5B40D

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40D00
5GT0C 5AV9C 1AOIB 4KUDD 3REHD 3WA9A 3MGQC 2HUEC 4J8XA 5CPKA 3TU4A 3AZJA 3WTPE 1S32D 3VH5T 5B0ZC 1N1JB 4QLCC 4YM6B 3REJB 3KUYA 1AOIC 3REIA 1KX4B 5KDMA 2BYMA 1ZLAC 3WKJA 5AV8B 5GT3B 3X1UD 5B24A 1P3FA 4YM6C 4H9RB 2BYKA 3VH5W 3REJC 1P3LA 1H3OB 3W97D 5B0YB 3R45B 5BNXB 4Z5TD 2HIOC 2AROD 3LZ0A 1KX4C 2FJ7B 3NQJB 5AV8C 5JA4A 1P3OC 5GT3C 3MGPC 3UT9B 1P3MB 5AV6C 4X23B 3X1SA 3AZHA 3AV1A 1P3KD 3W98B 4H9PB 4R8PA 3LJAB 5B31D 5AV9D 4Z66A 1P34A 5AVCB 5AVBD 4XUJB 3MGSA 5B32C 1KU5A 5B1LD 5E5AD 3UT9C 5BT1C 2F8ND 1HQ3A 5B2JB 4WZSB 4X23C 3W98C 1N1JA 1M1AA 3AZKD 5DNMA 5G49B 5AVCC 5GXQD 4XUJC 3MNNA 3AZGA 1P3BD 5GSUA 1ZLAD 3MVDB 3AZMB 1M18A 3LELA 3X1TB 5B32G 4CAYA 1H3OA 5B0YA 3R45A 5JRGD 4JJNB 1P3AB 2FJ7A 5BO0B 2HIOD 3KSYA 1WWIA 4J8WC 3MVDC 3AZMC 1F66B 1P3MA 1P3OD 2IO5B 3AZNA 1KX3D 3X1TC 3AZIA 3AN2A 2NZDA 5AV5D 5AV6D 1ID3D 4JJNC 3LJAA 1P3AC 3REKD 3A6NA 4M6BA 5AVCA 3C1BB 5B33A 1P3PB 1F66C 4H9OB 5B32D 3AV2C 2IO5C 4WU9D 5B2JA 3W96A 5F99A 1BFMA 5BNVA 5DNNA 2PYOA 4H9SA 3C1BC 1P3PC 4YS3D 4ZUXA 4KGCA 3AYWC 4J8XB 5CPKB 2RVQD 1KX5A 3TU4B 3AZJB 1P3GB 3AZLD 1EQZA 5CP6A 4JJNA 1M19A 3KUYB 3UTAD 4NE5A 3KWQD 3REIB 4J8WD 2CV5A 3WA9C 5KDMB 1U35A 3B6GD 4J8XC 5CPKC 3AZFA 3TU4C 5B2ID 3AZJC 3WAAA 2NQBD 3MGRA 4J8VD 3AZEA 5B40B 5CPIA 1P3FB 5CPJB 2BYKB 3KUYC 1P3LB 3B6FA 1TZYA 3REIC 4LD9A 3LZ0B 3AFAA 4J8UA 3UTBA 3AV2D 3C1CB 3V9RB 3WKJC 5JA4B 4KHAA 5B24C 1P3FC 5CPJC 4NFTA 4Z5TB 3WTPD 4WV4B 3AZHB 4H9NA 3AV1B 1P3LC 1JFIA 5AY8A 4R8PB 3LZ0C 4Z66B 1P34B 5FUGB 3C1CC 3MGSB 3O62B 3AYWD 1P3GA 1HQ3B 3AZHC 3KXBD 3AV1C 3X1SC 4KUDA 3RELD 3REHA 1M1AB 4R8PC 4Z66C 5DNMB 1P34C 5B1MD 1BH9B 3MGSC 3MNNB 3AZGB 1S32A 5GSUB 1HQ3C 1M18B 5B40A 3LELB 1M1AC 5CPJA 4CAYB 1ULYA 1BH8A 4NE6A 3LZ1B 5DNMC 3MNNC 3AZGC 3C1CA 3V9RA 5GSUC 1M18C 3WKJD 3W97A 3AZNB 3LELC 4Z5TA 3AZIB 3AN2B 5B24D 2NZDB 5B0YC 2FJ7C 3A6NB 5GT0D 1Q9CA 5FUGA 5B33B 3O62A 3MGQD 1P3KA 1P3MC 3X1VB 4Z2MH 3AZNC 4G91B 3AZIC 3AN2C 5B31A 2NZDC 1TAFB 2F8NH 3X1SD 3W99B 5B0ZD 5F99B 5BNVB 3W96B 5DNNB 4QLCD 5AVBA 3LJAC 2PYOB 3A6NC 5B1LA 1AOID 5E5AA 4E45A 2F8NA 4H9QA 1BH9A 5B33C 3X1VC 5C3IB 4ZUXB 5B2JC 4G91C 4KGCB 2YFWA 3AZKA 3W96C 3W99C 5F99C 1KX5B 5DNNC 2PYOC 4YM6D 5GXQA 3REJD 3LZ1A 4H9SC 4WU8B 1P3BA 1EQZB 5CP6B 1M19B 1KX4D 5C3IC 4ZUXC 4KGCC 2CV5B 5AV8D 5GT3D 3MGPD 1U35B 5JRGA 1KX5C 3B0BA 3AZFB 4WU8C 3WAAB 1EQZC 5CP6C 1M19C 3MGRB 3AZEB 5CPIB 2FJ7D 3B6FB 1TZYB 1KX3A 4LD9B 2CV5C 5AV5A 3X1VA 3AFAB 4J8UB 3UT9D 1ID3A 3UTBB 1U35C 5BT1D 1P3MD 3B0CT 3VH6A 1TAFA 3AZFC 4X23D 3W99A 3W98D 3WAAC 3MGRC 3AZEC 5CPIC 4KHAB 4H9NB 1JFIB 4WU9A 3B6FC 1TZYC 4LD9C 5AVCD 5AY8B 4XUJD 3AFAC 4J8UC 3UTBC 1P3IB 5B2JD 4XZQB 4WU8A 4KUDB 4YS3A 3REHB 5AY8C 1R4VA 2YFVA 3MVDD 3AZMD 3AZLA 1S32B 3X1TD 1P3GC 3UTAA 3KWQA 4KUDC 4JJND 3REHC 1P3AD 5B1MB 1BH8B 5B2IA 1F66D 2NQBA 1HTAA 4J8VA 1S32C 3X1UB 3W97B 5B40C 2L5AA 2AROB 3C1BD 4DRAA 1P3PD 1P3IA 4XZQA 3WTPA 1P3KB 3W97C 2JSSA 1F1EA 4ZBJB 4Z5TC 5B31B 5AV9B 5BS7A 1B67A 5AVBB 5B1LB 5E5AB 4G92B 2F8NB 2HUEB 4H9QB 3WA9D 3O62C 3KXBA 1P3KC 3RELA 4J8XD 5B0ZB 5CPKD 3TU4D 3AZJD 1P3GD 5B31C 2YFWB 4CSRA 3AZKB 5B1MA 5AVBC 5GXQB 3KUYD 1P3BB 5B1LC 3B0DB 5E5AC 4G92C 3REID 1ZLAB 3X1UA 3NQUA 3AZKC 5JRGB 5B40D 1P3FD 2AROA 5CPJD 5GXQC 3LZ1C 2HIOB 1P3BC 1P3LD 3B0DC 3VH5A 5B31G 3LZ0D 1P3OB 4WNNA 3MGPB 1KX3B 4Z2MG 3C1CD 5AV5B 5AV6B 2F8NG 1ID3B 4EO5B 5JRGC 3REKB 1B6WA 5AV9A 5GT0A 3AZHD 3AV1D 3MGQA 4R8PD 5B32B 4Z66D 4WU9B 1P34D 1KX3C 4NE3A 3MGSD 5AV5C 3O62D 5B0ZA 1ID3C 4EO5C 4QLCA 3REKC 1HQ3D 1AOIA 1M1AD 2F8NK 1ZLAA 5DNMD 4WU9C 4YS3B 3MNND 3AZGD 5GSUD 4UUZB 2YFVB 4YM6A 3REJA 1M18D 3AZLB 3LELD 2LY8A 2HIOA 3UTAB 1KX4A 3KWQB 5B0YD 3LZ1D 4YS3C 4J8WB 4E44A 3VH6T 5AV8A 1P3OA 5GT3A 3MGPA 3B6GB 2RVQC 5B2IB 4H9RA 5AV6A 3AZLC 2NQBB 5BNXA 4J8VB 3REKA 3AZND 3AZID 3AN2D 2NZDD 3UTAC 3KWQC 3NQJA 3LJAD 5B32A 3A6ND 3UT9A 3VH6W 3AV2B 3B6GC 5B33D 5B2IC 4X23A 3W98A 2NQBC 3X1VD 4J8VC 4H9PA 4DRBA 3WTPB 3B0CW 3W99D 3W96D 5F99D 5DNND 2PYOD 4XUJA 3AYWB 1A7WA 4UUZA 4ZUXD 1P3IC 4KGCD 4XZQC 3WTPC 3KXBB 3RELB 1KX5D 5G49A 4WU8D 4CSRB 5CP6D 4J8WA 1M19D 1EQZD 1WWSA 5BS7C 3MVDA 3AZMA 3WA9B 3B6GA 3X1TA 2CV5D 3KXBC 1U35D 3RELC 4AWLB 3NQUB 1P3AA 3AZFD 5BO0A 3WAAD 3MGRD 5B1MC 3AZED 5CPID 1F66A 3AV2A 3B6FD 1TZYD 2BYMB 4LD9D 4HGAB 3AFAD 4J8UD 3WKJB 2CWEA 4WNNB 3X1UC 4AWLC 3UTBD 5B24B 3C1BA 1P3PA 2AROC 5GT0B 4H9OA 3AYWA 4HGAC 5AY8D 3MGQB 1P3ID 4XZQD 5CHLB 3X1SB 4QLCB 4ZBJC
chains in the Genus database with same CATH superfamily
5GT0C 5AV9C 1AOIB 4KUDD 3REHD 2XD5A 3MGQC 3WA9A 2HUEC 4J8XA 5CPKA 3TU4A 3AZJA 3WTPE 1S32D 3VH5T 5B0ZC 1N1JB 4QLCC 4YM6B 3REJB 3KUYA 1AOIC 3REIA 4WJ3C 1KX4B 5KDMA 2BYMA 1ZLAC 3WKJA 5AV8B 5GT3B 3X1UD 5B24A 1P3FA 4YM6C 4H9RB 2BYKA 3VH5W 3REJC 4UPKA 1P3LA 1H3OB 3W97D 5B0YB 3R45B 5BNXB 4Z5TD 2HIOC 2AROD 3LZ0A 1KX4C 2FJ7B 3NQJB 2XD1A 5AV8C 5JA4A 1P3OC 5GT3C 3MGPC 3UT9B 1P3MB 2Y2KA 2RIQA 5AV6C 4X23B 3X1SA 3AZHA 3AV1A 1P3KD 3W98B 2ZY2A 4H9PB 3A1IA 4R8PA 3LJAB 5B31D 5AV9D 4Z66A 1P34A 1T3UA 5AVCB 5AVBD 4XUJB 3MGSA 5B32C 1KU5A 5B1LD 5E5AD 3UT9C 5BT1C 3H0MC 2F8ND 1HQ3A 5B2JB 4WZSB 4X23C 3W98C 1N1JA 1M1AA 3AZKD 5DNMA 2DF4C 5G49B 5AVCC 5GXQD 2DQNC 4XUJC 3MNNA 3EG5B 3AZGA 1P3BD 5GSUA 1ZLAD 3MVDB 3AZMB 1M18A 3LELA 3X1TB 5B32G 4CAYA 1H3OA 5B0YA 3R45A 5JRGD 4JJNB 1P3AB 2FJ7A 5BO0B 2HIOD 3KSYA 1WWIA 4J8WC 3MVDC 3AZMC 1F66B 1P3MA 1P3OD 2IO5B 3AZNA 1KX3D 3X1TC 3AZIA 3AN2A 2NZDA 5AV5D 5AV6D 1ID3D 4JJNC 3LJAA 1P3AC 3REKD 3A6NA 4M6BA 5AVCA 3C1BB 5B33A 1P3PB 1F66C 4H9OB 5B32D 3AV2C 2IO5C 4WU9D 5B2JA 3W96A 5F99A 1BFMA 5BNVA 5DNNA 2PYOA 4H9SA 3C1BC 1P3PC 2Y2PA 4YS3D 4ZUXA 4KGCA 3AYWC 4J8XB 5CPKB 2RVQD 1KX5A 3TU4B 3AZJB 1P3GB 3AZLD 2Y2IA 1EQZA 5CP6A 4JJNA 1M19A 3KFUG 3KUYB 3UTAD 4NE5A 3KWQD 3REIB 4J8WD 2CV5A 3WA9C 5KDMB 1U35A 3B6GD 4J8XC 5CPKC 3AZFA 3TU4C 5B2ID 3AZJC 3WAAA 2NQBD 3MGRA 4J8VD 3AZEA 5B40B 5CPIA 1P3FB 5CPJB 2BYKB 3KUYC 1P3LB 3B6FA 1TZYA 3REIC 4LD9A 3LZ0B 3AFAA 4J8UA 3UTBA 3AV2D 3C1CB 3V9RB 4DQYB 3WKJC 5JA4B 4KHAA 5B24C 1P3FC 5CPJC 4NFTA 4Z5TB 3WTPD 4WV4B 3AZHB 4H9NA 3AV1B 1P3LC 1JFIA 2Y2LA 5AY8A 4R8PB 3LZ0C 4Z66B 1P34B 5FUGB 3C1CC 3MGSB 3O62B 3AYWD 2J8PA 1P3GA 1HQ3B 3AZHC 3KXBD 3AV1C 3X1SC 4KUDA 3RELD 3REHA 1M1AB 4R8PC 3EPHA 4Z66C 5DNMB 1P34C 5B1MD 1BH9B 3MGSC 3MNNB 3AZGB 1S32A 5GSUB 3A1KA 1HQ3C 1M18B 2G5HC 5B40A 3LELB 1M1AC 5CPJA 4CAYB 1ULYA 1BH8A 4NE6A 3LZ1B 5DNMC 3MNNC 3AZGC 3C1CA 3V9RA 5GSUC 1M18C 3WKJD 3W97A 3AZNB 3LELC 4Z5TA 3AZIB 3AN2B 5B24D 2NZDB 5B0YC 2Y2GA 2FJ7C 3A6NB 5GT0D 1Q9CA 5FUGA 5B33B 3O62A 3MGQD 1P3KA 1P3MC 2Y2OA 3X1VB 4Z2MH 3AZNC 4G91B 3EPLA 3AZIC 3AN2C 5B31A 2NZDC 1TAFB 2F8NH 3X1SD 3W99B 5B0ZD 5F99B 5BNVB 3W96B 5DNNB 4QLCD 5AVBA 3LJAC 2PYOB 3A6NC 5B1LA 1AOID 5E5AA 2F2AC 4E45A 2F8NA 4H9QA 1BH9A 5B33C 3X1VC 5C3IB 4ZUXB 5B2JC 4G91C 4KGCB 2YFWA 3AZKA 3W96C 3W99C 5F99C 1KX5B 5DNNC 2PYOC 4YM6D 5GXQA 2Y2HA 3LZ1A 4H9SC 4WU8B 3REJD 1P3BA 1EQZB 2JE5A 5CP6B 1M19B 1KX4D 5C3IC 4ZUXC 4KGCC 2CV5B 5AV8D 5GT3D 3MGPD 1U35B 5JRGA 1KX5C 3B0BA 3AZFB 4WU8C 3WAAB 1EQZC 2ZY5A 5CP6C 1M19C 3MGRB 3AZEB 5CPIB 2FJ7D 3B6FB 1TZYB 1KX3A 4LD9B 2CV5C 5AV5A 3X1VA 3AFAB 4J8UB 3UT9D 1ID3A 3UTBB 1U35C 5BT1D 1P3MD 3B0CT 3VH6A 1TAFA 3AZFC 4X23D 3W99A 3W98D 3WAAC 3MGRC 3AZEC 5CPIC 4KHAB 4H9NB 1JFIB 4WU9A 3B6FC 1TZYC 2Y2NA 5AVCD 4LD9C 5AY8B 4XUJD 3AFAC 4J8UC 3UTBC 1P3IB 5B2JD 3AL0C 4XZQB 4WU8A 4KUDB 4YS3A 3REHB 5AY8C 3H0RC 1R4VA 2YFVA 3MVDD 3AZMD 3AZLA 1S32B 3X1TD 1P3GC 3UTAA 3KWQA 4KUDC 4JJND 3REHC 1P3AD 5B1MB 1BH8B 5B2IA 1F66D 2NQBA 1HTAA 4J8VA 1S32C 3X1UB 3W97B 5B40C 2L5AA 3FDDA 2AROB 3C1BD 4DRAA 1P3PD 2Y2QA 3F6TA 1P3IA 4XZQA 3WTPA 1P3KB 3W97C 2JSSA 1F1EA 4ZBJB 4Z5TC 5B31B 5AV9B 5BS7A 1B67A 5AVBB 5B1LB 5E5AB 4G92B 2F8NB 2HUEB 4H9QB 3WA9D 3O62C 2Y2JA 3KXBA 1P3KC 3RELA 4J8XD 5B0ZB 5CPKD 3TU4D 3AZJD 1P3GD 5B31C 2W8SA 2YFWB 4CSRA 3AZKB 5B1MA 5AVBC 5GXQB 3KUYD 1P3BB 5B1LC 3B0DB 5E5AC 4G92C 3REID 1ZLAB 3X1UA 3NQUA 3AZKC 2BG1A 5JRGB 5B40D 1P3FD 2AROA 5CPJD 5GXQC 3LZ1C 2HIOB 1P3BC 1P3LD 3B0DC 3VH5A 5B31G 3LZ0D 1P3OB 1PZRA 4WNNA 3MGPB 1KX3B 4Z2MG 3C1CD 5AV5B 5AV6B 2F8NG 1ID3B 4EO5B 5JRGC 3REKB 1B6WA 5GT0A 5AV9A 3EPJA 3AZHD 3AV1D 3MGQA 4R8PD 1Z2CB 5B32B 4Z66D 4WU9B 1P34D 1KX3C 4NE3A 3MGSD 5AV5C 3O62D 5B0ZA 1ID3C 4EO5C 4QLCA 3REKC 1HQ3D 1W2EA 1AOIA 1M1AD 2F8NK 1ZLAA 5DNMD 4WU9C 4YS3B 3MNND 3AZGD 2ZM5A 5GSUD 4UUZB 2YFVB 4YM6A 3REJA 1M18D 3AZLB 3LELD 2LY8A 3P5JB 2HIOA 3UTAB 1KX4A 3KWQB 5B0YD 3LZ1D 4YS3C 4J8WB 4E44A 3VH6T 5AV8A 2G5IC 2UWXA 2VQRA 5GT3A 3MGPA 1P3OA 3B6GB 2RVQC 5B2IB 4H9RA 5AV6A 3AZLC 2NQBB 5BNXA 4J8VB 3REKA 3AZND 3AZID 3AN2D 2NZDD 3UTAC 3KWQC 3NQJA 3LJAD 5B32A 3A6ND 3UT9A 3VH6W 3AV2B 3B6GC 5B33D 5B2IC 4X23A 3W98A 2NQBC 3X1VD 4J8VC 4H9PA 4DRBA 2Y2MA 3WTPB 3B0CW 3W99D 3W96D 5F99D 3IP4C 5DNND 2PYOD 4XUJA 3EPKA 3AYWB 2ZY4A 1A7WA 4UUZA 4ZUXD 1P3IC 4KGCD 4XZQC 3WTPC 3KXBB 3RELB 1KX5D 5G49A 3H0LC 4WU8D 4CSRB 5CP6D 4J8WA 1M19D 1EQZD 1WWSA 5BS7C 3MVDA 3AZMA 3WA9B 3B6GA 3X1TA 2CV5D 3KXBC 1U35D 3RELC 4AWLB 3NQUB 1P3AA 3AZFD 5BO0A 3WAAD 3MGRD 5B1MC 3AZED 5CPID 1F66A 2ZY3A 3AV2A 3B6FD 1TZYD 2BYMB 4LD9D 4HGAB 2JCHA 3AFAD 4J8UD 3WKJB 2CWEA 4WNNB 3X1UC 4AWLC 3UTBD 5B24B 3C1BA 1P3PA 2AROC 5GT0B 4H9OA 3AYWA 4HGAC 5AY8D 3MGQB 1P3ID 4XZQD 5CHLB 3X1SB 4QLCB 4ZBJC 2FFFB
chains in the Genus database with same CATH topology
5GT0C 5AV9C 1AOIB 4KUDD 3REHD 2XD5A 3MGQC 3WA9A 2HUEC 4J8XA 5CPKA 3TU4A 3AZJA 3WTPE 1S32D 3VH5T 5B0ZC 1N1JB 4QLCC 4YM6B 3REJB 3KUYA 1AOIC 3REIA 4WJ3C 1KX4B 5KDMA 2BYMA 1ZLAC 3WKJA 5AV8B 5GT3B 3X1UD 5B24A 1P3FA 4YM6C 4H9RB 2BYKA 3VH5W 3REJC 4UPKA 1P3LA 1H3OB 3W97D 5B0YB 3R45B 5BNXB 4Z5TD 2HIOC 2AROD 3LZ0A 1KX4C 2FJ7B 3NQJB 2XD1A 5AV8C 5JA4A 1P3OC 5GT3C 3MGPC 3UT9B 1P3MB 2Y2KA 2RIQA 5AV6C 4X23B 3X1SA 3AZHA 3AV1A 1P3KD 3W98B 2ZY2A 4H9PB 3A1IA 4R8PA 3LJAB 5B31D 5AV9D 4Z66A 1P34A 1T3UA 5AVCB 5AVBD 4XUJB 3MGSA 5B32C 1KU5A 5B1LD 5E5AD 3UT9C 5BT1C 3H0MC 2F8ND 1HQ3A 5B2JB 4WZSB 4X23C 3W98C 1N1JA 1M1AA 3AZKD 5DNMA 2DF4C 5G49B 5AVCC 5GXQD 2DQNC 4XUJC 3MNNA 3EG5B 3AZGA 1P3BD 5GSUA 1ZLAD 3MVDB 3AZMB 1M18A 3LELA 3X1TB 5B32G 4CAYA 1H3OA 5B0YA 3R45A 5JRGD 4JJNB 1P3AB 2FJ7A 5BO0B 2HIOD 3KSYA 1WWIA 4J8WC 3MVDC 3AZMC 1F66B 1P3MA 1P3OD 2IO5B 3AZNA 1KX3D 3X1TC 3AZIA 3AN2A 2NZDA 5AV5D 5AV6D 1ID3D 4JJNC 3LJAA 1P3AC 3REKD 3A6NA 4M6BA 5AVCA 3C1BB 5B33A 1P3PB 1F66C 4H9OB 5B32D 3AV2C 2IO5C 4WU9D 5B2JA 3W96A 5F99A 1BFMA 5BNVA 5DNNA 2PYOA 4H9SA 3C1BC 1P3PC 2Y2PA 4YS3D 4ZUXA 4KGCA 3AYWC 4J8XB 5CPKB 2RVQD 1KX5A 3TU4B 3AZJB 1P3GB 3AZLD 2Y2IA 1EQZA 5CP6A 4JJNA 1M19A 3KFUG 3KUYB 3UTAD 4NE5A 3KWQD 3REIB 4J8WD 2CV5A 3WA9C 5KDMB 1U35A 3B6GD 4J8XC 5CPKC 3AZFA 3TU4C 5B2ID 3AZJC 3WAAA 2NQBD 3MGRA 4J8VD 3AZEA 5B40B 5CPIA 1P3FB 5CPJB 2BYKB 3KUYC 1P3LB 3B6FA 1TZYA 3REIC 4LD9A 3LZ0B 3AFAA 4J8UA 3UTBA 3AV2D 3C1CB 3V9RB 4DQYB 3WKJC 5JA4B 4KHAA 5B24C 1P3FC 5CPJC 4NFTA 4Z5TB 3WTPD 4WV4B 3AZHB 4H9NA 3AV1B 1P3LC 1JFIA 2Y2LA 5AY8A 4R8PB 3LZ0C 4Z66B 1P34B 5FUGB 3C1CC 3MGSB 3O62B 3AYWD 2J8PA 1P3GA 1HQ3B 3AZHC 3KXBD 3AV1C 3X1SC 4KUDA 3RELD 3REHA 1M1AB 4R8PC 3EPHA 4Z66C 5DNMB 1P34C 5B1MD 1BH9B 3MGSC 3MNNB 3AZGB 1S32A 5GSUB 3A1KA 1HQ3C 1M18B 2G5HC 5B40A 3LELB 1M1AC 5CPJA 4CAYB 1ULYA 1BH8A 4NE6A 3LZ1B 5DNMC 3MNNC 3AZGC 3C1CA 3V9RA 5GSUC 1M18C 3WKJD 3W97A 3AZNB 3LELC 4Z5TA 3AZIB 3AN2B 5B24D 2NZDB 5B0YC 2Y2GA 2FJ7C 3A6NB 5GT0D 1Q9CA 5FUGA 5B33B 3O62A 3MGQD 1P3KA 1P3MC 2Y2OA 3X1VB 4Z2MH 3AZNC 4G91B 3EPLA 3AZIC 3AN2C 5B31A 2NZDC 1TAFB 2F8NH 3X1SD 3W99B 5B0ZD 5F99B 5BNVB 3W96B 5DNNB 4QLCD 5AVBA 3LJAC 2PYOB 3A6NC 5B1LA 1AOID 5E5AA 2F2AC 4E45A 2F8NA 4H9QA 1BH9A 5B33C 3X1VC 5C3IB 4ZUXB 5B2JC 4G91C 4KGCB 2YFWA 3AZKA 3W96C 3W99C 5F99C 1KX5B 5DNNC 2PYOC 4YM6D 5GXQA 2Y2HA 3LZ1A 4H9SC 4WU8B 3REJD 1P3BA 1EQZB 2JE5A 5CP6B 1M19B 1KX4D 5C3IC 4ZUXC 4KGCC 2CV5B 5AV8D 5GT3D 3MGPD 1U35B 5JRGA 1KX5C 3B0BA 3AZFB 4WU8C 3WAAB 1EQZC 2ZY5A 5CP6C 1M19C 3MGRB 3AZEB 5CPIB 2FJ7D 3B6FB 1TZYB 1KX3A 4LD9B 2CV5C 5AV5A 3X1VA 3AFAB 4J8UB 3UT9D 1ID3A 3UTBB 1U35C 5BT1D 1P3MD 3B0CT 3VH6A 1TAFA 3AZFC 4X23D 3W99A 3W98D 3WAAC 3MGRC 3AZEC 5CPIC 4KHAB 4H9NB 1JFIB 4WU9A 3B6FC 1TZYC 2Y2NA 5AVCD 4LD9C 5AY8B 4XUJD 3AFAC 4J8UC 3UTBC 1P3IB 5B2JD 3AL0C 4XZQB 4WU8A 4KUDB 4YS3A 3REHB 5AY8C 3H0RC 1R4VA 2YFVA 3MVDD 3AZMD 3AZLA 1S32B 3X1TD 1P3GC 3UTAA 3KWQA 4KUDC 4JJND 3REHC 1P3AD 5B1MB 1BH8B 5B2IA 1F66D 2NQBA 1HTAA 4J8VA 1S32C 3X1UB 3W97B 5B40C 2L5AA 3FDDA 2AROB 3C1BD 4DRAA 1P3PD 2Y2QA 3F6TA 1P3IA 4XZQA 3WTPA 1P3KB 3W97C 2JSSA 1F1EA 4ZBJB 4Z5TC 5B31B 5AV9B 5BS7A 1B67A 5AVBB 5B1LB 5E5AB 4G92B 2F8NB 2HUEB 4H9QB 3WA9D 3O62C 2Y2JA 3KXBA 1P3KC 3RELA 4J8XD 5B0ZB 5CPKD 3TU4D 3AZJD 1P3GD 5B31C 2W8SA 2YFWB 4CSRA 3AZKB 5B1MA 5AVBC 5GXQB 3KUYD 1P3BB 5B1LC 3B0DB 5E5AC 4G92C 3REID 1ZLAB 3X1UA 3NQUA 3AZKC 2BG1A 5JRGB 5B40D 1P3FD 2AROA 5CPJD 5GXQC 3LZ1C 2HIOB 1P3BC 1P3LD 3B0DC 3VH5A 5B31G 3LZ0D 1P3OB 1PZRA 4WNNA 3MGPB 1KX3B 4Z2MG 3C1CD 5AV5B 5AV6B 2F8NG 1ID3B 4EO5B 5JRGC 3REKB 1B6WA 5GT0A 5AV9A 3EPJA 3AZHD 3AV1D 3MGQA 4R8PD 1Z2CB 5B32B 4Z66D 4WU9B 1P34D 1KX3C 4NE3A 3MGSD 5AV5C 3O62D 5B0ZA 1ID3C 4EO5C 4QLCA 3REKC 1HQ3D 1W2EA 1AOIA 1M1AD 2F8NK 1ZLAA 5DNMD 4WU9C 4YS3B 3MNND 3AZGD 2ZM5A 5GSUD 4UUZB 2YFVB 4YM6A 3REJA 1M18D 3AZLB 3LELD 2LY8A 3P5JB 2HIOA 3UTAB 1KX4A 3KWQB 5B0YD 3LZ1D 4YS3C 4J8WB 4E44A 3VH6T 5AV8A 2G5IC 2UWXA 2VQRA 5GT3A 3MGPA 1P3OA 3B6GB 2RVQC 5B2IB 4H9RA 5AV6A 3AZLC 2NQBB 5BNXA 4J8VB 3REKA 3AZND 3AZID 3AN2D 2NZDD 3UTAC 3KWQC 3NQJA 3LJAD 5B32A 3A6ND 3UT9A 3VH6W 3AV2B 3B6GC 5B33D 5B2IC 4X23A 3W98A 2NQBC 3X1VD 4J8VC 4H9PA 4DRBA 2Y2MA 3WTPB 3B0CW 3W99D 3W96D 5F99D 3IP4C 5DNND 2PYOD 4XUJA 3EPKA 3AYWB 2ZY4A 1A7WA 4UUZA 4ZUXD 1P3IC 4KGCD 4XZQC 3WTPC 3KXBB 3RELB 1KX5D 5G49A 3H0LC 4WU8D 4CSRB 5CP6D 4J8WA 1M19D 1EQZD 1WWSA 5BS7C 3MVDA 3AZMA 3WA9B 3B6GA 3X1TA 2CV5D 3KXBC 1U35D 3RELC 4AWLB 3NQUB 1P3AA 3AZFD 5BO0A 3WAAD 3MGRD 5B1MC 3AZED 5CPID 1F66A 2ZY3A 3AV2A 3B6FD 1TZYD 2BYMB 4LD9D 4HGAB 2JCHA 3AFAD 4J8UD 3WKJB 2CWEA 4WNNB 3X1UC 4AWLC 3UTBD 5B24B 3C1BA 1P3PA 2AROC 5GT0B 4H9OA 3AYWA 4HGAC 5AY8D 3MGQB 1P3ID 4XZQD 5CHLB 3X1SB 4QLCB 4ZBJC 2FFFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 C;  5AV9 C;  1AOI B;  4KUD D;  3REH D;  3WA9 A;  3MGQ C;  2HUE C;  4J8X A;  5CPK A;  3TU4 A;  3AZJ A;  3WTP E;  1S32 D;  3VH5 T;  5B0Z C;  1N1J B;  4QLC C;  4YM6 B;  3REJ B;  3KUY A;  1AOI C;  3REI A;  1KX4 B;  5KDM A;  2BYM A;  1ZLA C;  3WKJ A;  5AV8 B;  5GT3 B;  3X1U D;  5B24 A;  1P3F A;  4YM6 C;  4H9R B;  2BYK A;  3VH5 W;  3REJ C;  1P3L A;  1H3O B;  3W97 D;  5B0Y B;  3R45 B;  5BNX B;  4Z5T D;  2HIO C;  2ARO D;  3LZ0 A;  1KX4 C;  2FJ7 B;  3NQJ B;  5AV8 C;  5JA4 A;  1P3O C;  5GT3 C;  3MGP C;  3UT9 B;  1P3M B;  5AV6 C;  4X23 B;  3X1S A;  3AZH A;  3AV1 A;  1P3K D;  3W98 B;  4H9P B;  4R8P A;  3LJA B;  5B31 D;  5AV9 D;  4Z66 A;  1P34 A;  5AVC B;  5AVB D;  4XUJ B;  3MGS A;  5B32 C;  1KU5 A;  5B1L D;  5E5A D;  3UT9 C;  5BT1 C;  2F8N D;  1HQ3 A;  5B2J B;  4WZS B;  4X23 C;  3W98 C;  1N1J A;  1M1A A;  3AZK D;  5DNM A;  5G49 B;  5AVC C;  5GXQ D;  4XUJ C;  3MNN A;  3AZG A;  1P3B D;  5GSU A;  1ZLA D;  3MVD B;  3AZM B;  1M18 A;  3LEL A;  3X1T B;  5B32 G;  4CAY A;  1H3O A;  5B0Y A;  3R45 A;  5JRG D;  4JJN B;  1P3A B;  2FJ7 A;  5BO0 B;  2HIO D;  3KSY A;  1WWI A;  4J8W C;  3MVD C;  3AZM C;  1F66 B;  1P3M A;  1P3O D;  2IO5 B;  3AZN A;  1KX3 D;  3X1T C;  3AZI A;  3AN2 A;  2NZD A;  5AV5 D;  5AV6 D;  1ID3 D;  4JJN C;  3LJA A;  1P3A C;  3REK D;  3A6N A;  4M6B A;  5AVC A;  3C1B B;  5B33 A;  1P3P B;  1F66 C;  4H9O B;  5B32 D;  3AV2 C;  2IO5 C;  4WU9 D;  5B2J A;  3W96 A;  5F99 A;  1BFM A;  5BNV A;  5DNN A;  2PYO A;  4H9S A;  3C1B C;  1P3P C;  4YS3 D;  4ZUX A;  4KGC A;  3AYW C;  4J8X B;  5CPK B;  2RVQ D;  1KX5 A;  3TU4 B;  3AZJ B;  1P3G B;  3AZL D;  1EQZ A;  5CP6 A;  4JJN A;  1M19 A;  3KUY B;  3UTA D;  4NE5 A;  3KWQ D;  3REI B;  4J8W D;  2CV5 A;  3WA9 C;  5KDM B;  1U35 A;  3B6G D;  4J8X C;  5CPK C;  3AZF A;  3TU4 C;  5B2I D;  3AZJ C;  3WAA A;  2NQB D;  3MGR A;  4J8V D;  3AZE A;  5B40 B;  5CPI A;  1P3F B;  5CPJ B;  2BYK B;  3KUY C;  1P3L B;  3B6F A;  1TZY A;  3REI C;  4LD9 A;  3LZ0 B;  3AFA A;  4J8U A;  3UTB A;  3AV2 D;  3C1C B;  3V9R B;  3WKJ C;  5JA4 B;  4KHA A;  5B24 C;  1P3F C;  5CPJ C;  4NFT A;  4Z5T B;  3WTP D;  4WV4 B;  3AZH B;  4H9N A;  3AV1 B;  1P3L C;  1JFI A;  5AY8 A;  4R8P B;  3LZ0 C;  4Z66 B;  1P34 B;  5FUG B;  3C1C C;  3MGS B;  3O62 B;  3AYW D;  1P3G A;  1HQ3 B;  3AZH C;  3KXB D;  3AV1 C;  3X1S C;  4KUD A;  3REL D;  3REH A;  1M1A B;  4R8P C;  4Z66 C;  5DNM B;  1P34 C;  5B1M D;  1BH9 B;  3MGS C;  3MNN B;  3AZG B;  1S32 A;  5GSU B;  1HQ3 C;  1M18 B;  5B40 A;  3LEL B;  1M1A C;  5CPJ A;  4CAY B;  1ULY A;  1BH8 A;  4NE6 A;  3LZ1 B;  5DNM C;  3MNN C;  3AZG C;  3C1C A;  3V9R A;  5GSU C;  1M18 C;  3WKJ D;  3W97 A;  3AZN B;  3LEL C;  4Z5T A;  3AZI B;  3AN2 B;  5B24 D;  2NZD B;  5B0Y C;  2FJ7 C;  3A6N B;  5GT0 D;  1Q9C A;  5FUG A;  5B33 B;  3O62 A;  3MGQ D;  1P3K A;  1P3M C;  3X1V B;  4Z2M H;  3AZN C;  4G91 B;  3AZI C;  3AN2 C;  5B31 A;  2NZD C;  1TAF B;  2F8N H;  3X1S D;  3W99 B;  5B0Z D;  5F99 B;  5BNV B;  3W96 B;  5DNN B;  4QLC D;  5AVB A;  3LJA C;  2PYO B;  3A6N C;  5B1L A;  1AOI D;  5E5A A;  4E45 A;  2F8N A;  4H9Q A;  1BH9 A;  5B33 C;  3X1V C;  5C3I B;  4ZUX B;  5B2J C;  4G91 C;  4KGC B;  2YFW A;  3AZK A;  3W96 C;  3W99 C;  5F99 C;  1KX5 B;  5DNN C;  2PYO C;  4YM6 D;  5GXQ A;  3REJ D;  3LZ1 A;  4H9S C;  4WU8 B;  1P3B A;  1EQZ B;  5CP6 B;  1M19 B;  1KX4 D;  5C3I C;  4ZUX C;  4KGC C;  2CV5 B;  5AV8 D;  5GT3 D;  3MGP D;  1U35 B;  5JRG A;  1KX5 C;  3B0B A;  3AZF B;  4WU8 C;  3WAA B;  1EQZ C;  5CP6 C;  1M19 C;  3MGR B;  3AZE B;  5CPI B;  2FJ7 D;  3B6F B;  1TZY B;  1KX3 A;  4LD9 B;  2CV5 C;  5AV5 A;  3X1V A;  3AFA B;  4J8U B;  3UT9 D;  1ID3 A;  3UTB B;  1U35 C;  5BT1 D;  1P3M D;  3B0C T;  3VH6 A;  1TAF A;  3AZF C;  4X23 D;  3W99 A;  3W98 D;  3WAA C;  3MGR C;  3AZE C;  5CPI C;  4KHA B;  4H9N B;  1JFI B;  4WU9 A;  3B6F C;  1TZY C;  4LD9 C;  5AVC D;  5AY8 B;  4XUJ D;  3AFA C;  4J8U C;  3UTB C;  1P3I B;  5B2J D;  4XZQ B;  4WU8 A;  4KUD B;  4YS3 A;  3REH B;  5AY8 C;  1R4V A;  2YFV A;  3MVD D;  3AZM D;  3AZL A;  1S32 B;  3X1T D;  1P3G C;  3UTA A;  3KWQ A;  4KUD C;  4JJN D;  3REH C;  1P3A D;  5B1M B;  1BH8 B;  5B2I A;  1F66 D;  2NQB A;  1HTA A;  4J8V A;  1S32 C;  3X1U B;  3W97 B;  5B40 C;  2L5A A;  2ARO B;  3C1B D;  4DRA A;  1P3P D;  1P3I A;  4XZQ A;  3WTP A;  1P3K B;  3W97 C;  2JSS A;  1F1E A;  4ZBJ B;  4Z5T C;  5B31 B;  5AV9 B;  5BS7 A;  1B67 A;  5AVB B;  5B1L B;  5E5A B;  4G92 B;  2F8N B;  2HUE B;  4H9Q B;  3WA9 D;  3O62 C;  3KXB A;  1P3K C;  3REL A;  4J8X D;  5B0Z B;  5CPK D;  3TU4 D;  3AZJ D;  1P3G D;  5B31 C;  2YFW B;  4CSR A;  3AZK B;  5B1M A;  5AVB C;  5GXQ B;  3KUY D;  1P3B B;  5B1L C;  3B0D B;  5E5A C;  4G92 C;  3REI D;  1ZLA B;  3X1U A;  3NQU A;  3AZK C;  5JRG B;  5B40 D;  1P3F D;  2ARO A;  5CPJ D;  5GXQ C;  3LZ1 C;  2HIO B;  1P3B C;  1P3L D;  3B0D C;  3VH5 A;  5B31 G;  3LZ0 D;  1P3O B;  4WNN A;  3MGP B;  1KX3 B;  4Z2M G;  3C1C D;  5AV5 B;  5AV6 B;  2F8N G;  1ID3 B;  4EO5 B;  5JRG C;  3REK B;  1B6W A;  5AV9 A;  5GT0 A;  3AZH D;  3AV1 D;  3MGQ A;  4R8P D;  5B32 B;  4Z66 D;  4WU9 B;  1P34 D;  1KX3 C;  4NE3 A;  3MGS D;  5AV5 C;  3O62 D;  5B0Z A;  1ID3 C;  4EO5 C;  4QLC A;  3REK C;  1HQ3 D;  1AOI A;  1M1A D;  2F8N K;  1ZLA A;  5DNM D;  4WU9 C;  4YS3 B;  3MNN D;  3AZG D;  5GSU D;  4UUZ B;  2YFV B;  4YM6 A;  3REJ A;  1M18 D;  3AZL B;  3LEL D;  2LY8 A;  2HIO A;  3UTA B;  1KX4 A;  3KWQ B;  5B0Y D;  3LZ1 D;  4YS3 C;  4J8W B;  4E44 A;  3VH6 T;  5AV8 A;  1P3O A;  5GT3 A;  3MGP A;  3B6G B;  2RVQ C;  5B2I B;  4H9R A;  5AV6 A;  3AZL C;  2NQB B;  5BNX A;  4J8V B;  3REK A;  3AZN D;  3AZI D;  3AN2 D;  2NZD D;  3UTA C;  3KWQ C;  3NQJ A;  3LJA D;  5B32 A;  3A6N D;  3UT9 A;  3VH6 W;  3AV2 B;  3B6G C;  5B33 D;  5B2I C;  4X23 A;  3W98 A;  2NQB C;  3X1V D;  4J8V C;  4H9P A;  4DRB A;  3WTP B;  3B0C W;  3W99 D;  3W96 D;  5F99 D;  5DNN D;  2PYO D;  4XUJ A;  3AYW B;  1A7W A;  4UUZ A;  4ZUX D;  1P3I C;  4KGC D;  4XZQ C;  3WTP C;  3KXB B;  3REL B;  1KX5 D;  5G49 A;  4WU8 D;  4CSR B;  5CP6 D;  4J8W A;  1M19 D;  1EQZ D;  1WWS A;  5BS7 C;  3MVD A;  3AZM A;  3WA9 B;  3B6G A;  3X1T A;  2CV5 D;  3KXB C;  1U35 D;  3REL C;  4AWL B;  3NQU B;  1P3A A;  3AZF D;  5BO0 A;  3WAA D;  3MGR D;  5B1M C;  3AZE D;  5CPI D;  1F66 A;  3AV2 A;  3B6F D;  1TZY D;  2BYM B;  4LD9 D;  4HGA B;  3AFA D;  4J8U D;  3WKJ B;  2CWE A;  4WNN B;  3X1U C;  4AWL C;  3UTB D;  5B24 B;  3C1B A;  1P3P A;  2ARO C;  5GT0 B;  4H9O A;  3AYW A;  4HGA C;  5AY8 D;  3MGQ B;  1P3I D;  4XZQ D;  5CHL B;  3X1S B;  4QLC B;  4ZBJ C; 
#chains in the Genus database with same CATH topology
 5GT0 C;  5AV9 C;  1AOI B;  4KUD D;  3REH D;  2XD5 A;  3MGQ C;  3WA9 A;  2HUE C;  4J8X A;  5CPK A;  3TU4 A;  3AZJ A;  3WTP E;  1S32 D;  3VH5 T;  5B0Z C;  1N1J B;  4QLC C;  4YM6 B;  3REJ B;  3KUY A;  1AOI C;  3REI A;  4WJ3 C;  1KX4 B;  5KDM A;  2BYM A;  1ZLA C;  3WKJ A;  5AV8 B;  5GT3 B;  3X1U D;  5B24 A;  1P3F A;  4YM6 C;  4H9R B;  2BYK A;  3VH5 W;  3REJ C;  4UPK A;  1P3L A;  1H3O B;  3W97 D;  5B0Y B;  3R45 B;  5BNX B;  4Z5T D;  2HIO C;  2ARO D;  3LZ0 A;  1KX4 C;  2FJ7 B;  3NQJ B;  2XD1 A;  5AV8 C;  5JA4 A;  1P3O C;  5GT3 C;  3MGP C;  3UT9 B;  1P3M B;  2Y2K A;  2RIQ A;  5AV6 C;  4X23 B;  3X1S A;  3AZH A;  3AV1 A;  1P3K D;  3W98 B;  2ZY2 A;  4H9P B;  3A1I A;  4R8P A;  3LJA B;  5B31 D;  5AV9 D;  4Z66 A;  1P34 A;  1T3U A;  5AVC B;  5AVB D;  4XUJ B;  3MGS A;  5B32 C;  1KU5 A;  5B1L D;  5E5A D;  3UT9 C;  5BT1 C;  3H0M C;  2F8N D;  1HQ3 A;  5B2J B;  4WZS B;  4X23 C;  3W98 C;  1N1J A;  1M1A A;  3AZK D;  5DNM A;  2DF4 C;  5G49 B;  5AVC C;  5GXQ D;  2DQN C;  4XUJ C;  3MNN A;  3EG5 B;  3AZG A;  1P3B D;  5GSU A;  1ZLA D;  3MVD B;  3AZM B;  1M18 A;  3LEL A;  3X1T B;  5B32 G;  4CAY A;  1H3O A;  5B0Y A;  3R45 A;  5JRG D;  4JJN B;  1P3A B;  2FJ7 A;  5BO0 B;  2HIO D;  3KSY A;  1WWI A;  4J8W C;  3MVD C;  3AZM C;  1F66 B;  1P3M A;  1P3O D;  2IO5 B;  3AZN A;  1KX3 D;  3X1T C;  3AZI A;  3AN2 A;  2NZD A;  5AV5 D;  5AV6 D;  1ID3 D;  4JJN C;  3LJA A;  1P3A C;  3REK D;  3A6N A;  4M6B A;  5AVC A;  3C1B B;  5B33 A;  1P3P B;  1F66 C;  4H9O B;  5B32 D;  3AV2 C;  2IO5 C;  4WU9 D;  5B2J A;  3W96 A;  5F99 A;  1BFM A;  5BNV A;  5DNN A;  2PYO A;  4H9S A;  3C1B C;  1P3P C;  2Y2P A;  4YS3 D;  4ZUX A;  4KGC A;  3AYW C;  4J8X B;  5CPK B;  2RVQ D;  1KX5 A;  3TU4 B;  3AZJ B;  1P3G B;  3AZL D;  2Y2I A;  1EQZ A;  5CP6 A;  4JJN A;  1M19 A;  3KFU G;  3KUY B;  3UTA D;  4NE5 A;  3KWQ D;  3REI B;  4J8W D;  2CV5 A;  3WA9 C;  5KDM B;  1U35 A;  3B6G D;  4J8X C;  5CPK C;  3AZF A;  3TU4 C;  5B2I D;  3AZJ C;  3WAA A;  2NQB D;  3MGR A;  4J8V D;  3AZE A;  5B40 B;  5CPI A;  1P3F B;  5CPJ B;  2BYK B;  3KUY C;  1P3L B;  3B6F A;  1TZY A;  3REI C;  4LD9 A;  3LZ0 B;  3AFA A;  4J8U A;  3UTB A;  3AV2 D;  3C1C B;  3V9R B;  4DQY B;  3WKJ C;  5JA4 B;  4KHA A;  5B24 C;  1P3F C;  5CPJ C;  4NFT A;  4Z5T B;  3WTP D;  4WV4 B;  3AZH B;  4H9N A;  3AV1 B;  1P3L C;  1JFI A;  2Y2L A;  5AY8 A;  4R8P B;  3LZ0 C;  4Z66 B;  1P34 B;  5FUG B;  3C1C C;  3MGS B;  3O62 B;  3AYW D;  2J8P A;  1P3G A;  1HQ3 B;  3AZH C;  3KXB D;  3AV1 C;  3X1S C;  4KUD A;  3REL D;  3REH A;  1M1A B;  4R8P C;  3EPH A;  4Z66 C;  5DNM B;  1P34 C;  5B1M D;  1BH9 B;  3MGS C;  3MNN B;  3AZG B;  1S32 A;  5GSU B;  3A1K A;  1HQ3 C;  1M18 B;  2G5H C;  5B40 A;  3LEL B;  1M1A C;  5CPJ A;  4CAY B;  1ULY A;  1BH8 A;  4NE6 A;  3LZ1 B;  5DNM C;  3MNN C;  3AZG C;  3C1C A;  3V9R A;  5GSU C;  1M18 C;  3WKJ D;  3W97 A;  3AZN B;  3LEL C;  4Z5T A;  3AZI B;  3AN2 B;  5B24 D;  2NZD B;  5B0Y C;  2Y2G A;  2FJ7 C;  3A6N B;  5GT0 D;  1Q9C A;  5FUG A;  5B33 B;  3O62 A;  3MGQ D;  1P3K A;  1P3M C;  2Y2O A;  3X1V B;  4Z2M H;  3AZN C;  4G91 B;  3EPL A;  3AZI C;  3AN2 C;  5B31 A;  2NZD C;  1TAF B;  2F8N H;  3X1S D;  3W99 B;  5B0Z D;  5F99 B;  5BNV B;  3W96 B;  5DNN B;  4QLC D;  5AVB A;  3LJA C;  2PYO B;  3A6N C;  5B1L A;  1AOI D;  5E5A A;  2F2A C;  4E45 A;  2F8N A;  4H9Q A;  1BH9 A;  5B33 C;  3X1V C;  5C3I B;  4ZUX B;  5B2J C;  4G91 C;  4KGC B;  2YFW A;  3AZK A;  3W96 C;  3W99 C;  5F99 C;  1KX5 B;  5DNN C;  2PYO C;  4YM6 D;  5GXQ A;  2Y2H A;  3LZ1 A;  4H9S C;  4WU8 B;  3REJ D;  1P3B A;  1EQZ B;  2JE5 A;  5CP6 B;  1M19 B;  1KX4 D;  5C3I C;  4ZUX C;  4KGC C;  2CV5 B;  5AV8 D;  5GT3 D;  3MGP D;  1U35 B;  5JRG A;  1KX5 C;  3B0B A;  3AZF B;  4WU8 C;  3WAA B;  1EQZ C;  2ZY5 A;  5CP6 C;  1M19 C;  3MGR B;  3AZE B;  5CPI B;  2FJ7 D;  3B6F B;  1TZY B;  1KX3 A;  4LD9 B;  2CV5 C;  5AV5 A;  3X1V A;  3AFA B;  4J8U B;  3UT9 D;  1ID3 A;  3UTB B;  1U35 C;  5BT1 D;  1P3M D;  3B0C T;  3VH6 A;  1TAF A;  3AZF C;  4X23 D;  3W99 A;  3W98 D;  3WAA C;  3MGR C;  3AZE C;  5CPI C;  4KHA B;  4H9N B;  1JFI B;  4WU9 A;  3B6F C;  1TZY C;  2Y2N A;  5AVC D;  4LD9 C;  5AY8 B;  4XUJ D;  3AFA C;  4J8U C;  3UTB C;  1P3I B;  5B2J D;  3AL0 C;  4XZQ B;  4WU8 A;  4KUD B;  4YS3 A;  3REH B;  5AY8 C;  3H0R C;  1R4V A;  2YFV A;  3MVD D;  3AZM D;  3AZL A;  1S32 B;  3X1T D;  1P3G C;  3UTA A;  3KWQ A;  4KUD C;  4JJN D;  3REH C;  1P3A D;  5B1M B;  1BH8 B;  5B2I A;  1F66 D;  2NQB A;  1HTA A;  4J8V A;  1S32 C;  3X1U B;  3W97 B;  5B40 C;  2L5A A;  3FDD A;  2ARO B;  3C1B D;  4DRA A;  1P3P D;  2Y2Q A;  3F6T A;  1P3I A;  4XZQ A;  3WTP A;  1P3K B;  3W97 C;  2JSS A;  1F1E A;  4ZBJ B;  4Z5T C;  5B31 B;  5AV9 B;  5BS7 A;  1B67 A;  5AVB B;  5B1L B;  5E5A B;  4G92 B;  2F8N B;  2HUE B;  4H9Q B;  3WA9 D;  3O62 C;  2Y2J A;  3KXB A;  1P3K C;  3REL A;  4J8X D;  5B0Z B;  5CPK D;  3TU4 D;  3AZJ D;  1P3G D;  5B31 C;  2W8S A;  2YFW B;  4CSR A;  3AZK B;  5B1M A;  5AVB C;  5GXQ B;  3KUY D;  1P3B B;  5B1L C;  3B0D B;  5E5A C;  4G92 C;  3REI D;  1ZLA B;  3X1U A;  3NQU A;  3AZK C;  2BG1 A;  5JRG B;  5B40 D;  1P3F D;  2ARO A;  5CPJ D;  5GXQ C;  3LZ1 C;  2HIO B;  1P3B C;  1P3L D;  3B0D C;  3VH5 A;  5B31 G;  3LZ0 D;  1P3O B;  1PZR A;  4WNN A;  3MGP B;  1KX3 B;  4Z2M G;  3C1C D;  5AV5 B;  5AV6 B;  2F8N G;  1ID3 B;  4EO5 B;  5JRG C;  3REK B;  1B6W A;  5GT0 A;  5AV9 A;  3EPJ A;  3AZH D;  3AV1 D;  3MGQ A;  4R8P D;  1Z2C B;  5B32 B;  4Z66 D;  4WU9 B;  1P34 D;  1KX3 C;  4NE3 A;  3MGS D;  5AV5 C;  3O62 D;  5B0Z A;  1ID3 C;  4EO5 C;  4QLC A;  3REK C;  1HQ3 D;  1W2E A;  1AOI A;  1M1A D;  2F8N K;  1ZLA A;  5DNM D;  4WU9 C;  4YS3 B;  3MNN D;  3AZG D;  2ZM5 A;  5GSU D;  4UUZ B;  2YFV B;  4YM6 A;  3REJ A;  1M18 D;  3AZL B;  3LEL D;  2LY8 A;  3P5J B;  2HIO A;  3UTA B;  1KX4 A;  3KWQ B;  5B0Y D;  3LZ1 D;  4YS3 C;  4J8W B;  4E44 A;  3VH6 T;  5AV8 A;  2G5I C;  2UWX A;  2VQR A;  5GT3 A;  3MGP A;  1P3O A;  3B6G B;  2RVQ C;  5B2I B;  4H9R A;  5AV6 A;  3AZL C;  2NQB B;  5BNX A;  4J8V B;  3REK A;  3AZN D;  3AZI D;  3AN2 D;  2NZD D;  3UTA C;  3KWQ C;  3NQJ A;  3LJA D;  5B32 A;  3A6N D;  3UT9 A;  3VH6 W;  3AV2 B;  3B6G C;  5B33 D;  5B2I C;  4X23 A;  3W98 A;  2NQB C;  3X1V D;  4J8V C;  4H9P A;  4DRB A;  2Y2M A;  3WTP B;  3B0C W;  3W99 D;  3W96 D;  5F99 D;  3IP4 C;  5DNN D;  2PYO D;  4XUJ A;  3EPK A;  3AYW B;  2ZY4 A;  1A7W A;  4UUZ A;  4ZUX D;  1P3I C;  4KGC D;  4XZQ C;  3WTP C;  3KXB B;  3REL B;  1KX5 D;  5G49 A;  3H0L C;  4WU8 D;  4CSR B;  5CP6 D;  4J8W A;  1M19 D;  1EQZ D;  1WWS A;  5BS7 C;  3MVD A;  3AZM A;  3WA9 B;  3B6G A;  3X1T A;  2CV5 D;  3KXB C;  1U35 D;  3REL C;  4AWL B;  3NQU B;  1P3A A;  3AZF D;  5BO0 A;  3WAA D;  3MGR D;  5B1M C;  3AZE D;  5CPI D;  1F66 A;  2ZY3 A;  3AV2 A;  3B6F D;  1TZY D;  2BYM B;  4LD9 D;  4HGA B;  2JCH A;  3AFA D;  4J8U D;  3WKJ B;  2CWE A;  4WNN B;  3X1U C;  4AWL C;  3UTB D;  5B24 B;  3C1B A;  1P3P A;  2ARO C;  5GT0 B;  4H9O A;  3AYW A;  4HGA C;  5AY8 D;  3MGQ B;  1P3I D;  4XZQ D;  5CHL B;  3X1S B;  4QLC B;  4ZBJ C;  2FFF B; 
#chains in the Genus database with same CATH homology
 5GT0 C;  5AV9 C;  1AOI B;  4KUD D;  3REH D;  2XD5 A;  3MGQ C;  3WA9 A;  2HUE C;  4J8X A;  5CPK A;  3TU4 A;  3AZJ A;  3WTP E;  1S32 D;  3VH5 T;  5B0Z C;  1N1J B;  4QLC C;  4YM6 B;  3REJ B;  3KUY A;  1AOI C;  3REI A;  4WJ3 C;  1KX4 B;  5KDM A;  2BYM A;  1ZLA C;  3WKJ A;  5AV8 B;  5GT3 B;  3X1U D;  5B24 A;  1P3F A;  4YM6 C;  4H9R B;  2BYK A;  3VH5 W;  3REJ C;  4UPK A;  1P3L A;  1H3O B;  3W97 D;  5B0Y B;  3R45 B;  5BNX B;  4Z5T D;  2HIO C;  2ARO D;  3LZ0 A;  1KX4 C;  2FJ7 B;  3NQJ B;  2XD1 A;  5AV8 C;  5JA4 A;  1P3O C;  5GT3 C;  3MGP C;  3UT9 B;  1P3M B;  2Y2K A;  2RIQ A;  5AV6 C;  4X23 B;  3X1S A;  3AZH A;  3AV1 A;  1P3K D;  3W98 B;  2ZY2 A;  4H9P B;  3A1I A;  4R8P A;  3LJA B;  5B31 D;  5AV9 D;  4Z66 A;  1P34 A;  1T3U A;  5AVC B;  5AVB D;  4XUJ B;  3MGS A;  5B32 C;  1KU5 A;  5B1L D;  5E5A D;  3UT9 C;  5BT1 C;  3H0M C;  2F8N D;  1HQ3 A;  5B2J B;  4WZS B;  4X23 C;  3W98 C;  1N1J A;  1M1A A;  3AZK D;  5DNM A;  2DF4 C;  5G49 B;  5AVC C;  5GXQ D;  2DQN C;  4XUJ C;  3MNN A;  3EG5 B;  3AZG A;  1P3B D;  5GSU A;  1ZLA D;  3MVD B;  3AZM B;  1M18 A;  3LEL A;  3X1T B;  5B32 G;  4CAY A;  1H3O A;  5B0Y A;  3R45 A;  5JRG D;  4JJN B;  1P3A B;  2FJ7 A;  5BO0 B;  2HIO D;  3KSY A;  1WWI A;  4J8W C;  3MVD C;  3AZM C;  1F66 B;  1P3M A;  1P3O D;  2IO5 B;  3AZN A;  1KX3 D;  3X1T C;  3AZI A;  3AN2 A;  2NZD A;  5AV5 D;  5AV6 D;  1ID3 D;  4JJN C;  3LJA A;  1P3A C;  3REK D;  3A6N A;  4M6B A;  5AVC A;  3C1B B;  5B33 A;  1P3P B;  1F66 C;  4H9O B;  5B32 D;  3AV2 C;  2IO5 C;  4WU9 D;  5B2J A;  3W96 A;  5F99 A;  1BFM A;  5BNV A;  5DNN A;  2PYO A;  4H9S A;  3C1B C;  1P3P C;  2Y2P A;  4YS3 D;  4ZUX A;  4KGC A;  3AYW C;  4J8X B;  5CPK B;  2RVQ D;  1KX5 A;  3TU4 B;  3AZJ B;  1P3G B;  3AZL D;  2Y2I A;  1EQZ A;  5CP6 A;  4JJN A;  1M19 A;  3KFU G;  3KUY B;  3UTA D;  4NE5 A;  3KWQ D;  3REI B;  4J8W D;  2CV5 A;  3WA9 C;  5KDM B;  1U35 A;  3B6G D;  4J8X C;  5CPK C;  3AZF A;  3TU4 C;  5B2I D;  3AZJ C;  3WAA A;  2NQB D;  3MGR A;  4J8V D;  3AZE A;  5B40 B;  5CPI A;  1P3F B;  5CPJ B;  2BYK B;  3KUY C;  1P3L B;  3B6F A;  1TZY A;  3REI C;  4LD9 A;  3LZ0 B;  3AFA A;  4J8U A;  3UTB A;  3AV2 D;  3C1C B;  3V9R B;  4DQY B;  3WKJ C;  5JA4 B;  4KHA A;  5B24 C;  1P3F C;  5CPJ C;  4NFT A;  4Z5T B;  3WTP D;  4WV4 B;  3AZH B;  4H9N A;  3AV1 B;  1P3L C;  1JFI A;  2Y2L A;  5AY8 A;  4R8P B;  3LZ0 C;  4Z66 B;  1P34 B;  5FUG B;  3C1C C;  3MGS B;  3O62 B;  3AYW D;  2J8P A;  1P3G A;  1HQ3 B;  3AZH C;  3KXB D;  3AV1 C;  3X1S C;  4KUD A;  3REL D;  3REH A;  1M1A B;  4R8P C;  3EPH A;  4Z66 C;  5DNM B;  1P34 C;  5B1M D;  1BH9 B;  3MGS C;  3MNN B;  3AZG B;  1S32 A;  5GSU B;  3A1K A;  1HQ3 C;  1M18 B;  2G5H C;  5B40 A;  3LEL B;  1M1A C;  5CPJ A;  4CAY B;  1ULY A;  1BH8 A;  4NE6 A;  3LZ1 B;  5DNM C;  3MNN C;  3AZG C;  3C1C A;  3V9R A;  5GSU C;  1M18 C;  3WKJ D;  3W97 A;  3AZN B;  3LEL C;  4Z5T A;  3AZI B;  3AN2 B;  5B24 D;  2NZD B;  5B0Y C;  2Y2G A;  2FJ7 C;  3A6N B;  5GT0 D;  1Q9C A;  5FUG A;  5B33 B;  3O62 A;  3MGQ D;  1P3K A;  1P3M C;  2Y2O A;  3X1V B;  4Z2M H;  3AZN C;  4G91 B;  3EPL A;  3AZI C;  3AN2 C;  5B31 A;  2NZD C;  1TAF B;  2F8N H;  3X1S D;  3W99 B;  5B0Z D;  5F99 B;  5BNV B;  3W96 B;  5DNN B;  4QLC D;  5AVB A;  3LJA C;  2PYO B;  3A6N C;  5B1L A;  1AOI D;  5E5A A;  2F2A C;  4E45 A;  2F8N A;  4H9Q A;  1BH9 A;  5B33 C;  3X1V C;  5C3I B;  4ZUX B;  5B2J C;  4G91 C;  4KGC B;  2YFW A;  3AZK A;  3W96 C;  3W99 C;  5F99 C;  1KX5 B;  5DNN C;  2PYO C;  4YM6 D;  5GXQ A;  2Y2H A;  3LZ1 A;  4H9S C;  4WU8 B;  3REJ D;  1P3B A;  1EQZ B;  2JE5 A;  5CP6 B;  1M19 B;  1KX4 D;  5C3I C;  4ZUX C;  4KGC C;  2CV5 B;  5AV8 D;  5GT3 D;  3MGP D;  1U35 B;  5JRG A;  1KX5 C;  3B0B A;  3AZF B;  4WU8 C;  3WAA B;  1EQZ C;  2ZY5 A;  5CP6 C;  1M19 C;  3MGR B;  3AZE B;  5CPI B;  2FJ7 D;  3B6F B;  1TZY B;  1KX3 A;  4LD9 B;  2CV5 C;  5AV5 A;  3X1V A;  3AFA B;  4J8U B;  3UT9 D;  1ID3 A;  3UTB B;  1U35 C;  5BT1 D;  1P3M D;  3B0C T;  3VH6 A;  1TAF A;  3AZF C;  4X23 D;  3W99 A;  3W98 D;  3WAA C;  3MGR C;  3AZE C;  5CPI C;  4KHA B;  4H9N B;  1JFI B;  4WU9 A;  3B6F C;  1TZY C;  2Y2N A;  5AVC D;  4LD9 C;  5AY8 B;  4XUJ D;  3AFA C;  4J8U C;  3UTB C;  1P3I B;  5B2J D;  3AL0 C;  4XZQ B;  4WU8 A;  4KUD B;  4YS3 A;  3REH B;  5AY8 C;  3H0R C;  1R4V A;  2YFV A;  3MVD D;  3AZM D;  3AZL A;  1S32 B;  3X1T D;  1P3G C;  3UTA A;  3KWQ A;  4KUD C;  4JJN D;  3REH C;  1P3A D;  5B1M B;  1BH8 B;  5B2I A;  1F66 D;  2NQB A;  1HTA A;  4J8V A;  1S32 C;  3X1U B;  3W97 B;  5B40 C;  2L5A A;  3FDD A;  2ARO B;  3C1B D;  4DRA A;  1P3P D;  2Y2Q A;  3F6T A;  1P3I A;  4XZQ A;  3WTP A;  1P3K B;  3W97 C;  2JSS A;  1F1E A;  4ZBJ B;  4Z5T C;  5B31 B;  5AV9 B;  5BS7 A;  1B67 A;  5AVB B;  5B1L B;  5E5A B;  4G92 B;  2F8N B;  2HUE B;  4H9Q B;  3WA9 D;  3O62 C;  2Y2J A;  3KXB A;  1P3K C;  3REL A;  4J8X D;  5B0Z B;  5CPK D;  3TU4 D;  3AZJ D;  1P3G D;  5B31 C;  2W8S A;  2YFW B;  4CSR A;  3AZK B;  5B1M A;  5AVB C;  5GXQ B;  3KUY D;  1P3B B;  5B1L C;  3B0D B;  5E5A C;  4G92 C;  3REI D;  1ZLA B;  3X1U A;  3NQU A;  3AZK C;  2BG1 A;  5JRG B;  5B40 D;  1P3F D;  2ARO A;  5CPJ D;  5GXQ C;  3LZ1 C;  2HIO B;  1P3B C;  1P3L D;  3B0D C;  3VH5 A;  5B31 G;  3LZ0 D;  1P3O B;  1PZR A;  4WNN A;  3MGP B;  1KX3 B;  4Z2M G;  3C1C D;  5AV5 B;  5AV6 B;  2F8N G;  1ID3 B;  4EO5 B;  5JRG C;  3REK B;  1B6W A;  5GT0 A;  5AV9 A;  3EPJ A;  3AZH D;  3AV1 D;  3MGQ A;  4R8P D;  1Z2C B;  5B32 B;  4Z66 D;  4WU9 B;  1P34 D;  1KX3 C;  4NE3 A;  3MGS D;  5AV5 C;  3O62 D;  5B0Z A;  1ID3 C;  4EO5 C;  4QLC A;  3REK C;  1HQ3 D;  1W2E A;  1AOI A;  1M1A D;  2F8N K;  1ZLA A;  5DNM D;  4WU9 C;  4YS3 B;  3MNN D;  3AZG D;  2ZM5 A;  5GSU D;  4UUZ B;  2YFV B;  4YM6 A;  3REJ A;  1M18 D;  3AZL B;  3LEL D;  2LY8 A;  3P5J B;  2HIO A;  3UTA B;  1KX4 A;  3KWQ B;  5B0Y D;  3LZ1 D;  4YS3 C;  4J8W B;  4E44 A;  3VH6 T;  5AV8 A;  2G5I C;  2UWX A;  2VQR A;  5GT3 A;  3MGP A;  1P3O A;  3B6G B;  2RVQ C;  5B2I B;  4H9R A;  5AV6 A;  3AZL C;  2NQB B;  5BNX A;  4J8V B;  3REK A;  3AZN D;  3AZI D;  3AN2 D;  2NZD D;  3UTA C;  3KWQ C;  3NQJ A;  3LJA D;  5B32 A;  3A6N D;  3UT9 A;  3VH6 W;  3AV2 B;  3B6G C;  5B33 D;  5B2I C;  4X23 A;  3W98 A;  2NQB C;  3X1V D;  4J8V C;  4H9P A;  4DRB A;  2Y2M A;  3WTP B;  3B0C W;  3W99 D;  3W96 D;  5F99 D;  3IP4 C;  5DNN D;  2PYO D;  4XUJ A;  3EPK A;  3AYW B;  2ZY4 A;  1A7W A;  4UUZ A;  4ZUX D;  1P3I C;  4KGC D;  4XZQ C;  3WTP C;  3KXB B;  3REL B;  1KX5 D;  5G49 A;  3H0L C;  4WU8 D;  4CSR B;  5CP6 D;  4J8W A;  1M19 D;  1EQZ D;  1WWS A;  5BS7 C;  3MVD A;  3AZM A;  3WA9 B;  3B6G A;  3X1T A;  2CV5 D;  3KXB C;  1U35 D;  3REL C;  4AWL B;  3NQU B;  1P3A A;  3AZF D;  5BO0 A;  3WAA D;  3MGR D;  5B1M C;  3AZE D;  5CPI D;  1F66 A;  2ZY3 A;  3AV2 A;  3B6F D;  1TZY D;  2BYM B;  4LD9 D;  4HGA B;  2JCH A;  3AFA D;  4J8U D;  3WKJ B;  2CWE A;  4WNN B;  3X1U C;  4AWL C;  3UTB D;  5B24 B;  3C1B A;  1P3P A;  2ARO C;  5GT0 B;  4H9O A;  3AYW A;  4HGA C;  5AY8 D;  3MGQ B;  1P3I D;  4XZQ D;  5CHL B;  3X1S B;  4QLC B;  4ZBJ C;  2FFF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...