5B40D

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40D00
4J8VB 5JA4B 5B0ZC 3MVDC 4X23B 4JJNC 5B40C 2F8NH 3X1SB 5JRGD 1TZYC 4WZSB 2PYOA 4J8XC 1P3FA 3KXBD 2NQBD 1M19A 1U35C 2HUEC 2F8NA 3UT9A 3B6FB 3V9RA 5F99A 5B0YD 1P3GA 4KUDB 4R8PB 2L5AA 5AY8A 5GXQC 3X1UC 3LZ0A 1P3LC 5BT1D 5AVCA 3UTAA 4WU9C 3MVDA 4H9PA 5CPJC 2PYOD 2CWEA 1P3FD 1KX5B 4Z66B 5B1MB 3WTPE 4H9QB 1TZYA 1M19D 1S32A 3REIB 5AV6B 5AV8A 2F8ND 3NQJB 4NFTA 5F99D 1U35A 1P3GD 1P34B 2CV5C 5AY8D 3LZ0D 2FJ7C 5GXQA 5AVCD 3UTAD 2RVQC 3AV1D 3MVDD 3WKJC 3W96C 1TZYD 2LY8A 4WU8B 3LJAB 1S32D 5AV8D 3UTBA 1U35D 3O62A 1P3KC 4E44A 4J8WA 3MGRA 2IO5C 3WAAB 5GXQD 3MNNB 4ZUXB 3RELA 5CP6A 5B33B 3KUYB 1AOIC 5GSUB 3AZKC 3WKJA 3AZJC 5BO0A 3UTBD 3B0BA 1KX4C 3O62D 4HGAB 5CPKB 4J8WD 1EQZB 3MGRD 4KGCC 1P3KA 3AV2B 2NQBB 5DNNC 3C1CB 3TU4B 3RELD 5CP6D 2BYMA 3AZEC 3AZMC 5B0YB 2JSSA 3KWQC 3WKJD 3AZKA 4CAYA 4KUDC 3MGQC 5GT3C 5B24B 3AZJA 2PYOB 5CPIA 1P3KD 4XUJC 3B0CT 1P3AB 3WTPC 3V9RB 5F99B 5AV5B 4H9RB 4QLCA 3AZEA 5AY8B 3AZMA 5B31C 3AZLB 3KWQA 2NZDB 3X1TB 1ID3C 3LZ1C 3AZJD 3AV1B 3MGQA 3WA9A 5KDMB 2YFVB 5GT3A 3REHB 1P3OC 5CPID 3REKA 3B0CW 5C3IB 3AZHC 1S32B 3W97C 5AV8B 4WU8C 1P3MA 4QLCD 5E5AB 3LJAC 1WWIA 3WTPA 3AZMD 3KWQD 2HIOC 3AZNC 5B31A 1M18A 5AV9C 4LD9B 3MGQD 3B0DC 3WA9D 5FUGA 3REKD 1P3OA 4G92B 3UTBB 3AZHA 1P3MD 1TAFB 3W97A 3REJB 4H9NB 3MGPA 3WTPD 4J8WB 3W99C 3MGRB 4UUZB 5B31D 5BNXA 1M18D 3AZIC 5CPKC 2HIOA 1ZLAC 3AZNA 3RELB 2AROC 5AV9A 4YS3A 1P3OD 3C1BC 3AZHD 5AVBB 3W97D 3MGPD 5B32C 1BH9A 5BNVA 3AZGC 3W99A 2HIOD 3W98C 3AZND 5DNMC 3AZIA 1ZLAA 5AV9D 2AROA 1M1AB 4YS3D 4KHAA 3A6NB 3C1BA 3AZFC 4Z2MH 5B0ZA 4JJNA 5CPIB 5B40A 1P3PC 3W99D 3B6GB 3AFAC 4J8XA 3AZID 3UT9D 1ZLAD 5DNMA 2AROD 4EO5C 4J8UB 1N1JA 4CSRB 5GT0B 3X1UA 1P3LA 1JFIB 3C1BD 4AWLC 3X1VB 5B0ZD 1KX3B 3AZFA 4JJND 4WU9A 3NQUA 4WNNA 4Z5TC 5B40D 3REKB 5CPJA 4ZBJB 4J8XD 1P3PA 4YM6C 1HQ3B 3AFAA 1P3MB 5B31G 5DNMD 1F66B 3LELB 5B1LC 2CV5A 3X1UD 1A7WA 1M18B 2BYKA 1P3LD 3AYWC 2FJ7A 1P3IC 3AZFD 5B2IB 4WV4B 4WU9D 1P3BB 4XZQB 4E45A 5CPJD 3MGSC 1P3PD 3W96A 3AN2C 3AFAD 5B2JC 3MGPB 4J8VC 5JRGB 5G49B 2CV5D 5AVBC 4X23C 3KXBB 3X1SC 1BFMA 2FJ7D 1BH8A 3AYWA 2RVQD 1AOIA 4YS3B 1P3IA 4H9OA 3B6FC 4G91B 3W96D 4R8PC 3MGSA 3AN2A 1KX4A 1P3FB 5JA4A 1M19B 4KGCA 4X23A 2F8NB 1KX5C 3UT9B 3AYWD 5DNNA 4Z66C 3X1SA 5B1MC 1P3GB 1AOID 3LZ0B 1P3ID 3REIC 5AV6C 3AZKD 1P34C 5AVCB 3UTAB 3B6FA 5B32G 3MGSD 4KUDA 3MVDB 4H9PB 4R8PA 3AN2D 1KX4D 3AN2B 4Z2MG 4JJNB 5B40B 4KGCD 1TZYB 1KX3C 4J8XB 4X23D 2F8NK 4XUJA 1ULYA 5DNND 3X1SD 1U35B 2HUEB 3AZED 1KX5A 4Z66A 5B1MA 4H9QA 3X1UB 5GXQB 1P3LB 3REIA 5AV6A 3B6FD 1P34A 4KUDD 3WAAC 4R8PD 1ID3A 5GT3D 4WU9B 3LZ1A 3MNNC 4ZUXC 1H3OA 4WNNB 1Q9CA 3KUYC 5B33C 4XUJD 5GSUC 3O62B 1KX5D 4Z66D 5B1MD 3R45A 4WU8A 4NE5A 3LJAA 3REID 5AV6D 4HGAC 1EQZC 3VH6A 1P34D 2FJ7B 5CP6B 1ID3D 3KXBC 3AV2C 3LZ1D 3C1CC 2NQBC 3TU4C 3WKJB 4ZUXA 5B0YC 5BO0B 5B33A 5GSUA 4WU8D 5B24C 1P3KB 5BS7C 3LJAD 2IO5B 2PYOC 2BYMB 5CPKA 1EQZA 1P3AC 1AOIB 3VH5A 3AV2A 3C1CA 4ZUXD 5F99C 5AV5C 3TU4A 4CAYB 3AZKB 5B33D 5AY8C 3AZLC 3AZJB 1KX4B 5AVCC 3X1TC 2NZDC 3AV1C 5B32A 4KGCB 5B24A 5BS7A 3REHC 3AZGA 5DNNB 5CPKD 1EQZD 3W98A 5C3IC 4QLCB 3AZEB 3AZMB 1S32C 3AV2D 5AV8C 3C1CD 3KWQB 3TU4D 1P3AA 2YFWA 5E5AC 5AV5A 4H9SC 4H9RA 3KSYA 3MGQB 5CHLB 3WA9B 5GT3B 4DRBA 3AZLA 5B32D 4LD9C 2NZDA 3X1TA 5B24D 3AV1A 3AZGD 4XUJB 5KDMA 2YFVA 3W98D 3REHA 3WTPB 4G92C 3UTBC 1P3AD 3O62C 5B31B 3REJC 5AV5D 4J8WC 3MGRC 1ID3B 5E5AA 4H9SA 5FUGB 3LZ1B 3AZLD 1H3OB 3RELC 5CP6C 2NZDD 3X1TD 1P3OB 4Z5TA 4LD9A 3AZHB 3REHD 3W97B 4YM6A 3R45B 5BNXB 5B1LA 2HIOB 3AZNB 1TAFA 3REJA 4H9NA 5E5AD 5AV9B 4UUZA 3B0DB 4Z5TD 4LD9D 1M1AC 3A6NC 1BH9B 4YM6D 5B2JA 5BNVB 3W99B 5B1LD 4J8VA 5AVBA 3REJD 5CPIC 3AZIB 1ZLAB 2AROB 3B6GC 4KHAB 4QLCC 4J8UC 3C1BB 1M1AA 5GT0C 5B0ZB 5B2JD 3A6NA 5B32B 3X1VC 4J8VD 3WA9C 3VH6T 5AVBD 3AZGB 4NE3A 3REKC 3W98B 5DNMB 2F8NG 1R4VA 1KU5A 4ZBJC 1HQ3C 1N1JB 1P3MC 3B6GA 2YFWB 1F1EA 1F66C 3LELC 3NQJA 4J8UA 1M1AD 3A6ND 3AZFB 1M18C 4NE6A 3NQUB 4CSRA 5GT0A 5CPJB 1JFIA 3VH6W 5B2IC 1P3PB 3X1VA 1B6WA 1P3BC 4XZQC 3AFAB 1KX3A 3VH5T 3B6GD 4EO5B 2CV5B 3MGPC 2BYKB 1HQ3A 5JRGC 1F66A 3LELA 4J8UD 4AWLB 5GT0D 3WAAA 1WWSA 3MNNA 4Z5TB 3X1VD 1B67A 3W96B 3KUYA 4YS3C 1KX3D 5B2IA 4G91C 4DRAA 1P3BA 4YM6B 5BT1C 4XZQA 3VH5W 5B1LB 1HTAA 1HQ3D 1F66D 3LELD 1BH8B 1P3FC 3AYWB 5JRGA 1M19C 5G49A 3WAAD 3KXBA 1P3IB 4H9OB 3UT9C 2NQBA 3MNND 1P3GC 3KUYD 4M6BA 3LZ0C 3MGSB 5B2ID 5B0YA 1P3BD 4XZQD 5GSUD 5B2JB 3UTAC
chains in the Genus database with same CATH superfamily
4J8VB 5JA4B 5B0ZC 3MVDC 4X23B 4JJNC 5B40C 2F8NH 3X1SB 5JRGD 1TZYC 4WZSB 2PYOA 4J8XC 1P3FA 3KXBD 2NQBD 1M19A 1U35C 2HUEC 2DQNC 2F8NA 3UT9A 3B6FB 3V9RA 3EG5B 5F99A 2Y2LA 5B0YD 1P3GA 4KUDB 2L5AA 5AY8A 5GXQC 3X1UC 4R8PB 3LZ0A 3H0RC 1P3LC 5BT1D 5AVCA 3UTAA 4WU9C 3EPHA 3MVDA 4H9PA 5CPJC 2PYOD 2CWEA 1P3FD 1KX5B 4Z66B 5B1MB 3WTPE 1TZYA 4H9QB 1M19D 1S32A 3REIB 5AV6B 5AV8A 2F8ND 3NQJB 4NFTA 5F99D 1U35A 1P3GD 1P34B 2CV5C 5AY8D 3LZ0D 2Y2QA 2ZY4A 2FJ7C 5GXQA 5AVCD 3UTAD 2RVQC 3AV1D 3MVDD 1W2EA 3WKJC 3W96C 1TZYD 2LY8A 4WU8B 1Z2CB 3LJAB 1S32D 5AV8D 3UTBA 1U35D 3O62A 1P3KC 4E44A 4J8WA 3MGRA 2IO5C 3WAAB 5GXQD 3MNNB 4ZUXB 3RELA 5CP6A 5B33B 3KUYB 1AOIC 5GSUB 3AZKC 3WKJA 3AZJC 5BO0A 3UTBD 3B0BA 1KX4C 3O62D 3AL0C 4HGAB 5CPKB 4J8WD 1EQZB 3MGRD 4KGCC 1P3KA 3AV2B 2NQBB 5DNNC 3C1CB 3TU4B 3RELD 5CP6D 2BYMA 2Y2JA 3AZEC 3AZMC 5B0YB 2JSSA 3KWQC 2G5HC 3WKJD 3AZKA 4CAYA 4KUDC 3MGQC 2FFFB 5GT3C 5B24B 3AZJA 2PYOB 5CPIA 1P3KD 4XUJC 3B0CT 1P3AB 2XD1A 3V9RB 3WTPC 5AV5B 5F99B 4H9RB 4QLCA 3AZEA 5AY8B 3AZMA 5B31C 3AZLB 3KWQA 2NZDB 3X1TB 1ID3C 3LZ1C 3AZJD 3AV1B 3MGQA 3WA9A 5KDMB 2YFVB 5GT3A 3REHB 1P3OC 5CPID 2Y2IA 3REKA 3B0CW 5C3IB 3KFUG 3AZHC 1S32B 3W97C 5AV8B 4WU8C 1P3MA 4QLCD 5E5AB 3LJAC 1WWIA 3WTPA 3AZMD 3KWQD 2HIOC 3AZNC 5B31A 3FDDA 1M18A 5AV9C 4LD9B 3MGQD 3B0DC 3WA9D 5FUGA 2ZY3A 3REKD 1P3OA 4G92B 3UTBB 3AZHA 1P3MD 1TAFB 3W97A 3REJB 4H9NB 2JCHA 3WTPD 3MGPA 4J8WB 3W99C 3MGRB 2Y2MA 4UUZB 5B31D 5BNXA 1M18D 3AZIC 5CPKC 2HIOA 1ZLAC 3H0MC 3RELB 3AZNA 2AROC 5AV9A 4YS3A 1P3OD 3C1BC 3AZHD 5AVBB 3W97D 3MGPD 5B32C 1BH9A 5BNVA 3AZGC 3W99A 2HIOD 3W98C 3AZND 5DNMC 3AZIA 1ZLAA 5AV9D 2AROA 1M1AB 4YS3D 4KHAA 3A6NB 3C1BA 3AZFC 4Z2MH 5B0ZA 4JJNA 5CPIB 5B40A 1P3PC 3W99D 3B6GB 3AFAC 4J8XA 3AZID 3UT9D 1ZLAD 5DNMA 2AROD 4EO5C 4J8UB 1N1JA 4CSRB 5GT0B 3X1UA 1P3LA 1JFIB 2ZM5A 3C1BD 4AWLC 3X1VB 5B0ZD 1KX3B 3AZFA 4JJND 4WU9A 3NQUA 4WNNA 4Z5TC 5B40D 3REKB 5CPJA 4ZBJB 4J8XD 1P3PA 4YM6C 1HQ3B 2F2AC 3AFAA 5B31G 5DNMD 1P3MB 1F66B 3LELB 5B1LC 2CV5A 3X1UD 1A7WA 1M18B 2BYKA 1P3LD 3AYWC 2FJ7A 1P3IC 3AZFD 5B2IB 4WV4B 4WU9D 1P3BB 4XZQB 4E45A 5CPJD 4WJ3C 3F6TA 3MGSC 1P3PD 3W96A 3AN2C 3AFAD 5B2JC 3MGPB 3UTAC 4J8VC 5JRGB 5G49B 2CV5D 5AVBC 4X23C 3KXBB 3X1SC 1BFMA 2FJ7D 1BH8A 3AYWA 2RVQD 1AOIA 4YS3B 1P3IA 4H9OA 3B6FC 4G91B 2Y2KA 3W96D 4R8PC 3MGSA 2J8PA 3AN2A 1KX4A 1P3FB 5JA4A 1M19B 4KGCA 4X23A 2F8NB 1KX5C 3UT9B 3AYWD 5DNNA 4Z66C 3X1SA 5B1MC 1P3GB 1AOID 3LZ0B 1P3ID 3REIC 5AV6C 2XD5A 3AZKD 1P34C 5AVCB 3UTAB 3B6FA 5B32G 3MGSD 4KUDA 3MVDB 4H9PB 4R8PA 3AN2D 1KX4D 3AN2B 4Z2MG 4JJNB 5B40B 4KGCD 1TZYB 1KX3C 4J8XB 4X23D 2F8NK 1PZRA 4XUJA 1ULYA 5DNND 3X1SD 1U35B 2HUEB 3AZED 1KX5A 4Z66A 5B1MA 2Y2OA 4H9QA 3X1UB 5GXQB 1P3LB 3REIA 5AV6A 3B6FD 2ZY2A 1P34A 4KUDD 3WAAC 4R8PD 1ID3A 5GT3D 4DQYB 4WU9B 3LZ1A 3MNNC 4ZUXC 1H3OA 4WNNB 1Q9CA 3KUYC 5B33C 4XUJD 5GSUC 3O62B 1KX5D 4Z66D 5B1MD 3R45A 4WU8A 4NE5A 3LJAA 3REID 5AV6D 4HGAC 1EQZC 3VH6A 1P34D 2FJ7B 5CP6B 1ID3D 3KXBC 3AV2C 3LZ1D 3C1CC 2NQBC 3TU4C 3WKJB 4ZUXA 5B0YC 5BO0B 5B33A 2DF4C 5GSUA 4WU8D 5B24C 1P3KB 5BS7C 3LJAD 2IO5B 2PYOC 2BYMB 3H0LC 2JE5A 5CPKA 1EQZA 1P3AC 1AOIB 3VH5A 3AV2A 3C1CA 4ZUXD 5AV5C 5F99C 3TU4A 4CAYB 3AZKB 5B33D 5AY8C 3AZLC 3AZJB 1KX4B 5AVCC 3X1TC 2NZDC 3AV1C 5B32A 4KGCB 5B24A 5BS7A 3REHC 3AZGA 5DNNB 5CPKD 1EQZD 3W98A 2Y2NA 5C3IC 4QLCB 3AZEB 3AZMB 1S32C 3AV2D 4UPKA 5AV8C 3C1CD 3KWQB 3TU4D 1P3AA 1T3UA 3IP4C 2YFWA 5E5AC 5AV5A 4H9SC 4H9RA 3KSYA 3MGQB 5CHLB 3WA9B 5GT3B 4DRBA 3AZLA 5B32D 4LD9C 2NZDA 3X1TA 5B24D 3AV1A 3AZGD 4XUJB 3EPJA 5KDMA 2YFVA 3W98D 3REHA 3WTPB 4G92C 3UTBC 1P3AD 3A1IA 3O62C 5B31B 3REJC 5AV5D 4J8WC 3MGRC 1ID3B 5E5AA 4H9SA 5FUGB 3LZ1B 3AZLD 1H3OB 3RELC 5CP6C 2NZDD 3X1TD 1P3OB 4Z5TA 4LD9A 3AZHB 3REHD 3W97B 4YM6A 3R45B 2UWXA 5BNXB 5B1LA 2HIOB 3AZNB 1TAFA 3REJA 4H9NA 5E5AD 5AV9B 2G5IC 4UUZA 3B0DB 4Z5TD 4LD9D 1M1AC 3A6NC 2W8SA 1BH9B 4YM6D 5B2JA 5BNVB 3W99B 5B1LD 4J8VA 5AVBA 3REJD 5CPIC 3AZIB 2Y2PA 1ZLAB 2AROB 3B6GC 4KHAB 4QLCC 2Y2HA 4J8UC 2Y2GA 3C1BB 1M1AA 5GT0C 5B0ZB 5B2JD 3A6NA 5B32B 3X1VC 4J8VD 3WA9C 3VH6T 5AVBD 3AZGB 4NE3A 3REKC 3W98B 5DNMB 2F8NG 1R4VA 1KU5A 4ZBJC 1HQ3C 1N1JB 1P3MC 3B6GA 2YFWB 1F1EA 1F66C 3LELC 3NQJA 4J8UA 1M1AD 3A6ND 3AZFB 1M18C 4NE6A 3NQUB 4CSRA 5GT0A 5CPJB 1JFIA 3VH6W 5B2IC 1P3PB 3X1VA 1B6WA 1P3BC 4XZQC 3AFAB 1KX3A 3VH5T 3B6GD 4EO5B 2CV5B 3MGPC 2BYKB 1HQ3A 3A1KA 5JRGC 1F66A 3LELA 4J8UD 4AWLB 2RIQA 5GT0D 3WAAA 1WWSA 2BG1A 3MNNA 4Z5TB 3X1VD 1B67A 3W96B 3KUYA 4YS3C 1KX3D 5B2IA 4G91C 4DRAA 1P3BA 5BT1C 4XZQA 4YM6B 3VH5W 3EPLA 5B1LB 1HTAA 1HQ3D 1F66D 3LELD 1BH8B 1P3FC 3AYWB 2ZY5A 5JRGA 1M19C 5G49A 3WAAD 3KXBA 1P3IB 4H9OB 3UT9C 2NQBA 3MNND 3EPKA 1P3GC 3KUYD 4M6BA 3LZ0C 3MGSB 5B2ID 5B0YA 1P3BD 4XZQD 5GSUD 5B2JB 3P5JB 2VQRA
chains in the Genus database with same CATH topology
4J8VB 5JA4B 5B0ZC 3MVDC 4X23B 4JJNC 5B40C 2F8NH 3X1SB 5JRGD 1TZYC 4WZSB 2PYOA 4J8XC 1P3FA 3KXBD 2NQBD 1M19A 1U35C 2HUEC 2DQNC 2F8NA 3UT9A 3B6FB 3V9RA 3EG5B 5F99A 2Y2LA 5B0YD 1P3GA 4KUDB 2L5AA 5AY8A 5GXQC 3X1UC 4R8PB 3LZ0A 3H0RC 1P3LC 5BT1D 5AVCA 3UTAA 4WU9C 3EPHA 3MVDA 4H9PA 5CPJC 2PYOD 2CWEA 1P3FD 1KX5B 4Z66B 5B1MB 3WTPE 1TZYA 4H9QB 1M19D 1S32A 3REIB 5AV6B 5AV8A 2F8ND 3NQJB 4NFTA 5F99D 1U35A 1P3GD 1P34B 2CV5C 5AY8D 3LZ0D 2Y2QA 2ZY4A 2FJ7C 5GXQA 5AVCD 3UTAD 2RVQC 3AV1D 3MVDD 1W2EA 3WKJC 3W96C 1TZYD 2LY8A 4WU8B 1Z2CB 3LJAB 1S32D 5AV8D 3UTBA 1U35D 3O62A 1P3KC 4E44A 4J8WA 3MGRA 2IO5C 3WAAB 5GXQD 3MNNB 4ZUXB 3RELA 5CP6A 5B33B 3KUYB 1AOIC 5GSUB 3AZKC 3WKJA 3AZJC 5BO0A 3UTBD 3B0BA 1KX4C 3O62D 3AL0C 4HGAB 5CPKB 4J8WD 1EQZB 3MGRD 4KGCC 1P3KA 3AV2B 2NQBB 5DNNC 3C1CB 3TU4B 3RELD 5CP6D 2BYMA 2Y2JA 3AZEC 3AZMC 5B0YB 2JSSA 3KWQC 2G5HC 3WKJD 3AZKA 4CAYA 4KUDC 3MGQC 2FFFB 5GT3C 5B24B 3AZJA 2PYOB 5CPIA 1P3KD 4XUJC 3B0CT 1P3AB 2XD1A 3V9RB 3WTPC 5AV5B 5F99B 4H9RB 4QLCA 3AZEA 5AY8B 3AZMA 5B31C 3AZLB 3KWQA 2NZDB 3X1TB 1ID3C 3LZ1C 3AZJD 3AV1B 3MGQA 3WA9A 5KDMB 2YFVB 5GT3A 3REHB 1P3OC 5CPID 2Y2IA 3REKA 3B0CW 5C3IB 3KFUG 3AZHC 1S32B 3W97C 5AV8B 4WU8C 1P3MA 4QLCD 5E5AB 3LJAC 1WWIA 3WTPA 3AZMD 3KWQD 2HIOC 3AZNC 5B31A 3FDDA 1M18A 5AV9C 4LD9B 3MGQD 3B0DC 3WA9D 5FUGA 2ZY3A 3REKD 1P3OA 4G92B 3UTBB 3AZHA 1P3MD 1TAFB 3W97A 3REJB 4H9NB 2JCHA 3WTPD 3MGPA 4J8WB 3W99C 3MGRB 2Y2MA 4UUZB 5B31D 5BNXA 1M18D 3AZIC 5CPKC 2HIOA 1ZLAC 3H0MC 3RELB 3AZNA 2AROC 5AV9A 4YS3A 1P3OD 3C1BC 3AZHD 5AVBB 3W97D 3MGPD 5B32C 1BH9A 5BNVA 3AZGC 3W99A 2HIOD 3W98C 3AZND 5DNMC 3AZIA 1ZLAA 5AV9D 2AROA 1M1AB 4YS3D 4KHAA 3A6NB 3C1BA 3AZFC 4Z2MH 5B0ZA 4JJNA 5CPIB 5B40A 1P3PC 3W99D 3B6GB 3AFAC 4J8XA 3AZID 3UT9D 1ZLAD 5DNMA 2AROD 4EO5C 4J8UB 1N1JA 4CSRB 5GT0B 3X1UA 1P3LA 1JFIB 2ZM5A 3C1BD 4AWLC 3X1VB 5B0ZD 1KX3B 3AZFA 4JJND 4WU9A 3NQUA 4WNNA 4Z5TC 5B40D 3REKB 5CPJA 4ZBJB 4J8XD 1P3PA 4YM6C 1HQ3B 2F2AC 3AFAA 5B31G 5DNMD 1P3MB 1F66B 3LELB 5B1LC 2CV5A 3X1UD 1A7WA 1M18B 2BYKA 1P3LD 3AYWC 2FJ7A 1P3IC 3AZFD 5B2IB 4WV4B 4WU9D 1P3BB 4XZQB 4E45A 5CPJD 4WJ3C 3F6TA 3MGSC 1P3PD 3W96A 3AN2C 3AFAD 5B2JC 3MGPB 3UTAC 4J8VC 5JRGB 5G49B 2CV5D 5AVBC 4X23C 3KXBB 3X1SC 1BFMA 2FJ7D 1BH8A 3AYWA 2RVQD 1AOIA 4YS3B 1P3IA 4H9OA 3B6FC 4G91B 2Y2KA 3W96D 4R8PC 3MGSA 2J8PA 3AN2A 1KX4A 1P3FB 5JA4A 1M19B 4KGCA 4X23A 2F8NB 1KX5C 3UT9B 3AYWD 5DNNA 4Z66C 3X1SA 5B1MC 1P3GB 1AOID 3LZ0B 1P3ID 3REIC 5AV6C 2XD5A 3AZKD 1P34C 5AVCB 3UTAB 3B6FA 5B32G 3MGSD 4KUDA 3MVDB 4H9PB 4R8PA 3AN2D 1KX4D 3AN2B 4Z2MG 4JJNB 5B40B 4KGCD 1TZYB 1KX3C 4J8XB 4X23D 2F8NK 1PZRA 4XUJA 1ULYA 5DNND 3X1SD 1U35B 2HUEB 3AZED 1KX5A 4Z66A 5B1MA 2Y2OA 4H9QA 3X1UB 5GXQB 1P3LB 3REIA 5AV6A 3B6FD 2ZY2A 1P34A 4KUDD 3WAAC 4R8PD 1ID3A 5GT3D 4DQYB 4WU9B 3LZ1A 3MNNC 4ZUXC 1H3OA 4WNNB 1Q9CA 3KUYC 5B33C 4XUJD 5GSUC 3O62B 1KX5D 4Z66D 5B1MD 3R45A 4WU8A 4NE5A 3LJAA 3REID 5AV6D 4HGAC 1EQZC 3VH6A 1P34D 2FJ7B 5CP6B 1ID3D 3KXBC 3AV2C 3LZ1D 3C1CC 2NQBC 3TU4C 3WKJB 4ZUXA 5B0YC 5BO0B 5B33A 2DF4C 5GSUA 4WU8D 5B24C 1P3KB 5BS7C 3LJAD 2IO5B 2PYOC 2BYMB 3H0LC 2JE5A 5CPKA 1EQZA 1P3AC 1AOIB 3VH5A 3AV2A 3C1CA 4ZUXD 5AV5C 5F99C 3TU4A 4CAYB 3AZKB 5B33D 5AY8C 3AZLC 3AZJB 1KX4B 5AVCC 3X1TC 2NZDC 3AV1C 5B32A 4KGCB 5B24A 5BS7A 3REHC 3AZGA 5DNNB 5CPKD 1EQZD 3W98A 2Y2NA 5C3IC 4QLCB 3AZEB 3AZMB 1S32C 3AV2D 4UPKA 5AV8C 3C1CD 3KWQB 3TU4D 1P3AA 1T3UA 3IP4C 2YFWA 5E5AC 5AV5A 4H9SC 4H9RA 3KSYA 3MGQB 5CHLB 3WA9B 5GT3B 4DRBA 3AZLA 5B32D 4LD9C 2NZDA 3X1TA 5B24D 3AV1A 3AZGD 4XUJB 3EPJA 5KDMA 2YFVA 3W98D 3REHA 3WTPB 4G92C 3UTBC 1P3AD 3A1IA 3O62C 5B31B 3REJC 5AV5D 4J8WC 3MGRC 1ID3B 5E5AA 4H9SA 5FUGB 3LZ1B 3AZLD 1H3OB 3RELC 5CP6C 2NZDD 3X1TD 1P3OB 4Z5TA 4LD9A 3AZHB 3REHD 3W97B 4YM6A 3R45B 2UWXA 5BNXB 5B1LA 2HIOB 3AZNB 1TAFA 3REJA 4H9NA 5E5AD 5AV9B 2G5IC 4UUZA 3B0DB 4Z5TD 4LD9D 1M1AC 3A6NC 2W8SA 1BH9B 4YM6D 5B2JA 5BNVB 3W99B 5B1LD 4J8VA 5AVBA 3REJD 5CPIC 3AZIB 2Y2PA 1ZLAB 2AROB 3B6GC 4KHAB 4QLCC 2Y2HA 4J8UC 2Y2GA 3C1BB 1M1AA 5GT0C 5B0ZB 5B2JD 3A6NA 5B32B 3X1VC 4J8VD 3WA9C 3VH6T 5AVBD 3AZGB 4NE3A 3REKC 3W98B 5DNMB 2F8NG 1R4VA 1KU5A 4ZBJC 1HQ3C 1N1JB 1P3MC 3B6GA 2YFWB 1F1EA 1F66C 3LELC 3NQJA 4J8UA 1M1AD 3A6ND 3AZFB 1M18C 4NE6A 3NQUB 4CSRA 5GT0A 5CPJB 1JFIA 3VH6W 5B2IC 1P3PB 3X1VA 1B6WA 1P3BC 4XZQC 3AFAB 1KX3A 3VH5T 3B6GD 4EO5B 2CV5B 3MGPC 2BYKB 1HQ3A 3A1KA 5JRGC 1F66A 3LELA 4J8UD 4AWLB 2RIQA 5GT0D 3WAAA 1WWSA 2BG1A 3MNNA 4Z5TB 3X1VD 1B67A 3W96B 3KUYA 4YS3C 1KX3D 5B2IA 4G91C 4DRAA 1P3BA 5BT1C 4XZQA 4YM6B 3VH5W 3EPLA 5B1LB 1HTAA 1HQ3D 1F66D 3LELD 1BH8B 1P3FC 3AYWB 2ZY5A 5JRGA 1M19C 5G49A 3WAAD 3KXBA 1P3IB 4H9OB 3UT9C 2NQBA 3MNND 3EPKA 1P3GC 3KUYD 4M6BA 3LZ0C 3MGSB 5B2ID 5B0YA 1P3BD 4XZQD 5GSUD 5B2JB 3P5JB 2VQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  5JA4 B;  5B0Z C;  3MVD C;  4X23 B;  4JJN C;  5B40 C;  2F8N H;  3X1S B;  5JRG D;  1TZY C;  4WZS B;  2PYO A;  4J8X C;  1P3F A;  3KXB D;  2NQB D;  1M19 A;  1U35 C;  2HUE C;  2F8N A;  3UT9 A;  3B6F B;  3V9R A;  5F99 A;  5B0Y D;  1P3G A;  4KUD B;  4R8P B;  2L5A A;  5AY8 A;  5GXQ C;  3X1U C;  3LZ0 A;  1P3L C;  5BT1 D;  5AVC A;  3UTA A;  4WU9 C;  3MVD A;  4H9P A;  5CPJ C;  2PYO D;  2CWE A;  1P3F D;  1KX5 B;  4Z66 B;  5B1M B;  3WTP E;  4H9Q B;  1TZY A;  1M19 D;  1S32 A;  3REI B;  5AV6 B;  5AV8 A;  2F8N D;  3NQJ B;  4NFT A;  5F99 D;  1U35 A;  1P3G D;  1P34 B;  2CV5 C;  5AY8 D;  3LZ0 D;  2FJ7 C;  5GXQ A;  5AVC D;  3UTA D;  2RVQ C;  3AV1 D;  3MVD D;  3WKJ C;  3W96 C;  1TZY D;  2LY8 A;  4WU8 B;  3LJA B;  1S32 D;  5AV8 D;  3UTB A;  1U35 D;  3O62 A;  1P3K C;  4E44 A;  4J8W A;  3MGR A;  2IO5 C;  3WAA B;  5GXQ D;  3MNN B;  4ZUX B;  3REL A;  5CP6 A;  5B33 B;  3KUY B;  1AOI C;  5GSU B;  3AZK C;  3WKJ A;  3AZJ C;  5BO0 A;  3UTB D;  3B0B A;  1KX4 C;  3O62 D;  4HGA B;  5CPK B;  4J8W D;  1EQZ B;  3MGR D;  4KGC C;  1P3K A;  3AV2 B;  2NQB B;  5DNN C;  3C1C B;  3TU4 B;  3REL D;  5CP6 D;  2BYM A;  3AZE C;  3AZM C;  5B0Y B;  2JSS A;  3KWQ C;  3WKJ D;  3AZK A;  4CAY A;  4KUD C;  3MGQ C;  5GT3 C;  5B24 B;  3AZJ A;  2PYO B;  5CPI A;  1P3K D;  4XUJ C;  3B0C T;  1P3A B;  3WTP C;  3V9R B;  5F99 B;  5AV5 B;  4H9R B;  4QLC A;  3AZE A;  5AY8 B;  3AZM A;  5B31 C;  3AZL B;  3KWQ A;  2NZD B;  3X1T B;  1ID3 C;  3LZ1 C;  3AZJ D;  3AV1 B;  3MGQ A;  3WA9 A;  5KDM B;  2YFV B;  5GT3 A;  3REH B;  1P3O C;  5CPI D;  3REK A;  3B0C W;  5C3I B;  3AZH C;  1S32 B;  3W97 C;  5AV8 B;  4WU8 C;  1P3M A;  4QLC D;  5E5A B;  3LJA C;  1WWI A;  3WTP A;  3AZM D;  3KWQ D;  2HIO C;  3AZN C;  5B31 A;  1M18 A;  5AV9 C;  4LD9 B;  3MGQ D;  3B0D C;  3WA9 D;  5FUG A;  3REK D;  1P3O A;  4G92 B;  3UTB B;  3AZH A;  1P3M D;  1TAF B;  3W97 A;  3REJ B;  4H9N B;  3MGP A;  3WTP D;  4J8W B;  3W99 C;  3MGR B;  4UUZ B;  5B31 D;  5BNX A;  1M18 D;  3AZI C;  5CPK C;  2HIO A;  1ZLA C;  3AZN A;  3REL B;  2ARO C;  5AV9 A;  4YS3 A;  1P3O D;  3C1B C;  3AZH D;  5AVB B;  3W97 D;  3MGP D;  5B32 C;  1BH9 A;  5BNV A;  3AZG C;  3W99 A;  2HIO D;  3W98 C;  3AZN D;  5DNM C;  3AZI A;  1ZLA A;  5AV9 D;  2ARO A;  1M1A B;  4YS3 D;  4KHA A;  3A6N B;  3C1B A;  3AZF C;  4Z2M H;  5B0Z A;  4JJN A;  5CPI B;  5B40 A;  1P3P C;  3W99 D;  3B6G B;  3AFA C;  4J8X A;  3AZI D;  3UT9 D;  1ZLA D;  5DNM A;  2ARO D;  4EO5 C;  4J8U B;  1N1J A;  4CSR B;  5GT0 B;  3X1U A;  1P3L A;  1JFI B;  3C1B D;  4AWL C;  3X1V B;  5B0Z D;  1KX3 B;  3AZF A;  4JJN D;  4WU9 A;  3NQU A;  4WNN A;  4Z5T C;  5B40 D;  3REK B;  5CPJ A;  4ZBJ B;  4J8X D;  1P3P A;  4YM6 C;  1HQ3 B;  3AFA A;  1P3M B;  5B31 G;  5DNM D;  1F66 B;  3LEL B;  5B1L C;  2CV5 A;  3X1U D;  1A7W A;  1M18 B;  2BYK A;  1P3L D;  3AYW C;  2FJ7 A;  1P3I C;  3AZF D;  5B2I B;  4WV4 B;  4WU9 D;  1P3B B;  4XZQ B;  4E45 A;  5CPJ D;  3MGS C;  1P3P D;  3W96 A;  3AN2 C;  3AFA D;  5B2J C;  3MGP B;  4J8V C;  5JRG B;  5G49 B;  2CV5 D;  5AVB C;  4X23 C;  3KXB B;  3X1S C;  1BFM A;  2FJ7 D;  1BH8 A;  3AYW A;  2RVQ D;  1AOI A;  4YS3 B;  1P3I A;  4H9O A;  3B6F C;  4G91 B;  3W96 D;  4R8P C;  3MGS A;  3AN2 A;  1KX4 A;  1P3F B;  5JA4 A;  1M19 B;  4KGC A;  4X23 A;  2F8N B;  1KX5 C;  3UT9 B;  3AYW D;  5DNN A;  4Z66 C;  3X1S A;  5B1M C;  1P3G B;  1AOI D;  3LZ0 B;  1P3I D;  3REI C;  5AV6 C;  3AZK D;  1P34 C;  5AVC B;  3UTA B;  3B6F A;  5B32 G;  3MGS D;  4KUD A;  3MVD B;  4H9P B;  4R8P A;  3AN2 D;  1KX4 D;  3AN2 B;  4Z2M G;  4JJN B;  5B40 B;  4KGC D;  1TZY B;  1KX3 C;  4J8X B;  4X23 D;  2F8N K;  4XUJ A;  1ULY A;  5DNN D;  3X1S D;  1U35 B;  2HUE B;  3AZE D;  1KX5 A;  4Z66 A;  5B1M A;  4H9Q A;  3X1U B;  5GXQ B;  1P3L B;  3REI A;  5AV6 A;  3B6F D;  1P34 A;  4KUD D;  3WAA C;  4R8P D;  1ID3 A;  5GT3 D;  4WU9 B;  3LZ1 A;  3MNN C;  4ZUX C;  1H3O A;  4WNN B;  1Q9C A;  3KUY C;  5B33 C;  4XUJ D;  5GSU C;  3O62 B;  1KX5 D;  4Z66 D;  5B1M D;  3R45 A;  4WU8 A;  4NE5 A;  3LJA A;  3REI D;  5AV6 D;  4HGA C;  1EQZ C;  3VH6 A;  1P34 D;  2FJ7 B;  5CP6 B;  1ID3 D;  3KXB C;  3AV2 C;  3LZ1 D;  3C1C C;  2NQB C;  3TU4 C;  3WKJ B;  4ZUX A;  5B0Y C;  5BO0 B;  5B33 A;  5GSU A;  4WU8 D;  5B24 C;  1P3K B;  5BS7 C;  3LJA D;  2IO5 B;  2PYO C;  2BYM B;  5CPK A;  1EQZ A;  1P3A C;  1AOI B;  3VH5 A;  3AV2 A;  3C1C A;  4ZUX D;  5F99 C;  5AV5 C;  3TU4 A;  4CAY B;  3AZK B;  5B33 D;  5AY8 C;  3AZL C;  3AZJ B;  1KX4 B;  5AVC C;  3X1T C;  2NZD C;  3AV1 C;  5B32 A;  4KGC B;  5B24 A;  5BS7 A;  3REH C;  3AZG A;  5DNN B;  5CPK D;  1EQZ D;  3W98 A;  5C3I C;  4QLC B;  3AZE B;  3AZM B;  1S32 C;  3AV2 D;  5AV8 C;  3C1C D;  3KWQ B;  3TU4 D;  1P3A A;  2YFW A;  5E5A C;  5AV5 A;  4H9S C;  4H9R A;  3KSY A;  3MGQ B;  5CHL B;  3WA9 B;  5GT3 B;  4DRB A;  3AZL A;  5B32 D;  4LD9 C;  2NZD A;  3X1T A;  5B24 D;  3AV1 A;  3AZG D;  4XUJ B;  5KDM A;  2YFV A;  3W98 D;  3REH A;  3WTP B;  4G92 C;  3UTB C;  1P3A D;  3O62 C;  5B31 B;  3REJ C;  5AV5 D;  4J8W C;  3MGR C;  1ID3 B;  5E5A A;  4H9S A;  5FUG B;  3LZ1 B;  3AZL D;  1H3O B;  3REL C;  5CP6 C;  2NZD D;  3X1T D;  1P3O B;  4Z5T A;  4LD9 A;  3AZH B;  3REH D;  3W97 B;  4YM6 A;  3R45 B;  5BNX B;  5B1L A;  2HIO B;  3AZN B;  1TAF A;  3REJ A;  4H9N A;  5E5A D;  5AV9 B;  4UUZ A;  3B0D B;  4Z5T D;  4LD9 D;  1M1A C;  3A6N C;  1BH9 B;  4YM6 D;  5B2J A;  5BNV B;  3W99 B;  5B1L D;  4J8V A;  5AVB A;  3REJ D;  5CPI C;  3AZI B;  1ZLA B;  2ARO B;  3B6G C;  4KHA B;  4QLC C;  4J8U C;  3C1B B;  1M1A A;  5GT0 C;  5B0Z B;  5B2J D;  3A6N A;  5B32 B;  3X1V C;  4J8V D;  3WA9 C;  3VH6 T;  5AVB D;  3AZG B;  4NE3 A;  3REK C;  3W98 B;  5DNM B;  2F8N G;  1R4V A;  1KU5 A;  4ZBJ C;  1HQ3 C;  1N1J B;  1P3M C;  3B6G A;  2YFW B;  1F1E A;  1F66 C;  3LEL C;  3NQJ A;  4J8U A;  1M1A D;  3A6N D;  3AZF B;  1M18 C;  4NE6 A;  3NQU B;  4CSR A;  5GT0 A;  5CPJ B;  1JFI A;  3VH6 W;  5B2I C;  1P3P B;  3X1V A;  1B6W A;  1P3B C;  4XZQ C;  3AFA B;  1KX3 A;  3VH5 T;  3B6G D;  4EO5 B;  2CV5 B;  3MGP C;  2BYK B;  1HQ3 A;  5JRG C;  1F66 A;  3LEL A;  4J8U D;  4AWL B;  5GT0 D;  3WAA A;  1WWS A;  3MNN A;  4Z5T B;  3X1V D;  1B67 A;  3W96 B;  3KUY A;  4YS3 C;  1KX3 D;  5B2I A;  4G91 C;  4DRA A;  1P3B A;  4YM6 B;  5BT1 C;  4XZQ A;  3VH5 W;  5B1L B;  1HTA A;  1HQ3 D;  1F66 D;  3LEL D;  1BH8 B;  1P3F C;  3AYW B;  5JRG A;  1M19 C;  5G49 A;  3WAA D;  3KXB A;  1P3I B;  4H9O B;  3UT9 C;  2NQB A;  3MNN D;  1P3G C;  3KUY D;  4M6B A;  3LZ0 C;  3MGS B;  5B2I D;  5B0Y A;  1P3B D;  4XZQ D;  5GSU D;  5B2J B;  3UTA C; 
#chains in the Genus database with same CATH topology
 4J8V B;  5JA4 B;  5B0Z C;  3MVD C;  4X23 B;  4JJN C;  5B40 C;  2F8N H;  3X1S B;  5JRG D;  1TZY C;  4WZS B;  2PYO A;  4J8X C;  1P3F A;  3KXB D;  2NQB D;  1M19 A;  1U35 C;  2HUE C;  2DQN C;  2F8N A;  3UT9 A;  3B6F B;  3V9R A;  3EG5 B;  5F99 A;  2Y2L A;  5B0Y D;  1P3G A;  4KUD B;  2L5A A;  5AY8 A;  5GXQ C;  3X1U C;  4R8P B;  3LZ0 A;  3H0R C;  1P3L C;  5BT1 D;  5AVC A;  3UTA A;  4WU9 C;  3EPH A;  3MVD A;  4H9P A;  5CPJ C;  2PYO D;  2CWE A;  1P3F D;  1KX5 B;  4Z66 B;  5B1M B;  3WTP E;  1TZY A;  4H9Q B;  1M19 D;  1S32 A;  3REI B;  5AV6 B;  5AV8 A;  2F8N D;  3NQJ B;  4NFT A;  5F99 D;  1U35 A;  1P3G D;  1P34 B;  2CV5 C;  5AY8 D;  3LZ0 D;  2Y2Q A;  2ZY4 A;  2FJ7 C;  5GXQ A;  5AVC D;  3UTA D;  2RVQ C;  3AV1 D;  3MVD D;  1W2E A;  3WKJ C;  3W96 C;  1TZY D;  2LY8 A;  4WU8 B;  1Z2C B;  3LJA B;  1S32 D;  5AV8 D;  3UTB A;  1U35 D;  3O62 A;  1P3K C;  4E44 A;  4J8W A;  3MGR A;  2IO5 C;  3WAA B;  5GXQ D;  3MNN B;  4ZUX B;  3REL A;  5CP6 A;  5B33 B;  3KUY B;  1AOI C;  5GSU B;  3AZK C;  3WKJ A;  3AZJ C;  5BO0 A;  3UTB D;  3B0B A;  1KX4 C;  3O62 D;  3AL0 C;  4HGA B;  5CPK B;  4J8W D;  1EQZ B;  3MGR D;  4KGC C;  1P3K A;  3AV2 B;  2NQB B;  5DNN C;  3C1C B;  3TU4 B;  3REL D;  5CP6 D;  2BYM A;  2Y2J A;  3AZE C;  3AZM C;  5B0Y B;  2JSS A;  3KWQ C;  2G5H C;  3WKJ D;  3AZK A;  4CAY A;  4KUD C;  3MGQ C;  2FFF B;  5GT3 C;  5B24 B;  3AZJ A;  2PYO B;  5CPI A;  1P3K D;  4XUJ C;  3B0C T;  1P3A B;  2XD1 A;  3V9R B;  3WTP C;  5AV5 B;  5F99 B;  4H9R B;  4QLC A;  3AZE A;  5AY8 B;  3AZM A;  5B31 C;  3AZL B;  3KWQ A;  2NZD B;  3X1T B;  1ID3 C;  3LZ1 C;  3AZJ D;  3AV1 B;  3MGQ A;  3WA9 A;  5KDM B;  2YFV B;  5GT3 A;  3REH B;  1P3O C;  5CPI D;  2Y2I A;  3REK A;  3B0C W;  5C3I B;  3KFU G;  3AZH C;  1S32 B;  3W97 C;  5AV8 B;  4WU8 C;  1P3M A;  4QLC D;  5E5A B;  3LJA C;  1WWI A;  3WTP A;  3AZM D;  3KWQ D;  2HIO C;  3AZN C;  5B31 A;  3FDD A;  1M18 A;  5AV9 C;  4LD9 B;  3MGQ D;  3B0D C;  3WA9 D;  5FUG A;  2ZY3 A;  3REK D;  1P3O A;  4G92 B;  3UTB B;  3AZH A;  1P3M D;  1TAF B;  3W97 A;  3REJ B;  4H9N B;  2JCH A;  3WTP D;  3MGP A;  4J8W B;  3W99 C;  3MGR B;  2Y2M A;  4UUZ B;  5B31 D;  5BNX A;  1M18 D;  3AZI C;  5CPK C;  2HIO A;  1ZLA C;  3H0M C;  3REL B;  3AZN A;  2ARO C;  5AV9 A;  4YS3 A;  1P3O D;  3C1B C;  3AZH D;  5AVB B;  3W97 D;  3MGP D;  5B32 C;  1BH9 A;  5BNV A;  3AZG C;  3W99 A;  2HIO D;  3W98 C;  3AZN D;  5DNM C;  3AZI A;  1ZLA A;  5AV9 D;  2ARO A;  1M1A B;  4YS3 D;  4KHA A;  3A6N B;  3C1B A;  3AZF C;  4Z2M H;  5B0Z A;  4JJN A;  5CPI B;  5B40 A;  1P3P C;  3W99 D;  3B6G B;  3AFA C;  4J8X A;  3AZI D;  3UT9 D;  1ZLA D;  5DNM A;  2ARO D;  4EO5 C;  4J8U B;  1N1J A;  4CSR B;  5GT0 B;  3X1U A;  1P3L A;  1JFI B;  2ZM5 A;  3C1B D;  4AWL C;  3X1V B;  5B0Z D;  1KX3 B;  3AZF A;  4JJN D;  4WU9 A;  3NQU A;  4WNN A;  4Z5T C;  5B40 D;  3REK B;  5CPJ A;  4ZBJ B;  4J8X D;  1P3P A;  4YM6 C;  1HQ3 B;  2F2A C;  3AFA A;  5B31 G;  5DNM D;  1P3M B;  1F66 B;  3LEL B;  5B1L C;  2CV5 A;  3X1U D;  1A7W A;  1M18 B;  2BYK A;  1P3L D;  3AYW C;  2FJ7 A;  1P3I C;  3AZF D;  5B2I B;  4WV4 B;  4WU9 D;  1P3B B;  4XZQ B;  4E45 A;  5CPJ D;  4WJ3 C;  3F6T A;  3MGS C;  1P3P D;  3W96 A;  3AN2 C;  3AFA D;  5B2J C;  3MGP B;  3UTA C;  4J8V C;  5JRG B;  5G49 B;  2CV5 D;  5AVB C;  4X23 C;  3KXB B;  3X1S C;  1BFM A;  2FJ7 D;  1BH8 A;  3AYW A;  2RVQ D;  1AOI A;  4YS3 B;  1P3I A;  4H9O A;  3B6F C;  4G91 B;  2Y2K A;  3W96 D;  4R8P C;  3MGS A;  2J8P A;  3AN2 A;  1KX4 A;  1P3F B;  5JA4 A;  1M19 B;  4KGC A;  4X23 A;  2F8N B;  1KX5 C;  3UT9 B;  3AYW D;  5DNN A;  4Z66 C;  3X1S A;  5B1M C;  1P3G B;  1AOI D;  3LZ0 B;  1P3I D;  3REI C;  5AV6 C;  2XD5 A;  3AZK D;  1P34 C;  5AVC B;  3UTA B;  3B6F A;  5B32 G;  3MGS D;  4KUD A;  3MVD B;  4H9P B;  4R8P A;  3AN2 D;  1KX4 D;  3AN2 B;  4Z2M G;  4JJN B;  5B40 B;  4KGC D;  1TZY B;  1KX3 C;  4J8X B;  4X23 D;  2F8N K;  1PZR A;  4XUJ A;  1ULY A;  5DNN D;  3X1S D;  1U35 B;  2HUE B;  3AZE D;  1KX5 A;  4Z66 A;  5B1M A;  2Y2O A;  4H9Q A;  3X1U B;  5GXQ B;  1P3L B;  3REI A;  5AV6 A;  3B6F D;  2ZY2 A;  1P34 A;  4KUD D;  3WAA C;  4R8P D;  1ID3 A;  5GT3 D;  4DQY B;  4WU9 B;  3LZ1 A;  3MNN C;  4ZUX C;  1H3O A;  4WNN B;  1Q9C A;  3KUY C;  5B33 C;  4XUJ D;  5GSU C;  3O62 B;  1KX5 D;  4Z66 D;  5B1M D;  3R45 A;  4WU8 A;  4NE5 A;  3LJA A;  3REI D;  5AV6 D;  4HGA C;  1EQZ C;  3VH6 A;  1P34 D;  2FJ7 B;  5CP6 B;  1ID3 D;  3KXB C;  3AV2 C;  3LZ1 D;  3C1C C;  2NQB C;  3TU4 C;  3WKJ B;  4ZUX A;  5B0Y C;  5BO0 B;  5B33 A;  2DF4 C;  5GSU A;  4WU8 D;  5B24 C;  1P3K B;  5BS7 C;  3LJA D;  2IO5 B;  2PYO C;  2BYM B;  3H0L C;  2JE5 A;  5CPK A;  1EQZ A;  1P3A C;  1AOI B;  3VH5 A;  3AV2 A;  3C1C A;  4ZUX D;  5AV5 C;  5F99 C;  3TU4 A;  4CAY B;  3AZK B;  5B33 D;  5AY8 C;  3AZL C;  3AZJ B;  1KX4 B;  5AVC C;  3X1T C;  2NZD C;  3AV1 C;  5B32 A;  4KGC B;  5B24 A;  5BS7 A;  3REH C;  3AZG A;  5DNN B;  5CPK D;  1EQZ D;  3W98 A;  2Y2N A;  5C3I C;  4QLC B;  3AZE B;  3AZM B;  1S32 C;  3AV2 D;  4UPK A;  5AV8 C;  3C1C D;  3KWQ B;  3TU4 D;  1P3A A;  1T3U A;  3IP4 C;  2YFW A;  5E5A C;  5AV5 A;  4H9S C;  4H9R A;  3KSY A;  3MGQ B;  5CHL B;  3WA9 B;  5GT3 B;  4DRB A;  3AZL A;  5B32 D;  4LD9 C;  2NZD A;  3X1T A;  5B24 D;  3AV1 A;  3AZG D;  4XUJ B;  3EPJ A;  5KDM A;  2YFV A;  3W98 D;  3REH A;  3WTP B;  4G92 C;  3UTB C;  1P3A D;  3A1I A;  3O62 C;  5B31 B;  3REJ C;  5AV5 D;  4J8W C;  3MGR C;  1ID3 B;  5E5A A;  4H9S A;  5FUG B;  3LZ1 B;  3AZL D;  1H3O B;  3REL C;  5CP6 C;  2NZD D;  3X1T D;  1P3O B;  4Z5T A;  4LD9 A;  3AZH B;  3REH D;  3W97 B;  4YM6 A;  3R45 B;  2UWX A;  5BNX B;  5B1L A;  2HIO B;  3AZN B;  1TAF A;  3REJ A;  4H9N A;  5E5A D;  5AV9 B;  2G5I C;  4UUZ A;  3B0D B;  4Z5T D;  4LD9 D;  1M1A C;  3A6N C;  2W8S A;  1BH9 B;  4YM6 D;  5B2J A;  5BNV B;  3W99 B;  5B1L D;  4J8V A;  5AVB A;  3REJ D;  5CPI C;  3AZI B;  2Y2P A;  1ZLA B;  2ARO B;  3B6G C;  4KHA B;  4QLC C;  2Y2H A;  4J8U C;  2Y2G A;  3C1B B;  1M1A A;  5GT0 C;  5B0Z B;  5B2J D;  3A6N A;  5B32 B;  3X1V C;  4J8V D;  3WA9 C;  3VH6 T;  5AVB D;  3AZG B;  4NE3 A;  3REK C;  3W98 B;  5DNM B;  2F8N G;  1R4V A;  1KU5 A;  4ZBJ C;  1HQ3 C;  1N1J B;  1P3M C;  3B6G A;  2YFW B;  1F1E A;  1F66 C;  3LEL C;  3NQJ A;  4J8U A;  1M1A D;  3A6N D;  3AZF B;  1M18 C;  4NE6 A;  3NQU B;  4CSR A;  5GT0 A;  5CPJ B;  1JFI A;  3VH6 W;  5B2I C;  1P3P B;  3X1V A;  1B6W A;  1P3B C;  4XZQ C;  3AFA B;  1KX3 A;  3VH5 T;  3B6G D;  4EO5 B;  2CV5 B;  3MGP C;  2BYK B;  1HQ3 A;  3A1K A;  5JRG C;  1F66 A;  3LEL A;  4J8U D;  4AWL B;  2RIQ A;  5GT0 D;  3WAA A;  1WWS A;  2BG1 A;  3MNN A;  4Z5T B;  3X1V D;  1B67 A;  3W96 B;  3KUY A;  4YS3 C;  1KX3 D;  5B2I A;  4G91 C;  4DRA A;  1P3B A;  5BT1 C;  4XZQ A;  4YM6 B;  3VH5 W;  3EPL A;  5B1L B;  1HTA A;  1HQ3 D;  1F66 D;  3LEL D;  1BH8 B;  1P3F C;  3AYW B;  2ZY5 A;  5JRG A;  1M19 C;  5G49 A;  3WAA D;  3KXB A;  1P3I B;  4H9O B;  3UT9 C;  2NQB A;  3MNN D;  3EPK A;  1P3G C;  3KUY D;  4M6B A;  3LZ0 C;  3MGS B;  5B2I D;  5B0Y A;  1P3B D;  4XZQ D;  5GSU D;  5B2J B;  3P5J B;  2VQR A; 
#chains in the Genus database with same CATH homology
 4J8V B;  5JA4 B;  5B0Z C;  3MVD C;  4X23 B;  4JJN C;  5B40 C;  2F8N H;  3X1S B;  5JRG D;  1TZY C;  4WZS B;  2PYO A;  4J8X C;  1P3F A;  3KXB D;  2NQB D;  1M19 A;  1U35 C;  2HUE C;  2DQN C;  2F8N A;  3UT9 A;  3B6F B;  3V9R A;  3EG5 B;  5F99 A;  2Y2L A;  5B0Y D;  1P3G A;  4KUD B;  2L5A A;  5AY8 A;  5GXQ C;  3X1U C;  4R8P B;  3LZ0 A;  3H0R C;  1P3L C;  5BT1 D;  5AVC A;  3UTA A;  4WU9 C;  3EPH A;  3MVD A;  4H9P A;  5CPJ C;  2PYO D;  2CWE A;  1P3F D;  1KX5 B;  4Z66 B;  5B1M B;  3WTP E;  1TZY A;  4H9Q B;  1M19 D;  1S32 A;  3REI B;  5AV6 B;  5AV8 A;  2F8N D;  3NQJ B;  4NFT A;  5F99 D;  1U35 A;  1P3G D;  1P34 B;  2CV5 C;  5AY8 D;  3LZ0 D;  2Y2Q A;  2ZY4 A;  2FJ7 C;  5GXQ A;  5AVC D;  3UTA D;  2RVQ C;  3AV1 D;  3MVD D;  1W2E A;  3WKJ C;  3W96 C;  1TZY D;  2LY8 A;  4WU8 B;  1Z2C B;  3LJA B;  1S32 D;  5AV8 D;  3UTB A;  1U35 D;  3O62 A;  1P3K C;  4E44 A;  4J8W A;  3MGR A;  2IO5 C;  3WAA B;  5GXQ D;  3MNN B;  4ZUX B;  3REL A;  5CP6 A;  5B33 B;  3KUY B;  1AOI C;  5GSU B;  3AZK C;  3WKJ A;  3AZJ C;  5BO0 A;  3UTB D;  3B0B A;  1KX4 C;  3O62 D;  3AL0 C;  4HGA B;  5CPK B;  4J8W D;  1EQZ B;  3MGR D;  4KGC C;  1P3K A;  3AV2 B;  2NQB B;  5DNN C;  3C1C B;  3TU4 B;  3REL D;  5CP6 D;  2BYM A;  2Y2J A;  3AZE C;  3AZM C;  5B0Y B;  2JSS A;  3KWQ C;  2G5H C;  3WKJ D;  3AZK A;  4CAY A;  4KUD C;  3MGQ C;  2FFF B;  5GT3 C;  5B24 B;  3AZJ A;  2PYO B;  5CPI A;  1P3K D;  4XUJ C;  3B0C T;  1P3A B;  2XD1 A;  3V9R B;  3WTP C;  5AV5 B;  5F99 B;  4H9R B;  4QLC A;  3AZE A;  5AY8 B;  3AZM A;  5B31 C;  3AZL B;  3KWQ A;  2NZD B;  3X1T B;  1ID3 C;  3LZ1 C;  3AZJ D;  3AV1 B;  3MGQ A;  3WA9 A;  5KDM B;  2YFV B;  5GT3 A;  3REH B;  1P3O C;  5CPI D;  2Y2I A;  3REK A;  3B0C W;  5C3I B;  3KFU G;  3AZH C;  1S32 B;  3W97 C;  5AV8 B;  4WU8 C;  1P3M A;  4QLC D;  5E5A B;  3LJA C;  1WWI A;  3WTP A;  3AZM D;  3KWQ D;  2HIO C;  3AZN C;  5B31 A;  3FDD A;  1M18 A;  5AV9 C;  4LD9 B;  3MGQ D;  3B0D C;  3WA9 D;  5FUG A;  2ZY3 A;  3REK D;  1P3O A;  4G92 B;  3UTB B;  3AZH A;  1P3M D;  1TAF B;  3W97 A;  3REJ B;  4H9N B;  2JCH A;  3WTP D;  3MGP A;  4J8W B;  3W99 C;  3MGR B;  2Y2M A;  4UUZ B;  5B31 D;  5BNX A;  1M18 D;  3AZI C;  5CPK C;  2HIO A;  1ZLA C;  3H0M C;  3REL B;  3AZN A;  2ARO C;  5AV9 A;  4YS3 A;  1P3O D;  3C1B C;  3AZH D;  5AVB B;  3W97 D;  3MGP D;  5B32 C;  1BH9 A;  5BNV A;  3AZG C;  3W99 A;  2HIO D;  3W98 C;  3AZN D;  5DNM C;  3AZI A;  1ZLA A;  5AV9 D;  2ARO A;  1M1A B;  4YS3 D;  4KHA A;  3A6N B;  3C1B A;  3AZF C;  4Z2M H;  5B0Z A;  4JJN A;  5CPI B;  5B40 A;  1P3P C;  3W99 D;  3B6G B;  3AFA C;  4J8X A;  3AZI D;  3UT9 D;  1ZLA D;  5DNM A;  2ARO D;  4EO5 C;  4J8U B;  1N1J A;  4CSR B;  5GT0 B;  3X1U A;  1P3L A;  1JFI B;  2ZM5 A;  3C1B D;  4AWL C;  3X1V B;  5B0Z D;  1KX3 B;  3AZF A;  4JJN D;  4WU9 A;  3NQU A;  4WNN A;  4Z5T C;  5B40 D;  3REK B;  5CPJ A;  4ZBJ B;  4J8X D;  1P3P A;  4YM6 C;  1HQ3 B;  2F2A C;  3AFA A;  5B31 G;  5DNM D;  1P3M B;  1F66 B;  3LEL B;  5B1L C;  2CV5 A;  3X1U D;  1A7W A;  1M18 B;  2BYK A;  1P3L D;  3AYW C;  2FJ7 A;  1P3I C;  3AZF D;  5B2I B;  4WV4 B;  4WU9 D;  1P3B B;  4XZQ B;  4E45 A;  5CPJ D;  4WJ3 C;  3F6T A;  3MGS C;  1P3P D;  3W96 A;  3AN2 C;  3AFA D;  5B2J C;  3MGP B;  3UTA C;  4J8V C;  5JRG B;  5G49 B;  2CV5 D;  5AVB C;  4X23 C;  3KXB B;  3X1S C;  1BFM A;  2FJ7 D;  1BH8 A;  3AYW A;  2RVQ D;  1AOI A;  4YS3 B;  1P3I A;  4H9O A;  3B6F C;  4G91 B;  2Y2K A;  3W96 D;  4R8P C;  3MGS A;  2J8P A;  3AN2 A;  1KX4 A;  1P3F B;  5JA4 A;  1M19 B;  4KGC A;  4X23 A;  2F8N B;  1KX5 C;  3UT9 B;  3AYW D;  5DNN A;  4Z66 C;  3X1S A;  5B1M C;  1P3G B;  1AOI D;  3LZ0 B;  1P3I D;  3REI C;  5AV6 C;  2XD5 A;  3AZK D;  1P34 C;  5AVC B;  3UTA B;  3B6F A;  5B32 G;  3MGS D;  4KUD A;  3MVD B;  4H9P B;  4R8P A;  3AN2 D;  1KX4 D;  3AN2 B;  4Z2M G;  4JJN B;  5B40 B;  4KGC D;  1TZY B;  1KX3 C;  4J8X B;  4X23 D;  2F8N K;  1PZR A;  4XUJ A;  1ULY A;  5DNN D;  3X1S D;  1U35 B;  2HUE B;  3AZE D;  1KX5 A;  4Z66 A;  5B1M A;  2Y2O A;  4H9Q A;  3X1U B;  5GXQ B;  1P3L B;  3REI A;  5AV6 A;  3B6F D;  2ZY2 A;  1P34 A;  4KUD D;  3WAA C;  4R8P D;  1ID3 A;  5GT3 D;  4DQY B;  4WU9 B;  3LZ1 A;  3MNN C;  4ZUX C;  1H3O A;  4WNN B;  1Q9C A;  3KUY C;  5B33 C;  4XUJ D;  5GSU C;  3O62 B;  1KX5 D;  4Z66 D;  5B1M D;  3R45 A;  4WU8 A;  4NE5 A;  3LJA A;  3REI D;  5AV6 D;  4HGA C;  1EQZ C;  3VH6 A;  1P34 D;  2FJ7 B;  5CP6 B;  1ID3 D;  3KXB C;  3AV2 C;  3LZ1 D;  3C1C C;  2NQB C;  3TU4 C;  3WKJ B;  4ZUX A;  5B0Y C;  5BO0 B;  5B33 A;  2DF4 C;  5GSU A;  4WU8 D;  5B24 C;  1P3K B;  5BS7 C;  3LJA D;  2IO5 B;  2PYO C;  2BYM B;  3H0L C;  2JE5 A;  5CPK A;  1EQZ A;  1P3A C;  1AOI B;  3VH5 A;  3AV2 A;  3C1C A;  4ZUX D;  5AV5 C;  5F99 C;  3TU4 A;  4CAY B;  3AZK B;  5B33 D;  5AY8 C;  3AZL C;  3AZJ B;  1KX4 B;  5AVC C;  3X1T C;  2NZD C;  3AV1 C;  5B32 A;  4KGC B;  5B24 A;  5BS7 A;  3REH C;  3AZG A;  5DNN B;  5CPK D;  1EQZ D;  3W98 A;  2Y2N A;  5C3I C;  4QLC B;  3AZE B;  3AZM B;  1S32 C;  3AV2 D;  4UPK A;  5AV8 C;  3C1C D;  3KWQ B;  3TU4 D;  1P3A A;  1T3U A;  3IP4 C;  2YFW A;  5E5A C;  5AV5 A;  4H9S C;  4H9R A;  3KSY A;  3MGQ B;  5CHL B;  3WA9 B;  5GT3 B;  4DRB A;  3AZL A;  5B32 D;  4LD9 C;  2NZD A;  3X1T A;  5B24 D;  3AV1 A;  3AZG D;  4XUJ B;  3EPJ A;  5KDM A;  2YFV A;  3W98 D;  3REH A;  3WTP B;  4G92 C;  3UTB C;  1P3A D;  3A1I A;  3O62 C;  5B31 B;  3REJ C;  5AV5 D;  4J8W C;  3MGR C;  1ID3 B;  5E5A A;  4H9S A;  5FUG B;  3LZ1 B;  3AZL D;  1H3O B;  3REL C;  5CP6 C;  2NZD D;  3X1T D;  1P3O B;  4Z5T A;  4LD9 A;  3AZH B;  3REH D;  3W97 B;  4YM6 A;  3R45 B;  2UWX A;  5BNX B;  5B1L A;  2HIO B;  3AZN B;  1TAF A;  3REJ A;  4H9N A;  5E5A D;  5AV9 B;  2G5I C;  4UUZ A;  3B0D B;  4Z5T D;  4LD9 D;  1M1A C;  3A6N C;  2W8S A;  1BH9 B;  4YM6 D;  5B2J A;  5BNV B;  3W99 B;  5B1L D;  4J8V A;  5AVB A;  3REJ D;  5CPI C;  3AZI B;  2Y2P A;  1ZLA B;  2ARO B;  3B6G C;  4KHA B;  4QLC C;  2Y2H A;  4J8U C;  2Y2G A;  3C1B B;  1M1A A;  5GT0 C;  5B0Z B;  5B2J D;  3A6N A;  5B32 B;  3X1V C;  4J8V D;  3WA9 C;  3VH6 T;  5AVB D;  3AZG B;  4NE3 A;  3REK C;  3W98 B;  5DNM B;  2F8N G;  1R4V A;  1KU5 A;  4ZBJ C;  1HQ3 C;  1N1J B;  1P3M C;  3B6G A;  2YFW B;  1F1E A;  1F66 C;  3LEL C;  3NQJ A;  4J8U A;  1M1A D;  3A6N D;  3AZF B;  1M18 C;  4NE6 A;  3NQU B;  4CSR A;  5GT0 A;  5CPJ B;  1JFI A;  3VH6 W;  5B2I C;  1P3P B;  3X1V A;  1B6W A;  1P3B C;  4XZQ C;  3AFA B;  1KX3 A;  3VH5 T;  3B6G D;  4EO5 B;  2CV5 B;  3MGP C;  2BYK B;  1HQ3 A;  3A1K A;  5JRG C;  1F66 A;  3LEL A;  4J8U D;  4AWL B;  2RIQ A;  5GT0 D;  3WAA A;  1WWS A;  2BG1 A;  3MNN A;  4Z5T B;  3X1V D;  1B67 A;  3W96 B;  3KUY A;  4YS3 C;  1KX3 D;  5B2I A;  4G91 C;  4DRA A;  1P3B A;  5BT1 C;  4XZQ A;  4YM6 B;  3VH5 W;  3EPL A;  5B1L B;  1HTA A;  1HQ3 D;  1F66 D;  3LEL D;  1BH8 B;  1P3F C;  3AYW B;  2ZY5 A;  5JRG A;  1M19 C;  5G49 A;  3WAA D;  3KXB A;  1P3I B;  4H9O B;  3UT9 C;  2NQB A;  3MNN D;  3EPK A;  1P3G C;  3KUY D;  4M6B A;  3LZ0 C;  3MGS B;  5B2I D;  5B0Y A;  1P3B D;  4XZQ D;  5GSU D;  5B2J B;  3P5J B;  2VQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...