5B40D

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40D00
3REID 5CPIA 3TU4B 5JA4B 1P3KD 1P3OB 3VH5W 3KUYA 3AZNB 2F8NK 5DNND 2NZDD 3AZFD 2BYKA 1P3AD 2HIOC 4YS3D 4WZSB 1F1EA 3AZFA 3RELC 5BNXA 5F99D 1P3AA 4YS3A 3W97C 4KGCD 4UUZB 5AVCD 3LZ1C 4WU9D 2NQBC 1BH8A 3A6ND 2CV5C 4WNNA 5B1LD 1TZYC 5GT0D 4KGCA 4H9OB 3WAAC 1P3MD 5AVCA 5B33B 3X1TD 4WU9A 3A6NA 5AVBB 3C1CC 5B1LA 5GT0A 4J8XC 1P34C 4LD9D 1P3MA 5BNVA 3AN2C 4Z5TA 5CP6D 1KX3A 3WTPB 4XZQC 3MGRB 4J8VB 3AV2C 5CHLB 5CPIC 3O62D 5B1MD 4R8PA 5B2JC 4WU8C 2F8NB 3UTAB 3REIC 5AV6D 3O62A 3WA9B 2L5AA 5B1MA 1P3KC 1R4VA 3X1UB 2NZDC 5DNNC 3AZFC 5B24A 1HTAA 4QLCB 1U35D 3LELC 5B40D 4G92C 3W96B 5F99C 3REJD 3MGPB 1U35A 3REKB 5B40A 5B0ZA 4KGCC 3TU4D 5AV8B 5AVCC 2YFWA 1N1JA 4WU9C 4CSRB 5B1LC 3W99B 5GT0C 3TU4A 1P3MC 1ULYA 5JA4A 4J8UB 5B2IB 3X1TC 3UTBB 3KWQA 1M18D 5BT1C 3REHC 1P3LB 4LD9C 5CP6C 5AV5D 3KUYB 4WV4B 1M18A 2BYKB 4Z66A 5C3IC 3O62C 5B1MC 5AV5A 4EO5C 3MVDA 5BNXB 1P3AB 4YS3B 5AVBD 5AV6C 3AYWB 4H9OA 3MNNC 1AOIB 5B31A 5AVBA 3V9RA 3MGRD 4J8VD 1P3GA 1U35C 3VH5T 3R45A 5B40C 1KX4B 2IO5C 3A6NB 3MGRA 4J8VA 3REJC 2F8ND 3UTAD 4KUDA 4Z5TB 3WA9D 3TU4C 1KX3B 1P3OC 3X1UD 3AZNC 2F8NA 1TAFA 2HUEB 1M19B 3WA9A 4QLCD 4R8PB 3X1UA 3AZGA 4J8WB 1A7WA 3MGPD 3REKD 1KX5D 3WKJB 5BS7C 4Z2MG 3B0CW 5B24B 3X1VB 1KX5A 3AZKD 1P3BB 5AY8B 1HQ3B 4J8UD 5B33C 5B2ID 2YFVB 5E5AB 5B0ZB 3AZKA 1P3LD 5B31G 1Q9CA 4DRBA 2YFWB 1P3PB 3WTPC 3LJAA 3MGRC 4J8VC 2BYMA 1P3LA 3X1SB 5KDMB 3KWQB 3VH6A 3UTAC 3AYWD 3WA9C 2F8NG 1M18B 1AOID 3X1UC 4Z66B 3AYWA 4QLCC 5AV5B 1AOIA 3MVDB 1ZLAD 4E44A 1KX4D 3W96C 3VH6W 1P3IA 3MGQA 4H9QA 3MGPC 3REKC 1ZLAA 4Z5TD 5B31B 1KX4A 1KX3D 5AV8C 3V9RB 4JJND 1P3GB 3AZEB 3R45B 3W99C 1M19D 4R8PD 4J8UC 5B2IC 4JJNA 3UTBC 2CWEA 1JFIB 4J8WD 4HGAB 4KUDB 3AZJB 1P3LC 1M19A 3AZLB 3LZ0D 3C1BD 3KUYC 5GXQA 4G91B 1TAFB 3WKJD 4J8WA 3AZMB 5B24D 3X1VD 3LZ0A 3C1BA 3AZGB 1P3BD 5AY8D 1HQ3D 3WKJA 5E5AD 1P3AC 4YS3C 1F66A 3X1VA 3AYWC 5B0ZD 1P3BA 5AY8A 1HQ3A 4NE6A 1AOIC 3W98D 2YFVA 5E5AA 1ID3D 1P3PD 5JRGA 1KX5B 3W98A 4ZBJB 1B6WA 5B0YA 1ID3A 3X1SD 1P3PA 3KWQD 1KX4C 3B6FD 3A6NC 4H9RA 3AZKB 3B0DB 1H3OA 5B32D 4Z5TC 3X1SA 5KDMA 1KX3C 3B6FA 3LJAB 4Z66D 2BYMB 2FJ7A 5B32A 2HUEC 1M19C 5CPKB 4R8PC 5GT3B 5GSUB 3MVDD 3B0CT 4J8WC 3WTPE 5B31D 5B24C 1P3GD 4XUJD 3X1VC 3AZED 3REJB 2PYOB 1P3BC 1HQ3C 5E5AC 1P3IB 3MGQB 4XUJA 4H9QB 3AZEA 3AV1B 4KUDD 5B0ZC 3AFAA 3AZJD 1ZLAB 4YM6D 3AZLD 1P3PC 1JFIA 3AZID 4H9SA 3AZJA 3AZMD 4YM6A 3AZLA 3X1SC 4JJNB 3KWQC 3AZGD 3AZIA 1EQZD 3KXBB 5DNMA 3AZMA 3LELB 5BO0A 3VH6T 5AV9A 2LY8A 1M18C 5GXQB 1EQZA 5B32G 2AROA 4Z66C 3LZ0B 3C1BB 5AV5C 3B6GA 3MVDC 4AWLB 1M1AB 4Z2MH 1F66B 1KU5A 2HIOD 4NE3A 1P3FB 3NQUB 5B31C 3RELD 3NQJB 5AVBC 2HIOA 5JRGB 3LJAD 4ZUXB 1P3GC 3AZEC 3W98B 3W97D 4X23B 5B0YB 5CPKD 3RELA 1ID3B 5GT3D 5GSUD 2NQBD 4H9RB 3AZHB 3W97A 1H3OB 4KUDC 4HGAC 2JSSA 4H9SC 3AZJC 5CPKA 5GT3A 3B6FB 5GSUA 3LZ1A 2NQBA 1B67A 2CV5A 4G91C 1BH9B 1TZYA 2FJ7B 5B32B 3MNNB 3AZMC 5CPJB 2PYOD 3AZGC 3AV2D 4J8XA 1P34A 1P3ID 3MGQD 3AV1D 2PYOA 4XZQA 3AV2A 4WU8D 3UT9B 5G49B 3AV1A 1KX5C 5B2JA 4ZBJC 4WU8A 4E45A 1WWSA 3REIA 4XUJB 3KXBD 3AFAB 3AZKC 1P3KA 3B0DC 3LELD 4DRAA 2NZDA 5DNNA 5GXQD 3KXBA 3LJAC 3LELA 4YM6B 5CPKC 5F99A 5GT3C 5GSUC 3AZIB 1S32B 4KHAA 5DNMB 1M1AD 1F66D 5BO0B 5AV9B 1P3FD 1EQZB 5BT1D 1M1AA 2AROB 3REHD 3MGSB 5JRGD 4ZUXD 3B6GB 3X1TA 4X23D 1P3FA 2PYOC 5FUGB 3NQUA 5B0YD 3REHA 3NQJA 4LD9A 4ZUXA 1P3IC 5CP6A 3MGQC 3AZHD 1BFMA 4X23A 3AV1C 1ZLAC 2HIOB 3AZHA 2FJ7D 4M6BA 3MNND 3RELB 5CPJD 4JJNC 5AV6A 1BH9A 3W97B 3KXBC 3KSYA 3MNNA 5CPJA 3LZ1B 4H9NA 2NQBB 2RVQD 5GXQC 2CV5B 1TZYB 3UT9D 3WAAB 4CAYA 3LZ0C 3C1BC 1P3OD 4H9PA 3C1CB 3WKJC 3REJA 4AWLC 4J8XB 3UT9A 3AZND 1P34B 1M1AC 3AN2B 1F66C 5G49A 3AFAD 1P3OA 5AY8C 4XZQB 3AZNA 3AV2B 1P3FC 4NFTA 5CPIB 5JRGC 5B2JB 4ZUXC 3W98C 4X23C 4WU8B 5B0YC 1ID3C 3REIB 1S32D 5DNMD 1P3KB 3AZHC 2NZDB 5DNNB 4UUZA 3AZFB 5AV9D 3B6FC 5B33D 5BS7A 1S32A 2AROD 2FJ7C 3MGSD 5B32C 4G92B 5F99B 5B33A 3B6GD 5CPJC 3WTPD 4NE5A 1BH8B 4KHAB 4WNNB 3MGSA 4KGCB 5AVCB 3WTPA 4WU9B 5FUGA 2RVQC 5B1LB 5GT0B 3UT9C 1P3MB 5BNVB 3X1TB 3REHB 3UTAA 4LD9B 1WWIA 5CP6B 4XUJC 3AFAC 3LZ1D 3W96D 2CV5D 5C3IB 1TZYD 5B1MB 4QLCA 3O62B 4EO5B 3WAAD 4YM6C 3AZLC 3W96A 5AV8D 5AV6B 3C1CD 3AZIC 4J8XD 1S32C 3MGPA 5DNMC 1P34D 3WAAA 3REKA 3AN2D 2F8NH 3W99D 4H9NB 5AV8A 5AV9C 3VH5A 3C1CA 4XZQD 3UTBD 1EQZC 4CSRA 1U35B 2AROC 4H9PB 3AN2A 5B40B 3W99A 4CAYB 3MGSC 5CPID 5B2JD 4J8UA 3B6GC 2IO5B 5B2IA 1N1JB 3UTBA 3KUYD 3B0BA
chains in the Genus database with same CATH superfamily
3REID 5CPIA 3TU4B 5JA4B 1P3KD 1P3OB 3VH5W 3KUYA 3AZNB 2F8NK 5DNND 2NZDD 3AZFD 2BYKA 1P3AD 2HIOC 2UWXA 4YS3D 4WZSB 3F6TA 1F1EA 2Y2OA 3AZFA 3RELC 5BNXA 5F99D 1P3AA 4YS3A 3W97C 4KGCD 4UUZB 5AVCD 3LZ1C 4WU9D 2NQBC 1BH8A 3A6ND 2CV5C 4WNNA 5B1LD 1TZYC 5GT0D 4KGCA 4H9OB 3WAAC 1P3MD 5AVCA 5B33B 3X1TD 4WU9A 3A6NA 5AVBB 3C1CC 5B1LA 5GT0A 4J8XC 1P34C 4LD9D 1P3MA 5BNVA 3AN2C 2ZY4A 4Z5TA 5CP6D 1KX3A 3WTPB 4XZQC 3MGRB 4J8VB 3AV2C 5CHLB 5CPIC 3O62D 5B1MD 4R8PA 5B2JC 4WU8C 2F8NB 3UTAB 3REIC 5AV6D 3O62A 3WA9B 2L5AA 5B1MA 1P3KC 2J8PA 1R4VA 3X1UB 2NZDC 5DNNC 3AZFC 5B24A 1HTAA 4QLCB 1U35D 3LELC 5B40D 4G92C 3W96B 5F99C 3REJD 3MGPB 1U35A 3REKB 5B40A 5B0ZA 4KGCC 3TU4D 5AV8B 5AVCC 2VQRA 2YFWA 1N1JA 4WU9C 4CSRB 5B1LC 3W99B 5GT0C 3TU4A 1P3MC 1ULYA 3H0LC 5JA4A 4J8UB 5B2IB 3X1TC 3UTBB 3KWQA 1M18D 5BT1C 3REHC 1P3LB 4LD9C 5CP6C 5AV5D 3KUYB 4WV4B 1M18A 2BYKB 4Z66A 5C3IC 3O62C 5B1MC 5AV5A 4EO5C 3MVDA 5BNXB 1P3AB 4YS3B 5AVBD 5AV6C 3AYWB 3KFUG 4H9OA 3MNNC 3P5JB 1AOIB 5B31A 5AVBA 3V9RA 3MGRD 4J8VD 4UPKA 1P3GA 1U35C 3VH5T 2G5IC 3R45A 5B40C 2DF4C 1KX4B 2IO5C 3A6NB 3A1IA 3MGRA 4J8VA 3REJC 2F8ND 3UTAD 4KUDA 2JCHA 4Z5TB 3WA9D 3TU4C 1KX3B 1P3OC 3X1UD 3AZNC 2F8NA 1TAFA 2HUEB 1M19B 3WA9A 4QLCD 4R8PB 3X1UA 3AZGA 4J8WB 1A7WA 3EPHA 2W8SA 3MGPD 3REKD 1KX5D 2ZY5A 3WKJB 5BS7C 4Z2MG 3B0CW 5B24B 3X1VB 1KX5A 2Y2HA 3AZKD 1P3BB 5AY8B 1HQ3B 4J8UD 5B33C 5B2ID 2YFVB 5E5AB 5B0ZB 3AZKA 1P3LD 5B31G 1Q9CA 4DRBA 2YFWB 1P3PB 3WTPC 3LJAA 3MGRC 4J8VC 2BYMA 1P3LA 3X1SB 5KDMB 3KWQB 3VH6A 3UTAC 3AYWD 3WA9C 2F8NG 1M18B 1AOID 2Y2GA 3X1UC 4Z66B 3AYWA 4QLCC 5AV5B 1AOIA 2Y2PA 3MVDB 1ZLAD 4E44A 1KX4D 3W96C 3VH6W 1P3IA 3MGQA 4H9QA 3MGPC 3REKC 1ZLAA 4Z5TD 5B31B 1KX4A 1KX3D 5AV8C 3V9RB 4JJND 1P3GB 3AZEB 3R45B 3W99C 1M19D 4R8PD 4J8UC 5B2IC 4JJNA 3UTBC 2CWEA 1JFIB 4J8WD 4HGAB 4KUDB 3AZJB 1P3LC 1M19A 3AZLB 3LZ0D 3C1BD 3KUYC 5GXQA 4G91B 1TAFB 3WKJD 4J8WA 3EG5B 4DQYB 3AZMB 5B24D 3X1VD 3LZ0A 3C1BA 3AZGB 1P3BD 5AY8D 1HQ3D 3WKJA 5E5AD 1P3AC 4YS3C 1F66A 3X1VA 3AYWC 5B0ZD 1P3BA 5AY8A 1HQ3A 4NE6A 3EPJA 1AOIC 3W98D 2YFVA 5E5AA 1ID3D 1P3PD 5JRGA 1KX5B 3W98A 4ZBJB 1B6WA 5B0YA 1ID3A 3X1SD 1P3PA 3KWQD 1KX4C 3B6FD 3A6NC 4H9RA 3AZKB 3B0DB 1H3OA 2RIQA 5B32D 4Z5TC 3X1SA 5KDMA 1PZRA 1KX3C 3B6FA 3LJAB 4Z66D 2BYMB 2FJ7A 5B32A 2HUEC 1M19C 5CPKB 4R8PC 5GT3B 5GSUB 3MVDD 3B0CT 4J8WC 3WTPE 5B31D 2Y2QA 5B24C 1P3GD 4XUJD 3X1VC 3AZED 3REJB 2PYOB 1P3BC 1HQ3C 2F2AC 5E5AC 1P3IB 3MGQB 3H0RC 4H9QB 4XUJA 3AZEA 3AV1B 4KUDD 5B0ZC 3AFAA 3AZJD 1ZLAB 4YM6D 3AZLD 1P3PC 1JFIA 3AZID 3EPLA 4H9SA 3AZJA 3AZMD 4YM6A 3AZLA 3AL0C 2DQNC 4JJNB 3KWQC 3AZGD 3X1SC 3AZIA 1EQZD 3KXBB 5DNMA 3AZMA 3LELB 5BO0A 3VH6T 5AV9A 2LY8A 1M18C 5GXQB 1EQZA 5B32G 2FFFB 3A1KA 2AROA 4Z66C 3LZ0B 3C1BB 5AV5C 3B6GA 3MVDC 4AWLB 1M1AB 4Z2MH 1F66B 1KU5A 3FDDA 2HIOD 4NE3A 1P3FB 3NQUB 5B31C 3RELD 3NQJB 2Y2LA 5AVBC 2HIOA 5JRGB 3LJAD 4ZUXB 1P3GC 3AZEC 3W98B 3W97D 4X23B 5B0YB 5CPKD 3RELA 1ID3B 5GT3D 5GSUD 2NQBD 4H9RB 3AZHB 3W97A 1H3OB 4KUDC 4HGAC 2JSSA 4H9SC 3AZJC 5CPKA 2XD1A 5GT3A 3B6FB 5GSUA 3LZ1A 2NQBA 1B67A 2CV5A 4G91C 1BH9B 1TZYA 2FJ7B 5B32B 3MNNB 3AZMC 5CPJB 2PYOD 3AZGC 3AV2D 4J8XA 1P34A 1P3ID 3MGQD 3AV1D 2PYOA 4XZQA 3AV2A 4WU8D 3UT9B 5G49B 3AV1A 1KX5C 5B2JA 4ZBJC 4WU8A 2Y2IA 4E45A 1WWSA 3REIA 4XUJB 1Z2CB 3KXBD 3AFAB 3AZKC 1P3KA 3B0DC 3LELD 2ZM5A 2Y2MA 4DRAA 2NZDA 5DNNA 5GXQD 3KXBA 3LJAC 3LELA 4YM6B 5CPKC 5F99A 5GT3C 5GSUC 3AZIB 1S32B 4KHAA 5DNMB 1M1AD 1F66D 5BO0B 5AV9B 2G5HC 1P3FD 1EQZB 5BT1D 1M1AA 2AROB 3REHD 3MGSB 5JRGD 4ZUXD 3B6GB 3X1TA 4X23D 1P3FA 2PYOC 5FUGB 3NQUA 5B0YD 2Y2KA 3REHA 3NQJA 4WJ3C 4LD9A 4ZUXA 1P3IC 5CP6A 3MGQC 3AZHD 1BFMA 4X23A 3AV1C 1ZLAC 3IP4C 2HIOB 2XD5A 3AZHA 2FJ7D 4M6BA 3MNND 3RELB 5CPJD 4JJNC 2BG1A 5AV6A 1BH9A 3EPKA 3KXBC 3KSYA 3W97B 3MNNA 2ZY3A 5CPJA 3LZ1B 4H9NA 2NQBB 2RVQD 5GXQC 2CV5B 1TZYB 3UT9D 3WAAB 4CAYA 3LZ0C 3C1BC 1P3OD 4H9PA 3C1CB 3WKJC 3REJA 4AWLC 4J8XB 3UT9A 3H0MC 3AZND 1P34B 1M1AC 3AN2B 1F66C 5G49A 3AFAD 1P3OA 5AY8C 4XZQB 3AZNA 3AV2B 1P3FC 4NFTA 5CPIB 5JRGC 5B2JB 4ZUXC 3W98C 4X23C 4WU8B 5B0YC 1ID3C 3REIB 1S32D 5DNMD 1P3KB 3AZHC 2NZDB 5DNNB 4UUZA 3AZFB 5AV9D 3B6FC 5B33D 5BS7A 1S32A 2AROD 2FJ7C 3MGSD 5B32C 1N1JB 4G92B 5F99B 5B33A 2JE5A 5CPJC 3B6GD 3WTPD 4NE5A 1BH8B 4KHAB 4WNNB 3MGSA 4KGCB 5AVCB 3WTPA 4WU9B 5FUGA 2RVQC 2ZY2A 5B1LB 5GT0B 3UT9C 1P3MB 5BNVB 3X1TB 3REHB 3UTAA 4LD9B 1WWIA 5CP6B 4XUJC 3AFAC 1T3UA 3LZ1D 3W96D 2CV5D 5C3IB 1TZYD 5B1MB 4QLCA 3O62B 4EO5B 3WAAD 4YM6C 3AZLC 3W96A 5AV8D 1W2EA 5AV6B 3C1CD 3AZIC 4J8XD 1S32C 3MGPA 5DNMC 1P34D 3WAAA 3REKA 2Y2NA 3AN2D 3W99D 2F8NH 5AV8A 5AV9C 4H9NB 3VH5A 3C1CA 2Y2JA 4XZQD 3UTBD 1EQZC 4CSRA 1U35B 2AROC 3AN2A 5B40B 3W99A 4CAYB 3MGSC 5CPID 5B2JD 4J8UA 3B6GC 2IO5B 5B2IA 4H9PB 3UTBA 3KUYD 3B0BA
chains in the Genus database with same CATH topology
3REID 5CPIA 3TU4B 5JA4B 1P3KD 1P3OB 3VH5W 3KUYA 3AZNB 2F8NK 5DNND 2NZDD 3AZFD 2BYKA 1P3AD 2HIOC 2UWXA 4YS3D 4WZSB 3F6TA 1F1EA 2Y2OA 3AZFA 3RELC 5BNXA 5F99D 1P3AA 4YS3A 3W97C 4KGCD 4UUZB 5AVCD 3LZ1C 4WU9D 2NQBC 1BH8A 3A6ND 2CV5C 4WNNA 5B1LD 1TZYC 5GT0D 4KGCA 4H9OB 3WAAC 1P3MD 5AVCA 5B33B 3X1TD 4WU9A 3A6NA 5AVBB 3C1CC 5B1LA 5GT0A 4J8XC 1P34C 4LD9D 1P3MA 5BNVA 3AN2C 2ZY4A 4Z5TA 5CP6D 1KX3A 3WTPB 4XZQC 3MGRB 4J8VB 3AV2C 5CHLB 5CPIC 3O62D 5B1MD 4R8PA 5B2JC 4WU8C 2F8NB 3UTAB 3REIC 5AV6D 3O62A 3WA9B 2L5AA 5B1MA 1P3KC 2J8PA 1R4VA 3X1UB 2NZDC 5DNNC 3AZFC 5B24A 1HTAA 4QLCB 1U35D 3LELC 5B40D 4G92C 3W96B 5F99C 3REJD 3MGPB 1U35A 3REKB 5B40A 5B0ZA 4KGCC 3TU4D 5AV8B 5AVCC 2VQRA 2YFWA 1N1JA 4WU9C 4CSRB 5B1LC 3W99B 5GT0C 3TU4A 1P3MC 1ULYA 3H0LC 5JA4A 4J8UB 5B2IB 3X1TC 3UTBB 3KWQA 1M18D 5BT1C 3REHC 1P3LB 4LD9C 5CP6C 5AV5D 3KUYB 4WV4B 1M18A 2BYKB 4Z66A 5C3IC 3O62C 5B1MC 5AV5A 4EO5C 3MVDA 5BNXB 1P3AB 4YS3B 5AVBD 5AV6C 3AYWB 3KFUG 4H9OA 3MNNC 3P5JB 1AOIB 5B31A 5AVBA 3V9RA 3MGRD 4J8VD 4UPKA 1P3GA 1U35C 3VH5T 2G5IC 3R45A 5B40C 2DF4C 1KX4B 2IO5C 3A6NB 3A1IA 3MGRA 4J8VA 3REJC 2F8ND 3UTAD 4KUDA 2JCHA 4Z5TB 3WA9D 3TU4C 1KX3B 1P3OC 3X1UD 3AZNC 2F8NA 1TAFA 2HUEB 1M19B 3WA9A 4QLCD 4R8PB 3X1UA 3AZGA 4J8WB 1A7WA 3EPHA 2W8SA 3MGPD 3REKD 1KX5D 2ZY5A 3WKJB 5BS7C 4Z2MG 3B0CW 5B24B 3X1VB 1KX5A 2Y2HA 3AZKD 1P3BB 5AY8B 1HQ3B 4J8UD 5B33C 5B2ID 2YFVB 5E5AB 5B0ZB 3AZKA 1P3LD 5B31G 1Q9CA 4DRBA 2YFWB 1P3PB 3WTPC 3LJAA 3MGRC 4J8VC 2BYMA 1P3LA 3X1SB 5KDMB 3KWQB 3VH6A 3UTAC 3AYWD 3WA9C 2F8NG 1M18B 1AOID 2Y2GA 3X1UC 4Z66B 3AYWA 4QLCC 5AV5B 1AOIA 2Y2PA 3MVDB 1ZLAD 4E44A 1KX4D 3W96C 3VH6W 1P3IA 3MGQA 4H9QA 3MGPC 3REKC 1ZLAA 4Z5TD 5B31B 1KX4A 1KX3D 5AV8C 3V9RB 4JJND 1P3GB 3AZEB 3R45B 3W99C 1M19D 4R8PD 4J8UC 5B2IC 4JJNA 3UTBC 2CWEA 1JFIB 4J8WD 4HGAB 4KUDB 3AZJB 1P3LC 1M19A 3AZLB 3LZ0D 3C1BD 3KUYC 5GXQA 4G91B 1TAFB 3WKJD 4J8WA 3EG5B 4DQYB 3AZMB 5B24D 3X1VD 3LZ0A 3C1BA 3AZGB 1P3BD 5AY8D 1HQ3D 3WKJA 5E5AD 1P3AC 4YS3C 1F66A 3X1VA 3AYWC 5B0ZD 1P3BA 5AY8A 1HQ3A 4NE6A 3EPJA 1AOIC 3W98D 2YFVA 5E5AA 1ID3D 1P3PD 5JRGA 1KX5B 3W98A 4ZBJB 1B6WA 5B0YA 1ID3A 3X1SD 1P3PA 3KWQD 1KX4C 3B6FD 3A6NC 4H9RA 3AZKB 3B0DB 1H3OA 2RIQA 5B32D 4Z5TC 3X1SA 5KDMA 1PZRA 1KX3C 3B6FA 3LJAB 4Z66D 2BYMB 2FJ7A 5B32A 2HUEC 1M19C 5CPKB 4R8PC 5GT3B 5GSUB 3MVDD 3B0CT 4J8WC 3WTPE 5B31D 2Y2QA 5B24C 1P3GD 4XUJD 3X1VC 3AZED 3REJB 2PYOB 1P3BC 1HQ3C 2F2AC 5E5AC 1P3IB 3MGQB 3H0RC 4H9QB 4XUJA 3AZEA 3AV1B 4KUDD 5B0ZC 3AFAA 3AZJD 1ZLAB 4YM6D 3AZLD 1P3PC 1JFIA 3AZID 3EPLA 4H9SA 3AZJA 3AZMD 4YM6A 3AZLA 3AL0C 2DQNC 4JJNB 3KWQC 3AZGD 3X1SC 3AZIA 1EQZD 3KXBB 5DNMA 3AZMA 3LELB 5BO0A 3VH6T 5AV9A 2LY8A 1M18C 5GXQB 1EQZA 5B32G 2FFFB 3A1KA 2AROA 4Z66C 3LZ0B 3C1BB 5AV5C 3B6GA 3MVDC 4AWLB 1M1AB 4Z2MH 1F66B 1KU5A 3FDDA 2HIOD 4NE3A 1P3FB 3NQUB 5B31C 3RELD 3NQJB 2Y2LA 5AVBC 2HIOA 5JRGB 3LJAD 4ZUXB 1P3GC 3AZEC 3W98B 3W97D 4X23B 5B0YB 5CPKD 3RELA 1ID3B 5GT3D 5GSUD 2NQBD 4H9RB 3AZHB 3W97A 1H3OB 4KUDC 4HGAC 2JSSA 4H9SC 3AZJC 5CPKA 2XD1A 5GT3A 3B6FB 5GSUA 3LZ1A 2NQBA 1B67A 2CV5A 4G91C 1BH9B 1TZYA 2FJ7B 5B32B 3MNNB 3AZMC 5CPJB 2PYOD 3AZGC 3AV2D 4J8XA 1P34A 1P3ID 3MGQD 3AV1D 2PYOA 4XZQA 3AV2A 4WU8D 3UT9B 5G49B 3AV1A 1KX5C 5B2JA 4ZBJC 4WU8A 2Y2IA 4E45A 1WWSA 3REIA 4XUJB 1Z2CB 3KXBD 3AFAB 3AZKC 1P3KA 3B0DC 3LELD 2ZM5A 2Y2MA 4DRAA 2NZDA 5DNNA 5GXQD 3KXBA 3LJAC 3LELA 4YM6B 5CPKC 5F99A 5GT3C 5GSUC 3AZIB 1S32B 4KHAA 5DNMB 1M1AD 1F66D 5BO0B 5AV9B 2G5HC 1P3FD 1EQZB 5BT1D 1M1AA 2AROB 3REHD 3MGSB 5JRGD 4ZUXD 3B6GB 3X1TA 4X23D 1P3FA 2PYOC 5FUGB 3NQUA 5B0YD 2Y2KA 3REHA 3NQJA 4WJ3C 4LD9A 4ZUXA 1P3IC 5CP6A 3MGQC 3AZHD 1BFMA 4X23A 3AV1C 1ZLAC 3IP4C 2HIOB 2XD5A 3AZHA 2FJ7D 4M6BA 3MNND 3RELB 5CPJD 4JJNC 2BG1A 5AV6A 1BH9A 3EPKA 3KXBC 3KSYA 3W97B 3MNNA 2ZY3A 5CPJA 3LZ1B 4H9NA 2NQBB 2RVQD 5GXQC 2CV5B 1TZYB 3UT9D 3WAAB 4CAYA 3LZ0C 3C1BC 1P3OD 4H9PA 3C1CB 3WKJC 3REJA 4AWLC 4J8XB 3UT9A 3H0MC 3AZND 1P34B 1M1AC 3AN2B 1F66C 5G49A 3AFAD 1P3OA 5AY8C 4XZQB 3AZNA 3AV2B 1P3FC 4NFTA 5CPIB 5JRGC 5B2JB 4ZUXC 3W98C 4X23C 4WU8B 5B0YC 1ID3C 3REIB 1S32D 5DNMD 1P3KB 3AZHC 2NZDB 5DNNB 4UUZA 3AZFB 5AV9D 3B6FC 5B33D 5BS7A 1S32A 2AROD 2FJ7C 3MGSD 5B32C 1N1JB 4G92B 5F99B 5B33A 2JE5A 5CPJC 3B6GD 3WTPD 4NE5A 1BH8B 4KHAB 4WNNB 3MGSA 4KGCB 5AVCB 3WTPA 4WU9B 5FUGA 2RVQC 2ZY2A 5B1LB 5GT0B 3UT9C 1P3MB 5BNVB 3X1TB 3REHB 3UTAA 4LD9B 1WWIA 5CP6B 4XUJC 3AFAC 1T3UA 3LZ1D 3W96D 2CV5D 5C3IB 1TZYD 5B1MB 4QLCA 3O62B 4EO5B 3WAAD 4YM6C 3AZLC 3W96A 5AV8D 1W2EA 5AV6B 3C1CD 3AZIC 4J8XD 1S32C 3MGPA 5DNMC 1P34D 3WAAA 3REKA 2Y2NA 3AN2D 3W99D 2F8NH 5AV8A 5AV9C 4H9NB 3VH5A 3C1CA 2Y2JA 4XZQD 3UTBD 1EQZC 4CSRA 1U35B 2AROC 3AN2A 5B40B 3W99A 4CAYB 3MGSC 5CPID 5B2JD 4J8UA 3B6GC 2IO5B 5B2IA 4H9PB 3UTBA 3KUYD 3B0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI D;  5CPI A;  3TU4 B;  5JA4 B;  1P3K D;  1P3O B;  3VH5 W;  3KUY A;  3AZN B;  2F8N K;  5DNN D;  2NZD D;  3AZF D;  2BYK A;  1P3A D;  2HIO C;  4YS3 D;  4WZS B;  1F1E A;  3AZF A;  3REL C;  5BNX A;  5F99 D;  1P3A A;  4YS3 A;  3W97 C;  4KGC D;  4UUZ B;  5AVC D;  3LZ1 C;  4WU9 D;  2NQB C;  1BH8 A;  3A6N D;  2CV5 C;  4WNN A;  5B1L D;  1TZY C;  5GT0 D;  4KGC A;  4H9O B;  3WAA C;  1P3M D;  5AVC A;  5B33 B;  3X1T D;  4WU9 A;  3A6N A;  5AVB B;  3C1C C;  5B1L A;  5GT0 A;  4J8X C;  1P34 C;  4LD9 D;  1P3M A;  5BNV A;  3AN2 C;  4Z5T A;  5CP6 D;  1KX3 A;  3WTP B;  4XZQ C;  3MGR B;  4J8V B;  3AV2 C;  5CHL B;  5CPI C;  3O62 D;  5B1M D;  4R8P A;  5B2J C;  4WU8 C;  2F8N B;  3UTA B;  3REI C;  5AV6 D;  3O62 A;  3WA9 B;  2L5A A;  5B1M A;  1P3K C;  1R4V A;  3X1U B;  2NZD C;  5DNN C;  3AZF C;  5B24 A;  1HTA A;  4QLC B;  1U35 D;  3LEL C;  5B40 D;  4G92 C;  3W96 B;  5F99 C;  3REJ D;  3MGP B;  1U35 A;  3REK B;  5B40 A;  5B0Z A;  4KGC C;  3TU4 D;  5AV8 B;  5AVC C;  2YFW A;  1N1J A;  4WU9 C;  4CSR B;  5B1L C;  3W99 B;  5GT0 C;  3TU4 A;  1P3M C;  1ULY A;  5JA4 A;  4J8U B;  5B2I B;  3X1T C;  3UTB B;  3KWQ A;  1M18 D;  5BT1 C;  3REH C;  1P3L B;  4LD9 C;  5CP6 C;  5AV5 D;  3KUY B;  4WV4 B;  1M18 A;  2BYK B;  4Z66 A;  5C3I C;  3O62 C;  5B1M C;  5AV5 A;  4EO5 C;  3MVD A;  5BNX B;  1P3A B;  4YS3 B;  5AVB D;  5AV6 C;  3AYW B;  4H9O A;  3MNN C;  1AOI B;  5B31 A;  5AVB A;  3V9R A;  3MGR D;  4J8V D;  1P3G A;  1U35 C;  3VH5 T;  3R45 A;  5B40 C;  1KX4 B;  2IO5 C;  3A6N B;  3MGR A;  4J8V A;  3REJ C;  2F8N D;  3UTA D;  4KUD A;  4Z5T B;  3WA9 D;  3TU4 C;  1KX3 B;  1P3O C;  3X1U D;  3AZN C;  2F8N A;  1TAF A;  2HUE B;  1M19 B;  3WA9 A;  4QLC D;  4R8P B;  3X1U A;  3AZG A;  4J8W B;  1A7W A;  3MGP D;  3REK D;  1KX5 D;  3WKJ B;  5BS7 C;  4Z2M G;  3B0C W;  5B24 B;  3X1V B;  1KX5 A;  3AZK D;  1P3B B;  5AY8 B;  1HQ3 B;  4J8U D;  5B33 C;  5B2I D;  2YFV B;  5E5A B;  5B0Z B;  3AZK A;  1P3L D;  5B31 G;  1Q9C A;  4DRB A;  2YFW B;  1P3P B;  3WTP C;  3LJA A;  3MGR C;  4J8V C;  2BYM A;  1P3L A;  3X1S B;  5KDM B;  3KWQ B;  3VH6 A;  3UTA C;  3AYW D;  3WA9 C;  2F8N G;  1M18 B;  1AOI D;  3X1U C;  4Z66 B;  3AYW A;  4QLC C;  5AV5 B;  1AOI A;  3MVD B;  1ZLA D;  4E44 A;  1KX4 D;  3W96 C;  3VH6 W;  1P3I A;  3MGQ A;  4H9Q A;  3MGP C;  3REK C;  1ZLA A;  4Z5T D;  5B31 B;  1KX4 A;  1KX3 D;  5AV8 C;  3V9R B;  4JJN D;  1P3G B;  3AZE B;  3R45 B;  3W99 C;  1M19 D;  4R8P D;  4J8U C;  5B2I C;  4JJN A;  3UTB C;  2CWE A;  1JFI B;  4J8W D;  4HGA B;  4KUD B;  3AZJ B;  1P3L C;  1M19 A;  3AZL B;  3LZ0 D;  3C1B D;  3KUY C;  5GXQ A;  4G91 B;  1TAF B;  3WKJ D;  4J8W A;  3AZM B;  5B24 D;  3X1V D;  3LZ0 A;  3C1B A;  3AZG B;  1P3B D;  5AY8 D;  1HQ3 D;  3WKJ A;  5E5A D;  1P3A C;  4YS3 C;  1F66 A;  3X1V A;  3AYW C;  5B0Z D;  1P3B A;  5AY8 A;  1HQ3 A;  4NE6 A;  1AOI C;  3W98 D;  2YFV A;  5E5A A;  1ID3 D;  1P3P D;  5JRG A;  1KX5 B;  3W98 A;  4ZBJ B;  1B6W A;  5B0Y A;  1ID3 A;  3X1S D;  1P3P A;  3KWQ D;  1KX4 C;  3B6F D;  3A6N C;  4H9R A;  3AZK B;  3B0D B;  1H3O A;  5B32 D;  4Z5T C;  3X1S A;  5KDM A;  1KX3 C;  3B6F A;  3LJA B;  4Z66 D;  2BYM B;  2FJ7 A;  5B32 A;  2HUE C;  1M19 C;  5CPK B;  4R8P C;  5GT3 B;  5GSU B;  3MVD D;  3B0C T;  4J8W C;  3WTP E;  5B31 D;  5B24 C;  1P3G D;  4XUJ D;  3X1V C;  3AZE D;  3REJ B;  2PYO B;  1P3B C;  1HQ3 C;  5E5A C;  1P3I B;  3MGQ B;  4XUJ A;  4H9Q B;  3AZE A;  3AV1 B;  4KUD D;  5B0Z C;  3AFA A;  3AZJ D;  1ZLA B;  4YM6 D;  3AZL D;  1P3P C;  1JFI A;  3AZI D;  4H9S A;  3AZJ A;  3AZM D;  4YM6 A;  3AZL A;  3X1S C;  4JJN B;  3KWQ C;  3AZG D;  3AZI A;  1EQZ D;  3KXB B;  5DNM A;  3AZM A;  3LEL B;  5BO0 A;  3VH6 T;  5AV9 A;  2LY8 A;  1M18 C;  5GXQ B;  1EQZ A;  5B32 G;  2ARO A;  4Z66 C;  3LZ0 B;  3C1B B;  5AV5 C;  3B6G A;  3MVD C;  4AWL B;  1M1A B;  4Z2M H;  1F66 B;  1KU5 A;  2HIO D;  4NE3 A;  1P3F B;  3NQU B;  5B31 C;  3REL D;  3NQJ B;  5AVB C;  2HIO A;  5JRG B;  3LJA D;  4ZUX B;  1P3G C;  3AZE C;  3W98 B;  3W97 D;  4X23 B;  5B0Y B;  5CPK D;  3REL A;  1ID3 B;  5GT3 D;  5GSU D;  2NQB D;  4H9R B;  3AZH B;  3W97 A;  1H3O B;  4KUD C;  4HGA C;  2JSS A;  4H9S C;  3AZJ C;  5CPK A;  5GT3 A;  3B6F B;  5GSU A;  3LZ1 A;  2NQB A;  1B67 A;  2CV5 A;  4G91 C;  1BH9 B;  1TZY A;  2FJ7 B;  5B32 B;  3MNN B;  3AZM C;  5CPJ B;  2PYO D;  3AZG C;  3AV2 D;  4J8X A;  1P34 A;  1P3I D;  3MGQ D;  3AV1 D;  2PYO A;  4XZQ A;  3AV2 A;  4WU8 D;  3UT9 B;  5G49 B;  3AV1 A;  1KX5 C;  5B2J A;  4ZBJ C;  4WU8 A;  4E45 A;  1WWS A;  3REI A;  4XUJ B;  3KXB D;  3AFA B;  3AZK C;  1P3K A;  3B0D C;  3LEL D;  4DRA A;  2NZD A;  5DNN A;  5GXQ D;  3KXB A;  3LJA C;  3LEL A;  4YM6 B;  5CPK C;  5F99 A;  5GT3 C;  5GSU C;  3AZI B;  1S32 B;  4KHA A;  5DNM B;  1M1A D;  1F66 D;  5BO0 B;  5AV9 B;  1P3F D;  1EQZ B;  5BT1 D;  1M1A A;  2ARO B;  3REH D;  3MGS B;  5JRG D;  4ZUX D;  3B6G B;  3X1T A;  4X23 D;  1P3F A;  2PYO C;  5FUG B;  3NQU A;  5B0Y D;  3REH A;  3NQJ A;  4LD9 A;  4ZUX A;  1P3I C;  5CP6 A;  3MGQ C;  3AZH D;  1BFM A;  4X23 A;  3AV1 C;  1ZLA C;  2HIO B;  3AZH A;  2FJ7 D;  4M6B A;  3MNN D;  3REL B;  5CPJ D;  4JJN C;  5AV6 A;  1BH9 A;  3W97 B;  3KXB C;  3KSY A;  3MNN A;  5CPJ A;  3LZ1 B;  4H9N A;  2NQB B;  2RVQ D;  5GXQ C;  2CV5 B;  1TZY B;  3UT9 D;  3WAA B;  4CAY A;  3LZ0 C;  3C1B C;  1P3O D;  4H9P A;  3C1C B;  3WKJ C;  3REJ A;  4AWL C;  4J8X B;  3UT9 A;  3AZN D;  1P34 B;  1M1A C;  3AN2 B;  1F66 C;  5G49 A;  3AFA D;  1P3O A;  5AY8 C;  4XZQ B;  3AZN A;  3AV2 B;  1P3F C;  4NFT A;  5CPI B;  5JRG C;  5B2J B;  4ZUX C;  3W98 C;  4X23 C;  4WU8 B;  5B0Y C;  1ID3 C;  3REI B;  1S32 D;  5DNM D;  1P3K B;  3AZH C;  2NZD B;  5DNN B;  4UUZ A;  3AZF B;  5AV9 D;  3B6F C;  5B33 D;  5BS7 A;  1S32 A;  2ARO D;  2FJ7 C;  3MGS D;  5B32 C;  4G92 B;  5F99 B;  5B33 A;  3B6G D;  5CPJ C;  3WTP D;  4NE5 A;  1BH8 B;  4KHA B;  4WNN B;  3MGS A;  4KGC B;  5AVC B;  3WTP A;  4WU9 B;  5FUG A;  2RVQ C;  5B1L B;  5GT0 B;  3UT9 C;  1P3M B;  5BNV B;  3X1T B;  3REH B;  3UTA A;  4LD9 B;  1WWI A;  5CP6 B;  4XUJ C;  3AFA C;  3LZ1 D;  3W96 D;  2CV5 D;  5C3I B;  1TZY D;  5B1M B;  4QLC A;  3O62 B;  4EO5 B;  3WAA D;  4YM6 C;  3AZL C;  3W96 A;  5AV8 D;  5AV6 B;  3C1C D;  3AZI C;  4J8X D;  1S32 C;  3MGP A;  5DNM C;  1P34 D;  3WAA A;  3REK A;  3AN2 D;  2F8N H;  3W99 D;  4H9N B;  5AV8 A;  5AV9 C;  3VH5 A;  3C1C A;  4XZQ D;  3UTB D;  1EQZ C;  4CSR A;  1U35 B;  2ARO C;  4H9P B;  3AN2 A;  5B40 B;  3W99 A;  4CAY B;  3MGS C;  5CPI D;  5B2J D;  4J8U A;  3B6G C;  2IO5 B;  5B2I A;  1N1J B;  3UTB A;  3KUY D;  3B0B A; 
#chains in the Genus database with same CATH topology
 3REI D;  5CPI A;  3TU4 B;  5JA4 B;  1P3K D;  1P3O B;  3VH5 W;  3KUY A;  3AZN B;  2F8N K;  5DNN D;  2NZD D;  3AZF D;  2BYK A;  1P3A D;  2HIO C;  2UWX A;  4YS3 D;  4WZS B;  3F6T A;  1F1E A;  2Y2O A;  3AZF A;  3REL C;  5BNX A;  5F99 D;  1P3A A;  4YS3 A;  3W97 C;  4KGC D;  4UUZ B;  5AVC D;  3LZ1 C;  4WU9 D;  2NQB C;  1BH8 A;  3A6N D;  2CV5 C;  4WNN A;  5B1L D;  1TZY C;  5GT0 D;  4KGC A;  4H9O B;  3WAA C;  1P3M D;  5AVC A;  5B33 B;  3X1T D;  4WU9 A;  3A6N A;  5AVB B;  3C1C C;  5B1L A;  5GT0 A;  4J8X C;  1P34 C;  4LD9 D;  1P3M A;  5BNV A;  3AN2 C;  2ZY4 A;  4Z5T A;  5CP6 D;  1KX3 A;  3WTP B;  4XZQ C;  3MGR B;  4J8V B;  3AV2 C;  5CHL B;  5CPI C;  3O62 D;  5B1M D;  4R8P A;  5B2J C;  4WU8 C;  2F8N B;  3UTA B;  3REI C;  5AV6 D;  3O62 A;  3WA9 B;  2L5A A;  5B1M A;  1P3K C;  2J8P A;  1R4V A;  3X1U B;  2NZD C;  5DNN C;  3AZF C;  5B24 A;  1HTA A;  4QLC B;  1U35 D;  3LEL C;  5B40 D;  4G92 C;  3W96 B;  5F99 C;  3REJ D;  3MGP B;  1U35 A;  3REK B;  5B40 A;  5B0Z A;  4KGC C;  3TU4 D;  5AV8 B;  5AVC C;  2VQR A;  2YFW A;  1N1J A;  4WU9 C;  4CSR B;  5B1L C;  3W99 B;  5GT0 C;  3TU4 A;  1P3M C;  1ULY A;  3H0L C;  5JA4 A;  4J8U B;  5B2I B;  3X1T C;  3UTB B;  3KWQ A;  1M18 D;  5BT1 C;  3REH C;  1P3L B;  4LD9 C;  5CP6 C;  5AV5 D;  3KUY B;  4WV4 B;  1M18 A;  2BYK B;  4Z66 A;  5C3I C;  3O62 C;  5B1M C;  5AV5 A;  4EO5 C;  3MVD A;  5BNX B;  1P3A B;  4YS3 B;  5AVB D;  5AV6 C;  3AYW B;  3KFU G;  4H9O A;  3MNN C;  3P5J B;  1AOI B;  5B31 A;  5AVB A;  3V9R A;  3MGR D;  4J8V D;  4UPK A;  1P3G A;  1U35 C;  3VH5 T;  2G5I C;  3R45 A;  5B40 C;  2DF4 C;  1KX4 B;  2IO5 C;  3A6N B;  3A1I A;  3MGR A;  4J8V A;  3REJ C;  2F8N D;  3UTA D;  4KUD A;  2JCH A;  4Z5T B;  3WA9 D;  3TU4 C;  1KX3 B;  1P3O C;  3X1U D;  3AZN C;  2F8N A;  1TAF A;  2HUE B;  1M19 B;  3WA9 A;  4QLC D;  4R8P B;  3X1U A;  3AZG A;  4J8W B;  1A7W A;  3EPH A;  2W8S A;  3MGP D;  3REK D;  1KX5 D;  2ZY5 A;  3WKJ B;  5BS7 C;  4Z2M G;  3B0C W;  5B24 B;  3X1V B;  1KX5 A;  2Y2H A;  3AZK D;  1P3B B;  5AY8 B;  1HQ3 B;  4J8U D;  5B33 C;  5B2I D;  2YFV B;  5E5A B;  5B0Z B;  3AZK A;  1P3L D;  5B31 G;  1Q9C A;  4DRB A;  2YFW B;  1P3P B;  3WTP C;  3LJA A;  3MGR C;  4J8V C;  2BYM A;  1P3L A;  3X1S B;  5KDM B;  3KWQ B;  3VH6 A;  3UTA C;  3AYW D;  3WA9 C;  2F8N G;  1M18 B;  1AOI D;  2Y2G A;  3X1U C;  4Z66 B;  3AYW A;  4QLC C;  5AV5 B;  1AOI A;  2Y2P A;  3MVD B;  1ZLA D;  4E44 A;  1KX4 D;  3W96 C;  3VH6 W;  1P3I A;  3MGQ A;  4H9Q A;  3MGP C;  3REK C;  1ZLA A;  4Z5T D;  5B31 B;  1KX4 A;  1KX3 D;  5AV8 C;  3V9R B;  4JJN D;  1P3G B;  3AZE B;  3R45 B;  3W99 C;  1M19 D;  4R8P D;  4J8U C;  5B2I C;  4JJN A;  3UTB C;  2CWE A;  1JFI B;  4J8W D;  4HGA B;  4KUD B;  3AZJ B;  1P3L C;  1M19 A;  3AZL B;  3LZ0 D;  3C1B D;  3KUY C;  5GXQ A;  4G91 B;  1TAF B;  3WKJ D;  4J8W A;  3EG5 B;  4DQY B;  3AZM B;  5B24 D;  3X1V D;  3LZ0 A;  3C1B A;  3AZG B;  1P3B D;  5AY8 D;  1HQ3 D;  3WKJ A;  5E5A D;  1P3A C;  4YS3 C;  1F66 A;  3X1V A;  3AYW C;  5B0Z D;  1P3B A;  5AY8 A;  1HQ3 A;  4NE6 A;  3EPJ A;  1AOI C;  3W98 D;  2YFV A;  5E5A A;  1ID3 D;  1P3P D;  5JRG A;  1KX5 B;  3W98 A;  4ZBJ B;  1B6W A;  5B0Y A;  1ID3 A;  3X1S D;  1P3P A;  3KWQ D;  1KX4 C;  3B6F D;  3A6N C;  4H9R A;  3AZK B;  3B0D B;  1H3O A;  2RIQ A;  5B32 D;  4Z5T C;  3X1S A;  5KDM A;  1PZR A;  1KX3 C;  3B6F A;  3LJA B;  4Z66 D;  2BYM B;  2FJ7 A;  5B32 A;  2HUE C;  1M19 C;  5CPK B;  4R8P C;  5GT3 B;  5GSU B;  3MVD D;  3B0C T;  4J8W C;  3WTP E;  5B31 D;  2Y2Q A;  5B24 C;  1P3G D;  4XUJ D;  3X1V C;  3AZE D;  3REJ B;  2PYO B;  1P3B C;  1HQ3 C;  2F2A C;  5E5A C;  1P3I B;  3MGQ B;  3H0R C;  4H9Q B;  4XUJ A;  3AZE A;  3AV1 B;  4KUD D;  5B0Z C;  3AFA A;  3AZJ D;  1ZLA B;  4YM6 D;  3AZL D;  1P3P C;  1JFI A;  3AZI D;  3EPL A;  4H9S A;  3AZJ A;  3AZM D;  4YM6 A;  3AZL A;  3AL0 C;  2DQN C;  4JJN B;  3KWQ C;  3AZG D;  3X1S C;  3AZI A;  1EQZ D;  3KXB B;  5DNM A;  3AZM A;  3LEL B;  5BO0 A;  3VH6 T;  5AV9 A;  2LY8 A;  1M18 C;  5GXQ B;  1EQZ A;  5B32 G;  2FFF B;  3A1K A;  2ARO A;  4Z66 C;  3LZ0 B;  3C1B B;  5AV5 C;  3B6G A;  3MVD C;  4AWL B;  1M1A B;  4Z2M H;  1F66 B;  1KU5 A;  3FDD A;  2HIO D;  4NE3 A;  1P3F B;  3NQU B;  5B31 C;  3REL D;  3NQJ B;  2Y2L A;  5AVB C;  2HIO A;  5JRG B;  3LJA D;  4ZUX B;  1P3G C;  3AZE C;  3W98 B;  3W97 D;  4X23 B;  5B0Y B;  5CPK D;  3REL A;  1ID3 B;  5GT3 D;  5GSU D;  2NQB D;  4H9R B;  3AZH B;  3W97 A;  1H3O B;  4KUD C;  4HGA C;  2JSS A;  4H9S C;  3AZJ C;  5CPK A;  2XD1 A;  5GT3 A;  3B6F B;  5GSU A;  3LZ1 A;  2NQB A;  1B67 A;  2CV5 A;  4G91 C;  1BH9 B;  1TZY A;  2FJ7 B;  5B32 B;  3MNN B;  3AZM C;  5CPJ B;  2PYO D;  3AZG C;  3AV2 D;  4J8X A;  1P34 A;  1P3I D;  3MGQ D;  3AV1 D;  2PYO A;  4XZQ A;  3AV2 A;  4WU8 D;  3UT9 B;  5G49 B;  3AV1 A;  1KX5 C;  5B2J A;  4ZBJ C;  4WU8 A;  2Y2I A;  4E45 A;  1WWS A;  3REI A;  4XUJ B;  1Z2C B;  3KXB D;  3AFA B;  3AZK C;  1P3K A;  3B0D C;  3LEL D;  2ZM5 A;  2Y2M A;  4DRA A;  2NZD A;  5DNN A;  5GXQ D;  3KXB A;  3LJA C;  3LEL A;  4YM6 B;  5CPK C;  5F99 A;  5GT3 C;  5GSU C;  3AZI B;  1S32 B;  4KHA A;  5DNM B;  1M1A D;  1F66 D;  5BO0 B;  5AV9 B;  2G5H C;  1P3F D;  1EQZ B;  5BT1 D;  1M1A A;  2ARO B;  3REH D;  3MGS B;  5JRG D;  4ZUX D;  3B6G B;  3X1T A;  4X23 D;  1P3F A;  2PYO C;  5FUG B;  3NQU A;  5B0Y D;  2Y2K A;  3REH A;  3NQJ A;  4WJ3 C;  4LD9 A;  4ZUX A;  1P3I C;  5CP6 A;  3MGQ C;  3AZH D;  1BFM A;  4X23 A;  3AV1 C;  1ZLA C;  3IP4 C;  2HIO B;  2XD5 A;  3AZH A;  2FJ7 D;  4M6B A;  3MNN D;  3REL B;  5CPJ D;  4JJN C;  2BG1 A;  5AV6 A;  1BH9 A;  3EPK A;  3KXB C;  3KSY A;  3W97 B;  3MNN A;  2ZY3 A;  5CPJ A;  3LZ1 B;  4H9N A;  2NQB B;  2RVQ D;  5GXQ C;  2CV5 B;  1TZY B;  3UT9 D;  3WAA B;  4CAY A;  3LZ0 C;  3C1B C;  1P3O D;  4H9P A;  3C1C B;  3WKJ C;  3REJ A;  4AWL C;  4J8X B;  3UT9 A;  3H0M C;  3AZN D;  1P34 B;  1M1A C;  3AN2 B;  1F66 C;  5G49 A;  3AFA D;  1P3O A;  5AY8 C;  4XZQ B;  3AZN A;  3AV2 B;  1P3F C;  4NFT A;  5CPI B;  5JRG C;  5B2J B;  4ZUX C;  3W98 C;  4X23 C;  4WU8 B;  5B0Y C;  1ID3 C;  3REI B;  1S32 D;  5DNM D;  1P3K B;  3AZH C;  2NZD B;  5DNN B;  4UUZ A;  3AZF B;  5AV9 D;  3B6F C;  5B33 D;  5BS7 A;  1S32 A;  2ARO D;  2FJ7 C;  3MGS D;  5B32 C;  1N1J B;  4G92 B;  5F99 B;  5B33 A;  2JE5 A;  5CPJ C;  3B6G D;  3WTP D;  4NE5 A;  1BH8 B;  4KHA B;  4WNN B;  3MGS A;  4KGC B;  5AVC B;  3WTP A;  4WU9 B;  5FUG A;  2RVQ C;  2ZY2 A;  5B1L B;  5GT0 B;  3UT9 C;  1P3M B;  5BNV B;  3X1T B;  3REH B;  3UTA A;  4LD9 B;  1WWI A;  5CP6 B;  4XUJ C;  3AFA C;  1T3U A;  3LZ1 D;  3W96 D;  2CV5 D;  5C3I B;  1TZY D;  5B1M B;  4QLC A;  3O62 B;  4EO5 B;  3WAA D;  4YM6 C;  3AZL C;  3W96 A;  5AV8 D;  1W2E A;  5AV6 B;  3C1C D;  3AZI C;  4J8X D;  1S32 C;  3MGP A;  5DNM C;  1P34 D;  3WAA A;  3REK A;  2Y2N A;  3AN2 D;  3W99 D;  2F8N H;  5AV8 A;  5AV9 C;  4H9N B;  3VH5 A;  3C1C A;  2Y2J A;  4XZQ D;  3UTB D;  1EQZ C;  4CSR A;  1U35 B;  2ARO C;  3AN2 A;  5B40 B;  3W99 A;  4CAY B;  3MGS C;  5CPI D;  5B2J D;  4J8U A;  3B6G C;  2IO5 B;  5B2I A;  4H9P B;  3UTB A;  3KUY D;  3B0B A; 
#chains in the Genus database with same CATH homology
 3REI D;  5CPI A;  3TU4 B;  5JA4 B;  1P3K D;  1P3O B;  3VH5 W;  3KUY A;  3AZN B;  2F8N K;  5DNN D;  2NZD D;  3AZF D;  2BYK A;  1P3A D;  2HIO C;  2UWX A;  4YS3 D;  4WZS B;  3F6T A;  1F1E A;  2Y2O A;  3AZF A;  3REL C;  5BNX A;  5F99 D;  1P3A A;  4YS3 A;  3W97 C;  4KGC D;  4UUZ B;  5AVC D;  3LZ1 C;  4WU9 D;  2NQB C;  1BH8 A;  3A6N D;  2CV5 C;  4WNN A;  5B1L D;  1TZY C;  5GT0 D;  4KGC A;  4H9O B;  3WAA C;  1P3M D;  5AVC A;  5B33 B;  3X1T D;  4WU9 A;  3A6N A;  5AVB B;  3C1C C;  5B1L A;  5GT0 A;  4J8X C;  1P34 C;  4LD9 D;  1P3M A;  5BNV A;  3AN2 C;  2ZY4 A;  4Z5T A;  5CP6 D;  1KX3 A;  3WTP B;  4XZQ C;  3MGR B;  4J8V B;  3AV2 C;  5CHL B;  5CPI C;  3O62 D;  5B1M D;  4R8P A;  5B2J C;  4WU8 C;  2F8N B;  3UTA B;  3REI C;  5AV6 D;  3O62 A;  3WA9 B;  2L5A A;  5B1M A;  1P3K C;  2J8P A;  1R4V A;  3X1U B;  2NZD C;  5DNN C;  3AZF C;  5B24 A;  1HTA A;  4QLC B;  1U35 D;  3LEL C;  5B40 D;  4G92 C;  3W96 B;  5F99 C;  3REJ D;  3MGP B;  1U35 A;  3REK B;  5B40 A;  5B0Z A;  4KGC C;  3TU4 D;  5AV8 B;  5AVC C;  2VQR A;  2YFW A;  1N1J A;  4WU9 C;  4CSR B;  5B1L C;  3W99 B;  5GT0 C;  3TU4 A;  1P3M C;  1ULY A;  3H0L C;  5JA4 A;  4J8U B;  5B2I B;  3X1T C;  3UTB B;  3KWQ A;  1M18 D;  5BT1 C;  3REH C;  1P3L B;  4LD9 C;  5CP6 C;  5AV5 D;  3KUY B;  4WV4 B;  1M18 A;  2BYK B;  4Z66 A;  5C3I C;  3O62 C;  5B1M C;  5AV5 A;  4EO5 C;  3MVD A;  5BNX B;  1P3A B;  4YS3 B;  5AVB D;  5AV6 C;  3AYW B;  3KFU G;  4H9O A;  3MNN C;  3P5J B;  1AOI B;  5B31 A;  5AVB A;  3V9R A;  3MGR D;  4J8V D;  4UPK A;  1P3G A;  1U35 C;  3VH5 T;  2G5I C;  3R45 A;  5B40 C;  2DF4 C;  1KX4 B;  2IO5 C;  3A6N B;  3A1I A;  3MGR A;  4J8V A;  3REJ C;  2F8N D;  3UTA D;  4KUD A;  2JCH A;  4Z5T B;  3WA9 D;  3TU4 C;  1KX3 B;  1P3O C;  3X1U D;  3AZN C;  2F8N A;  1TAF A;  2HUE B;  1M19 B;  3WA9 A;  4QLC D;  4R8P B;  3X1U A;  3AZG A;  4J8W B;  1A7W A;  3EPH A;  2W8S A;  3MGP D;  3REK D;  1KX5 D;  2ZY5 A;  3WKJ B;  5BS7 C;  4Z2M G;  3B0C W;  5B24 B;  3X1V B;  1KX5 A;  2Y2H A;  3AZK D;  1P3B B;  5AY8 B;  1HQ3 B;  4J8U D;  5B33 C;  5B2I D;  2YFV B;  5E5A B;  5B0Z B;  3AZK A;  1P3L D;  5B31 G;  1Q9C A;  4DRB A;  2YFW B;  1P3P B;  3WTP C;  3LJA A;  3MGR C;  4J8V C;  2BYM A;  1P3L A;  3X1S B;  5KDM B;  3KWQ B;  3VH6 A;  3UTA C;  3AYW D;  3WA9 C;  2F8N G;  1M18 B;  1AOI D;  2Y2G A;  3X1U C;  4Z66 B;  3AYW A;  4QLC C;  5AV5 B;  1AOI A;  2Y2P A;  3MVD B;  1ZLA D;  4E44 A;  1KX4 D;  3W96 C;  3VH6 W;  1P3I A;  3MGQ A;  4H9Q A;  3MGP C;  3REK C;  1ZLA A;  4Z5T D;  5B31 B;  1KX4 A;  1KX3 D;  5AV8 C;  3V9R B;  4JJN D;  1P3G B;  3AZE B;  3R45 B;  3W99 C;  1M19 D;  4R8P D;  4J8U C;  5B2I C;  4JJN A;  3UTB C;  2CWE A;  1JFI B;  4J8W D;  4HGA B;  4KUD B;  3AZJ B;  1P3L C;  1M19 A;  3AZL B;  3LZ0 D;  3C1B D;  3KUY C;  5GXQ A;  4G91 B;  1TAF B;  3WKJ D;  4J8W A;  3EG5 B;  4DQY B;  3AZM B;  5B24 D;  3X1V D;  3LZ0 A;  3C1B A;  3AZG B;  1P3B D;  5AY8 D;  1HQ3 D;  3WKJ A;  5E5A D;  1P3A C;  4YS3 C;  1F66 A;  3X1V A;  3AYW C;  5B0Z D;  1P3B A;  5AY8 A;  1HQ3 A;  4NE6 A;  3EPJ A;  1AOI C;  3W98 D;  2YFV A;  5E5A A;  1ID3 D;  1P3P D;  5JRG A;  1KX5 B;  3W98 A;  4ZBJ B;  1B6W A;  5B0Y A;  1ID3 A;  3X1S D;  1P3P A;  3KWQ D;  1KX4 C;  3B6F D;  3A6N C;  4H9R A;  3AZK B;  3B0D B;  1H3O A;  2RIQ A;  5B32 D;  4Z5T C;  3X1S A;  5KDM A;  1PZR A;  1KX3 C;  3B6F A;  3LJA B;  4Z66 D;  2BYM B;  2FJ7 A;  5B32 A;  2HUE C;  1M19 C;  5CPK B;  4R8P C;  5GT3 B;  5GSU B;  3MVD D;  3B0C T;  4J8W C;  3WTP E;  5B31 D;  2Y2Q A;  5B24 C;  1P3G D;  4XUJ D;  3X1V C;  3AZE D;  3REJ B;  2PYO B;  1P3B C;  1HQ3 C;  2F2A C;  5E5A C;  1P3I B;  3MGQ B;  3H0R C;  4H9Q B;  4XUJ A;  3AZE A;  3AV1 B;  4KUD D;  5B0Z C;  3AFA A;  3AZJ D;  1ZLA B;  4YM6 D;  3AZL D;  1P3P C;  1JFI A;  3AZI D;  3EPL A;  4H9S A;  3AZJ A;  3AZM D;  4YM6 A;  3AZL A;  3AL0 C;  2DQN C;  4JJN B;  3KWQ C;  3AZG D;  3X1S C;  3AZI A;  1EQZ D;  3KXB B;  5DNM A;  3AZM A;  3LEL B;  5BO0 A;  3VH6 T;  5AV9 A;  2LY8 A;  1M18 C;  5GXQ B;  1EQZ A;  5B32 G;  2FFF B;  3A1K A;  2ARO A;  4Z66 C;  3LZ0 B;  3C1B B;  5AV5 C;  3B6G A;  3MVD C;  4AWL B;  1M1A B;  4Z2M H;  1F66 B;  1KU5 A;  3FDD A;  2HIO D;  4NE3 A;  1P3F B;  3NQU B;  5B31 C;  3REL D;  3NQJ B;  2Y2L A;  5AVB C;  2HIO A;  5JRG B;  3LJA D;  4ZUX B;  1P3G C;  3AZE C;  3W98 B;  3W97 D;  4X23 B;  5B0Y B;  5CPK D;  3REL A;  1ID3 B;  5GT3 D;  5GSU D;  2NQB D;  4H9R B;  3AZH B;  3W97 A;  1H3O B;  4KUD C;  4HGA C;  2JSS A;  4H9S C;  3AZJ C;  5CPK A;  2XD1 A;  5GT3 A;  3B6F B;  5GSU A;  3LZ1 A;  2NQB A;  1B67 A;  2CV5 A;  4G91 C;  1BH9 B;  1TZY A;  2FJ7 B;  5B32 B;  3MNN B;  3AZM C;  5CPJ B;  2PYO D;  3AZG C;  3AV2 D;  4J8X A;  1P34 A;  1P3I D;  3MGQ D;  3AV1 D;  2PYO A;  4XZQ A;  3AV2 A;  4WU8 D;  3UT9 B;  5G49 B;  3AV1 A;  1KX5 C;  5B2J A;  4ZBJ C;  4WU8 A;  2Y2I A;  4E45 A;  1WWS A;  3REI A;  4XUJ B;  1Z2C B;  3KXB D;  3AFA B;  3AZK C;  1P3K A;  3B0D C;  3LEL D;  2ZM5 A;  2Y2M A;  4DRA A;  2NZD A;  5DNN A;  5GXQ D;  3KXB A;  3LJA C;  3LEL A;  4YM6 B;  5CPK C;  5F99 A;  5GT3 C;  5GSU C;  3AZI B;  1S32 B;  4KHA A;  5DNM B;  1M1A D;  1F66 D;  5BO0 B;  5AV9 B;  2G5H C;  1P3F D;  1EQZ B;  5BT1 D;  1M1A A;  2ARO B;  3REH D;  3MGS B;  5JRG D;  4ZUX D;  3B6G B;  3X1T A;  4X23 D;  1P3F A;  2PYO C;  5FUG B;  3NQU A;  5B0Y D;  2Y2K A;  3REH A;  3NQJ A;  4WJ3 C;  4LD9 A;  4ZUX A;  1P3I C;  5CP6 A;  3MGQ C;  3AZH D;  1BFM A;  4X23 A;  3AV1 C;  1ZLA C;  3IP4 C;  2HIO B;  2XD5 A;  3AZH A;  2FJ7 D;  4M6B A;  3MNN D;  3REL B;  5CPJ D;  4JJN C;  2BG1 A;  5AV6 A;  1BH9 A;  3EPK A;  3KXB C;  3KSY A;  3W97 B;  3MNN A;  2ZY3 A;  5CPJ A;  3LZ1 B;  4H9N A;  2NQB B;  2RVQ D;  5GXQ C;  2CV5 B;  1TZY B;  3UT9 D;  3WAA B;  4CAY A;  3LZ0 C;  3C1B C;  1P3O D;  4H9P A;  3C1C B;  3WKJ C;  3REJ A;  4AWL C;  4J8X B;  3UT9 A;  3H0M C;  3AZN D;  1P34 B;  1M1A C;  3AN2 B;  1F66 C;  5G49 A;  3AFA D;  1P3O A;  5AY8 C;  4XZQ B;  3AZN A;  3AV2 B;  1P3F C;  4NFT A;  5CPI B;  5JRG C;  5B2J B;  4ZUX C;  3W98 C;  4X23 C;  4WU8 B;  5B0Y C;  1ID3 C;  3REI B;  1S32 D;  5DNM D;  1P3K B;  3AZH C;  2NZD B;  5DNN B;  4UUZ A;  3AZF B;  5AV9 D;  3B6F C;  5B33 D;  5BS7 A;  1S32 A;  2ARO D;  2FJ7 C;  3MGS D;  5B32 C;  1N1J B;  4G92 B;  5F99 B;  5B33 A;  2JE5 A;  5CPJ C;  3B6G D;  3WTP D;  4NE5 A;  1BH8 B;  4KHA B;  4WNN B;  3MGS A;  4KGC B;  5AVC B;  3WTP A;  4WU9 B;  5FUG A;  2RVQ C;  2ZY2 A;  5B1L B;  5GT0 B;  3UT9 C;  1P3M B;  5BNV B;  3X1T B;  3REH B;  3UTA A;  4LD9 B;  1WWI A;  5CP6 B;  4XUJ C;  3AFA C;  1T3U A;  3LZ1 D;  3W96 D;  2CV5 D;  5C3I B;  1TZY D;  5B1M B;  4QLC A;  3O62 B;  4EO5 B;  3WAA D;  4YM6 C;  3AZL C;  3W96 A;  5AV8 D;  1W2E A;  5AV6 B;  3C1C D;  3AZI C;  4J8X D;  1S32 C;  3MGP A;  5DNM C;  1P34 D;  3WAA A;  3REK A;  2Y2N A;  3AN2 D;  3W99 D;  2F8N H;  5AV8 A;  5AV9 C;  4H9N B;  3VH5 A;  3C1C A;  2Y2J A;  4XZQ D;  3UTB D;  1EQZ C;  4CSR A;  1U35 B;  2ARO C;  3AN2 A;  5B40 B;  3W99 A;  4CAY B;  3MGS C;  5CPI D;  5B2J D;  4J8U A;  3B6G C;  2IO5 B;  5B2I A;  4H9P B;  3UTB A;  3KUY D;  3B0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...