5GT0C

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0C00
5AV5A 3W97D 3AZIB 3MNNB 4Z66C 3REIC 3W97C 2FJ7A 2BYMA 1P3BA 1M19B 3LZ1A 2YFWB 1M19D 3MNNC 4NFTA 5DNMA 4J8VB 1TAFB 4J8VD 1M19C 3W99B 3B0DB 3W99D 5B1LB 5BNXA 3MGRA 3AZHA 4J8VC 3KUYA 2BYKB 5B1LD 3LZ0B 3W99C 4CAYA 3B0DC 1A7WA 5GT0B 4J8XB 5B1LC 3KXBA 5GT0D 4J8XD 2AROB 2HIOB 2AROD 5B1MB 4YM6B 3VH5T 3AFAA 3VH5A 5GT0C 1P3KB 4J8XC 2NQBA 2HIOD 1JFIB 1P3KD 3C1CA 2AROC 3X1VB 1ZLAA 2HIOC 5B31G 5B1MC 1P3KC 3X1VD 3MGQB 3TU4D 4WZSB 3MGQD 1N1JB 3AZEB 3X1VC 3WA9B 5AVBB 3KWQB 3AZED 3WA9D 1KX5A 5AVBD 3MGQC 3KWQD 4Z5TB 4LD9B 3MVDA 4DRAA 3AZEC 1KX3A 4Z5TD 3WA9C 5AVBC 1AOIA 3B6FB 4LD9D 3KWQC 2IO5B 3B6FD 1BH8A 4H9QB 4Z5TC 1F1EA 4LD9C 5JRGA 5AY8B 5B2JB 4H9RB 3B6FC 5AY8D 3W98B 5B2JD 2IO5C 5F99A 4WNNB 3LJAB 5B32B 5AY8C 4J8WA 2HUEB 3LJAD 5B2JC 4ZUXA 1BH9B 3REJA 5B32D 1U35A 3LELD 3TU4A 5B2IB 1P3LB 3LJAC 5CPIA 1P3LD 5B2ID 5B32C 2HUEC 3LELC 4YS3A 3X1TB 1P3OA 1P3LC 5B2IC 4QLCA 5B33B 5BO0B 1EQZB 5CPJB 5JA4A 5AV6A 3R45A 4WV4B 1EQZD 5CPJD 5B33C 3AV1B 3WKJB 1WWIA 3AZJB 1EQZC 4H9OB 5CPJC 3WKJD 1TZYB 3AZJD 5GSUB 1TZYD 3AV1C 3WKJC 5GSUD 5B0ZB 3AZGA 4H9PB 3WTPE 3MGPB 3AN2A 1M18B 3AZJC 3LELA 3AZNB 1BH9A 5B0ZD 1TZYC 3MGPD 3REKB 3AYWB 1M18D 4KUDB 1P3FA 5GSUC 1P3LA 3AZND 2F8NA 5GXQB 3AYWD 4KUDD 5B0ZC 3MGPC 1M18C 3NQJB 5GXQD 1H3OA 3AZNC 3AYWC 3V9RA 4KUDC 4H9NB 4J8UA 5GXQC 3REID 3AZKA 1P3PB 1P3AB 4X23B 1P3PD 1P3AD 3AZID 3W96A 5B40B 5AV9A 4X23D 3MNND 3O62B 4R8PB 1F66A 5B40D 1P3PC 3WTPB 1P3AC 5GT3A 3AZIC 3O62D 4X23C 4H9SC 3AZMA 1M1AA 5BNVA 3WTPD 4KGCA 2PYOB 5B40C 3O62C 1ID3B 4R8PC 4UUZB 3WTPC 1ID3D 4XZQA 3WAAB 2PYOC 1KX4A 3WAAD 1ID3C 4KHAA 1KU5A 3MGSB 5G49B 1HQ3B 3LZ0D 3RELB 2YFVB 3MGSD 4Z66A 3WAAC 3RELD 1HQ3D 2CV5B 1WWSA 5B24B 3REIA 3W97A 3LZ0C 3MGSC 4JJNB 2CV5D 3VH6T 3VH6A 5B24D 3RELC 1HQ3C 4WU8B 3NQUB 3AZIA 3MNNA 5B1MD 4YM6D 4JJND 4WU8D 4WU9B 1B67A 2CV5C 5B24C 3AZLB 3X1UB 4WU9D 1M19A 4JJNC 3VH5W 4YM6C 2YFWA 3AZLD 1P34B 4WU8C 1P3GB 3X1UD 3REHB 4WU9C 4J8VA 1P3GD 5CP6B 5C3IB 3AZLC 1TAFA 2F8NH 3REHD 3X1UC 3W99A 5CP6D 1P34C 1P3GC 3AZFB 5B1LA 3REHC 2BYKA 5CP6C 5C3IC 3LZ0A 3UT9B 5GT0A 4J8XA 5B31B 3UT9D 3AZFC 5B31D 2AROA 4NE3A 4E44A 3B0CT 2HIOA 1S32B 4CSRB 3UT9C 5B1MA 4YM6A 1P3KA 5BS7C 3W98D 5CHLB 5B31C 5B0YB 1S32D 5AV8B 1JFIA 5DNNB 5B0YD 5AV8D 3X1VA 3W98C 3C1BB 1P3MB 1S32C 2F8NG 3MGQA 1P3MD 5B0YC 3UTAB 5CPKB 5AV8C 3B6GB 1N1JA 5DNNC 3UTAD 3AZEA 5FUGB 5CPKD 3WA9A 5AVBA 3C1BC 1P3MC 3KWQA 3X1SB 4E45A 3X1TD 4DRBA 5KDMB 3A6NB 3UTAC 3AV2B 5CPKC 4Z5TA 4LD9A 2NZDB 3UTBB 5B33D 3W97B 3B6GC 4Z2MH 3X1TC 3B6FA 2NZDD 3UTBD 3X1SC 5AVCB 4XUJB 3AV2C 4H9QA 5E5AB 2NZDC 3UTBC 1Q9CA 5AY8A 4XUJD 5AVCD 3AV1D 5B2JA 4H9RA 1P3IB 5E5AD 4G92B 3W98A 1P3ID 5AVCC 4NE5A 4XUJC 4WNNA 3LJAA 5E5AC 5B32A 5AV5B 1P3IC 5AV5D 4G92C 5B2IA 3REKD 2BYMB 1P3BB 5AV5C 3LZ1B 3REKC 4Z2MG 1P3BD 3X1TA 3LZ1D 5DNMB 5B33A 5DNMD 5BO0A 1P3BC 3LZ1C 1EQZA 5CPJA 5DNMC 5BNXB 2CWEA 3MGRB 3AZHB 3KUYB 3AV1A 3MGRD 3AZHD 3WKJA 4CAYB 3KUYD 4R8PD 3AZJA 4H9OA 1TZYA 3KXBB 3MGRC 3AZHC 5GSUA 3KUYC 2PYOD 3KXBD 4NE6A 5B0ZA 4H9PA 3MGPA 3AFAB 1M18A 2NQBB 3AZNA 3B0BA 3REKA 3KXBC 3AYWA 3AFAD 2NQBD 4KUDA 3C1CB 5GXQA 1ZLAB 3C1CD 3AFAC 2NQBC 3NQJA 1ZLAD 4M6BA 4H9NA 3C1CC 1ZLAC 1P3PA 1P3AA 4X23A 4H9SA 1KX5B 5B40A 5BT1D 3MVDB 4AWLB 1KX5D 3O62A 1KX3B 3VH6W 4R8PA 1AOIB 3MVDD 3WTPA 1KX3D 5BT1C 1KX5C 1AOID 1BH8B 1P34D 2PYOA 3MVDC 5JRGB 4AWLC 1KX3C 1ID3A 4UUZA 1AOIC 5JRGD 5F99B 3WAAA 5JRGC 5F99D 4J8WB 3AZFD 3REJB 4ZUXB 3MGSA 1U35B 4J8WD 5G49A 1HQ3A 1B6WA 4ZUXD 3REJD 3RELA 3TU4B 5F99C 2YFVA 1U35D 5CPIB 2CV5A 2F8NK 4J8WC 5B24A 3REJC 4ZUXC 5CPID 4YS3B 4JJNA 1U35C 1P3OB 3TU4C 5B32G 4WU8A 4QLCB 3NQUA 4YS3D 4HGAB 2LY8A 1P3OD 5CPIC 4WU9A 4QLCD 3B0CW 3AZLA 3X1UA 4YS3C 5JA4B 5DNND 3R45B 5AV6B 1P3OC 3C1BD 1P34A 4QLCC 1P3GA 4HGAC 4EO5B 5AV6D 3REHA 5CP6A 3B6GD 5AV6C 1HTAA 3X1SD 4EO5C 3AZFA 3A6ND 3AZGB 3AV2D 3AN2B 3LELB 3AZGD 3UT9A 3AN2D 1P3FB 3A6NC 5BS7A 5B31A 2F8NB 1P3FD 3AZGC 2JSSA 3AN2C 2F8ND 1R4VA 1H3OB 1S32A 4CSRA 2L5AA 4ZBJB 3V9RB 1P3FC 4J8UB 5B0YA 5AV8A 3AZKB 4J8UD 5DNNA 3AZKD 3C1BA 1P3MA 3KSYA 4ZBJC 3W96B 5AV9B 2FJ7B 4J8UC 3UTAA 4G91B 5CPKA 3AZKC 1F66B 5AV9D 3W96D 2FJ7D 5GT3B 3B6GA 5FUGA 3AZMB 1M1AB 1F66D 5BNVB 4KGCB 5GT3D 3X1SA 3W96C 5AV9C 3AZMD 1M1AD 2FJ7C 2RVQD 5KDMA 3A6NA 4KGCD 4G91C 3AV2A 1F66C 2NZDA 3UTBA 5GT3C 1BFMA 3AZMC 4XZQB 1M1AC 2RVQC 4KGCC 4XZQD 4XUJA 5AVCA 1KX4B 4KHAB 1ULYA 5E5AA 1KX4D 1P3IA 4XZQC 4Z66B 3REIB 4Z66D 1KX4C
chains in the Genus database with same CATH superfamily
5AV5A 2Y2GA 3W97D 3AZIB 3MNNB 4Z66C 3REIC 2J8PA 3W97C 2W8SA 2FJ7A 2BYMA 1P3BA 1M19B 3LZ1A 2YFWB 1M19D 3MNNC 4NFTA 4DQYB 5DNMA 4J8VB 1TAFB 4J8VD 1M19C 3EG5B 3W99B 3B0DB 3EPHA 3W99D 5B1LB 5BNXA 3MGRA 3AZHA 4J8VC 3KUYA 2BYKB 5B1LD 3LZ0B 3W99C 4CAYA 3AL0C 3B0DC 1A7WA 5GT0B 4J8XB 5B1LC 3KXBA 5GT0D 4J8XD 2AROB 2HIOB 2AROD 5B1MB 2Y2IA 3VH5T 4YM6B 3VH5A 5GT0C 3AFAA 4J8XC 1P3KB 2HIOD 2NQBA 3H0RC 1JFIB 1PZRA 1P3KD 3C1CA 2ZY3A 2AROC 3X1VB 1ZLAA 2HIOC 5B31G 5B1MC 1P3KC 3X1VD 3MGQB 3TU4D 4WZSB 3MGQD 1N1JB 3AZEB 3F6TA 3X1VC 3WA9B 5AVBB 3KWQB 3EPLA 3AZED 3WA9D 1KX5A 5AVBD 3MGQC 3KWQD 4Z5TB 2UWXA 4LD9B 3MVDA 4DRAA 3AZEC 1KX3A 4Z5TD 3WA9C 5AVBC 1AOIA 3B6FB 4LD9D 3KWQC 2IO5B 3B6FD 1BH8A 4H9QB 4Z5TC 1F1EA 4LD9C 5JRGA 5AY8B 5B2JB 4H9RB 3B6FC 5AY8D 3W98B 5B2JD 2IO5C 3FDDA 5F99A 2Y2OA 4WNNB 3LJAB 1T3UA 5B32B 5AY8C 4J8WA 2HUEB 3LJAD 5B2JC 4ZUXA 1BH9B 3REJA 5B32D 1U35A 3LELD 3TU4A 2ZY2A 5B2IB 1P3LB 4WJ3C 3LJAC 5CPIA 1P3LD 5B2ID 5B32C 2HUEC 3LELC 4YS3A 3X1TB 1P3OA 1P3LC 5B2IC 4QLCA 5B33B 5BO0B 1EQZB 5CPJB 5JA4A 5AV6A 3R45A 4WV4B 1EQZD 5CPJD 5B33C 2Y2PA 3AV1B 3WKJB 1WWIA 3AZJB 1EQZC 4H9OB 5CPJC 3WKJD 1TZYB 4UPKA 2G5HC 5GSUB 3AZJD 1TZYD 3AV1C 3WKJC 5GSUD 5B0ZB 3AZGA 4H9PB 3WTPE 3MGPB 3AN2A 1M18B 3AZJC 3LELA 3AZNB 1BH9A 5B0ZD 1TZYC 3MGPD 3REKB 3AYWB 1M18D 4KUDB 1P3FA 5GSUC 1P3LA 3AZND 2F8NA 5GXQB 3AYWD 4KUDD 3H0MC 5B0ZC 3MGPC 1M18C 3NQJB 5GXQD 1H3OA 3AZNC 3AYWC 2G5IC 3V9RA 4KUDC 4H9NB 4J8UA 2XD5A 5GXQC 3REID 3AZKA 1P3PB 1P3AB 4X23B 1P3PD 1P3AD 3AZID 3W96A 5B40B 5AV9A 4X23D 3MNND 3O62B 4R8PB 1F66A 5B40D 1P3PC 3WTPB 1P3AC 5GT3A 3AZIC 3O62D 4X23C 4H9SC 3AZMA 1M1AA 5BNVA 3WTPD 4KGCA 2PYOB 5B40C 3O62C 1ID3B 4R8PC 4UUZB 3WTPC 1ID3D 4XZQA 3WAAB 2PYOC 1KX4A 3WAAD 1ID3C 4KHAA 1KU5A 2FFFB 3MGSB 5G49B 1HQ3B 3LZ0D 3RELB 2YFVB 3MGSD 4Z66A 3WAAC 3RELD 1HQ3D 2CV5B 1WWSA 2VQRA 5B24B 3REIA 3W97A 3LZ0C 3MGSC 4JJNB 2CV5D 3VH6T 3VH6A 5B24D 3RELC 1HQ3C 4WU8B 3NQUB 3AZIA 3MNNA 5B1MD 4YM6D 4JJND 4WU8D 4WU9B 1B67A 2CV5C 5B24C 3AZLB 3X1UB 4WU9D 1M19A 2ZY5A 4JJNC 3VH5W 4YM6C 2YFWA 3AZLD 1P34B 4WU8C 1P3GB 3X1UD 3REHB 4WU9C 4J8VA 1P3GD 5CP6B 5C3IB 3AZLC 1TAFA 1Z2CB 3REHD 3X1UC 2F8NH 3W99A 5CP6D 1P34C 1P3GC 3AZFB 5B1LA 3REHC 2BYKA 5CP6C 5C3IC 3LZ0A 3UT9B 5GT0A 4J8XA 5B31B 3UT9D 3AZFC 5B31D 2AROA 4NE3A 4E44A 3B0CT 2HIOA 1S32B 4CSRB 3UT9C 5B1MA 4YM6A 1P3KA 5BS7C 3W98D 5CHLB 5B31C 5B0YB 1S32D 2Y2LA 5AV8B 1JFIA 5DNNB 5B0YD 5AV8D 3X1VA 3W98C 3C1BB 1P3MB 1S32C 2F8NG 3MGQA 1P3MD 5B0YC 3UTAB 5CPKB 5AV8C 3B6GB 1N1JA 5DNNC 3UTAD 3AZEA 5FUGB 5CPKD 3WA9A 5AVBA 3C1BC 1P3MC 3KWQA 3X1SB 4E45A 3X1TD 4DRBA 5KDMB 3A6NB 3UTAC 3AV2B 5CPKC 4Z5TA 3IP4C 4LD9A 2NZDB 3UTBB 5B33D 3W97B 3B6GC 4Z2MH 3X1TC 3B6FA 2NZDD 3UTBD 2DF4C 3X1SC 5AVCB 4XUJB 3AV2C 4H9QA 5E5AB 2NZDC 3UTBC 1Q9CA 5AY8A 3H0LC 4XUJD 5AVCD 3AV1D 5B2JA 4H9RA 1P3IB 5E5AD 4G92B 3W98A 2Y2QA 1P3ID 4NE5A 4XUJC 4WNNA 5AVCC 3LJAA 5E5AC 5B32A 5AV5B 3P5JB 1P3IC 5AV5D 4G92C 5B2IA 2Y2KA 3REKD 2BYMB 1P3BB 2DQNC 5AV5C 3LZ1B 2ZY4A 3REKC 4Z2MG 1P3BD 3X1TA 3LZ1D 5DNMB 5B33A 5DNMD 3EPKA 5BO0A 1P3BC 3LZ1C 1EQZA 5CPJA 5DNMC 5BNXB 2CWEA 3MGRB 3AZHB 3KUYB 3AV1A 3MGRD 3AZHD 3WKJA 3KFUG 4CAYB 3KUYD 4R8PD 3AZJA 4H9OA 1TZYA 3KXBB 3MGRC 3AZHC 5GSUA 3KUYC 2PYOD 3KXBD 4NE6A 5B0ZA 4H9PA 3MGPA 3AFAB 1M18A 2NQBB 3AZNA 3B0BA 3REKA 3KXBC 3AYWA 2F2AC 3AFAD 2NQBD 4KUDA 3C1CB 5GXQA 1ZLAB 3C1CD 3AFAC 2NQBC 3NQJA 1ZLAD 4M6BA 4H9NA 3C1CC 1ZLAC 1P3PA 1P3AA 4X23A 4H9SA 1KX5B 5B40A 5BT1D 3MVDB 4AWLB 1KX5D 3O62A 1KX3B 3VH6W 4R8PA 1AOIB 3MVDD 3WTPA 1KX3D 5BT1C 1KX5C 1AOID 1BH8B 1P34D 2PYOA 2Y2HA 3MVDC 5JRGB 4AWLC 1KX3C 1ID3A 4UUZA 1AOIC 5JRGD 2JCHA 5F99B 3WAAA 5JRGC 5F99D 4J8WB 3AZFD 3REJB 4ZUXB 3MGSA 1U35B 2BG1A 4J8WD 5G49A 1HQ3A 1B6WA 4ZUXD 3REJD 3RELA 3TU4B 3A1IA 2YFVA 5F99C 1U35D 5CPIB 2Y2NA 2CV5A 1KX4C 2F8NK 4J8WC 5B24A 3REJC 4ZUXC 5CPID 4YS3B 4JJNA 1U35C 1P3OB 3TU4C 5B32G 4WU8A 4QLCB 3NQUA 4YS3D 4HGAB 2LY8A 1P3OD 5CPIC 4WU9A 4QLCD 3B0CW 3AZLA 3X1UA 4YS3C 2ZM5A 5JA4B 5DNND 3R45B 5AV6B 1P3OC 3C1BD 1P34A 4QLCC 1P3GA 4HGAC 5AV6D 4EO5B 3REHA 5CP6A 2Y2JA 3B6GD 5AV6C 1HTAA 3X1SD 4EO5C 3AZFA 3A6ND 3AZGB 3AV2D 3AN2B 3LELB 3AZGD 3UT9A 3AN2D 1P3FB 3A6NC 5BS7A 5B31A 3EPJA 2F8NB 1P3FD 3AZGC 2JSSA 3AN2C 2F8ND 1R4VA 1H3OB 1S32A 4CSRA 2L5AA 4ZBJB 3V9RB 1P3FC 4J8UB 5B0YA 5AV8A 3AZKB 4J8UD 5DNNA 3AZKD 3C1BA 1P3MA 3KSYA 4ZBJC 3W96B 3A1KA 5AV9B 2FJ7B 4J8UC 3UTAA 4G91B 5CPKA 3AZKC 1F66B 5AV9D 3W96D 2FJ7D 5GT3B 3B6GA 5FUGA 3AZMB 1M1AB 1F66D 5BNVB 4KGCB 5GT3D 3X1SA 3W96C 5AV9C 3AZMD 1M1AD 2FJ7C 2RVQD 5KDMA 3A6NA 4KGCD 4G91C 3AV2A 1F66C 2NZDA 3UTBA 2JE5A 5GT3C 1BFMA 3AZMC 4XZQB 1M1AC 2RVQC 4KGCC 4XZQD 2Y2MA 4XUJA 5AVCA 1KX4B 1W2EA 4KHAB 1ULYA 5E5AA 1KX4D 1P3IA 4XZQC 4Z66B 2RIQA 3REIB 4Z66D 2XD1A
chains in the Genus database with same CATH topology
5AV5A 2Y2GA 3W97D 3AZIB 3MNNB 4Z66C 3REIC 2J8PA 3W97C 2W8SA 2FJ7A 2BYMA 1P3BA 1M19B 3LZ1A 2YFWB 1M19D 3MNNC 4NFTA 4DQYB 5DNMA 4J8VB 1TAFB 4J8VD 1M19C 3EG5B 3W99B 3B0DB 3EPHA 3W99D 5B1LB 5BNXA 3MGRA 3AZHA 4J8VC 3KUYA 2BYKB 5B1LD 3LZ0B 3W99C 4CAYA 3AL0C 3B0DC 1A7WA 5GT0B 4J8XB 5B1LC 3KXBA 5GT0D 4J8XD 2AROB 2HIOB 2AROD 5B1MB 2Y2IA 3VH5T 4YM6B 3VH5A 5GT0C 3AFAA 4J8XC 1P3KB 2HIOD 2NQBA 3H0RC 1JFIB 1PZRA 1P3KD 3C1CA 2ZY3A 2AROC 3X1VB 1ZLAA 2HIOC 5B31G 5B1MC 1P3KC 3X1VD 3MGQB 3TU4D 4WZSB 3MGQD 1N1JB 3AZEB 3F6TA 3X1VC 3WA9B 5AVBB 3KWQB 3EPLA 3AZED 3WA9D 1KX5A 5AVBD 3MGQC 3KWQD 4Z5TB 2UWXA 4LD9B 3MVDA 4DRAA 3AZEC 1KX3A 4Z5TD 3WA9C 5AVBC 1AOIA 3B6FB 4LD9D 3KWQC 2IO5B 3B6FD 1BH8A 4H9QB 4Z5TC 1F1EA 4LD9C 5JRGA 5AY8B 5B2JB 4H9RB 3B6FC 5AY8D 3W98B 5B2JD 2IO5C 3FDDA 5F99A 2Y2OA 4WNNB 3LJAB 1T3UA 5B32B 5AY8C 4J8WA 2HUEB 3LJAD 5B2JC 4ZUXA 1BH9B 3REJA 5B32D 1U35A 3LELD 3TU4A 2ZY2A 5B2IB 1P3LB 4WJ3C 3LJAC 5CPIA 1P3LD 5B2ID 5B32C 2HUEC 3LELC 4YS3A 3X1TB 1P3OA 1P3LC 5B2IC 4QLCA 5B33B 5BO0B 1EQZB 5CPJB 5JA4A 5AV6A 3R45A 4WV4B 1EQZD 5CPJD 5B33C 2Y2PA 3AV1B 3WKJB 1WWIA 3AZJB 1EQZC 4H9OB 5CPJC 3WKJD 1TZYB 4UPKA 2G5HC 5GSUB 3AZJD 1TZYD 3AV1C 3WKJC 5GSUD 5B0ZB 3AZGA 4H9PB 3WTPE 3MGPB 3AN2A 1M18B 3AZJC 3LELA 3AZNB 1BH9A 5B0ZD 1TZYC 3MGPD 3REKB 3AYWB 1M18D 4KUDB 1P3FA 5GSUC 1P3LA 3AZND 2F8NA 5GXQB 3AYWD 4KUDD 3H0MC 5B0ZC 3MGPC 1M18C 3NQJB 5GXQD 1H3OA 3AZNC 3AYWC 2G5IC 3V9RA 4KUDC 4H9NB 4J8UA 2XD5A 5GXQC 3REID 3AZKA 1P3PB 1P3AB 4X23B 1P3PD 1P3AD 3AZID 3W96A 5B40B 5AV9A 4X23D 3MNND 3O62B 4R8PB 1F66A 5B40D 1P3PC 3WTPB 1P3AC 5GT3A 3AZIC 3O62D 4X23C 4H9SC 3AZMA 1M1AA 5BNVA 3WTPD 4KGCA 2PYOB 5B40C 3O62C 1ID3B 4R8PC 4UUZB 3WTPC 1ID3D 4XZQA 3WAAB 2PYOC 1KX4A 3WAAD 1ID3C 4KHAA 1KU5A 2FFFB 3MGSB 5G49B 1HQ3B 3LZ0D 3RELB 2YFVB 3MGSD 4Z66A 3WAAC 3RELD 1HQ3D 2CV5B 1WWSA 2VQRA 5B24B 3REIA 3W97A 3LZ0C 3MGSC 4JJNB 2CV5D 3VH6T 3VH6A 5B24D 3RELC 1HQ3C 4WU8B 3NQUB 3AZIA 3MNNA 5B1MD 4YM6D 4JJND 4WU8D 4WU9B 1B67A 2CV5C 5B24C 3AZLB 3X1UB 4WU9D 1M19A 2ZY5A 4JJNC 3VH5W 4YM6C 2YFWA 3AZLD 1P34B 4WU8C 1P3GB 3X1UD 3REHB 4WU9C 4J8VA 1P3GD 5CP6B 5C3IB 3AZLC 1TAFA 1Z2CB 3REHD 3X1UC 2F8NH 3W99A 5CP6D 1P34C 1P3GC 3AZFB 5B1LA 3REHC 2BYKA 5CP6C 5C3IC 3LZ0A 3UT9B 5GT0A 4J8XA 5B31B 3UT9D 3AZFC 5B31D 2AROA 4NE3A 4E44A 3B0CT 2HIOA 1S32B 4CSRB 3UT9C 5B1MA 4YM6A 1P3KA 5BS7C 3W98D 5CHLB 5B31C 5B0YB 1S32D 2Y2LA 5AV8B 1JFIA 5DNNB 5B0YD 5AV8D 3X1VA 3W98C 3C1BB 1P3MB 1S32C 2F8NG 3MGQA 1P3MD 5B0YC 3UTAB 5CPKB 5AV8C 3B6GB 1N1JA 5DNNC 3UTAD 3AZEA 5FUGB 5CPKD 3WA9A 5AVBA 3C1BC 1P3MC 3KWQA 3X1SB 4E45A 3X1TD 4DRBA 5KDMB 3A6NB 3UTAC 3AV2B 5CPKC 4Z5TA 3IP4C 4LD9A 2NZDB 3UTBB 5B33D 3W97B 3B6GC 4Z2MH 3X1TC 3B6FA 2NZDD 3UTBD 2DF4C 3X1SC 5AVCB 4XUJB 3AV2C 4H9QA 5E5AB 2NZDC 3UTBC 1Q9CA 5AY8A 3H0LC 4XUJD 5AVCD 3AV1D 5B2JA 4H9RA 1P3IB 5E5AD 4G92B 3W98A 2Y2QA 1P3ID 4NE5A 4XUJC 4WNNA 5AVCC 3LJAA 5E5AC 5B32A 5AV5B 3P5JB 1P3IC 5AV5D 4G92C 5B2IA 2Y2KA 3REKD 2BYMB 1P3BB 2DQNC 5AV5C 3LZ1B 2ZY4A 3REKC 4Z2MG 1P3BD 3X1TA 3LZ1D 5DNMB 5B33A 5DNMD 3EPKA 5BO0A 1P3BC 3LZ1C 1EQZA 5CPJA 5DNMC 5BNXB 2CWEA 3MGRB 3AZHB 3KUYB 3AV1A 3MGRD 3AZHD 3WKJA 3KFUG 4CAYB 3KUYD 4R8PD 3AZJA 4H9OA 1TZYA 3KXBB 3MGRC 3AZHC 5GSUA 3KUYC 2PYOD 3KXBD 4NE6A 5B0ZA 4H9PA 3MGPA 3AFAB 1M18A 2NQBB 3AZNA 3B0BA 3REKA 3KXBC 3AYWA 2F2AC 3AFAD 2NQBD 4KUDA 3C1CB 5GXQA 1ZLAB 3C1CD 3AFAC 2NQBC 3NQJA 1ZLAD 4M6BA 4H9NA 3C1CC 1ZLAC 1P3PA 1P3AA 4X23A 4H9SA 1KX5B 5B40A 5BT1D 3MVDB 4AWLB 1KX5D 3O62A 1KX3B 3VH6W 4R8PA 1AOIB 3MVDD 3WTPA 1KX3D 5BT1C 1KX5C 1AOID 1BH8B 1P34D 2PYOA 2Y2HA 3MVDC 5JRGB 4AWLC 1KX3C 1ID3A 4UUZA 1AOIC 5JRGD 2JCHA 5F99B 3WAAA 5JRGC 5F99D 4J8WB 3AZFD 3REJB 4ZUXB 3MGSA 1U35B 2BG1A 4J8WD 5G49A 1HQ3A 1B6WA 4ZUXD 3REJD 3RELA 3TU4B 3A1IA 2YFVA 5F99C 1U35D 5CPIB 2Y2NA 2CV5A 1KX4C 2F8NK 4J8WC 5B24A 3REJC 4ZUXC 5CPID 4YS3B 4JJNA 1U35C 1P3OB 3TU4C 5B32G 4WU8A 4QLCB 3NQUA 4YS3D 4HGAB 2LY8A 1P3OD 5CPIC 4WU9A 4QLCD 3B0CW 3AZLA 3X1UA 4YS3C 2ZM5A 5JA4B 5DNND 3R45B 5AV6B 1P3OC 3C1BD 1P34A 4QLCC 1P3GA 4HGAC 5AV6D 4EO5B 3REHA 5CP6A 2Y2JA 3B6GD 5AV6C 1HTAA 3X1SD 4EO5C 3AZFA 3A6ND 3AZGB 3AV2D 3AN2B 3LELB 3AZGD 3UT9A 3AN2D 1P3FB 3A6NC 5BS7A 5B31A 3EPJA 2F8NB 1P3FD 3AZGC 2JSSA 3AN2C 2F8ND 1R4VA 1H3OB 1S32A 4CSRA 2L5AA 4ZBJB 3V9RB 1P3FC 4J8UB 5B0YA 5AV8A 3AZKB 4J8UD 5DNNA 3AZKD 3C1BA 1P3MA 3KSYA 4ZBJC 3W96B 3A1KA 5AV9B 2FJ7B 4J8UC 3UTAA 4G91B 5CPKA 3AZKC 1F66B 5AV9D 3W96D 2FJ7D 5GT3B 3B6GA 5FUGA 3AZMB 1M1AB 1F66D 5BNVB 4KGCB 5GT3D 3X1SA 3W96C 5AV9C 3AZMD 1M1AD 2FJ7C 2RVQD 5KDMA 3A6NA 4KGCD 4G91C 3AV2A 1F66C 2NZDA 3UTBA 2JE5A 5GT3C 1BFMA 3AZMC 4XZQB 1M1AC 2RVQC 4KGCC 4XZQD 2Y2MA 4XUJA 5AVCA 1KX4B 1W2EA 4KHAB 1ULYA 5E5AA 1KX4D 1P3IA 4XZQC 4Z66B 2RIQA 3REIB 4Z66D 2XD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 A;  3W97 D;  3AZI B;  3MNN B;  4Z66 C;  3REI C;  3W97 C;  2FJ7 A;  2BYM A;  1P3B A;  1M19 B;  3LZ1 A;  2YFW B;  1M19 D;  3MNN C;  4NFT A;  5DNM A;  4J8V B;  1TAF B;  4J8V D;  1M19 C;  3W99 B;  3B0D B;  3W99 D;  5B1L B;  5BNX A;  3MGR A;  3AZH A;  4J8V C;  3KUY A;  2BYK B;  5B1L D;  3LZ0 B;  3W99 C;  4CAY A;  3B0D C;  1A7W A;  5GT0 B;  4J8X B;  5B1L C;  3KXB A;  5GT0 D;  4J8X D;  2ARO B;  2HIO B;  2ARO D;  5B1M B;  4YM6 B;  3VH5 T;  3AFA A;  3VH5 A;  5GT0 C;  1P3K B;  4J8X C;  2NQB A;  2HIO D;  1JFI B;  1P3K D;  3C1C A;  2ARO C;  3X1V B;  1ZLA A;  2HIO C;  5B31 G;  5B1M C;  1P3K C;  3X1V D;  3MGQ B;  3TU4 D;  4WZS B;  3MGQ D;  1N1J B;  3AZE B;  3X1V C;  3WA9 B;  5AVB B;  3KWQ B;  3AZE D;  3WA9 D;  1KX5 A;  5AVB D;  3MGQ C;  3KWQ D;  4Z5T B;  4LD9 B;  3MVD A;  4DRA A;  3AZE C;  1KX3 A;  4Z5T D;  3WA9 C;  5AVB C;  1AOI A;  3B6F B;  4LD9 D;  3KWQ C;  2IO5 B;  3B6F D;  1BH8 A;  4H9Q B;  4Z5T C;  1F1E A;  4LD9 C;  5JRG A;  5AY8 B;  5B2J B;  4H9R B;  3B6F C;  5AY8 D;  3W98 B;  5B2J D;  2IO5 C;  5F99 A;  4WNN B;  3LJA B;  5B32 B;  5AY8 C;  4J8W A;  2HUE B;  3LJA D;  5B2J C;  4ZUX A;  1BH9 B;  3REJ A;  5B32 D;  1U35 A;  3LEL D;  3TU4 A;  5B2I B;  1P3L B;  3LJA C;  5CPI A;  1P3L D;  5B2I D;  5B32 C;  2HUE C;  3LEL C;  4YS3 A;  3X1T B;  1P3O A;  1P3L C;  5B2I C;  4QLC A;  5B33 B;  5BO0 B;  1EQZ B;  5CPJ B;  5JA4 A;  5AV6 A;  3R45 A;  4WV4 B;  1EQZ D;  5CPJ D;  5B33 C;  3AV1 B;  3WKJ B;  1WWI A;  3AZJ B;  1EQZ C;  4H9O B;  5CPJ C;  3WKJ D;  1TZY B;  3AZJ D;  5GSU B;  1TZY D;  3AV1 C;  3WKJ C;  5GSU D;  5B0Z B;  3AZG A;  4H9P B;  3WTP E;  3MGP B;  3AN2 A;  1M18 B;  3AZJ C;  3LEL A;  3AZN B;  1BH9 A;  5B0Z D;  1TZY C;  3MGP D;  3REK B;  3AYW B;  1M18 D;  4KUD B;  1P3F A;  5GSU C;  1P3L A;  3AZN D;  2F8N A;  5GXQ B;  3AYW D;  4KUD D;  5B0Z C;  3MGP C;  1M18 C;  3NQJ B;  5GXQ D;  1H3O A;  3AZN C;  3AYW C;  3V9R A;  4KUD C;  4H9N B;  4J8U A;  5GXQ C;  3REI D;  3AZK A;  1P3P B;  1P3A B;  4X23 B;  1P3P D;  1P3A D;  3AZI D;  3W96 A;  5B40 B;  5AV9 A;  4X23 D;  3MNN D;  3O62 B;  4R8P B;  1F66 A;  5B40 D;  1P3P C;  3WTP B;  1P3A C;  5GT3 A;  3AZI C;  3O62 D;  4X23 C;  4H9S C;  3AZM A;  1M1A A;  5BNV A;  3WTP D;  4KGC A;  2PYO B;  5B40 C;  3O62 C;  1ID3 B;  4R8P C;  4UUZ B;  3WTP C;  1ID3 D;  4XZQ A;  3WAA B;  2PYO C;  1KX4 A;  3WAA D;  1ID3 C;  4KHA A;  1KU5 A;  3MGS B;  5G49 B;  1HQ3 B;  3LZ0 D;  3REL B;  2YFV B;  3MGS D;  4Z66 A;  3WAA C;  3REL D;  1HQ3 D;  2CV5 B;  1WWS A;  5B24 B;  3REI A;  3W97 A;  3LZ0 C;  3MGS C;  4JJN B;  2CV5 D;  3VH6 T;  3VH6 A;  5B24 D;  3REL C;  1HQ3 C;  4WU8 B;  3NQU B;  3AZI A;  3MNN A;  5B1M D;  4YM6 D;  4JJN D;  4WU8 D;  4WU9 B;  1B67 A;  2CV5 C;  5B24 C;  3AZL B;  3X1U B;  4WU9 D;  1M19 A;  4JJN C;  3VH5 W;  4YM6 C;  2YFW A;  3AZL D;  1P34 B;  4WU8 C;  1P3G B;  3X1U D;  3REH B;  4WU9 C;  4J8V A;  1P3G D;  5CP6 B;  5C3I B;  3AZL C;  1TAF A;  2F8N H;  3REH D;  3X1U C;  3W99 A;  5CP6 D;  1P34 C;  1P3G C;  3AZF B;  5B1L A;  3REH C;  2BYK A;  5CP6 C;  5C3I C;  3LZ0 A;  3UT9 B;  5GT0 A;  4J8X A;  5B31 B;  3UT9 D;  3AZF C;  5B31 D;  2ARO A;  4NE3 A;  4E44 A;  3B0C T;  2HIO A;  1S32 B;  4CSR B;  3UT9 C;  5B1M A;  4YM6 A;  1P3K A;  5BS7 C;  3W98 D;  5CHL B;  5B31 C;  5B0Y B;  1S32 D;  5AV8 B;  1JFI A;  5DNN B;  5B0Y D;  5AV8 D;  3X1V A;  3W98 C;  3C1B B;  1P3M B;  1S32 C;  2F8N G;  3MGQ A;  1P3M D;  5B0Y C;  3UTA B;  5CPK B;  5AV8 C;  3B6G B;  1N1J A;  5DNN C;  3UTA D;  3AZE A;  5FUG B;  5CPK D;  3WA9 A;  5AVB A;  3C1B C;  1P3M C;  3KWQ A;  3X1S B;  4E45 A;  3X1T D;  4DRB A;  5KDM B;  3A6N B;  3UTA C;  3AV2 B;  5CPK C;  4Z5T A;  4LD9 A;  2NZD B;  3UTB B;  5B33 D;  3W97 B;  3B6G C;  4Z2M H;  3X1T C;  3B6F A;  2NZD D;  3UTB D;  3X1S C;  5AVC B;  4XUJ B;  3AV2 C;  4H9Q A;  5E5A B;  2NZD C;  3UTB C;  1Q9C A;  5AY8 A;  4XUJ D;  5AVC D;  3AV1 D;  5B2J A;  4H9R A;  1P3I B;  5E5A D;  4G92 B;  3W98 A;  1P3I D;  5AVC C;  4NE5 A;  4XUJ C;  4WNN A;  3LJA A;  5E5A C;  5B32 A;  5AV5 B;  1P3I C;  5AV5 D;  4G92 C;  5B2I A;  3REK D;  2BYM B;  1P3B B;  5AV5 C;  3LZ1 B;  3REK C;  4Z2M G;  1P3B D;  3X1T A;  3LZ1 D;  5DNM B;  5B33 A;  5DNM D;  5BO0 A;  1P3B C;  3LZ1 C;  1EQZ A;  5CPJ A;  5DNM C;  5BNX B;  2CWE A;  3MGR B;  3AZH B;  3KUY B;  3AV1 A;  3MGR D;  3AZH D;  3WKJ A;  4CAY B;  3KUY D;  4R8P D;  3AZJ A;  4H9O A;  1TZY A;  3KXB B;  3MGR C;  3AZH C;  5GSU A;  3KUY C;  2PYO D;  3KXB D;  4NE6 A;  5B0Z A;  4H9P A;  3MGP A;  3AFA B;  1M18 A;  2NQB B;  3AZN A;  3B0B A;  3REK A;  3KXB C;  3AYW A;  3AFA D;  2NQB D;  4KUD A;  3C1C B;  5GXQ A;  1ZLA B;  3C1C D;  3AFA C;  2NQB C;  3NQJ A;  1ZLA D;  4M6B A;  4H9N A;  3C1C C;  1ZLA C;  1P3P A;  1P3A A;  4X23 A;  4H9S A;  1KX5 B;  5B40 A;  5BT1 D;  3MVD B;  4AWL B;  1KX5 D;  3O62 A;  1KX3 B;  3VH6 W;  4R8P A;  1AOI B;  3MVD D;  3WTP A;  1KX3 D;  5BT1 C;  1KX5 C;  1AOI D;  1BH8 B;  1P34 D;  2PYO A;  3MVD C;  5JRG B;  4AWL C;  1KX3 C;  1ID3 A;  4UUZ A;  1AOI C;  5JRG D;  5F99 B;  3WAA A;  5JRG C;  5F99 D;  4J8W B;  3AZF D;  3REJ B;  4ZUX B;  3MGS A;  1U35 B;  4J8W D;  5G49 A;  1HQ3 A;  1B6W A;  4ZUX D;  3REJ D;  3REL A;  3TU4 B;  5F99 C;  2YFV A;  1U35 D;  5CPI B;  2CV5 A;  2F8N K;  4J8W C;  5B24 A;  3REJ C;  4ZUX C;  5CPI D;  4YS3 B;  4JJN A;  1U35 C;  1P3O B;  3TU4 C;  5B32 G;  4WU8 A;  4QLC B;  3NQU A;  4YS3 D;  4HGA B;  2LY8 A;  1P3O D;  5CPI C;  4WU9 A;  4QLC D;  3B0C W;  3AZL A;  3X1U A;  4YS3 C;  5JA4 B;  5DNN D;  3R45 B;  5AV6 B;  1P3O C;  3C1B D;  1P34 A;  4QLC C;  1P3G A;  4HGA C;  4EO5 B;  5AV6 D;  3REH A;  5CP6 A;  3B6G D;  5AV6 C;  1HTA A;  3X1S D;  4EO5 C;  3AZF A;  3A6N D;  3AZG B;  3AV2 D;  3AN2 B;  3LEL B;  3AZG D;  3UT9 A;  3AN2 D;  1P3F B;  3A6N C;  5BS7 A;  5B31 A;  2F8N B;  1P3F D;  3AZG C;  2JSS A;  3AN2 C;  2F8N D;  1R4V A;  1H3O B;  1S32 A;  4CSR A;  2L5A A;  4ZBJ B;  3V9R B;  1P3F C;  4J8U B;  5B0Y A;  5AV8 A;  3AZK B;  4J8U D;  5DNN A;  3AZK D;  3C1B A;  1P3M A;  3KSY A;  4ZBJ C;  3W96 B;  5AV9 B;  2FJ7 B;  4J8U C;  3UTA A;  4G91 B;  5CPK A;  3AZK C;  1F66 B;  5AV9 D;  3W96 D;  2FJ7 D;  5GT3 B;  3B6G A;  5FUG A;  3AZM B;  1M1A B;  1F66 D;  5BNV B;  4KGC B;  5GT3 D;  3X1S A;  3W96 C;  5AV9 C;  3AZM D;  1M1A D;  2FJ7 C;  2RVQ D;  5KDM A;  3A6N A;  4KGC D;  4G91 C;  3AV2 A;  1F66 C;  2NZD A;  3UTB A;  5GT3 C;  1BFM A;  3AZM C;  4XZQ B;  1M1A C;  2RVQ C;  4KGC C;  4XZQ D;  4XUJ A;  5AVC A;  1KX4 B;  4KHA B;  1ULY A;  5E5A A;  1KX4 D;  1P3I A;  4XZQ C;  4Z66 B;  3REI B;  4Z66 D;  1KX4 C; 
#chains in the Genus database with same CATH topology
 5AV5 A;  2Y2G A;  3W97 D;  3AZI B;  3MNN B;  4Z66 C;  3REI C;  2J8P A;  3W97 C;  2W8S A;  2FJ7 A;  2BYM A;  1P3B A;  1M19 B;  3LZ1 A;  2YFW B;  1M19 D;  3MNN C;  4NFT A;  4DQY B;  5DNM A;  4J8V B;  1TAF B;  4J8V D;  1M19 C;  3EG5 B;  3W99 B;  3B0D B;  3EPH A;  3W99 D;  5B1L B;  5BNX A;  3MGR A;  3AZH A;  4J8V C;  3KUY A;  2BYK B;  5B1L D;  3LZ0 B;  3W99 C;  4CAY A;  3AL0 C;  3B0D C;  1A7W A;  5GT0 B;  4J8X B;  5B1L C;  3KXB A;  5GT0 D;  4J8X D;  2ARO B;  2HIO B;  2ARO D;  5B1M B;  2Y2I A;  3VH5 T;  4YM6 B;  3VH5 A;  5GT0 C;  3AFA A;  4J8X C;  1P3K B;  2HIO D;  2NQB A;  3H0R C;  1JFI B;  1PZR A;  1P3K D;  3C1C A;  2ZY3 A;  2ARO C;  3X1V B;  1ZLA A;  2HIO C;  5B31 G;  5B1M C;  1P3K C;  3X1V D;  3MGQ B;  3TU4 D;  4WZS B;  3MGQ D;  1N1J B;  3AZE B;  3F6T A;  3X1V C;  3WA9 B;  5AVB B;  3KWQ B;  3EPL A;  3AZE D;  3WA9 D;  1KX5 A;  5AVB D;  3MGQ C;  3KWQ D;  4Z5T B;  2UWX A;  4LD9 B;  3MVD A;  4DRA A;  3AZE C;  1KX3 A;  4Z5T D;  3WA9 C;  5AVB C;  1AOI A;  3B6F B;  4LD9 D;  3KWQ C;  2IO5 B;  3B6F D;  1BH8 A;  4H9Q B;  4Z5T C;  1F1E A;  4LD9 C;  5JRG A;  5AY8 B;  5B2J B;  4H9R B;  3B6F C;  5AY8 D;  3W98 B;  5B2J D;  2IO5 C;  3FDD A;  5F99 A;  2Y2O A;  4WNN B;  3LJA B;  1T3U A;  5B32 B;  5AY8 C;  4J8W A;  2HUE B;  3LJA D;  5B2J C;  4ZUX A;  1BH9 B;  3REJ A;  5B32 D;  1U35 A;  3LEL D;  3TU4 A;  2ZY2 A;  5B2I B;  1P3L B;  4WJ3 C;  3LJA C;  5CPI A;  1P3L D;  5B2I D;  5B32 C;  2HUE C;  3LEL C;  4YS3 A;  3X1T B;  1P3O A;  1P3L C;  5B2I C;  4QLC A;  5B33 B;  5BO0 B;  1EQZ B;  5CPJ B;  5JA4 A;  5AV6 A;  3R45 A;  4WV4 B;  1EQZ D;  5CPJ D;  5B33 C;  2Y2P A;  3AV1 B;  3WKJ B;  1WWI A;  3AZJ B;  1EQZ C;  4H9O B;  5CPJ C;  3WKJ D;  1TZY B;  4UPK A;  2G5H C;  5GSU B;  3AZJ D;  1TZY D;  3AV1 C;  3WKJ C;  5GSU D;  5B0Z B;  3AZG A;  4H9P B;  3WTP E;  3MGP B;  3AN2 A;  1M18 B;  3AZJ C;  3LEL A;  3AZN B;  1BH9 A;  5B0Z D;  1TZY C;  3MGP D;  3REK B;  3AYW B;  1M18 D;  4KUD B;  1P3F A;  5GSU C;  1P3L A;  3AZN D;  2F8N A;  5GXQ B;  3AYW D;  4KUD D;  3H0M C;  5B0Z C;  3MGP C;  1M18 C;  3NQJ B;  5GXQ D;  1H3O A;  3AZN C;  3AYW C;  2G5I C;  3V9R A;  4KUD C;  4H9N B;  4J8U A;  2XD5 A;  5GXQ C;  3REI D;  3AZK A;  1P3P B;  1P3A B;  4X23 B;  1P3P D;  1P3A D;  3AZI D;  3W96 A;  5B40 B;  5AV9 A;  4X23 D;  3MNN D;  3O62 B;  4R8P B;  1F66 A;  5B40 D;  1P3P C;  3WTP B;  1P3A C;  5GT3 A;  3AZI C;  3O62 D;  4X23 C;  4H9S C;  3AZM A;  1M1A A;  5BNV A;  3WTP D;  4KGC A;  2PYO B;  5B40 C;  3O62 C;  1ID3 B;  4R8P C;  4UUZ B;  3WTP C;  1ID3 D;  4XZQ A;  3WAA B;  2PYO C;  1KX4 A;  3WAA D;  1ID3 C;  4KHA A;  1KU5 A;  2FFF B;  3MGS B;  5G49 B;  1HQ3 B;  3LZ0 D;  3REL B;  2YFV B;  3MGS D;  4Z66 A;  3WAA C;  3REL D;  1HQ3 D;  2CV5 B;  1WWS A;  2VQR A;  5B24 B;  3REI A;  3W97 A;  3LZ0 C;  3MGS C;  4JJN B;  2CV5 D;  3VH6 T;  3VH6 A;  5B24 D;  3REL C;  1HQ3 C;  4WU8 B;  3NQU B;  3AZI A;  3MNN A;  5B1M D;  4YM6 D;  4JJN D;  4WU8 D;  4WU9 B;  1B67 A;  2CV5 C;  5B24 C;  3AZL B;  3X1U B;  4WU9 D;  1M19 A;  2ZY5 A;  4JJN C;  3VH5 W;  4YM6 C;  2YFW A;  3AZL D;  1P34 B;  4WU8 C;  1P3G B;  3X1U D;  3REH B;  4WU9 C;  4J8V A;  1P3G D;  5CP6 B;  5C3I B;  3AZL C;  1TAF A;  1Z2C B;  3REH D;  3X1U C;  2F8N H;  3W99 A;  5CP6 D;  1P34 C;  1P3G C;  3AZF B;  5B1L A;  3REH C;  2BYK A;  5CP6 C;  5C3I C;  3LZ0 A;  3UT9 B;  5GT0 A;  4J8X A;  5B31 B;  3UT9 D;  3AZF C;  5B31 D;  2ARO A;  4NE3 A;  4E44 A;  3B0C T;  2HIO A;  1S32 B;  4CSR B;  3UT9 C;  5B1M A;  4YM6 A;  1P3K A;  5BS7 C;  3W98 D;  5CHL B;  5B31 C;  5B0Y B;  1S32 D;  2Y2L A;  5AV8 B;  1JFI A;  5DNN B;  5B0Y D;  5AV8 D;  3X1V A;  3W98 C;  3C1B B;  1P3M B;  1S32 C;  2F8N G;  3MGQ A;  1P3M D;  5B0Y C;  3UTA B;  5CPK B;  5AV8 C;  3B6G B;  1N1J A;  5DNN C;  3UTA D;  3AZE A;  5FUG B;  5CPK D;  3WA9 A;  5AVB A;  3C1B C;  1P3M C;  3KWQ A;  3X1S B;  4E45 A;  3X1T D;  4DRB A;  5KDM B;  3A6N B;  3UTA C;  3AV2 B;  5CPK C;  4Z5T A;  3IP4 C;  4LD9 A;  2NZD B;  3UTB B;  5B33 D;  3W97 B;  3B6G C;  4Z2M H;  3X1T C;  3B6F A;  2NZD D;  3UTB D;  2DF4 C;  3X1S C;  5AVC B;  4XUJ B;  3AV2 C;  4H9Q A;  5E5A B;  2NZD C;  3UTB C;  1Q9C A;  5AY8 A;  3H0L C;  4XUJ D;  5AVC D;  3AV1 D;  5B2J A;  4H9R A;  1P3I B;  5E5A D;  4G92 B;  3W98 A;  2Y2Q A;  1P3I D;  4NE5 A;  4XUJ C;  4WNN A;  5AVC C;  3LJA A;  5E5A C;  5B32 A;  5AV5 B;  3P5J B;  1P3I C;  5AV5 D;  4G92 C;  5B2I A;  2Y2K A;  3REK D;  2BYM B;  1P3B B;  2DQN C;  5AV5 C;  3LZ1 B;  2ZY4 A;  3REK C;  4Z2M G;  1P3B D;  3X1T A;  3LZ1 D;  5DNM B;  5B33 A;  5DNM D;  3EPK A;  5BO0 A;  1P3B C;  3LZ1 C;  1EQZ A;  5CPJ A;  5DNM C;  5BNX B;  2CWE A;  3MGR B;  3AZH B;  3KUY B;  3AV1 A;  3MGR D;  3AZH D;  3WKJ A;  3KFU G;  4CAY B;  3KUY D;  4R8P D;  3AZJ A;  4H9O A;  1TZY A;  3KXB B;  3MGR C;  3AZH C;  5GSU A;  3KUY C;  2PYO D;  3KXB D;  4NE6 A;  5B0Z A;  4H9P A;  3MGP A;  3AFA B;  1M18 A;  2NQB B;  3AZN A;  3B0B A;  3REK A;  3KXB C;  3AYW A;  2F2A C;  3AFA D;  2NQB D;  4KUD A;  3C1C B;  5GXQ A;  1ZLA B;  3C1C D;  3AFA C;  2NQB C;  3NQJ A;  1ZLA D;  4M6B A;  4H9N A;  3C1C C;  1ZLA C;  1P3P A;  1P3A A;  4X23 A;  4H9S A;  1KX5 B;  5B40 A;  5BT1 D;  3MVD B;  4AWL B;  1KX5 D;  3O62 A;  1KX3 B;  3VH6 W;  4R8P A;  1AOI B;  3MVD D;  3WTP A;  1KX3 D;  5BT1 C;  1KX5 C;  1AOI D;  1BH8 B;  1P34 D;  2PYO A;  2Y2H A;  3MVD C;  5JRG B;  4AWL C;  1KX3 C;  1ID3 A;  4UUZ A;  1AOI C;  5JRG D;  2JCH A;  5F99 B;  3WAA A;  5JRG C;  5F99 D;  4J8W B;  3AZF D;  3REJ B;  4ZUX B;  3MGS A;  1U35 B;  2BG1 A;  4J8W D;  5G49 A;  1HQ3 A;  1B6W A;  4ZUX D;  3REJ D;  3REL A;  3TU4 B;  3A1I A;  2YFV A;  5F99 C;  1U35 D;  5CPI B;  2Y2N A;  2CV5 A;  1KX4 C;  2F8N K;  4J8W C;  5B24 A;  3REJ C;  4ZUX C;  5CPI D;  4YS3 B;  4JJN A;  1U35 C;  1P3O B;  3TU4 C;  5B32 G;  4WU8 A;  4QLC B;  3NQU A;  4YS3 D;  4HGA B;  2LY8 A;  1P3O D;  5CPI C;  4WU9 A;  4QLC D;  3B0C W;  3AZL A;  3X1U A;  4YS3 C;  2ZM5 A;  5JA4 B;  5DNN D;  3R45 B;  5AV6 B;  1P3O C;  3C1B D;  1P34 A;  4QLC C;  1P3G A;  4HGA C;  5AV6 D;  4EO5 B;  3REH A;  5CP6 A;  2Y2J A;  3B6G D;  5AV6 C;  1HTA A;  3X1S D;  4EO5 C;  3AZF A;  3A6N D;  3AZG B;  3AV2 D;  3AN2 B;  3LEL B;  3AZG D;  3UT9 A;  3AN2 D;  1P3F B;  3A6N C;  5BS7 A;  5B31 A;  3EPJ A;  2F8N B;  1P3F D;  3AZG C;  2JSS A;  3AN2 C;  2F8N D;  1R4V A;  1H3O B;  1S32 A;  4CSR A;  2L5A A;  4ZBJ B;  3V9R B;  1P3F C;  4J8U B;  5B0Y A;  5AV8 A;  3AZK B;  4J8U D;  5DNN A;  3AZK D;  3C1B A;  1P3M A;  3KSY A;  4ZBJ C;  3W96 B;  3A1K A;  5AV9 B;  2FJ7 B;  4J8U C;  3UTA A;  4G91 B;  5CPK A;  3AZK C;  1F66 B;  5AV9 D;  3W96 D;  2FJ7 D;  5GT3 B;  3B6G A;  5FUG A;  3AZM B;  1M1A B;  1F66 D;  5BNV B;  4KGC B;  5GT3 D;  3X1S A;  3W96 C;  5AV9 C;  3AZM D;  1M1A D;  2FJ7 C;  2RVQ D;  5KDM A;  3A6N A;  4KGC D;  4G91 C;  3AV2 A;  1F66 C;  2NZD A;  3UTB A;  2JE5 A;  5GT3 C;  1BFM A;  3AZM C;  4XZQ B;  1M1A C;  2RVQ C;  4KGC C;  4XZQ D;  2Y2M A;  4XUJ A;  5AVC A;  1KX4 B;  1W2E A;  4KHA B;  1ULY A;  5E5A A;  1KX4 D;  1P3I A;  4XZQ C;  4Z66 B;  2RIQ A;  3REI B;  4Z66 D;  2XD1 A; 
#chains in the Genus database with same CATH homology
 5AV5 A;  2Y2G A;  3W97 D;  3AZI B;  3MNN B;  4Z66 C;  3REI C;  2J8P A;  3W97 C;  2W8S A;  2FJ7 A;  2BYM A;  1P3B A;  1M19 B;  3LZ1 A;  2YFW B;  1M19 D;  3MNN C;  4NFT A;  4DQY B;  5DNM A;  4J8V B;  1TAF B;  4J8V D;  1M19 C;  3EG5 B;  3W99 B;  3B0D B;  3EPH A;  3W99 D;  5B1L B;  5BNX A;  3MGR A;  3AZH A;  4J8V C;  3KUY A;  2BYK B;  5B1L D;  3LZ0 B;  3W99 C;  4CAY A;  3AL0 C;  3B0D C;  1A7W A;  5GT0 B;  4J8X B;  5B1L C;  3KXB A;  5GT0 D;  4J8X D;  2ARO B;  2HIO B;  2ARO D;  5B1M B;  2Y2I A;  3VH5 T;  4YM6 B;  3VH5 A;  5GT0 C;  3AFA A;  4J8X C;  1P3K B;  2HIO D;  2NQB A;  3H0R C;  1JFI B;  1PZR A;  1P3K D;  3C1C A;  2ZY3 A;  2ARO C;  3X1V B;  1ZLA A;  2HIO C;  5B31 G;  5B1M C;  1P3K C;  3X1V D;  3MGQ B;  3TU4 D;  4WZS B;  3MGQ D;  1N1J B;  3AZE B;  3F6T A;  3X1V C;  3WA9 B;  5AVB B;  3KWQ B;  3EPL A;  3AZE D;  3WA9 D;  1KX5 A;  5AVB D;  3MGQ C;  3KWQ D;  4Z5T B;  2UWX A;  4LD9 B;  3MVD A;  4DRA A;  3AZE C;  1KX3 A;  4Z5T D;  3WA9 C;  5AVB C;  1AOI A;  3B6F B;  4LD9 D;  3KWQ C;  2IO5 B;  3B6F D;  1BH8 A;  4H9Q B;  4Z5T C;  1F1E A;  4LD9 C;  5JRG A;  5AY8 B;  5B2J B;  4H9R B;  3B6F C;  5AY8 D;  3W98 B;  5B2J D;  2IO5 C;  3FDD A;  5F99 A;  2Y2O A;  4WNN B;  3LJA B;  1T3U A;  5B32 B;  5AY8 C;  4J8W A;  2HUE B;  3LJA D;  5B2J C;  4ZUX A;  1BH9 B;  3REJ A;  5B32 D;  1U35 A;  3LEL D;  3TU4 A;  2ZY2 A;  5B2I B;  1P3L B;  4WJ3 C;  3LJA C;  5CPI A;  1P3L D;  5B2I D;  5B32 C;  2HUE C;  3LEL C;  4YS3 A;  3X1T B;  1P3O A;  1P3L C;  5B2I C;  4QLC A;  5B33 B;  5BO0 B;  1EQZ B;  5CPJ B;  5JA4 A;  5AV6 A;  3R45 A;  4WV4 B;  1EQZ D;  5CPJ D;  5B33 C;  2Y2P A;  3AV1 B;  3WKJ B;  1WWI A;  3AZJ B;  1EQZ C;  4H9O B;  5CPJ C;  3WKJ D;  1TZY B;  4UPK A;  2G5H C;  5GSU B;  3AZJ D;  1TZY D;  3AV1 C;  3WKJ C;  5GSU D;  5B0Z B;  3AZG A;  4H9P B;  3WTP E;  3MGP B;  3AN2 A;  1M18 B;  3AZJ C;  3LEL A;  3AZN B;  1BH9 A;  5B0Z D;  1TZY C;  3MGP D;  3REK B;  3AYW B;  1M18 D;  4KUD B;  1P3F A;  5GSU C;  1P3L A;  3AZN D;  2F8N A;  5GXQ B;  3AYW D;  4KUD D;  3H0M C;  5B0Z C;  3MGP C;  1M18 C;  3NQJ B;  5GXQ D;  1H3O A;  3AZN C;  3AYW C;  2G5I C;  3V9R A;  4KUD C;  4H9N B;  4J8U A;  2XD5 A;  5GXQ C;  3REI D;  3AZK A;  1P3P B;  1P3A B;  4X23 B;  1P3P D;  1P3A D;  3AZI D;  3W96 A;  5B40 B;  5AV9 A;  4X23 D;  3MNN D;  3O62 B;  4R8P B;  1F66 A;  5B40 D;  1P3P C;  3WTP B;  1P3A C;  5GT3 A;  3AZI C;  3O62 D;  4X23 C;  4H9S C;  3AZM A;  1M1A A;  5BNV A;  3WTP D;  4KGC A;  2PYO B;  5B40 C;  3O62 C;  1ID3 B;  4R8P C;  4UUZ B;  3WTP C;  1ID3 D;  4XZQ A;  3WAA B;  2PYO C;  1KX4 A;  3WAA D;  1ID3 C;  4KHA A;  1KU5 A;  2FFF B;  3MGS B;  5G49 B;  1HQ3 B;  3LZ0 D;  3REL B;  2YFV B;  3MGS D;  4Z66 A;  3WAA C;  3REL D;  1HQ3 D;  2CV5 B;  1WWS A;  2VQR A;  5B24 B;  3REI A;  3W97 A;  3LZ0 C;  3MGS C;  4JJN B;  2CV5 D;  3VH6 T;  3VH6 A;  5B24 D;  3REL C;  1HQ3 C;  4WU8 B;  3NQU B;  3AZI A;  3MNN A;  5B1M D;  4YM6 D;  4JJN D;  4WU8 D;  4WU9 B;  1B67 A;  2CV5 C;  5B24 C;  3AZL B;  3X1U B;  4WU9 D;  1M19 A;  2ZY5 A;  4JJN C;  3VH5 W;  4YM6 C;  2YFW A;  3AZL D;  1P34 B;  4WU8 C;  1P3G B;  3X1U D;  3REH B;  4WU9 C;  4J8V A;  1P3G D;  5CP6 B;  5C3I B;  3AZL C;  1TAF A;  1Z2C B;  3REH D;  3X1U C;  2F8N H;  3W99 A;  5CP6 D;  1P34 C;  1P3G C;  3AZF B;  5B1L A;  3REH C;  2BYK A;  5CP6 C;  5C3I C;  3LZ0 A;  3UT9 B;  5GT0 A;  4J8X A;  5B31 B;  3UT9 D;  3AZF C;  5B31 D;  2ARO A;  4NE3 A;  4E44 A;  3B0C T;  2HIO A;  1S32 B;  4CSR B;  3UT9 C;  5B1M A;  4YM6 A;  1P3K A;  5BS7 C;  3W98 D;  5CHL B;  5B31 C;  5B0Y B;  1S32 D;  2Y2L A;  5AV8 B;  1JFI A;  5DNN B;  5B0Y D;  5AV8 D;  3X1V A;  3W98 C;  3C1B B;  1P3M B;  1S32 C;  2F8N G;  3MGQ A;  1P3M D;  5B0Y C;  3UTA B;  5CPK B;  5AV8 C;  3B6G B;  1N1J A;  5DNN C;  3UTA D;  3AZE A;  5FUG B;  5CPK D;  3WA9 A;  5AVB A;  3C1B C;  1P3M C;  3KWQ A;  3X1S B;  4E45 A;  3X1T D;  4DRB A;  5KDM B;  3A6N B;  3UTA C;  3AV2 B;  5CPK C;  4Z5T A;  3IP4 C;  4LD9 A;  2NZD B;  3UTB B;  5B33 D;  3W97 B;  3B6G C;  4Z2M H;  3X1T C;  3B6F A;  2NZD D;  3UTB D;  2DF4 C;  3X1S C;  5AVC B;  4XUJ B;  3AV2 C;  4H9Q A;  5E5A B;  2NZD C;  3UTB C;  1Q9C A;  5AY8 A;  3H0L C;  4XUJ D;  5AVC D;  3AV1 D;  5B2J A;  4H9R A;  1P3I B;  5E5A D;  4G92 B;  3W98 A;  2Y2Q A;  1P3I D;  4NE5 A;  4XUJ C;  4WNN A;  5AVC C;  3LJA A;  5E5A C;  5B32 A;  5AV5 B;  3P5J B;  1P3I C;  5AV5 D;  4G92 C;  5B2I A;  2Y2K A;  3REK D;  2BYM B;  1P3B B;  2DQN C;  5AV5 C;  3LZ1 B;  2ZY4 A;  3REK C;  4Z2M G;  1P3B D;  3X1T A;  3LZ1 D;  5DNM B;  5B33 A;  5DNM D;  3EPK A;  5BO0 A;  1P3B C;  3LZ1 C;  1EQZ A;  5CPJ A;  5DNM C;  5BNX B;  2CWE A;  3MGR B;  3AZH B;  3KUY B;  3AV1 A;  3MGR D;  3AZH D;  3WKJ A;  3KFU G;  4CAY B;  3KUY D;  4R8P D;  3AZJ A;  4H9O A;  1TZY A;  3KXB B;  3MGR C;  3AZH C;  5GSU A;  3KUY C;  2PYO D;  3KXB D;  4NE6 A;  5B0Z A;  4H9P A;  3MGP A;  3AFA B;  1M18 A;  2NQB B;  3AZN A;  3B0B A;  3REK A;  3KXB C;  3AYW A;  2F2A C;  3AFA D;  2NQB D;  4KUD A;  3C1C B;  5GXQ A;  1ZLA B;  3C1C D;  3AFA C;  2NQB C;  3NQJ A;  1ZLA D;  4M6B A;  4H9N A;  3C1C C;  1ZLA C;  1P3P A;  1P3A A;  4X23 A;  4H9S A;  1KX5 B;  5B40 A;  5BT1 D;  3MVD B;  4AWL B;  1KX5 D;  3O62 A;  1KX3 B;  3VH6 W;  4R8P A;  1AOI B;  3MVD D;  3WTP A;  1KX3 D;  5BT1 C;  1KX5 C;  1AOI D;  1BH8 B;  1P34 D;  2PYO A;  2Y2H A;  3MVD C;  5JRG B;  4AWL C;  1KX3 C;  1ID3 A;  4UUZ A;  1AOI C;  5JRG D;  2JCH A;  5F99 B;  3WAA A;  5JRG C;  5F99 D;  4J8W B;  3AZF D;  3REJ B;  4ZUX B;  3MGS A;  1U35 B;  2BG1 A;  4J8W D;  5G49 A;  1HQ3 A;  1B6W A;  4ZUX D;  3REJ D;  3REL A;  3TU4 B;  3A1I A;  2YFV A;  5F99 C;  1U35 D;  5CPI B;  2Y2N A;  2CV5 A;  1KX4 C;  2F8N K;  4J8W C;  5B24 A;  3REJ C;  4ZUX C;  5CPI D;  4YS3 B;  4JJN A;  1U35 C;  1P3O B;  3TU4 C;  5B32 G;  4WU8 A;  4QLC B;  3NQU A;  4YS3 D;  4HGA B;  2LY8 A;  1P3O D;  5CPI C;  4WU9 A;  4QLC D;  3B0C W;  3AZL A;  3X1U A;  4YS3 C;  2ZM5 A;  5JA4 B;  5DNN D;  3R45 B;  5AV6 B;  1P3O C;  3C1B D;  1P34 A;  4QLC C;  1P3G A;  4HGA C;  5AV6 D;  4EO5 B;  3REH A;  5CP6 A;  2Y2J A;  3B6G D;  5AV6 C;  1HTA A;  3X1S D;  4EO5 C;  3AZF A;  3A6N D;  3AZG B;  3AV2 D;  3AN2 B;  3LEL B;  3AZG D;  3UT9 A;  3AN2 D;  1P3F B;  3A6N C;  5BS7 A;  5B31 A;  3EPJ A;  2F8N B;  1P3F D;  3AZG C;  2JSS A;  3AN2 C;  2F8N D;  1R4V A;  1H3O B;  1S32 A;  4CSR A;  2L5A A;  4ZBJ B;  3V9R B;  1P3F C;  4J8U B;  5B0Y A;  5AV8 A;  3AZK B;  4J8U D;  5DNN A;  3AZK D;  3C1B A;  1P3M A;  3KSY A;  4ZBJ C;  3W96 B;  3A1K A;  5AV9 B;  2FJ7 B;  4J8U C;  3UTA A;  4G91 B;  5CPK A;  3AZK C;  1F66 B;  5AV9 D;  3W96 D;  2FJ7 D;  5GT3 B;  3B6G A;  5FUG A;  3AZM B;  1M1A B;  1F66 D;  5BNV B;  4KGC B;  5GT3 D;  3X1S A;  3W96 C;  5AV9 C;  3AZM D;  1M1A D;  2FJ7 C;  2RVQ D;  5KDM A;  3A6N A;  4KGC D;  4G91 C;  3AV2 A;  1F66 C;  2NZD A;  3UTB A;  2JE5 A;  5GT3 C;  1BFM A;  3AZM C;  4XZQ B;  1M1A C;  2RVQ C;  4KGC C;  4XZQ D;  2Y2M A;  4XUJ A;  5AVC A;  1KX4 B;  1W2E A;  4KHA B;  1ULY A;  5E5A A;  1KX4 D;  1P3I A;  4XZQ C;  4Z66 B;  2RIQ A;  3REI B;  4Z66 D;  2XD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...