5GT0C

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0C00
5B2JD 3AZLC 5DNNA 5BO0A 4YS3C 4J8WA 5B40C 2FJ7A 4XUJC 3X1UA 1KX5D 3AN2A 3C1BC 2JSSA 3AZJA 5B24D 3MGPC 3AZFB 4Z66C 1KU5A 3W98D 4EO5B 3MGSA 3B0DC 5AVBA 3TU4A 3VH6A 3C1CA 4YS3A 4H9OA 5B32D 5CPIA 5AV5D 3LZ1C 5AY8D 3C1BA 1P3GC 3KWQD 1BH8B 5B0YC 3MGRA 3VH5T 3KUYA 4J8UD 1M1AB 2F8NH 3V9RB 1KX4A 3B0CT 2F8NB 2HUEC 2BYMB 4R8PD 1P3LA 1ID3D 2YFWB 5KDMB 3AZIC 3KXBA 3WTPD 3W96C 3X1SC 2RVQD 5B2IC 4KUDB 3R45A 3W99D 4KHAB 1ZLAB 3WAAB 5GSUB 1WWIA 3MVDC 4J8VB 1M19B 3AZIA 3AZFA 3LELC 4CAYA 5JRGC 1P3PD 4G92B 4M6BA 3WTPE 1BH8A 4ZUXD 1ZLAC 5JRGA 1M1AA 3V9RA 3B6FD 2F8NA 2BYMA 3O62D 3LZ0B 2YFWA 4YM6D 3LJAB 3AZHD 3X1TB 1HQ3B 5DNMB 4KUDA 4KHAA 3AV1C 1ZLAA 5GSUA 3WAAA 5CHLB 3AFAB 5B31D 5F99C 2NQBB 4J8VA 1M19A 3REKB 5AV6C 3REHD 5B1LB 2BYKA 4QLCD 3AV1A 4NE3A 5AVCC 1EQZB 1P3KB 2AROB 4WU9B 3X1VD 4E44A 4Z5TD 2F8NG 3MNND 2PYOC 2HIOB 5AV9C 5CP6B 1P3IB 3AV2D 3LZ0A 1P3BD 3NQJB 1HQ3A 5DNMA 1S32D 3AZGC 5AV8C 3AZEC 3AYWB 5GXQB 2CWEA 3AFAA 5AV9A 3UTBB 3REJD 3REKA 4WU8D 5GT3B 5E5AD 4LD9D 5B1LA 5B33C 3AZKC 3A6NC 3UT9D 1P3FC 4XZQD 5B0ZC 3RELD 3AZEA 1B67A 1P34C 4ZBJB 1P3KA 2AROA 4WU9A 1KX3D 4JJNB 1P3OB 3AZLB 1U35C 5CPKD 1P3FA 5GT0D 3LJAD 3W97D 4H9OB 2HIOA 2L5AA 5B40B 5B2JC 4XUJB 3REID 5CP6A 3C1BB 4H9NB 1P34A 1P3IA 1TZYD 3MGQD 3MGPB 3NQJA 4Z66B 4KGCC 1KX5C 5B24C 3AZMC 3B0DB 4WV4B 4DRAA 5GXQA 3AYWA 3B6GC 3W98C 3LZ1B 1P3GB 1BFMA 5B32C 5B0YB 5GT3A 4KGCA 5AV5C 3AZND 1P3OC 1P3AD 5B1MD 5B24A 4AWLC 3AZMA 2HUEB 3B6GA 3AZIB 3W96B 3X1SB 4R8PC 4X23D 5B2IB 1ID3C 4UUZB 4CAYB 4JJNA 1P3OA 3WTPC 3AZLA 1JFIB 2RVQC 1AOID 3W99C 3MVDB 1P3MD 5B40A 4G91C 4NFTA 4XUJA 4H9NA 1M18D 3MGPA 4Z66A 3LELB 5JRGB 3WKJD 3WTPA 4NE5A 5BT1D 3W99A 2NZDD 1P3PC 1ULYA 3LZ1A 1P3GA 5DNND 5B0YA 4J8WD 2FJ7D 3X1UD 3AN2D 4J8XD 4ZUXC 3AZJD 4CSRB 2LY8A 3UTAC 5CPJD 5B32G 3W96A 3X1SA 3O62C 3MGSD 2BYKB 5B2IA 4H9RA 5AVBD 4UUZA 4YM6C 4YS3D 4WNNB 3C1CD 3TU4D 3AZHC 3AV1B 5CPID 1JFIA 5F99B 3MVDA 3MGRD 5AV6B 3KUYD 3UTAA 5B31C 3VH6T 2YFVA 1KX4D 3O62A 5FUGA 3LELA 4YM6A 3VH5W 1P3LD 3REHC 5AVCB 3KXBD 3B0CW 2CV5D 2IO5B 4QLCC 1F66C 5B31A 4H9PA 1R4VA 2PYOB 3X1VC 5AV9B 3WA9B 3AZFD 3B0BA 4Z5TC 4CSRA 3MNNC 1TAFB 1F66A 3AV2C 3AZGB 1P3BC 5BNXB 4WNNA 5C3IC 4DRBA 5AV8B 3AZEB 1S32C 2IO5C 5F99A 1B6WA 5AV6A 1M1AD 5B33B 3AZKB 3REJC 3A6NB 1P3FB 4WU8C 2F8ND 5B0ZB 5E5AC 4LD9C 5AVCA 3WA9C 3UT9C 1P34B 4XZQC 4KUDD 5B31G 3RELC 1ZLAD 3WAAD 5GSUD 4J8VD 1U35B 1M19D 4WU8A 1KX3C 2PYOA 4LD9A 5B2JB 5BS7C 3WA9A 1F1EA 3UT9A 5GT0C 5CPKC 3W97C 3RELA 5G49A 1TAFA 4KGCB 3REIC 1KX5B 3AZGA 1TZYC 3MGQC 5BNXA 5B24B 3AZMB 5AV8A 3B6GB 3W98B 5BS7A 5CPKA 3W97A 5B32B 5AV5B 3REIA 5AY8B 4H9SC 5B33A 3AZKA 3A6NA 3KWQB 4AWLB 3LZ0D 5B0ZA 1HTAA 5JA4B 3AZNC 3X1TD 1HQ3D 1P3AC 5DNMD 4J8UB 5B1MC 1A7WA 4R8PB 1ID3B 3AFAD 3WTPB 5AV9D 2NQBD 1U35A 1H3OB 4X23C 5BNVB 3REKD 3W99B 5B2JA 4G91B 5B1LD 1AOIC 1P3MC 1KX5A 5AY8C 1M18C 1EQZD 3KWQC 1P3KD 2AROD 4WU9D 3WKJC 4J8UC 1P3PB 3W98A 3VH5A 5BT1C 4H9RB 2NZDC 5B32A 2HIOD 5AV5A 5AY8A 5CP6D 5DNNC 3KWQA 1P3ID 5JA4A 4ZUXB 4J8WC 4WZSB 2FJ7C 3X1UC 3AN2C 4J8UA 3UTAB 4J8XC 3AZJC 2YFVB 3O62B 5FUGB 4R8PA 1ID3A 1BH9B 4YM6B 3AZHB 4H9QB 5GXQD 3AYWD 5CPJC 3UTBD 1H3OA 3MGSC 2F8NK 5AVBC 5BNVA 3TU4C 3C1CC 5CPIC 1WWSA 5GT3D 4KGCD 5B31B 4J8XA 3AZMD 3MGRC 3KUYC 4H9PB 3B6GD 3REHB 5CPJA 1KX4C 1P3LC 4QLCB 1P3PA 4JJND 3KXBC 1P3OD 1F66B 3AZLD 3B6FC 2CV5C 4HGAC 5B40D 4XUJD 3C1BD 3X1VB 4ZUXA 3MGPD 4Z66D 4Z5TB 3MNNB 3B6FA 3AZFC 2CV5A 3AV2B 1P3BB 1BH9A 3AZHA 5C3IB 4H9QA 4EO5C 3LZ1D 1S32B 1P3GD 3NQUB 5B0YD 1N1JB 3KSYA 3REJB 4WU8B 5E5AB 3REHA 1M1AC 3AZID 4LD9B 3W96D 3X1SD 3UT9B 4XZQB 5B2ID 4QLCA 3RELB 5G49B 4Z2MH 4KUDC 3MVDD 3WAAC 5GSUC 1KX3B 3UTAD 3X1VA 4J8VC 1M19C 5CPKB 5GT0B 4Z5TA 3LELD 5KDMA 3W97B 3MNNA 5JRGD 3REIB 3VH6W 3AV2A 1TZYB 1P3BA 3MGQB 1S32A 4G92C 3NQUA 1N1JA 3REJA 1Q9CA 5E5AA 3AZNB 1F66D 1P3AB 5B1MB 4XZQA 3LZ0C 3LJAC 4NE6A 3AV1D 3X1TC 1HQ3C 5DNMC 5F99D 4X23B 5AV6D 1KX3A 3AFAC 2NQBC 1AOIB 5GT0A 3REKC 3LJAA 1P3MB 3X1TA 5AVCD 5B1LC 1M18B 1TZYA 3MGQA 1EQZC 3WKJB 2NQBA 1P3KC 2AROC 2NZDB 4WU9C 2PYOD 3WA9D 4H9SA 5DNNB 5BO0B 4J8WB 2HIOC 3AZNA 3X1UB 1EQZA 2FJ7B 5CP6C 3AN2B 1P3AA 1P3IC 5B1MA 3AZGD 4J8XB 3AZJB 5AV8D 3AZED 4Z2MG 5CPJB 4X23A 3MGSB 5AVBB 3TU4B 3C1CB 4YS3B 3AYWC 5GXQC 5CPIB 3UTBC 1AOIA 5B33D 3AZKD 3A6ND 1P3FD 5B0ZD 1P3MA 3MGRB 5GT3C 3KUYB 1M18A 1P34D 1KX4B 1P3LB 3WKJA 3UTBA 3KXBB 4ZBJC 3B6FB 2CV5B 1U35D 4HGAB 4E45A 2NZDA 3R45B 4JJNC
chains in the Genus database with same CATH superfamily
5B2JD 3AZLC 2BG1A 5DNNA 5BO0A 4YS3C 4J8WA 5B40C 2FJ7A 4XUJC 3X1UA 1KX5D 3AN2A 3C1BC 2JSSA 3AZJA 5B24D 3MGPC 3AZFB 4Z66C 1KU5A 3W98D 3AL0C 4EO5B 3MGSA 3B0DC 5AVBA 3TU4A 3VH6A 3C1CA 4YS3A 4H9OA 5B32D 5CPIA 5AV5D 3LZ1C 5AY8D 3C1BA 1P3GC 3KWQD 1BH8B 2Y2LA 5B0YC 3MGRA 3VH5T 3KUYA 4J8UD 1M1AB 2F8NH 3H0RC 3V9RB 1KX4A 3B0CT 2F8NB 2HUEC 2BYMB 4R8PD 1P3LA 1ID3D 2YFWB 5KDMB 3AZIC 3KXBA 3WTPD 3W96C 3X1SC 2RVQD 5B2IC 4KUDB 3R45A 3W99D 4KHAB 1ZLAB 3WAAB 2ZY3A 5GSUB 1WWIA 3MVDC 4J8VB 1M19B 2ZY4A 2ZM5A 3AZIA 3AZFA 3LELC 1T3UA 4CAYA 5JRGC 1P3PD 2DF4C 4G92B 4M6BA 3WTPE 1BH8A 4ZUXD 3A1KA 1ZLAC 5JRGA 1M1AA 3V9RA 3B6FD 2F8NA 2BYMA 3O62D 3LZ0B 2YFWA 4YM6D 3LJAB 3AZHD 3X1TB 1HQ3B 5DNMB 4KUDA 4KHAA 3AV1C 1ZLAA 5GSUA 3WAAA 5CHLB 3AFAB 5B31D 2Y2GA 5F99C 2NQBB 4J8VA 1M19A 3REKB 5AV6C 3REHD 5B1LB 4WJ3C 2BYKA 4QLCD 3AV1A 4NE3A 5AVCC 1EQZB 1P3KB 2AROB 4WU9B 3X1VD 4E44A 3EG5B 4Z5TD 2F8NG 3MNND 2PYOC 2HIOB 5AV9C 5CP6B 1P3IB 3AV2D 3LZ0A 1P3BD 3NQJB 1HQ3A 5DNMA 1S32D 3AZGC 5AV8C 3AZEC 3AYWB 5GXQB 2CWEA 3AFAA 5AV9A 3UTBB 3REJD 3REKA 4WU8D 5GT3B 5E5AD 4LD9D 5B1LA 5B33C 3AZKC 3A6NC 3UT9D 1P3FC 4XZQD 5B0ZC 2Y2JA 3RELD 3AZEA 1B67A 1P34C 4ZBJB 1P3KA 2Y2QA 2AROA 4WU9A 1KX3D 2Y2OA 4JJNB 1P3OB 3AZLB 1U35C 5CPKD 1P3FA 5GT0D 3LJAD 3W97D 4H9OB 2HIOA 2L5AA 5B40B 5B2JC 4XUJB 3REID 5CP6A 3C1BB 4H9NB 1P34A 1P3IA 1TZYD 3MGQD 3MGPB 3NQJA 4Z66B 4KGCC 1KX5C 5B24C 3AZMC 3B0DB 4WV4B 2J8PA 4DRAA 5GXQA 3AYWA 3B6GC 3W98C 3LZ1B 1P3GB 1BFMA 1Z2CB 2Y2MA 5B32C 5B0YB 5GT3A 4KGCA 5AV5C 3AZND 1P3OC 1P3AD 5B1MD 5B24A 4AWLC 3AZMA 1PZRA 2HUEB 3B6GA 3AZIB 3W96B 3X1SB 4R8PC 4X23D 2JCHA 5B2IB 1ID3C 4UUZB 4CAYB 4JJNA 1P3OA 3WTPC 2FFFB 3AZLA 1JFIB 2RVQC 1AOID 3W99C 3MVDB 4UPKA 1P3MD 5B40A 4G91C 4NFTA 4XUJA 4H9NA 1M18D 2G5IC 3MGPA 4Z66A 3A1IA 3LELB 5JRGB 3WKJD 3WTPA 4NE5A 5BT1D 3W99A 2NZDD 1P3PC 1ULYA 3LZ1A 1P3GA 5DNND 5B0YA 4J8WD 2FJ7D 3X1UD 3AN2D 4J8XD 4ZUXC 3AZJD 4CSRB 2ZY2A 2LY8A 3UTAC 5CPJD 5B32G 3W96A 3X1SA 3O62C 3MGSD 2BYKB 5B2IA 4H9RA 5AVBD 4UUZA 4YM6C 4YS3D 4WNNB 3C1CD 3TU4D 3AZHC 3AV1B 5CPID 1JFIA 5F99B 3MVDA 3MGRD 5AV6B 3KUYD 3UTAA 5B31C 3VH6T 2YFVA 1KX4D 3O62A 5FUGA 3LELA 3F6TA 3VH5W 4YM6A 1P3LD 3REHC 5AVCB 3KXBD 3B0CW 2CV5D 2IO5B 4QLCC 1F66C 5B31A 4H9PA 1R4VA 2PYOB 3X1VC 5AV9B 3WA9B 3AZFD 3B0BA 4Z5TC 4CSRA 3MNNC 1TAFB 1F66A 3AV2C 3AZGB 1P3BC 5BNXB 4WNNA 5C3IC 4DRBA 5AV8B 3AZEB 2RIQA 2ZY5A 1S32C 2IO5C 5F99A 1B6WA 2Y2IA 5AV6A 1M1AD 5B33B 3AZKB 3REJC 3A6NB 1P3FB 4WU8C 2F8ND 5B0ZB 5E5AC 4LD9C 5AVCA 3WA9C 3UT9C 1P34B 4XZQC 4KUDD 5B31G 3RELC 2XD5A 1ZLAD 5GSUD 3WAAD 4J8VD 1U35B 1M19D 4WU8A 2VQRA 2Y2NA 1KX3C 3EPLA 2PYOA 4LD9A 5B2JB 5BS7C 3WA9A 1F1EA 3UT9A 5GT0C 5CPKC 3W97C 3RELA 5G49A 1TAFA 4KGCB 3REIC 2Y2PA 1KX5B 3AZGA 1TZYC 2XD1A 3MGQC 5BNXA 5B24B 3AZMB 3H0MC 5AV8A 3B6GB 3FDDA 3W98B 5BS7A 5CPKA 3W97A 5B32B 5AV5B 3REIA 5AY8B 4H9SC 5B33A 3AZKA 3A6NA 3KWQB 4AWLB 3LZ0D 5B0ZA 1HTAA 5JA4B 3AZNC 3X1TD 1HQ3D 1P3AC 5DNMD 4J8UB 5B1MC 2DQNC 1A7WA 4R8PB 1ID3B 2Y2KA 3AFAD 3WTPB 5AV9D 2NQBD 1U35A 1H3OB 4X23C 5BNVB 3REKD 3W99B 5B2JA 2Y2HA 4G91B 5B1LD 1AOIC 1P3MC 3H0LC 1KX5A 5AY8C 1M18C 1EQZD 3KWQC 1P3KD 2AROD 4WU9D 3WKJC 4J8UC 1P3PB 3W98A 3VH5A 5BT1C 4H9RB 2NZDC 5B32A 2HIOD 5AV5A 5AY8A 5CP6D 5DNNC 3KWQA 1P3ID 3EPHA 5JA4A 4ZUXB 4J8WC 4WZSB 2FJ7C 3X1UC 3AN2C 4J8UA 3UTAB 4J8XC 3AZJC 2YFVB 3O62B 5FUGB 4R8PA 3EPJA 1ID3A 1BH9B 4YM6B 3AZHB 4H9QB 5GXQD 3AYWD 5CPJC 3UTBD 1H3OA 3MGSC 2F8NK 5AVBC 5BNVA 3TU4C 3C1CC 5CPIC 1WWSA 5GT3D 4KGCD 5B31B 4J8XA 3AZMD 3MGRC 3KUYC 4H9PB 3B6GD 3REHB 5CPJA 1KX4C 2G5HC 1P3LC 4QLCB 1P3PA 4JJND 3KXBC 1P3OD 1F66B 3AZLD 3B6FC 2CV5C 4HGAC 2F2AC 5B40D 4XUJD 3C1BD 3X1VB 4ZUXA 3IP4C 3MGPD 4Z66D 4Z5TB 3MNNB 3B6FA 3AZFC 2CV5A 3P5JB 3AV2B 1P3BB 1BH9A 3AZHA 5C3IB 4H9QA 4EO5C 3LZ1D 1S32B 1P3GD 3NQUB 5B0YD 1N1JB 3KSYA 3REJB 3KFUG 4WU8B 5E5AB 3REHA 1M1AC 3AZID 4LD9B 3W96D 3X1SD 3UT9B 4XZQB 5B2ID 4QLCA 3RELB 5G49B 1W2EA 4Z2MH 4KUDC 3MVDD 3WAAC 5GSUC 1KX3B 3UTAD 3X1VA 4J8VC 1M19C 5CPKB 5GT0B 4Z5TA 3LELD 2JE5A 5KDMA 3W97B 3MNNA 5JRGD 3REIB 3VH6W 3AV2A 1TZYB 1P3BA 3MGQB 1S32A 4G92C 3NQUA 2W8SA 1N1JA 3REJA 1Q9CA 5E5AA 3AZNB 1F66D 1P3AB 5B1MB 4XZQA 3LZ0C 3LJAC 4NE6A 3AV1D 3X1TC 1HQ3C 5DNMC 5F99D 4X23B 5AV6D 1KX3A 3AFAC 2NQBC 1AOIB 5GT0A 3REKC 3LJAA 1P3MB 3X1TA 5AVCD 5B1LC 1M18B 1TZYA 3MGQA 1EQZC 3WKJB 2NQBA 1P3KC 2AROC 2NZDB 4WU9C 2PYOD 3WA9D 4H9SA 5DNNB 4DQYB 5BO0B 4J8WB 2HIOC 3AZNA 3X1UB 1EQZA 2FJ7B 5CP6C 3AN2B 1P3AA 1P3IC 5B1MA 3AZGD 4J8XB 3AZJB 5AV8D 3AZED 4Z2MG 5CPJB 4X23A 3MGSB 5AVBB 3TU4B 3C1CB 4YS3B 3AYWC 5GXQC 5CPIB 2UWXA 3UTBC 1AOIA 5B33D 3AZKD 3A6ND 1P3FD 5B0ZD 1P3MA 3MGRB 5GT3C 3KUYB 1M18A 1P34D 1KX4B 1P3LB 3WKJA 3UTBA 3KXBB 4ZBJC 3B6FB 2CV5B 1U35D 4HGAB 4E45A 2NZDA 3R45B 3EPKA 4JJNC
chains in the Genus database with same CATH topology
5B2JD 3AZLC 2BG1A 5DNNA 5BO0A 4YS3C 4J8WA 5B40C 2FJ7A 4XUJC 3X1UA 1KX5D 3AN2A 3C1BC 2JSSA 3AZJA 5B24D 3MGPC 3AZFB 4Z66C 1KU5A 3W98D 3AL0C 4EO5B 3MGSA 3B0DC 5AVBA 3TU4A 3VH6A 3C1CA 4YS3A 4H9OA 5B32D 5CPIA 5AV5D 3LZ1C 5AY8D 3C1BA 1P3GC 3KWQD 1BH8B 2Y2LA 5B0YC 3MGRA 3VH5T 3KUYA 4J8UD 1M1AB 2F8NH 3H0RC 3V9RB 1KX4A 3B0CT 2F8NB 2HUEC 2BYMB 4R8PD 1P3LA 1ID3D 2YFWB 5KDMB 3AZIC 3KXBA 3WTPD 3W96C 3X1SC 2RVQD 5B2IC 4KUDB 3R45A 3W99D 4KHAB 1ZLAB 3WAAB 2ZY3A 5GSUB 1WWIA 3MVDC 4J8VB 1M19B 2ZY4A 2ZM5A 3AZIA 3AZFA 3LELC 1T3UA 4CAYA 5JRGC 1P3PD 2DF4C 4G92B 4M6BA 3WTPE 1BH8A 4ZUXD 3A1KA 1ZLAC 5JRGA 1M1AA 3V9RA 3B6FD 2F8NA 2BYMA 3O62D 3LZ0B 2YFWA 4YM6D 3LJAB 3AZHD 3X1TB 1HQ3B 5DNMB 4KUDA 4KHAA 3AV1C 1ZLAA 5GSUA 3WAAA 5CHLB 3AFAB 5B31D 2Y2GA 5F99C 2NQBB 4J8VA 1M19A 3REKB 5AV6C 3REHD 5B1LB 4WJ3C 2BYKA 4QLCD 3AV1A 4NE3A 5AVCC 1EQZB 1P3KB 2AROB 4WU9B 3X1VD 4E44A 3EG5B 4Z5TD 2F8NG 3MNND 2PYOC 2HIOB 5AV9C 5CP6B 1P3IB 3AV2D 3LZ0A 1P3BD 3NQJB 1HQ3A 5DNMA 1S32D 3AZGC 5AV8C 3AZEC 3AYWB 5GXQB 2CWEA 3AFAA 5AV9A 3UTBB 3REJD 3REKA 4WU8D 5GT3B 5E5AD 4LD9D 5B1LA 5B33C 3AZKC 3A6NC 3UT9D 1P3FC 4XZQD 5B0ZC 2Y2JA 3RELD 3AZEA 1B67A 1P34C 4ZBJB 1P3KA 2Y2QA 2AROA 4WU9A 1KX3D 2Y2OA 4JJNB 1P3OB 3AZLB 1U35C 5CPKD 1P3FA 5GT0D 3LJAD 3W97D 4H9OB 2HIOA 2L5AA 5B40B 5B2JC 4XUJB 3REID 5CP6A 3C1BB 4H9NB 1P34A 1P3IA 1TZYD 3MGQD 3MGPB 3NQJA 4Z66B 4KGCC 1KX5C 5B24C 3AZMC 3B0DB 4WV4B 2J8PA 4DRAA 5GXQA 3AYWA 3B6GC 3W98C 3LZ1B 1P3GB 1BFMA 1Z2CB 2Y2MA 5B32C 5B0YB 5GT3A 4KGCA 5AV5C 3AZND 1P3OC 1P3AD 5B1MD 5B24A 4AWLC 3AZMA 1PZRA 2HUEB 3B6GA 3AZIB 3W96B 3X1SB 4R8PC 4X23D 2JCHA 5B2IB 1ID3C 4UUZB 4CAYB 4JJNA 1P3OA 3WTPC 2FFFB 3AZLA 1JFIB 2RVQC 1AOID 3W99C 3MVDB 4UPKA 1P3MD 5B40A 4G91C 4NFTA 4XUJA 4H9NA 1M18D 2G5IC 3MGPA 4Z66A 3A1IA 3LELB 5JRGB 3WKJD 3WTPA 4NE5A 5BT1D 3W99A 2NZDD 1P3PC 1ULYA 3LZ1A 1P3GA 5DNND 5B0YA 4J8WD 2FJ7D 3X1UD 3AN2D 4J8XD 4ZUXC 3AZJD 4CSRB 2ZY2A 2LY8A 3UTAC 5CPJD 5B32G 3W96A 3X1SA 3O62C 3MGSD 2BYKB 5B2IA 4H9RA 5AVBD 4UUZA 4YM6C 4YS3D 4WNNB 3C1CD 3TU4D 3AZHC 3AV1B 5CPID 1JFIA 5F99B 3MVDA 3MGRD 5AV6B 3KUYD 3UTAA 5B31C 3VH6T 2YFVA 1KX4D 3O62A 5FUGA 3LELA 3F6TA 3VH5W 4YM6A 1P3LD 3REHC 5AVCB 3KXBD 3B0CW 2CV5D 2IO5B 4QLCC 1F66C 5B31A 4H9PA 1R4VA 2PYOB 3X1VC 5AV9B 3WA9B 3AZFD 3B0BA 4Z5TC 4CSRA 3MNNC 1TAFB 1F66A 3AV2C 3AZGB 1P3BC 5BNXB 4WNNA 5C3IC 4DRBA 5AV8B 3AZEB 2RIQA 2ZY5A 1S32C 2IO5C 5F99A 1B6WA 2Y2IA 5AV6A 1M1AD 5B33B 3AZKB 3REJC 3A6NB 1P3FB 4WU8C 2F8ND 5B0ZB 5E5AC 4LD9C 5AVCA 3WA9C 3UT9C 1P34B 4XZQC 4KUDD 5B31G 3RELC 2XD5A 1ZLAD 5GSUD 3WAAD 4J8VD 1U35B 1M19D 4WU8A 2VQRA 2Y2NA 1KX3C 3EPLA 2PYOA 4LD9A 5B2JB 5BS7C 3WA9A 1F1EA 3UT9A 5GT0C 5CPKC 3W97C 3RELA 5G49A 1TAFA 4KGCB 3REIC 2Y2PA 1KX5B 3AZGA 1TZYC 2XD1A 3MGQC 5BNXA 5B24B 3AZMB 3H0MC 5AV8A 3B6GB 3FDDA 3W98B 5BS7A 5CPKA 3W97A 5B32B 5AV5B 3REIA 5AY8B 4H9SC 5B33A 3AZKA 3A6NA 3KWQB 4AWLB 3LZ0D 5B0ZA 1HTAA 5JA4B 3AZNC 3X1TD 1HQ3D 1P3AC 5DNMD 4J8UB 5B1MC 2DQNC 1A7WA 4R8PB 1ID3B 2Y2KA 3AFAD 3WTPB 5AV9D 2NQBD 1U35A 1H3OB 4X23C 5BNVB 3REKD 3W99B 5B2JA 2Y2HA 4G91B 5B1LD 1AOIC 1P3MC 3H0LC 1KX5A 5AY8C 1M18C 1EQZD 3KWQC 1P3KD 2AROD 4WU9D 3WKJC 4J8UC 1P3PB 3W98A 3VH5A 5BT1C 4H9RB 2NZDC 5B32A 2HIOD 5AV5A 5AY8A 5CP6D 5DNNC 3KWQA 1P3ID 3EPHA 5JA4A 4ZUXB 4J8WC 4WZSB 2FJ7C 3X1UC 3AN2C 4J8UA 3UTAB 4J8XC 3AZJC 2YFVB 3O62B 5FUGB 4R8PA 3EPJA 1ID3A 1BH9B 4YM6B 3AZHB 4H9QB 5GXQD 3AYWD 5CPJC 3UTBD 1H3OA 3MGSC 2F8NK 5AVBC 5BNVA 3TU4C 3C1CC 5CPIC 1WWSA 5GT3D 4KGCD 5B31B 4J8XA 3AZMD 3MGRC 3KUYC 4H9PB 3B6GD 3REHB 5CPJA 1KX4C 2G5HC 1P3LC 4QLCB 1P3PA 4JJND 3KXBC 1P3OD 1F66B 3AZLD 3B6FC 2CV5C 4HGAC 2F2AC 5B40D 4XUJD 3C1BD 3X1VB 4ZUXA 3IP4C 3MGPD 4Z66D 4Z5TB 3MNNB 3B6FA 3AZFC 2CV5A 3P5JB 3AV2B 1P3BB 1BH9A 3AZHA 5C3IB 4H9QA 4EO5C 3LZ1D 1S32B 1P3GD 3NQUB 5B0YD 1N1JB 3KSYA 3REJB 3KFUG 4WU8B 5E5AB 3REHA 1M1AC 3AZID 4LD9B 3W96D 3X1SD 3UT9B 4XZQB 5B2ID 4QLCA 3RELB 5G49B 1W2EA 4Z2MH 4KUDC 3MVDD 3WAAC 5GSUC 1KX3B 3UTAD 3X1VA 4J8VC 1M19C 5CPKB 5GT0B 4Z5TA 3LELD 2JE5A 5KDMA 3W97B 3MNNA 5JRGD 3REIB 3VH6W 3AV2A 1TZYB 1P3BA 3MGQB 1S32A 4G92C 3NQUA 2W8SA 1N1JA 3REJA 1Q9CA 5E5AA 3AZNB 1F66D 1P3AB 5B1MB 4XZQA 3LZ0C 3LJAC 4NE6A 3AV1D 3X1TC 1HQ3C 5DNMC 5F99D 4X23B 5AV6D 1KX3A 3AFAC 2NQBC 1AOIB 5GT0A 3REKC 3LJAA 1P3MB 3X1TA 5AVCD 5B1LC 1M18B 1TZYA 3MGQA 1EQZC 3WKJB 2NQBA 1P3KC 2AROC 2NZDB 4WU9C 2PYOD 3WA9D 4H9SA 5DNNB 4DQYB 5BO0B 4J8WB 2HIOC 3AZNA 3X1UB 1EQZA 2FJ7B 5CP6C 3AN2B 1P3AA 1P3IC 5B1MA 3AZGD 4J8XB 3AZJB 5AV8D 3AZED 4Z2MG 5CPJB 4X23A 3MGSB 5AVBB 3TU4B 3C1CB 4YS3B 3AYWC 5GXQC 5CPIB 2UWXA 3UTBC 1AOIA 5B33D 3AZKD 3A6ND 1P3FD 5B0ZD 1P3MA 3MGRB 5GT3C 3KUYB 1M18A 1P34D 1KX4B 1P3LB 3WKJA 3UTBA 3KXBB 4ZBJC 3B6FB 2CV5B 1U35D 4HGAB 4E45A 2NZDA 3R45B 3EPKA 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J D;  3AZL C;  5DNN A;  5BO0 A;  4YS3 C;  4J8W A;  5B40 C;  2FJ7 A;  4XUJ C;  3X1U A;  1KX5 D;  3AN2 A;  3C1B C;  2JSS A;  3AZJ A;  5B24 D;  3MGP C;  3AZF B;  4Z66 C;  1KU5 A;  3W98 D;  4EO5 B;  3MGS A;  3B0D C;  5AVB A;  3TU4 A;  3VH6 A;  3C1C A;  4YS3 A;  4H9O A;  5B32 D;  5CPI A;  5AV5 D;  3LZ1 C;  5AY8 D;  3C1B A;  1P3G C;  3KWQ D;  1BH8 B;  5B0Y C;  3MGR A;  3VH5 T;  3KUY A;  4J8U D;  1M1A B;  2F8N H;  3V9R B;  1KX4 A;  3B0C T;  2F8N B;  2HUE C;  2BYM B;  4R8P D;  1P3L A;  1ID3 D;  2YFW B;  5KDM B;  3AZI C;  3KXB A;  3WTP D;  3W96 C;  3X1S C;  2RVQ D;  5B2I C;  4KUD B;  3R45 A;  3W99 D;  4KHA B;  1ZLA B;  3WAA B;  5GSU B;  1WWI A;  3MVD C;  4J8V B;  1M19 B;  3AZI A;  3AZF A;  3LEL C;  4CAY A;  5JRG C;  1P3P D;  4G92 B;  4M6B A;  3WTP E;  1BH8 A;  4ZUX D;  1ZLA C;  5JRG A;  1M1A A;  3V9R A;  3B6F D;  2F8N A;  2BYM A;  3O62 D;  3LZ0 B;  2YFW A;  4YM6 D;  3LJA B;  3AZH D;  3X1T B;  1HQ3 B;  5DNM B;  4KUD A;  4KHA A;  3AV1 C;  1ZLA A;  5GSU A;  3WAA A;  5CHL B;  3AFA B;  5B31 D;  5F99 C;  2NQB B;  4J8V A;  1M19 A;  3REK B;  5AV6 C;  3REH D;  5B1L B;  2BYK A;  4QLC D;  3AV1 A;  4NE3 A;  5AVC C;  1EQZ B;  1P3K B;  2ARO B;  4WU9 B;  3X1V D;  4E44 A;  4Z5T D;  2F8N G;  3MNN D;  2PYO C;  2HIO B;  5AV9 C;  5CP6 B;  1P3I B;  3AV2 D;  3LZ0 A;  1P3B D;  3NQJ B;  1HQ3 A;  5DNM A;  1S32 D;  3AZG C;  5AV8 C;  3AZE C;  3AYW B;  5GXQ B;  2CWE A;  3AFA A;  5AV9 A;  3UTB B;  3REJ D;  3REK A;  4WU8 D;  5GT3 B;  5E5A D;  4LD9 D;  5B1L A;  5B33 C;  3AZK C;  3A6N C;  3UT9 D;  1P3F C;  4XZQ D;  5B0Z C;  3REL D;  3AZE A;  1B67 A;  1P34 C;  4ZBJ B;  1P3K A;  2ARO A;  4WU9 A;  1KX3 D;  4JJN B;  1P3O B;  3AZL B;  1U35 C;  5CPK D;  1P3F A;  5GT0 D;  3LJA D;  3W97 D;  4H9O B;  2HIO A;  2L5A A;  5B40 B;  5B2J C;  4XUJ B;  3REI D;  5CP6 A;  3C1B B;  4H9N B;  1P34 A;  1P3I A;  1TZY D;  3MGQ D;  3MGP B;  3NQJ A;  4Z66 B;  4KGC C;  1KX5 C;  5B24 C;  3AZM C;  3B0D B;  4WV4 B;  4DRA A;  5GXQ A;  3AYW A;  3B6G C;  3W98 C;  3LZ1 B;  1P3G B;  1BFM A;  5B32 C;  5B0Y B;  5GT3 A;  4KGC A;  5AV5 C;  3AZN D;  1P3O C;  1P3A D;  5B1M D;  5B24 A;  4AWL C;  3AZM A;  2HUE B;  3B6G A;  3AZI B;  3W96 B;  3X1S B;  4R8P C;  4X23 D;  5B2I B;  1ID3 C;  4UUZ B;  4CAY B;  4JJN A;  1P3O A;  3WTP C;  3AZL A;  1JFI B;  2RVQ C;  1AOI D;  3W99 C;  3MVD B;  1P3M D;  5B40 A;  4G91 C;  4NFT A;  4XUJ A;  4H9N A;  1M18 D;  3MGP A;  4Z66 A;  3LEL B;  5JRG B;  3WKJ D;  3WTP A;  4NE5 A;  5BT1 D;  3W99 A;  2NZD D;  1P3P C;  1ULY A;  3LZ1 A;  1P3G A;  5DNN D;  5B0Y A;  4J8W D;  2FJ7 D;  3X1U D;  3AN2 D;  4J8X D;  4ZUX C;  3AZJ D;  4CSR B;  2LY8 A;  3UTA C;  5CPJ D;  5B32 G;  3W96 A;  3X1S A;  3O62 C;  3MGS D;  2BYK B;  5B2I A;  4H9R A;  5AVB D;  4UUZ A;  4YM6 C;  4YS3 D;  4WNN B;  3C1C D;  3TU4 D;  3AZH C;  3AV1 B;  5CPI D;  1JFI A;  5F99 B;  3MVD A;  3MGR D;  5AV6 B;  3KUY D;  3UTA A;  5B31 C;  3VH6 T;  2YFV A;  1KX4 D;  3O62 A;  5FUG A;  3LEL A;  4YM6 A;  3VH5 W;  1P3L D;  3REH C;  5AVC B;  3KXB D;  3B0C W;  2CV5 D;  2IO5 B;  4QLC C;  1F66 C;  5B31 A;  4H9P A;  1R4V A;  2PYO B;  3X1V C;  5AV9 B;  3WA9 B;  3AZF D;  3B0B A;  4Z5T C;  4CSR A;  3MNN C;  1TAF B;  1F66 A;  3AV2 C;  3AZG B;  1P3B C;  5BNX B;  4WNN A;  5C3I C;  4DRB A;  5AV8 B;  3AZE B;  1S32 C;  2IO5 C;  5F99 A;  1B6W A;  5AV6 A;  1M1A D;  5B33 B;  3AZK B;  3REJ C;  3A6N B;  1P3F B;  4WU8 C;  2F8N D;  5B0Z B;  5E5A C;  4LD9 C;  5AVC A;  3WA9 C;  3UT9 C;  1P34 B;  4XZQ C;  4KUD D;  5B31 G;  3REL C;  1ZLA D;  3WAA D;  5GSU D;  4J8V D;  1U35 B;  1M19 D;  4WU8 A;  1KX3 C;  2PYO A;  4LD9 A;  5B2J B;  5BS7 C;  3WA9 A;  1F1E A;  3UT9 A;  5GT0 C;  5CPK C;  3W97 C;  3REL A;  5G49 A;  1TAF A;  4KGC B;  3REI C;  1KX5 B;  3AZG A;  1TZY C;  3MGQ C;  5BNX A;  5B24 B;  3AZM B;  5AV8 A;  3B6G B;  3W98 B;  5BS7 A;  5CPK A;  3W97 A;  5B32 B;  5AV5 B;  3REI A;  5AY8 B;  4H9S C;  5B33 A;  3AZK A;  3A6N A;  3KWQ B;  4AWL B;  3LZ0 D;  5B0Z A;  1HTA A;  5JA4 B;  3AZN C;  3X1T D;  1HQ3 D;  1P3A C;  5DNM D;  4J8U B;  5B1M C;  1A7W A;  4R8P B;  1ID3 B;  3AFA D;  3WTP B;  5AV9 D;  2NQB D;  1U35 A;  1H3O B;  4X23 C;  5BNV B;  3REK D;  3W99 B;  5B2J A;  4G91 B;  5B1L D;  1AOI C;  1P3M C;  1KX5 A;  5AY8 C;  1M18 C;  1EQZ D;  3KWQ C;  1P3K D;  2ARO D;  4WU9 D;  3WKJ C;  4J8U C;  1P3P B;  3W98 A;  3VH5 A;  5BT1 C;  4H9R B;  2NZD C;  5B32 A;  2HIO D;  5AV5 A;  5AY8 A;  5CP6 D;  5DNN C;  3KWQ A;  1P3I D;  5JA4 A;  4ZUX B;  4J8W C;  4WZS B;  2FJ7 C;  3X1U C;  3AN2 C;  4J8U A;  3UTA B;  4J8X C;  3AZJ C;  2YFV B;  3O62 B;  5FUG B;  4R8P A;  1ID3 A;  1BH9 B;  4YM6 B;  3AZH B;  4H9Q B;  5GXQ D;  3AYW D;  5CPJ C;  3UTB D;  1H3O A;  3MGS C;  2F8N K;  5AVB C;  5BNV A;  3TU4 C;  3C1C C;  5CPI C;  1WWS A;  5GT3 D;  4KGC D;  5B31 B;  4J8X A;  3AZM D;  3MGR C;  3KUY C;  4H9P B;  3B6G D;  3REH B;  5CPJ A;  1KX4 C;  1P3L C;  4QLC B;  1P3P A;  4JJN D;  3KXB C;  1P3O D;  1F66 B;  3AZL D;  3B6F C;  2CV5 C;  4HGA C;  5B40 D;  4XUJ D;  3C1B D;  3X1V B;  4ZUX A;  3MGP D;  4Z66 D;  4Z5T B;  3MNN B;  3B6F A;  3AZF C;  2CV5 A;  3AV2 B;  1P3B B;  1BH9 A;  3AZH A;  5C3I B;  4H9Q A;  4EO5 C;  3LZ1 D;  1S32 B;  1P3G D;  3NQU B;  5B0Y D;  1N1J B;  3KSY A;  3REJ B;  4WU8 B;  5E5A B;  3REH A;  1M1A C;  3AZI D;  4LD9 B;  3W96 D;  3X1S D;  3UT9 B;  4XZQ B;  5B2I D;  4QLC A;  3REL B;  5G49 B;  4Z2M H;  4KUD C;  3MVD D;  3WAA C;  5GSU C;  1KX3 B;  3UTA D;  3X1V A;  4J8V C;  1M19 C;  5CPK B;  5GT0 B;  4Z5T A;  3LEL D;  5KDM A;  3W97 B;  3MNN A;  5JRG D;  3REI B;  3VH6 W;  3AV2 A;  1TZY B;  1P3B A;  3MGQ B;  1S32 A;  4G92 C;  3NQU A;  1N1J A;  3REJ A;  1Q9C A;  5E5A A;  3AZN B;  1F66 D;  1P3A B;  5B1M B;  4XZQ A;  3LZ0 C;  3LJA C;  4NE6 A;  3AV1 D;  3X1T C;  1HQ3 C;  5DNM C;  5F99 D;  4X23 B;  5AV6 D;  1KX3 A;  3AFA C;  2NQB C;  1AOI B;  5GT0 A;  3REK C;  3LJA A;  1P3M B;  3X1T A;  5AVC D;  5B1L C;  1M18 B;  1TZY A;  3MGQ A;  1EQZ C;  3WKJ B;  2NQB A;  1P3K C;  2ARO C;  2NZD B;  4WU9 C;  2PYO D;  3WA9 D;  4H9S A;  5DNN B;  5BO0 B;  4J8W B;  2HIO C;  3AZN A;  3X1U B;  1EQZ A;  2FJ7 B;  5CP6 C;  3AN2 B;  1P3A A;  1P3I C;  5B1M A;  3AZG D;  4J8X B;  3AZJ B;  5AV8 D;  3AZE D;  4Z2M G;  5CPJ B;  4X23 A;  3MGS B;  5AVB B;  3TU4 B;  3C1C B;  4YS3 B;  3AYW C;  5GXQ C;  5CPI B;  3UTB C;  1AOI A;  5B33 D;  3AZK D;  3A6N D;  1P3F D;  5B0Z D;  1P3M A;  3MGR B;  5GT3 C;  3KUY B;  1M18 A;  1P34 D;  1KX4 B;  1P3L B;  3WKJ A;  3UTB A;  3KXB B;  4ZBJ C;  3B6F B;  2CV5 B;  1U35 D;  4HGA B;  4E45 A;  2NZD A;  3R45 B;  4JJN C; 
#chains in the Genus database with same CATH topology
 5B2J D;  3AZL C;  2BG1 A;  5DNN A;  5BO0 A;  4YS3 C;  4J8W A;  5B40 C;  2FJ7 A;  4XUJ C;  3X1U A;  1KX5 D;  3AN2 A;  3C1B C;  2JSS A;  3AZJ A;  5B24 D;  3MGP C;  3AZF B;  4Z66 C;  1KU5 A;  3W98 D;  3AL0 C;  4EO5 B;  3MGS A;  3B0D C;  5AVB A;  3TU4 A;  3VH6 A;  3C1C A;  4YS3 A;  4H9O A;  5B32 D;  5CPI A;  5AV5 D;  3LZ1 C;  5AY8 D;  3C1B A;  1P3G C;  3KWQ D;  1BH8 B;  2Y2L A;  5B0Y C;  3MGR A;  3VH5 T;  3KUY A;  4J8U D;  1M1A B;  2F8N H;  3H0R C;  3V9R B;  1KX4 A;  3B0C T;  2F8N B;  2HUE C;  2BYM B;  4R8P D;  1P3L A;  1ID3 D;  2YFW B;  5KDM B;  3AZI C;  3KXB A;  3WTP D;  3W96 C;  3X1S C;  2RVQ D;  5B2I C;  4KUD B;  3R45 A;  3W99 D;  4KHA B;  1ZLA B;  3WAA B;  2ZY3 A;  5GSU B;  1WWI A;  3MVD C;  4J8V B;  1M19 B;  2ZY4 A;  2ZM5 A;  3AZI A;  3AZF A;  3LEL C;  1T3U A;  4CAY A;  5JRG C;  1P3P D;  2DF4 C;  4G92 B;  4M6B A;  3WTP E;  1BH8 A;  4ZUX D;  3A1K A;  1ZLA C;  5JRG A;  1M1A A;  3V9R A;  3B6F D;  2F8N A;  2BYM A;  3O62 D;  3LZ0 B;  2YFW A;  4YM6 D;  3LJA B;  3AZH D;  3X1T B;  1HQ3 B;  5DNM B;  4KUD A;  4KHA A;  3AV1 C;  1ZLA A;  5GSU A;  3WAA A;  5CHL B;  3AFA B;  5B31 D;  2Y2G A;  5F99 C;  2NQB B;  4J8V A;  1M19 A;  3REK B;  5AV6 C;  3REH D;  5B1L B;  4WJ3 C;  2BYK A;  4QLC D;  3AV1 A;  4NE3 A;  5AVC C;  1EQZ B;  1P3K B;  2ARO B;  4WU9 B;  3X1V D;  4E44 A;  3EG5 B;  4Z5T D;  2F8N G;  3MNN D;  2PYO C;  2HIO B;  5AV9 C;  5CP6 B;  1P3I B;  3AV2 D;  3LZ0 A;  1P3B D;  3NQJ B;  1HQ3 A;  5DNM A;  1S32 D;  3AZG C;  5AV8 C;  3AZE C;  3AYW B;  5GXQ B;  2CWE A;  3AFA A;  5AV9 A;  3UTB B;  3REJ D;  3REK A;  4WU8 D;  5GT3 B;  5E5A D;  4LD9 D;  5B1L A;  5B33 C;  3AZK C;  3A6N C;  3UT9 D;  1P3F C;  4XZQ D;  5B0Z C;  2Y2J A;  3REL D;  3AZE A;  1B67 A;  1P34 C;  4ZBJ B;  1P3K A;  2Y2Q A;  2ARO A;  4WU9 A;  1KX3 D;  2Y2O A;  4JJN B;  1P3O B;  3AZL B;  1U35 C;  5CPK D;  1P3F A;  5GT0 D;  3LJA D;  3W97 D;  4H9O B;  2HIO A;  2L5A A;  5B40 B;  5B2J C;  4XUJ B;  3REI D;  5CP6 A;  3C1B B;  4H9N B;  1P34 A;  1P3I A;  1TZY D;  3MGQ D;  3MGP B;  3NQJ A;  4Z66 B;  4KGC C;  1KX5 C;  5B24 C;  3AZM C;  3B0D B;  4WV4 B;  2J8P A;  4DRA A;  5GXQ A;  3AYW A;  3B6G C;  3W98 C;  3LZ1 B;  1P3G B;  1BFM A;  1Z2C B;  2Y2M A;  5B32 C;  5B0Y B;  5GT3 A;  4KGC A;  5AV5 C;  3AZN D;  1P3O C;  1P3A D;  5B1M D;  5B24 A;  4AWL C;  3AZM A;  1PZR A;  2HUE B;  3B6G A;  3AZI B;  3W96 B;  3X1S B;  4R8P C;  4X23 D;  2JCH A;  5B2I B;  1ID3 C;  4UUZ B;  4CAY B;  4JJN A;  1P3O A;  3WTP C;  2FFF B;  3AZL A;  1JFI B;  2RVQ C;  1AOI D;  3W99 C;  3MVD B;  4UPK A;  1P3M D;  5B40 A;  4G91 C;  4NFT A;  4XUJ A;  4H9N A;  1M18 D;  2G5I C;  3MGP A;  4Z66 A;  3A1I A;  3LEL B;  5JRG B;  3WKJ D;  3WTP A;  4NE5 A;  5BT1 D;  3W99 A;  2NZD D;  1P3P C;  1ULY A;  3LZ1 A;  1P3G A;  5DNN D;  5B0Y A;  4J8W D;  2FJ7 D;  3X1U D;  3AN2 D;  4J8X D;  4ZUX C;  3AZJ D;  4CSR B;  2ZY2 A;  2LY8 A;  3UTA C;  5CPJ D;  5B32 G;  3W96 A;  3X1S A;  3O62 C;  3MGS D;  2BYK B;  5B2I A;  4H9R A;  5AVB D;  4UUZ A;  4YM6 C;  4YS3 D;  4WNN B;  3C1C D;  3TU4 D;  3AZH C;  3AV1 B;  5CPI D;  1JFI A;  5F99 B;  3MVD A;  3MGR D;  5AV6 B;  3KUY D;  3UTA A;  5B31 C;  3VH6 T;  2YFV A;  1KX4 D;  3O62 A;  5FUG A;  3LEL A;  3F6T A;  3VH5 W;  4YM6 A;  1P3L D;  3REH C;  5AVC B;  3KXB D;  3B0C W;  2CV5 D;  2IO5 B;  4QLC C;  1F66 C;  5B31 A;  4H9P A;  1R4V A;  2PYO B;  3X1V C;  5AV9 B;  3WA9 B;  3AZF D;  3B0B A;  4Z5T C;  4CSR A;  3MNN C;  1TAF B;  1F66 A;  3AV2 C;  3AZG B;  1P3B C;  5BNX B;  4WNN A;  5C3I C;  4DRB A;  5AV8 B;  3AZE B;  2RIQ A;  2ZY5 A;  1S32 C;  2IO5 C;  5F99 A;  1B6W A;  2Y2I A;  5AV6 A;  1M1A D;  5B33 B;  3AZK B;  3REJ C;  3A6N B;  1P3F B;  4WU8 C;  2F8N D;  5B0Z B;  5E5A C;  4LD9 C;  5AVC A;  3WA9 C;  3UT9 C;  1P34 B;  4XZQ C;  4KUD D;  5B31 G;  3REL C;  2XD5 A;  1ZLA D;  5GSU D;  3WAA D;  4J8V D;  1U35 B;  1M19 D;  4WU8 A;  2VQR A;  2Y2N A;  1KX3 C;  3EPL A;  2PYO A;  4LD9 A;  5B2J B;  5BS7 C;  3WA9 A;  1F1E A;  3UT9 A;  5GT0 C;  5CPK C;  3W97 C;  3REL A;  5G49 A;  1TAF A;  4KGC B;  3REI C;  2Y2P A;  1KX5 B;  3AZG A;  1TZY C;  2XD1 A;  3MGQ C;  5BNX A;  5B24 B;  3AZM B;  3H0M C;  5AV8 A;  3B6G B;  3FDD A;  3W98 B;  5BS7 A;  5CPK A;  3W97 A;  5B32 B;  5AV5 B;  3REI A;  5AY8 B;  4H9S C;  5B33 A;  3AZK A;  3A6N A;  3KWQ B;  4AWL B;  3LZ0 D;  5B0Z A;  1HTA A;  5JA4 B;  3AZN C;  3X1T D;  1HQ3 D;  1P3A C;  5DNM D;  4J8U B;  5B1M C;  2DQN C;  1A7W A;  4R8P B;  1ID3 B;  2Y2K A;  3AFA D;  3WTP B;  5AV9 D;  2NQB D;  1U35 A;  1H3O B;  4X23 C;  5BNV B;  3REK D;  3W99 B;  5B2J A;  2Y2H A;  4G91 B;  5B1L D;  1AOI C;  1P3M C;  3H0L C;  1KX5 A;  5AY8 C;  1M18 C;  1EQZ D;  3KWQ C;  1P3K D;  2ARO D;  4WU9 D;  3WKJ C;  4J8U C;  1P3P B;  3W98 A;  3VH5 A;  5BT1 C;  4H9R B;  2NZD C;  5B32 A;  2HIO D;  5AV5 A;  5AY8 A;  5CP6 D;  5DNN C;  3KWQ A;  1P3I D;  3EPH A;  5JA4 A;  4ZUX B;  4J8W C;  4WZS B;  2FJ7 C;  3X1U C;  3AN2 C;  4J8U A;  3UTA B;  4J8X C;  3AZJ C;  2YFV B;  3O62 B;  5FUG B;  4R8P A;  3EPJ A;  1ID3 A;  1BH9 B;  4YM6 B;  3AZH B;  4H9Q B;  5GXQ D;  3AYW D;  5CPJ C;  3UTB D;  1H3O A;  3MGS C;  2F8N K;  5AVB C;  5BNV A;  3TU4 C;  3C1C C;  5CPI C;  1WWS A;  5GT3 D;  4KGC D;  5B31 B;  4J8X A;  3AZM D;  3MGR C;  3KUY C;  4H9P B;  3B6G D;  3REH B;  5CPJ A;  1KX4 C;  2G5H C;  1P3L C;  4QLC B;  1P3P A;  4JJN D;  3KXB C;  1P3O D;  1F66 B;  3AZL D;  3B6F C;  2CV5 C;  4HGA C;  2F2A C;  5B40 D;  4XUJ D;  3C1B D;  3X1V B;  4ZUX A;  3IP4 C;  3MGP D;  4Z66 D;  4Z5T B;  3MNN B;  3B6F A;  3AZF C;  2CV5 A;  3P5J B;  3AV2 B;  1P3B B;  1BH9 A;  3AZH A;  5C3I B;  4H9Q A;  4EO5 C;  3LZ1 D;  1S32 B;  1P3G D;  3NQU B;  5B0Y D;  1N1J B;  3KSY A;  3REJ B;  3KFU G;  4WU8 B;  5E5A B;  3REH A;  1M1A C;  3AZI D;  4LD9 B;  3W96 D;  3X1S D;  3UT9 B;  4XZQ B;  5B2I D;  4QLC A;  3REL B;  5G49 B;  1W2E A;  4Z2M H;  4KUD C;  3MVD D;  3WAA C;  5GSU C;  1KX3 B;  3UTA D;  3X1V A;  4J8V C;  1M19 C;  5CPK B;  5GT0 B;  4Z5T A;  3LEL D;  2JE5 A;  5KDM A;  3W97 B;  3MNN A;  5JRG D;  3REI B;  3VH6 W;  3AV2 A;  1TZY B;  1P3B A;  3MGQ B;  1S32 A;  4G92 C;  3NQU A;  2W8S A;  1N1J A;  3REJ A;  1Q9C A;  5E5A A;  3AZN B;  1F66 D;  1P3A B;  5B1M B;  4XZQ A;  3LZ0 C;  3LJA C;  4NE6 A;  3AV1 D;  3X1T C;  1HQ3 C;  5DNM C;  5F99 D;  4X23 B;  5AV6 D;  1KX3 A;  3AFA C;  2NQB C;  1AOI B;  5GT0 A;  3REK C;  3LJA A;  1P3M B;  3X1T A;  5AVC D;  5B1L C;  1M18 B;  1TZY A;  3MGQ A;  1EQZ C;  3WKJ B;  2NQB A;  1P3K C;  2ARO C;  2NZD B;  4WU9 C;  2PYO D;  3WA9 D;  4H9S A;  5DNN B;  4DQY B;  5BO0 B;  4J8W B;  2HIO C;  3AZN A;  3X1U B;  1EQZ A;  2FJ7 B;  5CP6 C;  3AN2 B;  1P3A A;  1P3I C;  5B1M A;  3AZG D;  4J8X B;  3AZJ B;  5AV8 D;  3AZE D;  4Z2M G;  5CPJ B;  4X23 A;  3MGS B;  5AVB B;  3TU4 B;  3C1C B;  4YS3 B;  3AYW C;  5GXQ C;  5CPI B;  2UWX A;  3UTB C;  1AOI A;  5B33 D;  3AZK D;  3A6N D;  1P3F D;  5B0Z D;  1P3M A;  3MGR B;  5GT3 C;  3KUY B;  1M18 A;  1P34 D;  1KX4 B;  1P3L B;  3WKJ A;  3UTB A;  3KXB B;  4ZBJ C;  3B6F B;  2CV5 B;  1U35 D;  4HGA B;  4E45 A;  2NZD A;  3R45 B;  3EPK A;  4JJN C; 
#chains in the Genus database with same CATH homology
 5B2J D;  3AZL C;  2BG1 A;  5DNN A;  5BO0 A;  4YS3 C;  4J8W A;  5B40 C;  2FJ7 A;  4XUJ C;  3X1U A;  1KX5 D;  3AN2 A;  3C1B C;  2JSS A;  3AZJ A;  5B24 D;  3MGP C;  3AZF B;  4Z66 C;  1KU5 A;  3W98 D;  3AL0 C;  4EO5 B;  3MGS A;  3B0D C;  5AVB A;  3TU4 A;  3VH6 A;  3C1C A;  4YS3 A;  4H9O A;  5B32 D;  5CPI A;  5AV5 D;  3LZ1 C;  5AY8 D;  3C1B A;  1P3G C;  3KWQ D;  1BH8 B;  2Y2L A;  5B0Y C;  3MGR A;  3VH5 T;  3KUY A;  4J8U D;  1M1A B;  2F8N H;  3H0R C;  3V9R B;  1KX4 A;  3B0C T;  2F8N B;  2HUE C;  2BYM B;  4R8P D;  1P3L A;  1ID3 D;  2YFW B;  5KDM B;  3AZI C;  3KXB A;  3WTP D;  3W96 C;  3X1S C;  2RVQ D;  5B2I C;  4KUD B;  3R45 A;  3W99 D;  4KHA B;  1ZLA B;  3WAA B;  2ZY3 A;  5GSU B;  1WWI A;  3MVD C;  4J8V B;  1M19 B;  2ZY4 A;  2ZM5 A;  3AZI A;  3AZF A;  3LEL C;  1T3U A;  4CAY A;  5JRG C;  1P3P D;  2DF4 C;  4G92 B;  4M6B A;  3WTP E;  1BH8 A;  4ZUX D;  3A1K A;  1ZLA C;  5JRG A;  1M1A A;  3V9R A;  3B6F D;  2F8N A;  2BYM A;  3O62 D;  3LZ0 B;  2YFW A;  4YM6 D;  3LJA B;  3AZH D;  3X1T B;  1HQ3 B;  5DNM B;  4KUD A;  4KHA A;  3AV1 C;  1ZLA A;  5GSU A;  3WAA A;  5CHL B;  3AFA B;  5B31 D;  2Y2G A;  5F99 C;  2NQB B;  4J8V A;  1M19 A;  3REK B;  5AV6 C;  3REH D;  5B1L B;  4WJ3 C;  2BYK A;  4QLC D;  3AV1 A;  4NE3 A;  5AVC C;  1EQZ B;  1P3K B;  2ARO B;  4WU9 B;  3X1V D;  4E44 A;  3EG5 B;  4Z5T D;  2F8N G;  3MNN D;  2PYO C;  2HIO B;  5AV9 C;  5CP6 B;  1P3I B;  3AV2 D;  3LZ0 A;  1P3B D;  3NQJ B;  1HQ3 A;  5DNM A;  1S32 D;  3AZG C;  5AV8 C;  3AZE C;  3AYW B;  5GXQ B;  2CWE A;  3AFA A;  5AV9 A;  3UTB B;  3REJ D;  3REK A;  4WU8 D;  5GT3 B;  5E5A D;  4LD9 D;  5B1L A;  5B33 C;  3AZK C;  3A6N C;  3UT9 D;  1P3F C;  4XZQ D;  5B0Z C;  2Y2J A;  3REL D;  3AZE A;  1B67 A;  1P34 C;  4ZBJ B;  1P3K A;  2Y2Q A;  2ARO A;  4WU9 A;  1KX3 D;  2Y2O A;  4JJN B;  1P3O B;  3AZL B;  1U35 C;  5CPK D;  1P3F A;  5GT0 D;  3LJA D;  3W97 D;  4H9O B;  2HIO A;  2L5A A;  5B40 B;  5B2J C;  4XUJ B;  3REI D;  5CP6 A;  3C1B B;  4H9N B;  1P34 A;  1P3I A;  1TZY D;  3MGQ D;  3MGP B;  3NQJ A;  4Z66 B;  4KGC C;  1KX5 C;  5B24 C;  3AZM C;  3B0D B;  4WV4 B;  2J8P A;  4DRA A;  5GXQ A;  3AYW A;  3B6G C;  3W98 C;  3LZ1 B;  1P3G B;  1BFM A;  1Z2C B;  2Y2M A;  5B32 C;  5B0Y B;  5GT3 A;  4KGC A;  5AV5 C;  3AZN D;  1P3O C;  1P3A D;  5B1M D;  5B24 A;  4AWL C;  3AZM A;  1PZR A;  2HUE B;  3B6G A;  3AZI B;  3W96 B;  3X1S B;  4R8P C;  4X23 D;  2JCH A;  5B2I B;  1ID3 C;  4UUZ B;  4CAY B;  4JJN A;  1P3O A;  3WTP C;  2FFF B;  3AZL A;  1JFI B;  2RVQ C;  1AOI D;  3W99 C;  3MVD B;  4UPK A;  1P3M D;  5B40 A;  4G91 C;  4NFT A;  4XUJ A;  4H9N A;  1M18 D;  2G5I C;  3MGP A;  4Z66 A;  3A1I A;  3LEL B;  5JRG B;  3WKJ D;  3WTP A;  4NE5 A;  5BT1 D;  3W99 A;  2NZD D;  1P3P C;  1ULY A;  3LZ1 A;  1P3G A;  5DNN D;  5B0Y A;  4J8W D;  2FJ7 D;  3X1U D;  3AN2 D;  4J8X D;  4ZUX C;  3AZJ D;  4CSR B;  2ZY2 A;  2LY8 A;  3UTA C;  5CPJ D;  5B32 G;  3W96 A;  3X1S A;  3O62 C;  3MGS D;  2BYK B;  5B2I A;  4H9R A;  5AVB D;  4UUZ A;  4YM6 C;  4YS3 D;  4WNN B;  3C1C D;  3TU4 D;  3AZH C;  3AV1 B;  5CPI D;  1JFI A;  5F99 B;  3MVD A;  3MGR D;  5AV6 B;  3KUY D;  3UTA A;  5B31 C;  3VH6 T;  2YFV A;  1KX4 D;  3O62 A;  5FUG A;  3LEL A;  3F6T A;  3VH5 W;  4YM6 A;  1P3L D;  3REH C;  5AVC B;  3KXB D;  3B0C W;  2CV5 D;  2IO5 B;  4QLC C;  1F66 C;  5B31 A;  4H9P A;  1R4V A;  2PYO B;  3X1V C;  5AV9 B;  3WA9 B;  3AZF D;  3B0B A;  4Z5T C;  4CSR A;  3MNN C;  1TAF B;  1F66 A;  3AV2 C;  3AZG B;  1P3B C;  5BNX B;  4WNN A;  5C3I C;  4DRB A;  5AV8 B;  3AZE B;  2RIQ A;  2ZY5 A;  1S32 C;  2IO5 C;  5F99 A;  1B6W A;  2Y2I A;  5AV6 A;  1M1A D;  5B33 B;  3AZK B;  3REJ C;  3A6N B;  1P3F B;  4WU8 C;  2F8N D;  5B0Z B;  5E5A C;  4LD9 C;  5AVC A;  3WA9 C;  3UT9 C;  1P34 B;  4XZQ C;  4KUD D;  5B31 G;  3REL C;  2XD5 A;  1ZLA D;  5GSU D;  3WAA D;  4J8V D;  1U35 B;  1M19 D;  4WU8 A;  2VQR A;  2Y2N A;  1KX3 C;  3EPL A;  2PYO A;  4LD9 A;  5B2J B;  5BS7 C;  3WA9 A;  1F1E A;  3UT9 A;  5GT0 C;  5CPK C;  3W97 C;  3REL A;  5G49 A;  1TAF A;  4KGC B;  3REI C;  2Y2P A;  1KX5 B;  3AZG A;  1TZY C;  2XD1 A;  3MGQ C;  5BNX A;  5B24 B;  3AZM B;  3H0M C;  5AV8 A;  3B6G B;  3FDD A;  3W98 B;  5BS7 A;  5CPK A;  3W97 A;  5B32 B;  5AV5 B;  3REI A;  5AY8 B;  4H9S C;  5B33 A;  3AZK A;  3A6N A;  3KWQ B;  4AWL B;  3LZ0 D;  5B0Z A;  1HTA A;  5JA4 B;  3AZN C;  3X1T D;  1HQ3 D;  1P3A C;  5DNM D;  4J8U B;  5B1M C;  2DQN C;  1A7W A;  4R8P B;  1ID3 B;  2Y2K A;  3AFA D;  3WTP B;  5AV9 D;  2NQB D;  1U35 A;  1H3O B;  4X23 C;  5BNV B;  3REK D;  3W99 B;  5B2J A;  2Y2H A;  4G91 B;  5B1L D;  1AOI C;  1P3M C;  3H0L C;  1KX5 A;  5AY8 C;  1M18 C;  1EQZ D;  3KWQ C;  1P3K D;  2ARO D;  4WU9 D;  3WKJ C;  4J8U C;  1P3P B;  3W98 A;  3VH5 A;  5BT1 C;  4H9R B;  2NZD C;  5B32 A;  2HIO D;  5AV5 A;  5AY8 A;  5CP6 D;  5DNN C;  3KWQ A;  1P3I D;  3EPH A;  5JA4 A;  4ZUX B;  4J8W C;  4WZS B;  2FJ7 C;  3X1U C;  3AN2 C;  4J8U A;  3UTA B;  4J8X C;  3AZJ C;  2YFV B;  3O62 B;  5FUG B;  4R8P A;  3EPJ A;  1ID3 A;  1BH9 B;  4YM6 B;  3AZH B;  4H9Q B;  5GXQ D;  3AYW D;  5CPJ C;  3UTB D;  1H3O A;  3MGS C;  2F8N K;  5AVB C;  5BNV A;  3TU4 C;  3C1C C;  5CPI C;  1WWS A;  5GT3 D;  4KGC D;  5B31 B;  4J8X A;  3AZM D;  3MGR C;  3KUY C;  4H9P B;  3B6G D;  3REH B;  5CPJ A;  1KX4 C;  2G5H C;  1P3L C;  4QLC B;  1P3P A;  4JJN D;  3KXB C;  1P3O D;  1F66 B;  3AZL D;  3B6F C;  2CV5 C;  4HGA C;  2F2A C;  5B40 D;  4XUJ D;  3C1B D;  3X1V B;  4ZUX A;  3IP4 C;  3MGP D;  4Z66 D;  4Z5T B;  3MNN B;  3B6F A;  3AZF C;  2CV5 A;  3P5J B;  3AV2 B;  1P3B B;  1BH9 A;  3AZH A;  5C3I B;  4H9Q A;  4EO5 C;  3LZ1 D;  1S32 B;  1P3G D;  3NQU B;  5B0Y D;  1N1J B;  3KSY A;  3REJ B;  3KFU G;  4WU8 B;  5E5A B;  3REH A;  1M1A C;  3AZI D;  4LD9 B;  3W96 D;  3X1S D;  3UT9 B;  4XZQ B;  5B2I D;  4QLC A;  3REL B;  5G49 B;  1W2E A;  4Z2M H;  4KUD C;  3MVD D;  3WAA C;  5GSU C;  1KX3 B;  3UTA D;  3X1V A;  4J8V C;  1M19 C;  5CPK B;  5GT0 B;  4Z5T A;  3LEL D;  2JE5 A;  5KDM A;  3W97 B;  3MNN A;  5JRG D;  3REI B;  3VH6 W;  3AV2 A;  1TZY B;  1P3B A;  3MGQ B;  1S32 A;  4G92 C;  3NQU A;  2W8S A;  1N1J A;  3REJ A;  1Q9C A;  5E5A A;  3AZN B;  1F66 D;  1P3A B;  5B1M B;  4XZQ A;  3LZ0 C;  3LJA C;  4NE6 A;  3AV1 D;  3X1T C;  1HQ3 C;  5DNM C;  5F99 D;  4X23 B;  5AV6 D;  1KX3 A;  3AFA C;  2NQB C;  1AOI B;  5GT0 A;  3REK C;  3LJA A;  1P3M B;  3X1T A;  5AVC D;  5B1L C;  1M18 B;  1TZY A;  3MGQ A;  1EQZ C;  3WKJ B;  2NQB A;  1P3K C;  2ARO C;  2NZD B;  4WU9 C;  2PYO D;  3WA9 D;  4H9S A;  5DNN B;  4DQY B;  5BO0 B;  4J8W B;  2HIO C;  3AZN A;  3X1U B;  1EQZ A;  2FJ7 B;  5CP6 C;  3AN2 B;  1P3A A;  1P3I C;  5B1M A;  3AZG D;  4J8X B;  3AZJ B;  5AV8 D;  3AZE D;  4Z2M G;  5CPJ B;  4X23 A;  3MGS B;  5AVB B;  3TU4 B;  3C1C B;  4YS3 B;  3AYW C;  5GXQ C;  5CPI B;  2UWX A;  3UTB C;  1AOI A;  5B33 D;  3AZK D;  3A6N D;  1P3F D;  5B0Z D;  1P3M A;  3MGR B;  5GT3 C;  3KUY B;  1M18 A;  1P34 D;  1KX4 B;  1P3L B;  3WKJ A;  3UTB A;  3KXB B;  4ZBJ C;  3B6F B;  2CV5 B;  1U35 D;  4HGA B;  4E45 A;  2NZD A;  3R45 B;  3EPK A;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...