1U35 B;  4ZUX B;  5AV9 B;  5CPK B;  4E45 A;  3WKJ C;  3AZH A;  3REJ B;  1KX5 C;  4WZS B;  5B1M C;  3AZE D;  1N1J A;  5AV8 A;  4X23 A;  1HQ3 A;  3C1B D;  2UWX A;  3VH5 T;  3R45 A;  1AOI D;  3LJA B;  2HIO B;  3X1U D;  3AZH D;  2ARO A;  3MGR C;  3REH A;  3MGS C;  3C1C B;  3AYW D;  3AV1 B;  1P3A D;  1P3K A;  3WTP B;  4KGC C;  2CV5 A;  1S32 C;  4Z66 D;  5AY8 A;  2Y2H A;  2NZD B;  1PZR A;  4G92 B;  5B1L D;  5CPI B;  5B40 D;  2F8N H;  3UT9 B;  5GXQ C;  4HGA C;  2LY8 A;  1AOI C;  1P34 A;  4H9S C;  1P3B B;  4J8X C;  4KHA A;  1KX5 A;  3EPK A;  5GXQ B;  3A6N D;  4X23 C;  5CPJ A;  3WTP E;  4AWL B;  4R8P D;  2FJ7 D;  4J8W A;  3TU4 C;  5BS7 A;  5AV6 A;  2F8N D;  1ID3 C;  3WTP C;  1M1A A;  5AV5 A;  3AV2 D;  2Y2M A;  3P5J B;  5GT3 A;  3KSY A;  1P3K C;  4XUJ A;  1M18 A;  3B6F B;  5B0Y B;  1P3M A;  3AZM C;  2RVQ D;  3AFA A;  1P3G B;  1KX4 B;  5JRG A;  5B40 C;  1M1A D;  3AN2 A;  1Q9C A;  3LZ0 C;  3AV2 B;  2Y2K A;  3AV2 A;  4J8X A;  3AZL A;  4G92 C;  3O62 C;  1P3G A;  3F6T A;  1KX4 A;  5AV9 C;  2Y2O A;  1P3M B;  5KDM B;  2JE5 A;  5BNX A;  4LD9 B;  1M18 B;  3KUY C;  4JJN C;  5GT3 B;  3B6F C;  4QLC A;  3X1U A;  5AV5 B;  3A1K A;  3LZ1 D;  5AV6 B;  3IP4 C;  4WNN B;  3VH6 W;  5BT1 D;  2NZD D;  5CPJ B;  1S32 D;  1P3O B;  1F66 B;  3AZG C;  3WAA B;  4KHA B;  2Y2J A;  1P34 D;  2JSS A;  1P34 B;  5FUG A;  4Z2M G;  3UT9 A;  4ZUX C;  5GT0 D;  1P3G C;  1KX4 C;  2NZD A;  1HQ3 C;  1P3O D;  3WAA C;  3MNN D;  3REI D;  4CSR A;  1P3K B;  4R8P C;  3AZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...