4J8WB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wB00
5B1MB 1M1AD 3REHB 5AVBA 2BYMB 4YS3A 5CP6A 4Z5TA 3X1UD 3KXBD 5CPJA 4XZQB 1P3OB 4YM6D 5FUGB 5B2ID 3WKJC 1U35C 1KX4A 1M19C 4ZUXC 3WA9D 3A6NB 3C1BD 1HQ3C 5B2JC 2BYKB 4Z66D 1S32A 3AV1D 3WKJA 1KX5B 1M19A 4ZUXA 3KWQC 5GSUD 1HQ3A 3TU4A 5B2JA 4J8VB 3REJC 3B6GC 4ZBJB 5GT3A 5AVBB 3KWQA 5CPJB 3REIB 3RELC 3REJA 3B6GA 2YFVA 1P3IB 4WV4B 5AV9B 3AZLB 3UTBD 3R45A 3RELA 5B32C 1P34D 3AV2C 5B24A 3AZED 3WKJB 1U35B 5BNVA 1M19B 5B0ZC 4G91B 4XZQD 4KHAB 5BS7C 1P3OD 5B2JB 5GXQC 3AZIC 3AV2A 4KGCA 5BNXA 5B0ZA 3KWQB 4LD9C 4R8PC 5BS7A 2NQBD 3AZIA 4J8XC 1KX5D 3B6GB 5B0YC 2YFVB 5AY8D 4LD9A 4R8PA 3V9RA 4J8VD 3RELB 4J8XA 3AN2C 3REID 1P3MB 2CWEA 3B0DC 1P3PD 3AZFA 1EQZB 5B32B 5BNXB 3AN2A 1P3ID 5AV9D 3AZLD 3UTAC 5GXQB 5AVCC 3AZIB 4Z2MH 5B1LB 1U35D 1TAFB 1F66A 1TZYB 5GT0D 3V9RB 5AVCA 3NQUA 5B0YB 3AZMD 3X1VB 5DNNC 5DNMC 5CPKC 1P3KC 4NE5A 3B0DB 4KUDC 3REKB 4QLCD 3VH5W 5DNMA 5CPKA 1P3KA 3O62C 4WU8A 1P3MD 1ID3C 3UTAB 1EQZD 5B32D 3X1SC 4KUDA 3MGPB 5AVCB 3O62A 1ID3A 3AZGC 5JRGD 3X1SA 5G49A 3WAAD 5B1LD 4H9NA 1P3LB 1M18B 1TZYD 1P3GC 3AZGA 1ZLAA 5B0YD 5B33D 1A7WA 5JA4A 5DNNB 3X1VD 5CPKB 3LZ1C 1P3KB 3B6FC 4WU9D 4KUDB 4H9RA 2CV5C 3UT9C 3KUYD 3B6FA 3LZ1A 3WTPB 4CSRA 3O62B 3X1TB 1P3BA 3VH5A 3REKD 5G49B 4H9NB 4E45A 2CV5A 2RVQC 1BH9A 3AZND 4M6BA 2FJ7B 3MGPD 2F8NA 1P3GB 1P3LD 1M18D 5B40D 1P3FD 5E5AA 3AZJC 1KX3C 3LZ1B 3MGSD 3LJAD 5CP6C 4Z5TC 2CV5B 5DNND 3UT9B 3AZJA 1KX3A 3MVDC 1KX4C 3LELB 2JSSA 2F8NB 3X1TD 5AV6D 3WTPD 1S32C 3MVDA 1JFIA 4J8WC 3TU4C 2FJ7D 3VH6W 3W99C 5B31G 3MGRC 1AOIC 5GT3C 4J8WA 5CPID 4AWLC 3AZJB 1KX3B 3MGRA 1AOIA 3W99A 4YS3B 2PYOC 5CP6B 4Z5TB 5CHLB 5B24C 4X23C 1KX4B 2F8NK 1P3PA 1ULYA 2F8NH 2PYOA 3UT9D 4J8UC 3W98D 3C1CD 1S32B 4KGCC 4X23A 3AYWC 5B1MD 3REHD 3LELD 4ZUXB 4J8WB 4J8UA 1HQ3B 3MGQC 3TU4B 3MNNC 3AYWA 3MGRB 1AOIB 3W99B 5GT0A 3A6ND 5GT3B 1R4VA 1H3OA 3VH6A 3AZHC 3MGQA 4AWLB 5B31A 3MNNA 4HGAC 3REJB 2PYOB 3AZHA 3AZFC 3W97C 3R45B 5B24B 5AVBD 5CPJD 5BNVB 4YS3D 4Z5TD 3NQJA 3W97A 2L5AA 3AV2B 3LZ0C 5BT1C 1B67A 4KGCB 3AYWB 3B0CT 1F66C 5B0ZB 1S32D 3MGQB 1WWSA 3LZ0A 3WKJD 1M19D 4ZUXD 3WAAA 4H9QA 1HQ3D 4R8PB 5B2JD 4LD9B 4XUJA 4HGAB 5F99C 4J8XB 5BO0A 5GT3D 3KWQD 2NZDC 4JJNC 3AZFB 3W97B 2HIOC 3REJD 1P3AC 3B6GD 5F99A 3AN2B 2NZDA 4WU8C 4JJNA 4CAYA 4E44A 3RELD 5B24D 2HIOA 1P3AA 1F66B 2AROA 4H9QB 3AFAC 3AZKA 3AV2D 5AV5C 3NQUB 4WNNA 5B0ZD 3AFAA 1HTAA 5GXQD 5AV8C 3AZID 2LY8A 1ZLAC 5AV5A 2NZDB 4LD9D 4R8PD 4JJNB 4CAYB 5AV8A 1P3AB 1Q9CA 4J8XD 5KDMA 5DNMB 4H9SC 4WU8B 3AZFD 1P3BC 1BH8A 3KXBC 3W96A 4YM6C 3AN2D 4WNNB 5B2IC 4G92C 4H9SA 1ID3B 1M1AA 3WA9C 3X1SB 3X1UA 3KXBA 3C1BC 4Z66C 4YM6A 5B2IA 3UTAD 3AZGB 3WA9A 5GSUC 5AVCD 1ZLAB 3C1BA 5E5AC 4Z66A 5JA4B 5KDMB 3AV1A 5GSUA 4H9RB 5CPIA 3B6FB 4CSRB 1P3BB 3KXBB 1P34C 1BFMA 3AZEC 5DNMD 5CPKD 1BH9B 2IO5C 1P3KD 5B2IB 4WU8D 3WA9B 4KUDD 4XZQC 3UTBA 3C1BB 1P34A 3AZEA 3O62D 1ID3D 2BYMA 3X1SD 4XZQA 1P3OA 5E5AB 5FUGA 2NQBC 1KX5C 3AZGD 5AY8C 2BYKA 4J8VC 2NQBA 1P3GD 1KX5A 5AY8A 3REIC 1P3PC 4J8VA 1P34B 3B6FD 3AZEB 2IO5B 3LZ1D 1P3BD 1P3IC 3MVDB 5AV9C 1JFIB 3AZLC 3REIA 2CV5D 5B32G 1B6WA 1P3IA 4G91C 5AV9A 3AZLA 5GT0C 2RVQD 2F8ND 2NQBB 1U35A 3AZMC 5B31C 5AY8B 3WTPE 4KHAA 5E5AD 4NE6A 3AZMA 4H9OA 1P3PB 4QLCC 3AZJD 1KX3D 1N1JA 4WZSB 4X23B 1P3MC 1EQZC 5CP6D 2HUEC 4QLCA 4J8UB 3VH5T 3MVDD 1KX4D 1P3MA 5GT0B 5JRGC 1EQZA 5B32A 3WAAC 1H3OB 5B1LC 4XUJC 3AZMB 1TZYC 5B31B 3MNNB 4H9OB 4J8WD 5JRGA 5GXQA 5B1LA 3TU4D 3AZHB 1TAFA 5B33C 1N1JB 3X1VC 1TZYA 3W99D 3MGRD 1AOID 4WU9C 3NQJB 4QLCB 5B0YA 5B33A 3KUYC 3X1VA 4DRBA 2PYOD 2AROC 3REKC 4WU9A 3AZKC 2HUEB 4EO5C 4X23D 3KUYA 3LZ0B 3AZNC 1KU5A 5JRGB 3MGPC 3REKA 4J8UD 3WAAB 4KGCD 4XUJB 3AYWD 3AZNA 1WWIA 3UTAA 5BO0B 3MGPA 1P3LC 1M18C 5B40C 1P3FC 3MGQD 4H9PA 5B33B 5B31D 3MNND 5F99B 3W96D 4WU9B 3AZHD 1P3LA 5B40A 3MGSC 3LJAC 1P3FA 1M18A 2HIOB 3KUYB 3W96C 2AROB 1M1AC 3MGSA 3LJAA 3AZKB 3W97D 3X1UC 5DNNA 4EO5B 3AZNB 3WTPC 5AV6C 3X1TC 3B0CW 3AFAB 4H9PB 4NE3A 3LZ0D 5BT1D 5AV5B 2F8NG 3WTPA 5AV6A 3X1TA 1F66D 2FJ7C 3AV1C 5B40B 1P3FB 4XUJD 2YFWA 5AV8B 5C3IC 5CPIC 3VH6T 2FJ7A 3MGSB 3LJAB 1BH8B 4DRAA 3B0BA 1P3GA 5F99D 3W96B 2NZDD 4UUZA 4JJND 1M1AB 2HIOD 1P3AD 3X1UB 3UTBC 3W98C 3C1CC 5AV6B 4YM6B 2AROD 5B1MC 4G92B 3REHC 3AZKD 3LELC 2YFWB 3UT9A 1P3OC 3W98A 3C1CA 4Z66B 3KSYA 3AV1B 5B1MA 3AFAD 3REHA 3A6NC 3LELA 5AV5D 5GSUB 5C3IB 5CPIB 1F1EA 4UUZB 4Z2MG 3A6NA 5AV8D 1ZLAD 4NFTA 4ZBJC 5AVBC 4YS3C 5CPJC 3UTBB 3W98B 3C1CB
chains in the Genus database with same CATH superfamily
5B1MB 1M1AD 3REHB 5AVBA 2BYMB 2JCHA 5CP6A 4Z5TA 3X1UD 3KXBD 4YS3A 4XZQB 5CPJA 1P3OB 4YM6D 2UWXA 5FUGB 5B2ID 3WKJC 1U35C 1KX4A 1M19C 4ZUXC 3WA9D 3A6NB 3C1BD 1HQ3C 5B2JC 2BYKB 4Z66D 1S32A 3AV1D 3WKJA 1KX5B 1M19A 4ZUXA 3KWQC 5GSUD 1HQ3A 3TU4A 5B2JA 4J8VB 3REJC 3B6GC 4ZBJB 5GT3A 5AVBB 3KWQA 5CPJB 3REIB 3RELC 3REJA 3B6GA 2YFVA 1P3IB 4WV4B 5AV9B 3AZLB 3UTBD 3R45A 3RELA 5B32C 1P34D 3AV2C 5B24A 3AZED 3WKJB 1U35B 5BNVA 1M19B 5B0ZC 4G91B 4XZQD 4KHAB 2Y2JA 5BS7C 1P3OD 5B2JB 5GXQC 3AZIC 3EPLA 3AV2A 4KGCA 5BNXA 5B0ZA 3KWQB 4LD9C 4R8PC 5BS7A 2NQBD 3AZIA 4J8XC 1KX5D 3B6GB 5B0YC 2Y2KA 2YFVB 5AY8D 4LD9A 4R8PA 3V9RA 2Y2OA 4J8VD 3RELB 4J8XA 3AN2C 3REID 1P3MB 2CWEA 3B0DC 1P3PD 3AZFA 1EQZB 5B32B 5BNXB 3AN2A 1P3ID 5AV9D 3AZLD 3UTAC 2Y2IA 5GXQB 5AVCC 3AZIB 4Z2MH 5B1LB 1U35D 1TAFB 1F66A 1TZYB 5GT0D 3V9RB 2DQNC 3NQUA 5AVCA 5B0YB 3AZMD 3X1VB 2J8PA 3IP4C 5DNNC 5DNMC 5CPKC 1P3KC 2RIQA 4NE5A 3B0DB 4KUDC 3REKB 4QLCD 3VH5W 5DNMA 5CPKA 1P3KA 3O62C 4WU8A 2Y2MA 1P3MD 1ID3C 3UTAB 1EQZD 5B32D 3X1SC 4KUDA 3MGPB 3H0LC 5AVCB 3O62A 1ID3A 3AZGC 5JRGD 3X1SA 5G49A 3WAAD 5B1LD 4H9NA 1P3LB 1M18B 1TZYD 1P3GC 3AZGA 1ZLAA 5B0YD 5B33D 1A7WA 5JA4A 5DNNB 3X1VD 5CPKB 3LZ1C 1P3KB 3B6FC 4WU9D 4KUDB 4H9RA 2CV5C 3UT9C 3KUYD 3B6FA 3LZ1A 3WTPB 4CSRA 3O62B 3X1TB 1P3BA 4UPKA 3VH5A 3REKD 5G49B 4H9NB 4E45A 2CV5A 2RVQC 1BH9A 3AZND 4M6BA 2FJ7B 3MGPD 2F8NA 1P3GB 2G5IC 1P3LD 1W2EA 5B40D 1P3FD 1M18D 5E5AA 3AZJC 1KX3C 3LZ1B 3MGSD 3LJAD 5CP6C 4Z5TC 2CV5B 5DNND 3UT9B 3AZJA 1KX3A 2JE5A 3MVDC 2ZM5A 1KX4C 3LELB 2JSSA 2F8NB 3X1TD 5AV6D 3WTPD 1S32C 3MVDA 1JFIA 4J8WC 3TU4C 2FJ7D 3VH6W 3W99C 5B31G 3MGRC 1AOIC 5GT3C 4J8WA 5CPID 4AWLC 3AZJB 1KX3B 3MGRA 1AOIA 3W99A 2Y2GA 4YS3B 2PYOC 5CP6B 4Z5TB 3KFUG 5CHLB 5B24C 4X23C 2Y2PA 1KX4B 2F8NK 1P3PA 1ULYA 2F8NH 2PYOA 3UT9D 4J8UC 3W98D 3H0RC 3C1CD 1S32B 4KGCC 4X23A 3AYWC 5B1MD 3REHD 3LELD 4ZUXB 4J8WB 4J8UA 1HQ3B 3MGQC 3TU4B 3MNNC 1T3UA 3AYWA 3MGRB 1AOIB 3W99B 5GT0A 3A6ND 3EPHA 5GT3B 1R4VA 1H3OA 3VH6A 3AZHC 3MGQA 4AWLB 2W8SA 5B31A 4HGAC 3MNNA 3REJB 2Y2QA 2PYOB 3AZHA 3AZFC 3W97C 3R45B 5B24B 5AVBD 5CPJD 5BNVB 4YS3D 4Z5TD 3NQJA 3W97A 2L5AA 3AV2B 3LZ0C 5BT1C 1B67A 4KGCB 3AYWB 3B0CT 1F66C 5B0ZB 1S32D 3MGQB 1WWSA 3LZ0A 3WKJD 1M19D 4ZUXD 3WAAA 4H9QA 1HQ3D 3P5JB 5B2JD 4R8PB 4LD9B 4XUJA 4HGAB 5F99C 4J8XB 5BO0A 5GT3D 3KWQD 2NZDC 4JJNC 3AL0C 3AZFB 3W97B 2HIOC 3REJD 1P3AC 3B6GD 4DQYB 5F99A 3AN2B 2NZDA 4WU8C 4JJNA 3A1KA 4CAYA 4E44A 3RELD 5B24D 2HIOA 1P3AA 1F66B 2AROA 4H9QB 3AFAC 3AZKA 3AV2D 5AV5C 3NQUB 4WNNA 5B0ZD 3AFAA 1HTAA 5GXQD 5AV8C 3AZID 2LY8A 1ZLAC 5AV5A 2NZDB 4LD9D 4R8PD 4JJNB 4CAYB 5AV8A 1P3AB 1Q9CA 4J8XD 5KDMA 5DNMB 4H9SC 4WU8B 3AZFD 1P3BC 1BH8A 3KXBC 3W96A 4YM6C 3AN2D 3H0MC 2DF4C 4WNNB 5B2IC 4G92C 4H9SA 1ID3B 1M1AA 3WA9C 3X1SB 3X1UA 2G5HC 3KXBA 3C1BC 4Z66C 4YM6A 5B2IA 3UTAD 3AZGB 3WA9A 2BG1A 5GSUC 5AVCD 1ZLAB 3C1BA 2XD1A 5E5AC 4Z66A 5JA4B 5KDMB 3AV1A 2Y2NA 5GSUA 4H9RB 5CPIA 3B6FB 2ZY2A 4CSRB 1P3BB 2ZY5A 3KXBB 2Y2HA 1P34C 1BFMA 3AZEC 5DNMD 5CPKD 1BH9B 2IO5C 1P3KD 5B2IB 4WU8D 3WA9B 4KUDD 4XZQC 3UTBA 3C1BB 1P34A 3AZEA 3O62D 1ID3D 2BYMA 3X1SD 4XZQA 1P3OA 5E5AB 5FUGA 2NQBC 3FDDA 1KX5C 3AZGD 5AY8C 2BYKA 4J8VC 2NQBA 1P3GD 1KX5A 5AY8A 3REIC 1P3PC 4J8VA 1P34B 3B6FD 3AZEB 2IO5B 1PZRA 2Y2LA 3LZ1D 1P3BD 1P3IC 3MVDB 5AV9C 2XD5A 3AZLC 3REIA 1JFIB 2CV5D 2VQRA 5B32G 1B6WA 1P3IA 4G91C 5AV9A 3AZLA 5GT0C 2RVQD 2F8ND 2NQBB 1U35A 3AZMC 5B31C 5AY8B 3WTPE 4KHAA 5E5AD 4NE6A 3AZMA 4H9OA 1P3PB 3A1IA 4QLCC 3AZJD 1KX3D 1N1JA 4WZSB 4X23B 1P3MC 1EQZC 5CP6D 2HUEC 4QLCA 4J8UB 3VH5T 3MVDD 1KX4D 1P3MA 5GT0B 5JRGC 1EQZA 5B32A 3WAAC 1H3OB 5B1LC 4XUJC 3AZMB 1TZYC 5B31B 3MNNB 4WJ3C 3F6TA 4H9OB 4J8WD 5JRGA 5GXQA 5B1LA 3TU4D 3AZHB 1TAFA 5B33C 1N1JB 3X1VC 1TZYA 3W99D 3MGRD 1AOID 4WU9C 3NQJB 4QLCB 5B0YA 5B33A 3KUYC 3X1VA 4DRBA 2PYOD 2AROC 3REKC 4WU9A 3AZKC 2HUEB 4EO5C 4X23D 3KUYA 3LZ0B 3AZNC 1KU5A 5JRGB 3MGPC 3REKA 4J8UD 3WAAB 2F2AC 4KGCD 4XUJB 3AYWD 3AZNA 1WWIA 3UTAA 5BO0B 3MGPA 1P3LC 1M18C 5B40C 1P3FC 3MGQD 4H9PA 5B33B 5B31D 3MNND 5F99B 3W96D 4WU9B 3AZHD 1P3LA 5B40A 3MGSC 3LJAC 1P3FA 1M18A 2HIOB 3KUYB 3W96C 2AROB 1M1AC 3MGSA 3LJAA 3AZKB 3W97D 3X1UC 5DNNA 4EO5B 3EPJA 3AZNB 3WTPC 5AV6C 3X1TC 3B0CW 2FFFB 3AFAB 4H9PB 4NE3A 2ZY4A 3EPKA 3LZ0D 5BT1D 5AV5B 2F8NG 3WTPA 5AV6A 3X1TA 1F66D 2FJ7C 3AV1C 5B40B 1P3FB 4XUJD 2YFWA 5AV8B 5C3IC 5CPIC 3VH6T 2FJ7A 3MGSB 3LJAB 1BH8B 4DRAA 3B0BA 1P3GA 5F99D 3W96B 2NZDD 4UUZA 4JJND 1M1AB 2HIOD 1P3AD 3X1UB 3UTBC 3W98C 3C1CC 5AV6B 4YM6B 2AROD 5B1MC 4G92B 3REHC 3AZKD 3LELC 2YFWB 3UT9A 1P3OC 3W98A 3C1CA 3EG5B 4Z66B 3KSYA 3AV1B 5B1MA 3AFAD 3REHA 3A6NC 3LELA 5AV5D 5GSUB 5C3IB 5CPIB 1F1EA 4UUZB 2ZY3A 4Z2MG 3A6NA 5AV8D 1ZLAD 4NFTA 1Z2CB 4ZBJC 5AVBC 4YS3C 5CPJC 3UTBB 3W98B 3C1CB
chains in the Genus database with same CATH topology
5B1MB 1M1AD 3REHB 5AVBA 2BYMB 2JCHA 5CP6A 4Z5TA 3X1UD 3KXBD 4YS3A 4XZQB 5CPJA 1P3OB 4YM6D 2UWXA 5FUGB 5B2ID 3WKJC 1U35C 1KX4A 1M19C 4ZUXC 3WA9D 3A6NB 3C1BD 1HQ3C 5B2JC 2BYKB 4Z66D 1S32A 3AV1D 3WKJA 1KX5B 1M19A 4ZUXA 3KWQC 5GSUD 1HQ3A 3TU4A 5B2JA 4J8VB 3REJC 3B6GC 4ZBJB 5GT3A 5AVBB 3KWQA 5CPJB 3REIB 3RELC 3REJA 3B6GA 2YFVA 1P3IB 4WV4B 5AV9B 3AZLB 3UTBD 3R45A 3RELA 5B32C 1P34D 3AV2C 5B24A 3AZED 3WKJB 1U35B 5BNVA 1M19B 5B0ZC 4G91B 4XZQD 4KHAB 2Y2JA 5BS7C 1P3OD 5B2JB 5GXQC 3AZIC 3EPLA 3AV2A 4KGCA 5BNXA 5B0ZA 3KWQB 4LD9C 4R8PC 5BS7A 2NQBD 3AZIA 4J8XC 1KX5D 3B6GB 5B0YC 2Y2KA 2YFVB 5AY8D 4LD9A 4R8PA 3V9RA 2Y2OA 4J8VD 3RELB 4J8XA 3AN2C 3REID 1P3MB 2CWEA 3B0DC 1P3PD 3AZFA 1EQZB 5B32B 5BNXB 3AN2A 1P3ID 5AV9D 3AZLD 3UTAC 2Y2IA 5GXQB 5AVCC 3AZIB 4Z2MH 5B1LB 1U35D 1TAFB 1F66A 1TZYB 5GT0D 3V9RB 2DQNC 3NQUA 5AVCA 5B0YB 3AZMD 3X1VB 2J8PA 3IP4C 5DNNC 5DNMC 5CPKC 1P3KC 2RIQA 4NE5A 3B0DB 4KUDC 3REKB 4QLCD 3VH5W 5DNMA 5CPKA 1P3KA 3O62C 4WU8A 2Y2MA 1P3MD 1ID3C 3UTAB 1EQZD 5B32D 3X1SC 4KUDA 3MGPB 3H0LC 5AVCB 3O62A 1ID3A 3AZGC 5JRGD 3X1SA 5G49A 3WAAD 5B1LD 4H9NA 1P3LB 1M18B 1TZYD 1P3GC 3AZGA 1ZLAA 5B0YD 5B33D 1A7WA 5JA4A 5DNNB 3X1VD 5CPKB 3LZ1C 1P3KB 3B6FC 4WU9D 4KUDB 4H9RA 2CV5C 3UT9C 3KUYD 3B6FA 3LZ1A 3WTPB 4CSRA 3O62B 3X1TB 1P3BA 4UPKA 3VH5A 3REKD 5G49B 4H9NB 4E45A 2CV5A 2RVQC 1BH9A 3AZND 4M6BA 2FJ7B 3MGPD 2F8NA 1P3GB 2G5IC 1P3LD 1W2EA 5B40D 1P3FD 1M18D 5E5AA 3AZJC 1KX3C 3LZ1B 3MGSD 3LJAD 5CP6C 4Z5TC 2CV5B 5DNND 3UT9B 3AZJA 1KX3A 2JE5A 3MVDC 2ZM5A 1KX4C 3LELB 2JSSA 2F8NB 3X1TD 5AV6D 3WTPD 1S32C 3MVDA 1JFIA 4J8WC 3TU4C 2FJ7D 3VH6W 3W99C 5B31G 3MGRC 1AOIC 5GT3C 4J8WA 5CPID 4AWLC 3AZJB 1KX3B 3MGRA 1AOIA 3W99A 2Y2GA 4YS3B 2PYOC 5CP6B 4Z5TB 3KFUG 5CHLB 5B24C 4X23C 2Y2PA 1KX4B 2F8NK 1P3PA 1ULYA 2F8NH 2PYOA 3UT9D 4J8UC 3W98D 3H0RC 3C1CD 1S32B 4KGCC 4X23A 3AYWC 5B1MD 3REHD 3LELD 4ZUXB 4J8WB 4J8UA 1HQ3B 3MGQC 3TU4B 3MNNC 1T3UA 3AYWA 3MGRB 1AOIB 3W99B 5GT0A 3A6ND 3EPHA 5GT3B 1R4VA 1H3OA 3VH6A 3AZHC 3MGQA 4AWLB 2W8SA 5B31A 4HGAC 3MNNA 3REJB 2Y2QA 2PYOB 3AZHA 3AZFC 3W97C 3R45B 5B24B 5AVBD 5CPJD 5BNVB 4YS3D 4Z5TD 3NQJA 3W97A 2L5AA 3AV2B 3LZ0C 5BT1C 1B67A 4KGCB 3AYWB 3B0CT 1F66C 5B0ZB 1S32D 3MGQB 1WWSA 3LZ0A 3WKJD 1M19D 4ZUXD 3WAAA 4H9QA 1HQ3D 3P5JB 5B2JD 4R8PB 4LD9B 4XUJA 4HGAB 5F99C 4J8XB 5BO0A 5GT3D 3KWQD 2NZDC 4JJNC 3AL0C 3AZFB 3W97B 2HIOC 3REJD 1P3AC 3B6GD 4DQYB 5F99A 3AN2B 2NZDA 4WU8C 4JJNA 3A1KA 4CAYA 4E44A 3RELD 5B24D 2HIOA 1P3AA 1F66B 2AROA 4H9QB 3AFAC 3AZKA 3AV2D 5AV5C 3NQUB 4WNNA 5B0ZD 3AFAA 1HTAA 5GXQD 5AV8C 3AZID 2LY8A 1ZLAC 5AV5A 2NZDB 4LD9D 4R8PD 4JJNB 4CAYB 5AV8A 1P3AB 1Q9CA 4J8XD 5KDMA 5DNMB 4H9SC 4WU8B 3AZFD 1P3BC 1BH8A 3KXBC 3W96A 4YM6C 3AN2D 3H0MC 2DF4C 4WNNB 5B2IC 4G92C 4H9SA 1ID3B 1M1AA 3WA9C 3X1SB 3X1UA 2G5HC 3KXBA 3C1BC 4Z66C 4YM6A 5B2IA 3UTAD 3AZGB 3WA9A 2BG1A 5GSUC 5AVCD 1ZLAB 3C1BA 2XD1A 5E5AC 4Z66A 5JA4B 5KDMB 3AV1A 2Y2NA 5GSUA 4H9RB 5CPIA 3B6FB 2ZY2A 4CSRB 1P3BB 2ZY5A 3KXBB 2Y2HA 1P34C 1BFMA 3AZEC 5DNMD 5CPKD 1BH9B 2IO5C 1P3KD 5B2IB 4WU8D 3WA9B 4KUDD 4XZQC 3UTBA 3C1BB 1P34A 3AZEA 3O62D 1ID3D 2BYMA 3X1SD 4XZQA 1P3OA 5E5AB 5FUGA 2NQBC 3FDDA 1KX5C 3AZGD 5AY8C 2BYKA 4J8VC 2NQBA 1P3GD 1KX5A 5AY8A 3REIC 1P3PC 4J8VA 1P34B 3B6FD 3AZEB 2IO5B 1PZRA 2Y2LA 3LZ1D 1P3BD 1P3IC 3MVDB 5AV9C 2XD5A 3AZLC 3REIA 1JFIB 2CV5D 2VQRA 5B32G 1B6WA 1P3IA 4G91C 5AV9A 3AZLA 5GT0C 2RVQD 2F8ND 2NQBB 1U35A 3AZMC 5B31C 5AY8B 3WTPE 4KHAA 5E5AD 4NE6A 3AZMA 4H9OA 1P3PB 3A1IA 4QLCC 3AZJD 1KX3D 1N1JA 4WZSB 4X23B 1P3MC 1EQZC 5CP6D 2HUEC 4QLCA 4J8UB 3VH5T 3MVDD 1KX4D 1P3MA 5GT0B 5JRGC 1EQZA 5B32A 3WAAC 1H3OB 5B1LC 4XUJC 3AZMB 1TZYC 5B31B 3MNNB 4WJ3C 3F6TA 4H9OB 4J8WD 5JRGA 5GXQA 5B1LA 3TU4D 3AZHB 1TAFA 5B33C 1N1JB 3X1VC 1TZYA 3W99D 3MGRD 1AOID 4WU9C 3NQJB 4QLCB 5B0YA 5B33A 3KUYC 3X1VA 4DRBA 2PYOD 2AROC 3REKC 4WU9A 3AZKC 2HUEB 4EO5C 4X23D 3KUYA 3LZ0B 3AZNC 1KU5A 5JRGB 3MGPC 3REKA 4J8UD 3WAAB 2F2AC 4KGCD 4XUJB 3AYWD 3AZNA 1WWIA 3UTAA 5BO0B 3MGPA 1P3LC 1M18C 5B40C 1P3FC 3MGQD 4H9PA 5B33B 5B31D 3MNND 5F99B 3W96D 4WU9B 3AZHD 1P3LA 5B40A 3MGSC 3LJAC 1P3FA 1M18A 2HIOB 3KUYB 3W96C 2AROB 1M1AC 3MGSA 3LJAA 3AZKB 3W97D 3X1UC 5DNNA 4EO5B 3EPJA 3AZNB 3WTPC 5AV6C 3X1TC 3B0CW 2FFFB 3AFAB 4H9PB 4NE3A 2ZY4A 3EPKA 3LZ0D 5BT1D 5AV5B 2F8NG 3WTPA 5AV6A 3X1TA 1F66D 2FJ7C 3AV1C 5B40B 1P3FB 4XUJD 2YFWA 5AV8B 5C3IC 5CPIC 3VH6T 2FJ7A 3MGSB 3LJAB 1BH8B 4DRAA 3B0BA 1P3GA 5F99D 3W96B 2NZDD 4UUZA 4JJND 1M1AB 2HIOD 1P3AD 3X1UB 3UTBC 3W98C 3C1CC 5AV6B 4YM6B 2AROD 5B1MC 4G92B 3REHC 3AZKD 3LELC 2YFWB 3UT9A 1P3OC 3W98A 3C1CA 3EG5B 4Z66B 3KSYA 3AV1B 5B1MA 3AFAD 3REHA 3A6NC 3LELA 5AV5D 5GSUB 5C3IB 5CPIB 1F1EA 4UUZB 2ZY3A 4Z2MG 3A6NA 5AV8D 1ZLAD 4NFTA 1Z2CB 4ZBJC 5AVBC 4YS3C 5CPJC 3UTBB 3W98B 3C1CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M B;  1M1A D;  3REH B;  5AVB A;  2BYM B;  4YS3 A;  5CP6 A;  4Z5T A;  3X1U D;  3KXB D;  5CPJ A;  4XZQ B;  1P3O B;  4YM6 D;  5FUG B;  5B2I D;  3WKJ C;  1U35 C;  1KX4 A;  1M19 C;  4ZUX C;  3WA9 D;  3A6N B;  3C1B D;  1HQ3 C;  5B2J C;  2BYK B;  4Z66 D;  1S32 A;  3AV1 D;  3WKJ A;  1KX5 B;  1M19 A;  4ZUX A;  3KWQ C;  5GSU D;  1HQ3 A;  3TU4 A;  5B2J A;  4J8V B;  3REJ C;  3B6G C;  4ZBJ B;  5GT3 A;  5AVB B;  3KWQ A;  5CPJ B;  3REI B;  3REL C;  3REJ A;  3B6G A;  2YFV A;  1P3I B;  4WV4 B;  5AV9 B;  3AZL B;  3UTB D;  3R45 A;  3REL A;  5B32 C;  1P34 D;  3AV2 C;  5B24 A;  3AZE D;  3WKJ B;  1U35 B;  5BNV A;  1M19 B;  5B0Z C;  4G91 B;  4XZQ D;  4KHA B;  5BS7 C;  1P3O D;  5B2J B;  5GXQ C;  3AZI C;  3AV2 A;  4KGC A;  5BNX A;  5B0Z A;  3KWQ B;  4LD9 C;  4R8P C;  5BS7 A;  2NQB D;  3AZI A;  4J8X C;  1KX5 D;  3B6G B;  5B0Y C;  2YFV B;  5AY8 D;  4LD9 A;  4R8P A;  3V9R A;  4J8V D;  3REL B;  4J8X A;  3AN2 C;  3REI D;  1P3M B;  2CWE A;  3B0D C;  1P3P D;  3AZF A;  1EQZ B;  5B32 B;  5BNX B;  3AN2 A;  1P3I D;  5AV9 D;  3AZL D;  3UTA C;  5GXQ B;  5AVC C;  3AZI B;  4Z2M H;  5B1L B;  1U35 D;  1TAF B;  1F66 A;  1TZY B;  5GT0 D;  3V9R B;  5AVC A;  3NQU A;  5B0Y B;  3AZM D;  3X1V B;  5DNN C;  5DNM C;  5CPK C;  1P3K C;  4NE5 A;  3B0D B;  4KUD C;  3REK B;  4QLC D;  3VH5 W;  5DNM A;  5CPK A;  1P3K A;  3O62 C;  4WU8 A;  1P3M D;  1ID3 C;  3UTA B;  1EQZ D;  5B32 D;  3X1S C;  4KUD A;  3MGP B;  5AVC B;  3O62 A;  1ID3 A;  3AZG C;  5JRG D;  3X1S A;  5G49 A;  3WAA D;  5B1L D;  4H9N A;  1P3L B;  1M18 B;  1TZY D;  1P3G C;  3AZG A;  1ZLA A;  5B0Y D;  5B33 D;  1A7W A;  5JA4 A;  5DNN B;  3X1V D;  5CPK B;  3LZ1 C;  1P3K B;  3B6F C;  4WU9 D;  4KUD B;  4H9R A;  2CV5 C;  3UT9 C;  3KUY D;  3B6F A;  3LZ1 A;  3WTP B;  4CSR A;  3O62 B;  3X1T B;  1P3B A;  3VH5 A;  3REK D;  5G49 B;  4H9N B;  4E45 A;  2CV5 A;  2RVQ C;  1BH9 A;  3AZN D;  4M6B A;  2FJ7 B;  3MGP D;  2F8N A;  1P3G B;  1P3L D;  1M18 D;  5B40 D;  1P3F D;  5E5A A;  3AZJ C;  1KX3 C;  3LZ1 B;  3MGS D;  3LJA D;  5CP6 C;  4Z5T C;  2CV5 B;  5DNN D;  3UT9 B;  3AZJ A;  1KX3 A;  3MVD C;  1KX4 C;  3LEL B;  2JSS A;  2F8N B;  3X1T D;  5AV6 D;  3WTP D;  1S32 C;  3MVD A;  1JFI A;  4J8W C;  3TU4 C;  2FJ7 D;  3VH6 W;  3W99 C;  5B31 G;  3MGR C;  1AOI C;  5GT3 C;  4J8W A;  5CPI D;  4AWL C;  3AZJ B;  1KX3 B;  3MGR A;  1AOI A;  3W99 A;  4YS3 B;  2PYO C;  5CP6 B;  4Z5T B;  5CHL B;  5B24 C;  4X23 C;  1KX4 B;  2F8N K;  1P3P A;  1ULY A;  2F8N H;  2PYO A;  3UT9 D;  4J8U C;  3W98 D;  3C1C D;  1S32 B;  4KGC C;  4X23 A;  3AYW C;  5B1M D;  3REH D;  3LEL D;  4ZUX B;  4J8W B;  4J8U A;  1HQ3 B;  3MGQ C;  3TU4 B;  3MNN C;  3AYW A;  3MGR B;  1AOI B;  3W99 B;  5GT0 A;  3A6N D;  5GT3 B;  1R4V A;  1H3O A;  3VH6 A;  3AZH C;  3MGQ A;  4AWL B;  5B31 A;  3MNN A;  4HGA C;  3REJ B;  2PYO B;  3AZH A;  3AZF C;  3W97 C;  3R45 B;  5B24 B;  5AVB D;  5CPJ D;  5BNV B;  4YS3 D;  4Z5T D;  3NQJ A;  3W97 A;  2L5A A;  3AV2 B;  3LZ0 C;  5BT1 C;  1B67 A;  4KGC B;  3AYW B;  3B0C T;  1F66 C;  5B0Z B;  1S32 D;  3MGQ B;  1WWS A;  3LZ0 A;  3WKJ D;  1M19 D;  4ZUX D;  3WAA A;  4H9Q A;  1HQ3 D;  4R8P B;  5B2J D;  4LD9 B;  4XUJ A;  4HGA B;  5F99 C;  4J8X B;  5BO0 A;  5GT3 D;  3KWQ D;  2NZD C;  4JJN C;  3AZF B;  3W97 B;  2HIO C;  3REJ D;  1P3A C;  3B6G D;  5F99 A;  3AN2 B;  2NZD A;  4WU8 C;  4JJN A;  4CAY A;  4E44 A;  3REL D;  5B24 D;  2HIO A;  1P3A A;  1F66 B;  2ARO A;  4H9Q B;  3AFA C;  3AZK A;  3AV2 D;  5AV5 C;  3NQU B;  4WNN A;  5B0Z D;  3AFA A;  1HTA A;  5GXQ D;  5AV8 C;  3AZI D;  2LY8 A;  1ZLA C;  5AV5 A;  2NZD B;  4LD9 D;  4R8P D;  4JJN B;  4CAY B;  5AV8 A;  1P3A B;  1Q9C A;  4J8X D;  5KDM A;  5DNM B;  4H9S C;  4WU8 B;  3AZF D;  1P3B C;  1BH8 A;  3KXB C;  3W96 A;  4YM6 C;  3AN2 D;  4WNN B;  5B2I C;  4G92 C;  4H9S A;  1ID3 B;  1M1A A;  3WA9 C;  3X1S B;  3X1U A;  3KXB A;  3C1B C;  4Z66 C;  4YM6 A;  5B2I A;  3UTA D;  3AZG B;  3WA9 A;  5GSU C;  5AVC D;  1ZLA B;  3C1B A;  5E5A C;  4Z66 A;  5JA4 B;  5KDM B;  3AV1 A;  5GSU A;  4H9R B;  5CPI A;  3B6F B;  4CSR B;  1P3B B;  3KXB B;  1P34 C;  1BFM A;  3AZE C;  5DNM D;  5CPK D;  1BH9 B;  2IO5 C;  1P3K D;  5B2I B;  4WU8 D;  3WA9 B;  4KUD D;  4XZQ C;  3UTB A;  3C1B B;  1P34 A;  3AZE A;  3O62 D;  1ID3 D;  2BYM A;  3X1S D;  4XZQ A;  1P3O A;  5E5A B;  5FUG A;  2NQB C;  1KX5 C;  3AZG D;  5AY8 C;  2BYK A;  4J8V C;  2NQB A;  1P3G D;  1KX5 A;  5AY8 A;  3REI C;  1P3P C;  4J8V A;  1P34 B;  3B6F D;  3AZE B;  2IO5 B;  3LZ1 D;  1P3B D;  1P3I C;  3MVD B;  5AV9 C;  1JFI B;  3AZL C;  3REI A;  2CV5 D;  5B32 G;  1B6W A;  1P3I A;  4G91 C;  5AV9 A;  3AZL A;  5GT0 C;  2RVQ D;  2F8N D;  2NQB B;  1U35 A;  3AZM C;  5B31 C;  5AY8 B;  3WTP E;  4KHA A;  5E5A D;  4NE6 A;  3AZM A;  4H9O A;  1P3P B;  4QLC C;  3AZJ D;  1KX3 D;  1N1J A;  4WZS B;  4X23 B;  1P3M C;  1EQZ C;  5CP6 D;  2HUE C;  4QLC A;  4J8U B;  3VH5 T;  3MVD D;  1KX4 D;  1P3M A;  5GT0 B;  5JRG C;  1EQZ A;  5B32 A;  3WAA C;  1H3O B;  5B1L C;  4XUJ C;  3AZM B;  1TZY C;  5B31 B;  3MNN B;  4H9O B;  4J8W D;  5JRG A;  5GXQ A;  5B1L A;  3TU4 D;  3AZH B;  1TAF A;  5B33 C;  1N1J B;  3X1V C;  1TZY A;  3W99 D;  3MGR D;  1AOI D;  4WU9 C;  3NQJ B;  4QLC B;  5B0Y A;  5B33 A;  3KUY C;  3X1V A;  4DRB A;  2PYO D;  2ARO C;  3REK C;  4WU9 A;  3AZK C;  2HUE B;  4EO5 C;  4X23 D;  3KUY A;  3LZ0 B;  3AZN C;  1KU5 A;  5JRG B;  3MGP C;  3REK A;  4J8U D;  3WAA B;  4KGC D;  4XUJ B;  3AYW D;  3AZN A;  1WWI A;  3UTA A;  5BO0 B;  3MGP A;  1P3L C;  1M18 C;  5B40 C;  1P3F C;  3MGQ D;  4H9P A;  5B33 B;  5B31 D;  3MNN D;  5F99 B;  3W96 D;  4WU9 B;  3AZH D;  1P3L A;  5B40 A;  3MGS C;  3LJA C;  1P3F A;  1M18 A;  2HIO B;  3KUY B;  3W96 C;  2ARO B;  1M1A C;  3MGS A;  3LJA A;  3AZK B;  3W97 D;  3X1U C;  5DNN A;  4EO5 B;  3AZN B;  3WTP C;  5AV6 C;  3X1T C;  3B0C W;  3AFA B;  4H9P B;  4NE3 A;  3LZ0 D;  5BT1 D;  5AV5 B;  2F8N G;  3WTP A;  5AV6 A;  3X1T A;  1F66 D;  2FJ7 C;  3AV1 C;  5B40 B;  1P3F B;  4XUJ D;  2YFW A;  5AV8 B;  5C3I C;  5CPI C;  3VH6 T;  2FJ7 A;  3MGS B;  3LJA B;  1BH8 B;  4DRA A;  3B0B A;  1P3G A;  5F99 D;  3W96 B;  2NZD D;  4UUZ A;  4JJN D;  1M1A B;  2HIO D;  1P3A D;  3X1U B;  3UTB C;  3W98 C;  3C1C C;  5AV6 B;  4YM6 B;  2ARO D;  5B1M C;  4G92 B;  3REH C;  3AZK D;  3LEL C;  2YFW B;  3UT9 A;  1P3O C;  3W98 A;  3C1C A;  4Z66 B;  3KSY A;  3AV1 B;  5B1M A;  3AFA D;  3REH A;  3A6N C;  3LEL A;  5AV5 D;  5GSU B;  5C3I B;  5CPI B;  1F1E A;  4UUZ B;  4Z2M G;  3A6N A;  5AV8 D;  1ZLA D;  4NFT A;  4ZBJ C;  5AVB C;  4YS3 C;  5CPJ C;  3UTB B;  3W98 B;  3C1C B; 
#chains in the Genus database with same CATH topology
 5B1M B;  1M1A D;  3REH B;  5AVB A;  2BYM B;  2JCH A;  5CP6 A;  4Z5T A;  3X1U D;  3KXB D;  4YS3 A;  4XZQ B;  5CPJ A;  1P3O B;  4YM6 D;  2UWX A;  5FUG B;  5B2I D;  3WKJ C;  1U35 C;  1KX4 A;  1M19 C;  4ZUX C;  3WA9 D;  3A6N B;  3C1B D;  1HQ3 C;  5B2J C;  2BYK B;  4Z66 D;  1S32 A;  3AV1 D;  3WKJ A;  1KX5 B;  1M19 A;  4ZUX A;  3KWQ C;  5GSU D;  1HQ3 A;  3TU4 A;  5B2J A;  4J8V B;  3REJ C;  3B6G C;  4ZBJ B;  5GT3 A;  5AVB B;  3KWQ A;  5CPJ B;  3REI B;  3REL C;  3REJ A;  3B6G A;  2YFV A;  1P3I B;  4WV4 B;  5AV9 B;  3AZL B;  3UTB D;  3R45 A;  3REL A;  5B32 C;  1P34 D;  3AV2 C;  5B24 A;  3AZE D;  3WKJ B;  1U35 B;  5BNV A;  1M19 B;  5B0Z C;  4G91 B;  4XZQ D;  4KHA B;  2Y2J A;  5BS7 C;  1P3O D;  5B2J B;  5GXQ C;  3AZI C;  3EPL A;  3AV2 A;  4KGC A;  5BNX A;  5B0Z A;  3KWQ B;  4LD9 C;  4R8P C;  5BS7 A;  2NQB D;  3AZI A;  4J8X C;  1KX5 D;  3B6G B;  5B0Y C;  2Y2K A;  2YFV B;  5AY8 D;  4LD9 A;  4R8P A;  3V9R A;  2Y2O A;  4J8V D;  3REL B;  4J8X A;  3AN2 C;  3REI D;  1P3M B;  2CWE A;  3B0D C;  1P3P D;  3AZF A;  1EQZ B;  5B32 B;  5BNX B;  3AN2 A;  1P3I D;  5AV9 D;  3AZL D;  3UTA C;  2Y2I A;  5GXQ B;  5AVC C;  3AZI B;  4Z2M H;  5B1L B;  1U35 D;  1TAF B;  1F66 A;  1TZY B;  5GT0 D;  3V9R B;  2DQN C;  3NQU A;  5AVC A;  5B0Y B;  3AZM D;  3X1V B;  2J8P A;  3IP4 C;  5DNN C;  5DNM C;  5CPK C;  1P3K C;  2RIQ A;  4NE5 A;  3B0D B;  4KUD C;  3REK B;  4QLC D;  3VH5 W;  5DNM A;  5CPK A;  1P3K A;  3O62 C;  4WU8 A;  2Y2M A;  1P3M D;  1ID3 C;  3UTA B;  1EQZ D;  5B32 D;  3X1S C;  4KUD A;  3MGP B;  3H0L C;  5AVC B;  3O62 A;  1ID3 A;  3AZG C;  5JRG D;  3X1S A;  5G49 A;  3WAA D;  5B1L D;  4H9N A;  1P3L B;  1M18 B;  1TZY D;  1P3G C;  3AZG A;  1ZLA A;  5B0Y D;  5B33 D;  1A7W A;  5JA4 A;  5DNN B;  3X1V D;  5CPK B;  3LZ1 C;  1P3K B;  3B6F C;  4WU9 D;  4KUD B;  4H9R A;  2CV5 C;  3UT9 C;  3KUY D;  3B6F A;  3LZ1 A;  3WTP B;  4CSR A;  3O62 B;  3X1T B;  1P3B A;  4UPK A;  3VH5 A;  3REK D;  5G49 B;  4H9N B;  4E45 A;  2CV5 A;  2RVQ C;  1BH9 A;  3AZN D;  4M6B A;  2FJ7 B;  3MGP D;  2F8N A;  1P3G B;  2G5I C;  1P3L D;  1W2E A;  5B40 D;  1P3F D;  1M18 D;  5E5A A;  3AZJ C;  1KX3 C;  3LZ1 B;  3MGS D;  3LJA D;  5CP6 C;  4Z5T C;  2CV5 B;  5DNN D;  3UT9 B;  3AZJ A;  1KX3 A;  2JE5 A;  3MVD C;  2ZM5 A;  1KX4 C;  3LEL B;  2JSS A;  2F8N B;  3X1T D;  5AV6 D;  3WTP D;  1S32 C;  3MVD A;  1JFI A;  4J8W C;  3TU4 C;  2FJ7 D;  3VH6 W;  3W99 C;  5B31 G;  3MGR C;  1AOI C;  5GT3 C;  4J8W A;  5CPI D;  4AWL C;  3AZJ B;  1KX3 B;  3MGR A;  1AOI A;  3W99 A;  2Y2G A;  4YS3 B;  2PYO C;  5CP6 B;  4Z5T B;  3KFU G;  5CHL B;  5B24 C;  4X23 C;  2Y2P A;  1KX4 B;  2F8N K;  1P3P A;  1ULY A;  2F8N H;  2PYO A;  3UT9 D;  4J8U C;  3W98 D;  3H0R C;  3C1C D;  1S32 B;  4KGC C;  4X23 A;  3AYW C;  5B1M D;  3REH D;  3LEL D;  4ZUX B;  4J8W B;  4J8U A;  1HQ3 B;  3MGQ C;  3TU4 B;  3MNN C;  1T3U A;  3AYW A;  3MGR B;  1AOI B;  3W99 B;  5GT0 A;  3A6N D;  3EPH A;  5GT3 B;  1R4V A;  1H3O A;  3VH6 A;  3AZH C;  3MGQ A;  4AWL B;  2W8S A;  5B31 A;  4HGA C;  3MNN A;  3REJ B;  2Y2Q A;  2PYO B;  3AZH A;  3AZF C;  3W97 C;  3R45 B;  5B24 B;  5AVB D;  5CPJ D;  5BNV B;  4YS3 D;  4Z5T D;  3NQJ A;  3W97 A;  2L5A A;  3AV2 B;  3LZ0 C;  5BT1 C;  1B67 A;  4KGC B;  3AYW B;  3B0C T;  1F66 C;  5B0Z B;  1S32 D;  3MGQ B;  1WWS A;  3LZ0 A;  3WKJ D;  1M19 D;  4ZUX D;  3WAA A;  4H9Q A;  1HQ3 D;  3P5J B;  5B2J D;  4R8P B;  4LD9 B;  4XUJ A;  4HGA B;  5F99 C;  4J8X B;  5BO0 A;  5GT3 D;  3KWQ D;  2NZD C;  4JJN C;  3AL0 C;  3AZF B;  3W97 B;  2HIO C;  3REJ D;  1P3A C;  3B6G D;  4DQY B;  5F99 A;  3AN2 B;  2NZD A;  4WU8 C;  4JJN A;  3A1K A;  4CAY A;  4E44 A;  3REL D;  5B24 D;  2HIO A;  1P3A A;  1F66 B;  2ARO A;  4H9Q B;  3AFA C;  3AZK A;  3AV2 D;  5AV5 C;  3NQU B;  4WNN A;  5B0Z D;  3AFA A;  1HTA A;  5GXQ D;  5AV8 C;  3AZI D;  2LY8 A;  1ZLA C;  5AV5 A;  2NZD B;  4LD9 D;  4R8P D;  4JJN B;  4CAY B;  5AV8 A;  1P3A B;  1Q9C A;  4J8X D;  5KDM A;  5DNM B;  4H9S C;  4WU8 B;  3AZF D;  1P3B C;  1BH8 A;  3KXB C;  3W96 A;  4YM6 C;  3AN2 D;  3H0M C;  2DF4 C;  4WNN B;  5B2I C;  4G92 C;  4H9S A;  1ID3 B;  1M1A A;  3WA9 C;  3X1S B;  3X1U A;  2G5H C;  3KXB A;  3C1B C;  4Z66 C;  4YM6 A;  5B2I A;  3UTA D;  3AZG B;  3WA9 A;  2BG1 A;  5GSU C;  5AVC D;  1ZLA B;  3C1B A;  2XD1 A;  5E5A C;  4Z66 A;  5JA4 B;  5KDM B;  3AV1 A;  2Y2N A;  5GSU A;  4H9R B;  5CPI A;  3B6F B;  2ZY2 A;  4CSR B;  1P3B B;  2ZY5 A;  3KXB B;  2Y2H A;  1P34 C;  1BFM A;  3AZE C;  5DNM D;  5CPK D;  1BH9 B;  2IO5 C;  1P3K D;  5B2I B;  4WU8 D;  3WA9 B;  4KUD D;  4XZQ C;  3UTB A;  3C1B B;  1P34 A;  3AZE A;  3O62 D;  1ID3 D;  2BYM A;  3X1S D;  4XZQ A;  1P3O A;  5E5A B;  5FUG A;  2NQB C;  3FDD A;  1KX5 C;  3AZG D;  5AY8 C;  2BYK A;  4J8V C;  2NQB A;  1P3G D;  1KX5 A;  5AY8 A;  3REI C;  1P3P C;  4J8V A;  1P34 B;  3B6F D;  3AZE B;  2IO5 B;  1PZR A;  2Y2L A;  3LZ1 D;  1P3B D;  1P3I C;  3MVD B;  5AV9 C;  2XD5 A;  3AZL C;  3REI A;  1JFI B;  2CV5 D;  2VQR A;  5B32 G;  1B6W A;  1P3I A;  4G91 C;  5AV9 A;  3AZL A;  5GT0 C;  2RVQ D;  2F8N D;  2NQB B;  1U35 A;  3AZM C;  5B31 C;  5AY8 B;  3WTP E;  4KHA A;  5E5A D;  4NE6 A;  3AZM A;  4H9O A;  1P3P B;  3A1I A;  4QLC C;  3AZJ D;  1KX3 D;  1N1J A;  4WZS B;  4X23 B;  1P3M C;  1EQZ C;  5CP6 D;  2HUE C;  4QLC A;  4J8U B;  3VH5 T;  3MVD D;  1KX4 D;  1P3M A;  5GT0 B;  5JRG C;  1EQZ A;  5B32 A;  3WAA C;  1H3O B;  5B1L C;  4XUJ C;  3AZM B;  1TZY C;  5B31 B;  3MNN B;  4WJ3 C;  3F6T A;  4H9O B;  4J8W D;  5JRG A;  5GXQ A;  5B1L A;  3TU4 D;  3AZH B;  1TAF A;  5B33 C;  1N1J B;  3X1V C;  1TZY A;  3W99 D;  3MGR D;  1AOI D;  4WU9 C;  3NQJ B;  4QLC B;  5B0Y A;  5B33 A;  3KUY C;  3X1V A;  4DRB A;  2PYO D;  2ARO C;  3REK C;  4WU9 A;  3AZK C;  2HUE B;  4EO5 C;  4X23 D;  3KUY A;  3LZ0 B;  3AZN C;  1KU5 A;  5JRG B;  3MGP C;  3REK A;  4J8U D;  3WAA B;  2F2A C;  4KGC D;  4XUJ B;  3AYW D;  3AZN A;  1WWI A;  3UTA A;  5BO0 B;  3MGP A;  1P3L C;  1M18 C;  5B40 C;  1P3F C;  3MGQ D;  4H9P A;  5B33 B;  5B31 D;  3MNN D;  5F99 B;  3W96 D;  4WU9 B;  3AZH D;  1P3L A;  5B40 A;  3MGS C;  3LJA C;  1P3F A;  1M18 A;  2HIO B;  3KUY B;  3W96 C;  2ARO B;  1M1A C;  3MGS A;  3LJA A;  3AZK B;  3W97 D;  3X1U C;  5DNN A;  4EO5 B;  3EPJ A;  3AZN B;  3WTP C;  5AV6 C;  3X1T C;  3B0C W;  2FFF B;  3AFA B;  4H9P B;  4NE3 A;  2ZY4 A;  3EPK A;  3LZ0 D;  5BT1 D;  5AV5 B;  2F8N G;  3WTP A;  5AV6 A;  3X1T A;  1F66 D;  2FJ7 C;  3AV1 C;  5B40 B;  1P3F B;  4XUJ D;  2YFW A;  5AV8 B;  5C3I C;  5CPI C;  3VH6 T;  2FJ7 A;  3MGS B;  3LJA B;  1BH8 B;  4DRA A;  3B0B A;  1P3G A;  5F99 D;  3W96 B;  2NZD D;  4UUZ A;  4JJN D;  1M1A B;  2HIO D;  1P3A D;  3X1U B;  3UTB C;  3W98 C;  3C1C C;  5AV6 B;  4YM6 B;  2ARO D;  5B1M C;  4G92 B;  3REH C;  3AZK D;  3LEL C;  2YFW B;  3UT9 A;  1P3O C;  3W98 A;  3C1C A;  3EG5 B;  4Z66 B;  3KSY A;  3AV1 B;  5B1M A;  3AFA D;  3REH A;  3A6N C;  3LEL A;  5AV5 D;  5GSU B;  5C3I B;  5CPI B;  1F1E A;  4UUZ B;  2ZY3 A;  4Z2M G;  3A6N A;  5AV8 D;  1ZLA D;  4NFT A;  1Z2C B;  4ZBJ C;  5AVB C;  4YS3 C;  5CPJ C;  3UTB B;  3W98 B;  3C1C B; 
#chains in the Genus database with same CATH homology
 5B1M B;  1M1A D;  3REH B;  5AVB A;  2BYM B;  2JCH A;  5CP6 A;  4Z5T A;  3X1U D;  3KXB D;  4YS3 A;  4XZQ B;  5CPJ A;  1P3O B;  4YM6 D;  2UWX A;  5FUG B;  5B2I D;  3WKJ C;  1U35 C;  1KX4 A;  1M19 C;  4ZUX C;  3WA9 D;  3A6N B;  3C1B D;  1HQ3 C;  5B2J C;  2BYK B;  4Z66 D;  1S32 A;  3AV1 D;  3WKJ A;  1KX5 B;  1M19 A;  4ZUX A;  3KWQ C;  5GSU D;  1HQ3 A;  3TU4 A;  5B2J A;  4J8V B;  3REJ C;  3B6G C;  4ZBJ B;  5GT3 A;  5AVB B;  3KWQ A;  5CPJ B;  3REI B;  3REL C;  3REJ A;  3B6G A;  2YFV A;  1P3I B;  4WV4 B;  5AV9 B;  3AZL B;  3UTB D;  3R45 A;  3REL A;  5B32 C;  1P34 D;  3AV2 C;  5B24 A;  3AZE D;  3WKJ B;  1U35 B;  5BNV A;  1M19 B;  5B0Z C;  4G91 B;  4XZQ D;  4KHA B;  2Y2J A;  5BS7 C;  1P3O D;  5B2J B;  5GXQ C;  3AZI C;  3EPL A;  3AV2 A;  4KGC A;  5BNX A;  5B0Z A;  3KWQ B;  4LD9 C;  4R8P C;  5BS7 A;  2NQB D;  3AZI A;  4J8X C;  1KX5 D;  3B6G B;  5B0Y C;  2Y2K A;  2YFV B;  5AY8 D;  4LD9 A;  4R8P A;  3V9R A;  2Y2O A;  4J8V D;  3REL B;  4J8X A;  3AN2 C;  3REI D;  1P3M B;  2CWE A;  3B0D C;  1P3P D;  3AZF A;  1EQZ B;  5B32 B;  5BNX B;  3AN2 A;  1P3I D;  5AV9 D;  3AZL D;  3UTA C;  2Y2I A;  5GXQ B;  5AVC C;  3AZI B;  4Z2M H;  5B1L B;  1U35 D;  1TAF B;  1F66 A;  1TZY B;  5GT0 D;  3V9R B;  2DQN C;  3NQU A;  5AVC A;  5B0Y B;  3AZM D;  3X1V B;  2J8P A;  3IP4 C;  5DNN C;  5DNM C;  5CPK C;  1P3K C;  2RIQ A;  4NE5 A;  3B0D B;  4KUD C;  3REK B;  4QLC D;  3VH5 W;  5DNM A;  5CPK A;  1P3K A;  3O62 C;  4WU8 A;  2Y2M A;  1P3M D;  1ID3 C;  3UTA B;  1EQZ D;  5B32 D;  3X1S C;  4KUD A;  3MGP B;  3H0L C;  5AVC B;  3O62 A;  1ID3 A;  3AZG C;  5JRG D;  3X1S A;  5G49 A;  3WAA D;  5B1L D;  4H9N A;  1P3L B;  1M18 B;  1TZY D;  1P3G C;  3AZG A;  1ZLA A;  5B0Y D;  5B33 D;  1A7W A;  5JA4 A;  5DNN B;  3X1V D;  5CPK B;  3LZ1 C;  1P3K B;  3B6F C;  4WU9 D;  4KUD B;  4H9R A;  2CV5 C;  3UT9 C;  3KUY D;  3B6F A;  3LZ1 A;  3WTP B;  4CSR A;  3O62 B;  3X1T B;  1P3B A;  4UPK A;  3VH5 A;  3REK D;  5G49 B;  4H9N B;  4E45 A;  2CV5 A;  2RVQ C;  1BH9 A;  3AZN D;  4M6B A;  2FJ7 B;  3MGP D;  2F8N A;  1P3G B;  2G5I C;  1P3L D;  1W2E A;  5B40 D;  1P3F D;  1M18 D;  5E5A A;  3AZJ C;  1KX3 C;  3LZ1 B;  3MGS D;  3LJA D;  5CP6 C;  4Z5T C;  2CV5 B;  5DNN D;  3UT9 B;  3AZJ A;  1KX3 A;  2JE5 A;  3MVD C;  2ZM5 A;  1KX4 C;  3LEL B;  2JSS A;  2F8N B;  3X1T D;  5AV6 D;  3WTP D;  1S32 C;  3MVD A;  1JFI A;  4J8W C;  3TU4 C;  2FJ7 D;  3VH6 W;  3W99 C;  5B31 G;  3MGR C;  1AOI C;  5GT3 C;  4J8W A;  5CPI D;  4AWL C;  3AZJ B;  1KX3 B;  3MGR A;  1AOI A;  3W99 A;  2Y2G A;  4YS3 B;  2PYO C;  5CP6 B;  4Z5T B;  3KFU G;  5CHL B;  5B24 C;  4X23 C;  2Y2P A;  1KX4 B;  2F8N K;  1P3P A;  1ULY A;  2F8N H;  2PYO A;  3UT9 D;  4J8U C;  3W98 D;  3H0R C;  3C1C D;  1S32 B;  4KGC C;  4X23 A;  3AYW C;  5B1M D;  3REH D;  3LEL D;  4ZUX B;  4J8W B;  4J8U A;  1HQ3 B;  3MGQ C;  3TU4 B;  3MNN C;  1T3U A;  3AYW A;  3MGR B;  1AOI B;  3W99 B;  5GT0 A;  3A6N D;  3EPH A;  5GT3 B;  1R4V A;  1H3O A;  3VH6 A;  3AZH C;  3MGQ A;  4AWL B;  2W8S A;  5B31 A;  4HGA C;  3MNN A;  3REJ B;  2Y2Q A;  2PYO B;  3AZH A;  3AZF C;  3W97 C;  3R45 B;  5B24 B;  5AVB D;  5CPJ D;  5BNV B;  4YS3 D;  4Z5T D;  3NQJ A;  3W97 A;  2L5A A;  3AV2 B;  3LZ0 C;  5BT1 C;  1B67 A;  4KGC B;  3AYW B;  3B0C T;  1F66 C;  5B0Z B;  1S32 D;  3MGQ B;  1WWS A;  3LZ0 A;  3WKJ D;  1M19 D;  4ZUX D;  3WAA A;  4H9Q A;  1HQ3 D;  3P5J B;  5B2J D;  4R8P B;  4LD9 B;  4XUJ A;  4HGA B;  5F99 C;  4J8X B;  5BO0 A;  5GT3 D;  3KWQ D;  2NZD C;  4JJN C;  3AL0 C;  3AZF B;  3W97 B;  2HIO C;  3REJ D;  1P3A C;  3B6G D;  4DQY B;  5F99 A;  3AN2 B;  2NZD A;  4WU8 C;  4JJN A;  3A1K A;  4CAY A;  4E44 A;  3REL D;  5B24 D;  2HIO A;  1P3A A;  1F66 B;  2ARO A;  4H9Q B;  3AFA C;  3AZK A;  3AV2 D;  5AV5 C;  3NQU B;  4WNN A;  5B0Z D;  3AFA A;  1HTA A;  5GXQ D;  5AV8 C;  3AZI D;  2LY8 A;  1ZLA C;  5AV5 A;  2NZD B;  4LD9 D;  4R8P D;  4JJN B;  4CAY B;  5AV8 A;  1P3A B;  1Q9C A;  4J8X D;  5KDM A;  5DNM B;  4H9S C;  4WU8 B;  3AZF D;  1P3B C;  1BH8 A;  3KXB C;  3W96 A;  4YM6 C;  3AN2 D;  3H0M C;  2DF4 C;  4WNN B;  5B2I C;  4G92 C;  4H9S A;  1ID3 B;  1M1A A;  3WA9 C;  3X1S B;  3X1U A;  2G5H C;  3KXB A;  3C1B C;  4Z66 C;  4YM6 A;  5B2I A;  3UTA D;  3AZG B;  3WA9 A;  2BG1 A;  5GSU C;  5AVC D;  1ZLA B;  3C1B A;  2XD1 A;  5E5A C;  4Z66 A;  5JA4 B;  5KDM B;  3AV1 A;  2Y2N A;  5GSU A;  4H9R B;  5CPI A;  3B6F B;  2ZY2 A;  4CSR B;  1P3B B;  2ZY5 A;  3KXB B;  2Y2H A;  1P34 C;  1BFM A;  3AZE C;  5DNM D;  5CPK D;  1BH9 B;  2IO5 C;  1P3K D;  5B2I B;  4WU8 D;  3WA9 B;  4KUD D;  4XZQ C;  3UTB A;  3C1B B;  1P34 A;  3AZE A;  3O62 D;  1ID3 D;  2BYM A;  3X1S D;  4XZQ A;  1P3O A;  5E5A B;  5FUG A;  2NQB C;  3FDD A;  1KX5 C;  3AZG D;  5AY8 C;  2BYK A;  4J8V C;  2NQB A;  1P3G D;  1KX5 A;  5AY8 A;  3REI C;  1P3P C;  4J8V A;  1P34 B;  3B6F D;  3AZE B;  2IO5 B;  1PZR A;  2Y2L A;  3LZ1 D;  1P3B D;  1P3I C;  3MVD B;  5AV9 C;  2XD5 A;  3AZL C;  3REI A;  1JFI B;  2CV5 D;  2VQR A;  5B32 G;  1B6W A;  1P3I A;  4G91 C;  5AV9 A;  3AZL A;  5GT0 C;  2RVQ D;  2F8N D;  2NQB B;  1U35 A;  3AZM C;  5B31 C;  5AY8 B;  3WTP E;  4KHA A;  5E5A D;  4NE6 A;  3AZM A;  4H9O A;  1P3P B;  3A1I A;  4QLC C;  3AZJ D;  1KX3 D;  1N1J A;  4WZS B;  4X23 B;  1P3M C;  1EQZ C;  5CP6 D;  2HUE C;  4QLC A;  4J8U B;  3VH5 T;  3MVD D;  1KX4 D;  1P3M A;  5GT0 B;  5JRG C;  1EQZ A;  5B32 A;  3WAA C;  1H3O B;  5B1L C;  4XUJ C;  3AZM B;  1TZY C;  5B31 B;  3MNN B;  4WJ3 C;  3F6T A;  4H9O B;  4J8W D;  5JRG A;  5GXQ A;  5B1L A;  3TU4 D;  3AZH B;  1TAF A;  5B33 C;  1N1J B;  3X1V C;  1TZY A;  3W99 D;  3MGR D;  1AOI D;  4WU9 C;  3NQJ B;  4QLC B;  5B0Y A;  5B33 A;  3KUY C;  3X1V A;  4DRB A;  2PYO D;  2ARO C;  3REK C;  4WU9 A;  3AZK C;  2HUE B;  4EO5 C;  4X23 D;  3KUY A;  3LZ0 B;  3AZN C;  1KU5 A;  5JRG B;  3MGP C;  3REK A;  4J8U D;  3WAA B;  2F2A C;  4KGC D;  4XUJ B;  3AYW D;  3AZN A;  1WWI A;  3UTA A;  5BO0 B;  3MGP A;  1P3L C;  1M18 C;  5B40 C;  1P3F C;  3MGQ D;  4H9P A;  5B33 B;  5B31 D;  3MNN D;  5F99 B;  3W96 D;  4WU9 B;  3AZH D;  1P3L A;  5B40 A;  3MGS C;  3LJA C;  1P3F A;  1M18 A;  2HIO B;  3KUY B;  3W96 C;  2ARO B;  1M1A C;  3MGS A;  3LJA A;  3AZK B;  3W97 D;  3X1U C;  5DNN A;  4EO5 B;  3EPJ A;  3AZN B;  3WTP C;  5AV6 C;  3X1T C;  3B0C W;  2FFF B;  3AFA B;  4H9P B;  4NE3 A;  2ZY4 A;  3EPK A;  3LZ0 D;  5BT1 D;  5AV5 B;  2F8N G;  3WTP A;  5AV6 A;  3X1T A;  1F66 D;  2FJ7 C;  3AV1 C;  5B40 B;  1P3F B;  4XUJ D;  2YFW A;  5AV8 B;  5C3I C;  5CPI C;  3VH6 T;  2FJ7 A;  3MGS B;  3LJA B;  1BH8 B;  4DRA A;  3B0B A;  1P3G A;  5F99 D;  3W96 B;  2NZD D;  4UUZ A;  4JJN D;  1M1A B;  2HIO D;  1P3A D;  3X1U B;  3UTB C;  3W98 C;  3C1C C;  5AV6 B;  4YM6 B;  2ARO D;  5B1M C;  4G92 B;  3REH C;  3AZK D;  3LEL C;  2YFW B;  3UT9 A;  1P3O C;  3W98 A;  3C1C A;  3EG5 B;  4Z66 B;  3KSY A;  3AV1 B;  5B1M A;  3AFA D;  3REH A;  3A6N C;  3LEL A;  5AV5 D;  5GSU B;  5C3I B;  5CPI B;  1F1E A;  4UUZ B;  2ZY3 A;  4Z2M G;  3A6N A;  5AV8 D;  1ZLA D;  4NFT A;  1Z2C B;  4ZBJ C;  5AVB C;  4YS3 C;  5CPJ C;  3UTB B;  3W98 B;  3C1C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...