4J8WB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wB00
3X1TA 1P3AA 5CP6D 1P3AB 1P3MC 5B0ZC 3WAAC 3KWQD 3LZ0A 5B33C 5GSUC 5B32G 3AZIA 5B2JA 5B40A 5BO0A 4Z66C 3REJB 5B40B 5GT3B 4H9OB 3R45B 1P3OD 5CPJD 3WTPD 5G49A 4G92B 1P3MD 2RVQC 4ZBJC 1F66A 5BS7C 1M19D 5B0ZD 3WAAD 1F66B 2HIOC 5GT3C 3O62C 1EQZA 5B33D 3AZKB 3AV1C 1ZLAA 4G92C 5GSUD 1AOIC 3AYWA 5AV6A 4DRAA 2F8ND 3X1SC 4ZUXC 3UT9A 5CPIC 4Z66D 1P3GA 4H9SA 3UT9B 3WKJA 1P3GB 5BNVA 2AROB 2RVQD 4KGCB 3UTBC 5F99A 4H9NA 4H9PB 3UTAB 1HQ3C 3AZGC 4WU9B 1P3FA 2HIOD 1N1JA 5GT3D 3O62D 3AV1D 1ID3A 3KUYA 1N1JB 5B32A 1AOID 2AROC 4KGCC 5B1MB 3X1SD 4ZUXD 3REKA 5CPID 4J8UD 2F8NK 4WU8A 3LELC 3C1CB 3AZJC 2PYOC 3UTBD 4J8WA 5B1MC 1HQ3D 5AVBB 3AZGD 3MGPB 3MGRB 4X23A 5FUGA 3AZEC 5FUGB 3C1CC 2AROD 4KGCD 5B2IC 4WNNB 4Z5TB 3X1VA 1P3BB 1P3KC 3B6GC 3VH6T 5AVBC 3X1UC 5B1LA 3MGPC 3REIA 3W97B 4JJNA 3MGRC 3LELD 3TU4B 3AZHD 3AZJD 4XUJB 2PYOD 4KUDB 2BYKA 1B6WA 5B1MD 4Z5TC 1P3BC 5B24A 3W96A 1P3LC 5GXQA 1KX5C 3AFAA 5B24B 3W96B 3NQUA 3AZED 4YM6A 1BH9B 3MGSA 3A6NC 3TU4C 3REHA 3B0CT 4KUDC 5B2ID 4YS3A 3AN2B 2YFWA 1P3KD 3B6GD 3MVDB 5CP6A 5AVBD 3X1UD 3MGPD 3AV2A 1KX3A 3WA9D 1BFMA 3W98A 1U35D 3KXBB 3KWQB 3LZ1C 4Z5TD 3AN2C 3LJAA 1P3LD 1KX5D 3AZMA 4KHAA 3A6ND 2YFVA 5CPJA 3WTPA 1P3MA 4KUDD 5B31C 3KXBC 3KWQC 1P3OB 4M6BA 1ULYA 4XZQA 1WWSA 3WAAA 1M19B 5B0ZB 4H9QA 5B33A 1P34C 3WAAB 2NZDA 4UUZA 5GSUA 5B33B 3LZ1D 3AN2D 1P3IC 1KX4B 4UUZB 2F8NB 4Z66B 5AY8B 4QLCB 3C1BC 1M19C 5B31D 3KXBD 1M18B 2CV5B 1KX4C 5BS7A 4ZBJB 5CPKC 3REJA 5GT3A 4NE5A 4H9OA 3R45A 5AY8C 1P34D 4QLCC 4J8XB 2HIOB 3O62B 3AV1B 1P3ID 1M18C 3X1SA 1H3OA 1AOIB 2CV5C 5AV9B 5B0YD 5CPIA 5E5AB 1H3OB 5BT1C 3X1SB 4ZUXB 5CPIB 4J8UB 3C1BD 1R4VA 3AZKA 4J8XC 3VH5T 3W99C 3UTBB 5DNNC 1KX4D 1HQ3A 3AZGA 5CPKD 5AV9C 5E5AC 1HQ3B 3AZGB 4J8UC 5AY8D 4QLCD 3B6FC 4R8PD 2AROA 4KGCA 1M18D 5BNXA 2CV5D 4H9PA 5BNXB 3VH5W 5BT1D 3UTAA 3LZ0C 4WU9A 3LELA 3LELB 4J8XD 2PYOA 3AZHB 3AZJB 2PYOB 3W99D 5B1MA 5DNND 3AZNB 5AV9D 2FJ7B 1HTAA 5E5AD 4WZSB 3C1CA 4NFTA 3AZEB 3B6FD 4LD9B 5B2IA 3AZHC 3B6GA 5B2IB 3AZNC 1P3KB 5AVBA 3B6GB 3LZ0D 3MGPA 3RELB 1ZLAC 2FJ7C 3MGRA 3X1UB 3AZID 5AV6C 3WA9B 4EO5C 4LD9C 1U35B 4WNNA 4Z5TA 1JFIB 1P3BA 1P3LA 1KX5A 4Z2MG 3RELC 1TZYC 1P3LB 1KX5B 3W97A 1B67A 3TU4A 3WA9C 4XUJA 4KUDA 3A6NB 1U35C 3AZND 1BH8B 2FJ7D 1ZLAD 3KUYC 5B32C 3AYWD 2F8NG 4WV4B 5AV6D 3AZFC 1BH9A 4LD9D 3LZ1A 3AN2A 2BYMB 4J8VB 3AZLC 3MVDA 3LZ1B 3WKJD 3RELD 1TZYD 5AV5C 5JRGC 4CAYB 4E44A 4J8WC 4NE3A 3KXBA 3KWQA 1Q9CA 5B31B 4X23C 3MGQC 4J8VC 5DNMB 3KUYD 1S32B 5B32D 3MVDD 5AVCB 3AZFD 3X1VC 1P34A 1P34B 3REIC 1P3OA 4JJNC 3AZLD 4NE6A 1P3IB 5AV5D 4HGAC 4E45A 5GT0C 5JRGD 5DNMC 5B0YB 1S32C 4J8WD 3C1BA 5AVCC 1M19A 5B0ZA 1KU5A 3C1BB 5GXQC 3AFAC 5JA4B 4X23D 3MGQD 4J8VD 1KX4A 1P3PB 5CPKA 3REHC 2F8NA 2HUEB 5CPKB 5B0YC 3X1VD 4Z66A 5AY8A 4QLCA 3REID 3AV2C 1M18A 4JJND 4R8PB 2CV5A 3W98C 1P3PC 3VH6A 5DNMD 5GT0D 3B0BA 5AV8B 1S32D 2HUEC 5KDMB 5AVCD 3MNNB 4J8XA 5GXQD 2HIOA 3AFAD 3O62A 3AV1A 3AZMC 3NQJA 5DNNA 4R8PC 1AOIA 3B0DC 3MGSD 5AV9A 3NQJB 5DNNB 3REHD 3W99B 5E5AA 4ZUXA 5AV8C 2NQBB 4J8UA 3B6FA 3MNNC 3X1TB 4XZQC 3B6FB 3AV2D 1KX3D 1A7WA 1M1AC 3UTBA 3W98D 1P3PD 4CSRA 2NZDC 4CSRB 3LZ0B 2NQBC 3LJAD 3KSYA 3AZIB 3X1TC 3AZMD 5B2JB 1P3AC 5BO0B 1TAFA 1TAFB 5AV8D 5G49B 3MNND 4XZQD 3AZIC 3AZJA 3AZHA 1M1AD 5B2JC 3REJC 5B40C 3AZNA 2FJ7A 2NZDD 1EQZB 1ZLAB 2NQBD 4LD9A 3AZEA 3AYWB 3X1TD 5AV6B 4EO5B 1P3AD 1F66C 5B31G 1P3KA 3RELA 1TZYA 3AZKC 3WKJB 5BNVB 4Z2MH 1EQZC 1TZYB 3X1UA 5CHLB 3WA9A 5F99B 3AYWC 4H9NB 5B2JD 3REJD 1U35A 5B40D 1JFIA 3UT9C 1P3GC 1P3FB 4H9SC 3WKJC 1ID3B 3KUYB 3AZFA 5B32B 2F8NH 5C3IB 3UTAC 5F99C 3AZFB 3A6NA 3REKB 4WU9C 3AZLA 1F66D 1BH8A 4WU8B 3AZKD 5AV5A 3AZLB 5JRGA 1P3FC 1EQZD 5AV5B 5JRGB 1ID3C 4DRBA 4J8WB 5C3IC 3MGQA 3VH5A 2BYMA 4J8VA 3REKC 3UT9D 1P3GD 4X23B 3MGQB 4WU8C 3WTPE 4G91B 4CAYA 3UTAD 5F99D 3X1VB 4H9RA 4WU9D 5B31A 4H9RB 5B1LB 3REIB 4JJNB 4AWLB 1F1EA 5GT0A 5DNMA 1P3FD 1S32A 4HGAB 5GT0B 1ID3D 4G91C 5AVCA 2BYKB 5GXQB 3REKD 3AFAB 3VH6W 3W97C 3C1CD 5B1LC 3NQUB 3V9RA 1P3IA 4AWLC 4YM6B 4WU8D 4XUJC 3MGSB 3V9RB 5B0YA 3REHB 2IO5B 1WWIA 4YS3B 2YFWB 3MGRD 5JA4A 5CP6B 5B24C 3W96C 3AV2B 1P3PA 1KX3B 3W98B 2LY8A 4YM6C 3MGSC 1P3BD 2IO5C 3B0CW 3MVDC 4YS3C 3LJAB 3W97D 5CP6C 4R8PA 3AZMB 5B1LD 3TU4D 1KX3C 3B0DB 4XUJD 4KHAB 5AV8A 2YFVB 5CPJB 3WTPB 1P3MB 5KDMA 3MNNA 5B24D 4XZQB 1M1AA 3LJAC 2L5AA 3W96D 2CWEA 1M1AB 3W99A 4YM6D 2JSSA 4H9QB 2NQBA 2NZDB 1P3OC 5CPJC 3WTPC 5GSUB 4YS3D
chains in the Genus database with same CATH superfamily
3X1TA 1P3AA 5CP6D 1P3AB 1P3MC 5B0ZC 3WAAC 3KWQD 1PZRA 3LZ0A 5B33C 5GSUC 5B32G 3AZIA 5B2JA 5B40A 5BO0A 4Z66C 2Y2MA 3REJB 5B40B 5GT3B 4H9OB 3R45B 1P3OD 5CPJD 3WTPD 5G49A 4G92B 1P3MD 2RVQC 2W8SA 4ZBJC 2JCHA 1F66A 5BS7C 1M19D 5B0ZD 3WAAD 1F66B 2HIOC 5GT3C 3O62C 1EQZA 5B33D 3AZKB 3AV1C 1ZLAA 4G92C 5GSUD 1AOIC 3AYWA 5AV6A 4DRAA 2F8ND 3X1SC 4ZUXC 3UT9A 5CPIC 4Z66D 1P3GA 4H9SA 3UT9B 3WKJA 1P3GB 5BNVA 2AROB 2RVQD 4KGCB 3UTBC 5F99A 2Y2IA 4H9NA 4H9PB 3UTAB 1HQ3C 3AZGC 4WU9B 2Y2LA 1P3FA 2HIOD 1N1JA 5GT3D 3O62D 3AV1D 1ID3A 3KUYA 1N1JB 5B32A 1AOID 2AROC 4KGCC 5B1MB 3X1SD 4ZUXD 3REKA 2J8PA 5CPID 4J8UD 2F8NK 4WU8A 3LELC 3C1CB 3AZJC 3A1KA 2Y2OA 2PYOC 3UTBD 4J8WA 5B1MC 1HQ3D 5AVBB 3AZGD 3MGPB 3MGRB 1W2EA 5FUGA 4X23A 3AZEC 2Y2GA 5FUGB 3C1CC 2AROD 4KGCD 5B2IC 4WNNB 4Z5TB 3X1VA 1P3BB 1P3KC 3B6GC 3VH6T 5AVBC 3X1UC 5B1LA 3MGPC 3REIA 3W97B 4JJNA 3MGRC 3LELD 3TU4B 3AZHD 3AZJD 4XUJB 2PYOD 4KUDB 2BYKA 1B6WA 5B1MD 4Z5TC 1P3BC 5B24A 3W96A 1P3LC 5GXQA 1KX5C 3AFAA 5B24B 3W96B 3NQUA 3AZED 4YM6A 1BH9B 3MGSA 3A6NC 3TU4C 3REHA 3B0CT 4KUDC 5B2ID 4YS3A 3AN2B 2YFWA 1P3KD 3B6GD 3MVDB 5CP6A 5AVBD 3X1UD 3MGPD 3AV2A 1KX3A 3WA9D 1BFMA 3W98A 1U35D 3KXBB 3KWQB 3LZ1C 4Z5TD 3AN2C 3LJAA 1P3LD 1KX5D 3AZMA 2DF4C 4KHAA 3A6ND 2YFVA 2F2AC 5CPJA 3WTPA 1P3MA 2JE5A 4KUDD 5B31C 3KXBC 2ZY3A 3KWQC 1P3OB 4M6BA 1ULYA 4XZQA 1WWSA 2ZY2A 3WAAA 1M19B 5B0ZB 4H9QA 5B33A 1P34C 3WAAB 2NZDA 4UUZA 5GSUA 5B33B 3LZ1D 2DQNC 3AN2D 1P3IC 1KX4B 4UUZB 2F8NB 4Z66B 5AY8B 4QLCB 3C1BC 1M19C 5B31D 3KXBD 1M18B 2CV5B 1KX4C 5BS7A 4ZBJB 5CPKC 3REJA 5GT3A 4NE5A 4H9OA 3R45A 5AY8C 1P34D 4QLCC 4J8XB 3KFUG 2HIOB 3O62B 3P5JB 3AV1B 1P3ID 1M18C 3X1SA 1H3OA 1AOIB 2RIQA 2CV5C 5AV9B 5B0YD 5CPIA 5E5AB 1H3OB 5BT1C 3X1SB 4ZUXB 4DQYB 5CPIB 2Y2PA 2FFFB 4J8UB 3C1BD 1R4VA 3AZKA 4J8XC 3VH5T 3W99C 3UTBB 5DNNC 1KX4D 1HQ3A 3AZGA 5CPKD 5AV9C 5E5AC 1HQ3B 3AZGB 4J8UC 5AY8D 4QLCD 3B6FC 4R8PD 2AROA 4KGCA 1M18D 5BNXA 2CV5D 4H9PA 5BNXB 3VH5W 5BT1D 3UTAA 3LZ0C 4WU9A 3LELA 3LELB 4J8XD 2PYOA 3AZHB 3AZJB 4WJ3C 2PYOB 3W99D 3A1IA 5B1MA 5DNND 3AZNB 5AV9D 2FJ7B 1HTAA 5E5AD 2Y2JA 1T3UA 4WZSB 3C1CA 4NFTA 3AZEB 3B6FD 4LD9B 3EPHA 5B2IA 2ZY4A 3AZHC 3B6GA 5B2IB 3AZNC 1P3KB 5AVBA 3B6GB 3LZ0D 3MGPA 3RELB 1ZLAC 2FJ7C 3MGRA 3EPKA 3X1UB 3AL0C 3AZID 5AV6C 3WA9B 4EO5C 4LD9C 1U35B 4WNNA 4Z5TA 1JFIB 1P3BA 3H0MC 1P3LA 1KX5A 4Z2MG 3RELC 1TZYC 1P3LB 1KX5B 3W97A 1B67A 3TU4A 3H0LC 3WA9C 4XUJA 4KUDA 3A6NB 1U35C 3AZND 1BH8B 2FJ7D 1ZLAD 3KUYC 5B32C 3AYWD 2F8NG 4WV4B 5AV6D 3AZFC 1BH9A 4LD9D 3LZ1A 3AN2A 2BYMB 4J8VB 3AZLC 3MVDA 3LZ1B 3WKJD 3RELD 1TZYD 5AV5C 5JRGC 4CAYB 4E44A 4J8WC 4NE3A 3KXBA 3H0RC 3KWQA 1Q9CA 5B31B 4X23C 3MGQC 3IP4C 4J8VC 2ZY5A 5DNMB 3KUYD 1S32B 5B32D 3MVDD 3F6TA 5AVCB 3AZFD 3X1VC 1P34A 1P34B 3REIC 1P3OA 4JJNC 3AZLD 4NE6A 1P3IB 2Y2NA 5AV5D 4HGAC 5GT0C 4E45A 5JRGD 5DNMC 5B0YB 1S32C 4J8WD 3C1BA 5AVCC 1M19A 5B0ZA 1KU5A 3C1BB 5GXQC 3AFAC 5JA4B 4X23D 3MGQD 4J8VD 1KX4A 1P3PB 5CPKA 3REHC 2F8NA 2HUEB 5CPKB 5B0YC 3X1VD 4Z66A 5AY8A 4QLCA 3REID 3AV2C 1M18A 4JJND 4R8PB 2CV5A 3W98C 1P3PC 3VH6A 5DNMD 5GT0D 3B0BA 5AV8B 1S32D 2XD5A 2HUEC 5KDMB 5AVCD 2BG1A 3MNNB 4J8XA 5GXQD 2HIOA 3AFAD 3O62A 3AV1A 3AZMC 3NQJA 5DNNA 4R8PC 1AOIA 3B0DC 3MGSD 5AV9A 3NQJB 5DNNB 3REHD 3W99B 5E5AA 4ZUXA 5AV8C 2NQBB 4J8UA 3B6FA 3MNNC 3X1TB 4XZQC 3B6FB 3AV2D 1KX3D 1A7WA 1M1AC 2Y2HA 3UTBA 3W98D 1P3PD 4CSRA 2NZDC 4CSRB 3LZ0B 2NQBC 3LJAD 3KSYA 3EPJA 3AZIB 3X1TC 3AZMD 5B2JB 1P3AC 5BO0B 1TAFA 1TAFB 5AV8D 5G49B 3MNND 4XZQD 3AZIC 3AZJA 3AZHA 1M1AD 5B2JC 3REJC 5B40C 3AZNA 2FJ7A 2NZDD 1EQZB 3EPLA 1ZLAB 2NQBD 4LD9A 3AZEA 3AYWB 3X1TD 5AV6B 4EO5B 1P3AD 1F66C 5B31G 1P3KA 3RELA 1TZYA 3AZKC 3WKJB 5BNVB 4Z2MH 1EQZC 1TZYB 3X1UA 5CHLB 3WA9A 5F99B 3AYWC 4H9NB 5B2JD 3REJD 1U35A 5B40D 1JFIA 3UT9C 1P3GC 1P3FB 4H9SC 3WKJC 1ID3B 3KUYB 3AZFA 5B32B 2F8NH 2ZM5A 5C3IB 3UTAC 5F99C 3AZFB 3A6NA 3REKB 4WU9C 3AZLA 1F66D 1BH8A 4WU8B 3AZKD 5AV5A 3AZLB 5JRGA 1P3FC 4UPKA 1EQZD 5AV5B 5JRGB 1ID3C 4DRBA 4J8WB 5C3IC 3MGQA 3VH5A 2BYMA 4J8VA 3REKC 3UT9D 1P3GD 4X23B 3MGQB 2VQRA 4WU8C 3WTPE 2XD1A 4G91B 4CAYA 3UTAD 2Y2KA 5F99D 3X1VB 4H9RA 2UWXA 4WU9D 5B31A 4H9RB 2Y2QA 5B1LB 3REIB 4JJNB 4AWLB 1F1EA 5GT0A 5DNMA 1P3FD 1S32A 4HGAB 5GT0B 1ID3D 4G91C 5AVCA 2BYKB 3FDDA 5GXQB 3REKD 3AFAB 3VH6W 3W97C 3C1CD 5B1LC 3NQUB 3V9RA 1P3IA 4AWLC 4YM6B 4WU8D 4XUJC 3MGSB 3V9RB 5B0YA 3REHB 2IO5B 1WWIA 4YS3B 2YFWB 3MGRD 5JA4A 5CP6B 5B24C 3W96C 3AV2B 1P3PA 1KX3B 3W98B 2LY8A 4YM6C 2G5IC 3MGSC 1P3BD 2IO5C 3B0CW 3MVDC 4YS3C 3LJAB 3W97D 5CP6C 4R8PA 3AZMB 5B1LD 3TU4D 2G5HC 1KX3C 3B0DB 4XUJD 4KHAB 5AV8A 2YFVB 3EG5B 5CPJB 3WTPB 1P3MB 5KDMA 3MNNA 5B24D 4XZQB 1M1AA 3LJAC 2L5AA 3W96D 2CWEA 1M1AB 3W99A 4YM6D 2JSSA 4H9QB 1Z2CB 2NQBA 2NZDB 1P3OC 5CPJC 3WTPC 5GSUB 4YS3D
chains in the Genus database with same CATH topology
3X1TA 1P3AA 5CP6D 1P3AB 1P3MC 5B0ZC 3WAAC 3KWQD 1PZRA 3LZ0A 5B33C 5GSUC 5B32G 3AZIA 5B2JA 5B40A 5BO0A 4Z66C 2Y2MA 3REJB 5B40B 5GT3B 4H9OB 3R45B 1P3OD 5CPJD 3WTPD 5G49A 4G92B 1P3MD 2RVQC 2W8SA 4ZBJC 2JCHA 1F66A 5BS7C 1M19D 5B0ZD 3WAAD 1F66B 2HIOC 5GT3C 3O62C 1EQZA 5B33D 3AZKB 3AV1C 1ZLAA 4G92C 5GSUD 1AOIC 3AYWA 5AV6A 4DRAA 2F8ND 3X1SC 4ZUXC 3UT9A 5CPIC 4Z66D 1P3GA 4H9SA 3UT9B 3WKJA 1P3GB 5BNVA 2AROB 2RVQD 4KGCB 3UTBC 5F99A 2Y2IA 4H9NA 4H9PB 3UTAB 1HQ3C 3AZGC 4WU9B 2Y2LA 1P3FA 2HIOD 1N1JA 5GT3D 3O62D 3AV1D 1ID3A 3KUYA 1N1JB 5B32A 1AOID 2AROC 4KGCC 5B1MB 3X1SD 4ZUXD 3REKA 2J8PA 5CPID 4J8UD 2F8NK 4WU8A 3LELC 3C1CB 3AZJC 3A1KA 2Y2OA 2PYOC 3UTBD 4J8WA 5B1MC 1HQ3D 5AVBB 3AZGD 3MGPB 3MGRB 1W2EA 5FUGA 4X23A 3AZEC 2Y2GA 5FUGB 3C1CC 2AROD 4KGCD 5B2IC 4WNNB 4Z5TB 3X1VA 1P3BB 1P3KC 3B6GC 3VH6T 5AVBC 3X1UC 5B1LA 3MGPC 3REIA 3W97B 4JJNA 3MGRC 3LELD 3TU4B 3AZHD 3AZJD 4XUJB 2PYOD 4KUDB 2BYKA 1B6WA 5B1MD 4Z5TC 1P3BC 5B24A 3W96A 1P3LC 5GXQA 1KX5C 3AFAA 5B24B 3W96B 3NQUA 3AZED 4YM6A 1BH9B 3MGSA 3A6NC 3TU4C 3REHA 3B0CT 4KUDC 5B2ID 4YS3A 3AN2B 2YFWA 1P3KD 3B6GD 3MVDB 5CP6A 5AVBD 3X1UD 3MGPD 3AV2A 1KX3A 3WA9D 1BFMA 3W98A 1U35D 3KXBB 3KWQB 3LZ1C 4Z5TD 3AN2C 3LJAA 1P3LD 1KX5D 3AZMA 2DF4C 4KHAA 3A6ND 2YFVA 2F2AC 5CPJA 3WTPA 1P3MA 2JE5A 4KUDD 5B31C 3KXBC 2ZY3A 3KWQC 1P3OB 4M6BA 1ULYA 4XZQA 1WWSA 2ZY2A 3WAAA 1M19B 5B0ZB 4H9QA 5B33A 1P34C 3WAAB 2NZDA 4UUZA 5GSUA 5B33B 3LZ1D 2DQNC 3AN2D 1P3IC 1KX4B 4UUZB 2F8NB 4Z66B 5AY8B 4QLCB 3C1BC 1M19C 5B31D 3KXBD 1M18B 2CV5B 1KX4C 5BS7A 4ZBJB 5CPKC 3REJA 5GT3A 4NE5A 4H9OA 3R45A 5AY8C 1P34D 4QLCC 4J8XB 3KFUG 2HIOB 3O62B 3P5JB 3AV1B 1P3ID 1M18C 3X1SA 1H3OA 1AOIB 2RIQA 2CV5C 5AV9B 5B0YD 5CPIA 5E5AB 1H3OB 5BT1C 3X1SB 4ZUXB 4DQYB 5CPIB 2Y2PA 2FFFB 4J8UB 3C1BD 1R4VA 3AZKA 4J8XC 3VH5T 3W99C 3UTBB 5DNNC 1KX4D 1HQ3A 3AZGA 5CPKD 5AV9C 5E5AC 1HQ3B 3AZGB 4J8UC 5AY8D 4QLCD 3B6FC 4R8PD 2AROA 4KGCA 1M18D 5BNXA 2CV5D 4H9PA 5BNXB 3VH5W 5BT1D 3UTAA 3LZ0C 4WU9A 3LELA 3LELB 4J8XD 2PYOA 3AZHB 3AZJB 4WJ3C 2PYOB 3W99D 3A1IA 5B1MA 5DNND 3AZNB 5AV9D 2FJ7B 1HTAA 5E5AD 2Y2JA 1T3UA 4WZSB 3C1CA 4NFTA 3AZEB 3B6FD 4LD9B 3EPHA 5B2IA 2ZY4A 3AZHC 3B6GA 5B2IB 3AZNC 1P3KB 5AVBA 3B6GB 3LZ0D 3MGPA 3RELB 1ZLAC 2FJ7C 3MGRA 3EPKA 3X1UB 3AL0C 3AZID 5AV6C 3WA9B 4EO5C 4LD9C 1U35B 4WNNA 4Z5TA 1JFIB 1P3BA 3H0MC 1P3LA 1KX5A 4Z2MG 3RELC 1TZYC 1P3LB 1KX5B 3W97A 1B67A 3TU4A 3H0LC 3WA9C 4XUJA 4KUDA 3A6NB 1U35C 3AZND 1BH8B 2FJ7D 1ZLAD 3KUYC 5B32C 3AYWD 2F8NG 4WV4B 5AV6D 3AZFC 1BH9A 4LD9D 3LZ1A 3AN2A 2BYMB 4J8VB 3AZLC 3MVDA 3LZ1B 3WKJD 3RELD 1TZYD 5AV5C 5JRGC 4CAYB 4E44A 4J8WC 4NE3A 3KXBA 3H0RC 3KWQA 1Q9CA 5B31B 4X23C 3MGQC 3IP4C 4J8VC 2ZY5A 5DNMB 3KUYD 1S32B 5B32D 3MVDD 3F6TA 5AVCB 3AZFD 3X1VC 1P34A 1P34B 3REIC 1P3OA 4JJNC 3AZLD 4NE6A 1P3IB 2Y2NA 5AV5D 4HGAC 5GT0C 4E45A 5JRGD 5DNMC 5B0YB 1S32C 4J8WD 3C1BA 5AVCC 1M19A 5B0ZA 1KU5A 3C1BB 5GXQC 3AFAC 5JA4B 4X23D 3MGQD 4J8VD 1KX4A 1P3PB 5CPKA 3REHC 2F8NA 2HUEB 5CPKB 5B0YC 3X1VD 4Z66A 5AY8A 4QLCA 3REID 3AV2C 1M18A 4JJND 4R8PB 2CV5A 3W98C 1P3PC 3VH6A 5DNMD 5GT0D 3B0BA 5AV8B 1S32D 2XD5A 2HUEC 5KDMB 5AVCD 2BG1A 3MNNB 4J8XA 5GXQD 2HIOA 3AFAD 3O62A 3AV1A 3AZMC 3NQJA 5DNNA 4R8PC 1AOIA 3B0DC 3MGSD 5AV9A 3NQJB 5DNNB 3REHD 3W99B 5E5AA 4ZUXA 5AV8C 2NQBB 4J8UA 3B6FA 3MNNC 3X1TB 4XZQC 3B6FB 3AV2D 1KX3D 1A7WA 1M1AC 2Y2HA 3UTBA 3W98D 1P3PD 4CSRA 2NZDC 4CSRB 3LZ0B 2NQBC 3LJAD 3KSYA 3EPJA 3AZIB 3X1TC 3AZMD 5B2JB 1P3AC 5BO0B 1TAFA 1TAFB 5AV8D 5G49B 3MNND 4XZQD 3AZIC 3AZJA 3AZHA 1M1AD 5B2JC 3REJC 5B40C 3AZNA 2FJ7A 2NZDD 1EQZB 3EPLA 1ZLAB 2NQBD 4LD9A 3AZEA 3AYWB 3X1TD 5AV6B 4EO5B 1P3AD 1F66C 5B31G 1P3KA 3RELA 1TZYA 3AZKC 3WKJB 5BNVB 4Z2MH 1EQZC 1TZYB 3X1UA 5CHLB 3WA9A 5F99B 3AYWC 4H9NB 5B2JD 3REJD 1U35A 5B40D 1JFIA 3UT9C 1P3GC 1P3FB 4H9SC 3WKJC 1ID3B 3KUYB 3AZFA 5B32B 2F8NH 2ZM5A 5C3IB 3UTAC 5F99C 3AZFB 3A6NA 3REKB 4WU9C 3AZLA 1F66D 1BH8A 4WU8B 3AZKD 5AV5A 3AZLB 5JRGA 1P3FC 4UPKA 1EQZD 5AV5B 5JRGB 1ID3C 4DRBA 4J8WB 5C3IC 3MGQA 3VH5A 2BYMA 4J8VA 3REKC 3UT9D 1P3GD 4X23B 3MGQB 2VQRA 4WU8C 3WTPE 2XD1A 4G91B 4CAYA 3UTAD 2Y2KA 5F99D 3X1VB 4H9RA 2UWXA 4WU9D 5B31A 4H9RB 2Y2QA 5B1LB 3REIB 4JJNB 4AWLB 1F1EA 5GT0A 5DNMA 1P3FD 1S32A 4HGAB 5GT0B 1ID3D 4G91C 5AVCA 2BYKB 3FDDA 5GXQB 3REKD 3AFAB 3VH6W 3W97C 3C1CD 5B1LC 3NQUB 3V9RA 1P3IA 4AWLC 4YM6B 4WU8D 4XUJC 3MGSB 3V9RB 5B0YA 3REHB 2IO5B 1WWIA 4YS3B 2YFWB 3MGRD 5JA4A 5CP6B 5B24C 3W96C 3AV2B 1P3PA 1KX3B 3W98B 2LY8A 4YM6C 2G5IC 3MGSC 1P3BD 2IO5C 3B0CW 3MVDC 4YS3C 3LJAB 3W97D 5CP6C 4R8PA 3AZMB 5B1LD 3TU4D 2G5HC 1KX3C 3B0DB 4XUJD 4KHAB 5AV8A 2YFVB 3EG5B 5CPJB 3WTPB 1P3MB 5KDMA 3MNNA 5B24D 4XZQB 1M1AA 3LJAC 2L5AA 3W96D 2CWEA 1M1AB 3W99A 4YM6D 2JSSA 4H9QB 1Z2CB 2NQBA 2NZDB 1P3OC 5CPJC 3WTPC 5GSUB 4YS3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T A;  1P3A A;  5CP6 D;  1P3A B;  1P3M C;  5B0Z C;  3WAA C;  3KWQ D;  3LZ0 A;  5B33 C;  5GSU C;  5B32 G;  3AZI A;  5B2J A;  5B40 A;  5BO0 A;  4Z66 C;  3REJ B;  5B40 B;  5GT3 B;  4H9O B;  3R45 B;  1P3O D;  5CPJ D;  3WTP D;  5G49 A;  4G92 B;  1P3M D;  2RVQ C;  4ZBJ C;  1F66 A;  5BS7 C;  1M19 D;  5B0Z D;  3WAA D;  1F66 B;  2HIO C;  5GT3 C;  3O62 C;  1EQZ A;  5B33 D;  3AZK B;  3AV1 C;  1ZLA A;  4G92 C;  5GSU D;  1AOI C;  3AYW A;  5AV6 A;  4DRA A;  2F8N D;  3X1S C;  4ZUX C;  3UT9 A;  5CPI C;  4Z66 D;  1P3G A;  4H9S A;  3UT9 B;  3WKJ A;  1P3G B;  5BNV A;  2ARO B;  2RVQ D;  4KGC B;  3UTB C;  5F99 A;  4H9N A;  4H9P B;  3UTA B;  1HQ3 C;  3AZG C;  4WU9 B;  1P3F A;  2HIO D;  1N1J A;  5GT3 D;  3O62 D;  3AV1 D;  1ID3 A;  3KUY A;  1N1J B;  5B32 A;  1AOI D;  2ARO C;  4KGC C;  5B1M B;  3X1S D;  4ZUX D;  3REK A;  5CPI D;  4J8U D;  2F8N K;  4WU8 A;  3LEL C;  3C1C B;  3AZJ C;  2PYO C;  3UTB D;  4J8W A;  5B1M C;  1HQ3 D;  5AVB B;  3AZG D;  3MGP B;  3MGR B;  4X23 A;  5FUG A;  3AZE C;  5FUG B;  3C1C C;  2ARO D;  4KGC D;  5B2I C;  4WNN B;  4Z5T B;  3X1V A;  1P3B B;  1P3K C;  3B6G C;  3VH6 T;  5AVB C;  3X1U C;  5B1L A;  3MGP C;  3REI A;  3W97 B;  4JJN A;  3MGR C;  3LEL D;  3TU4 B;  3AZH D;  3AZJ D;  4XUJ B;  2PYO D;  4KUD B;  2BYK A;  1B6W A;  5B1M D;  4Z5T C;  1P3B C;  5B24 A;  3W96 A;  1P3L C;  5GXQ A;  1KX5 C;  3AFA A;  5B24 B;  3W96 B;  3NQU A;  3AZE D;  4YM6 A;  1BH9 B;  3MGS A;  3A6N C;  3TU4 C;  3REH A;  3B0C T;  4KUD C;  5B2I D;  4YS3 A;  3AN2 B;  2YFW A;  1P3K D;  3B6G D;  3MVD B;  5CP6 A;  5AVB D;  3X1U D;  3MGP D;  3AV2 A;  1KX3 A;  3WA9 D;  1BFM A;  3W98 A;  1U35 D;  3KXB B;  3KWQ B;  3LZ1 C;  4Z5T D;  3AN2 C;  3LJA A;  1P3L D;  1KX5 D;  3AZM A;  4KHA A;  3A6N D;  2YFV A;  5CPJ A;  3WTP A;  1P3M A;  4KUD D;  5B31 C;  3KXB C;  3KWQ C;  1P3O B;  4M6B A;  1ULY A;  4XZQ A;  1WWS A;  3WAA A;  1M19 B;  5B0Z B;  4H9Q A;  5B33 A;  1P34 C;  3WAA B;  2NZD A;  4UUZ A;  5GSU A;  5B33 B;  3LZ1 D;  3AN2 D;  1P3I C;  1KX4 B;  4UUZ B;  2F8N B;  4Z66 B;  5AY8 B;  4QLC B;  3C1B C;  1M19 C;  5B31 D;  3KXB D;  1M18 B;  2CV5 B;  1KX4 C;  5BS7 A;  4ZBJ B;  5CPK C;  3REJ A;  5GT3 A;  4NE5 A;  4H9O A;  3R45 A;  5AY8 C;  1P34 D;  4QLC C;  4J8X B;  2HIO B;  3O62 B;  3AV1 B;  1P3I D;  1M18 C;  3X1S A;  1H3O A;  1AOI B;  2CV5 C;  5AV9 B;  5B0Y D;  5CPI A;  5E5A B;  1H3O B;  5BT1 C;  3X1S B;  4ZUX B;  5CPI B;  4J8U B;  3C1B D;  1R4V A;  3AZK A;  4J8X C;  3VH5 T;  3W99 C;  3UTB B;  5DNN C;  1KX4 D;  1HQ3 A;  3AZG A;  5CPK D;  5AV9 C;  5E5A C;  1HQ3 B;  3AZG B;  4J8U C;  5AY8 D;  4QLC D;  3B6F C;  4R8P D;  2ARO A;  4KGC A;  1M18 D;  5BNX A;  2CV5 D;  4H9P A;  5BNX B;  3VH5 W;  5BT1 D;  3UTA A;  3LZ0 C;  4WU9 A;  3LEL A;  3LEL B;  4J8X D;  2PYO A;  3AZH B;  3AZJ B;  2PYO B;  3W99 D;  5B1M A;  5DNN D;  3AZN B;  5AV9 D;  2FJ7 B;  1HTA A;  5E5A D;  4WZS B;  3C1C A;  4NFT A;  3AZE B;  3B6F D;  4LD9 B;  5B2I A;  3AZH C;  3B6G A;  5B2I B;  3AZN C;  1P3K B;  5AVB A;  3B6G B;  3LZ0 D;  3MGP A;  3REL B;  1ZLA C;  2FJ7 C;  3MGR A;  3X1U B;  3AZI D;  5AV6 C;  3WA9 B;  4EO5 C;  4LD9 C;  1U35 B;  4WNN A;  4Z5T A;  1JFI B;  1P3B A;  1P3L A;  1KX5 A;  4Z2M G;  3REL C;  1TZY C;  1P3L B;  1KX5 B;  3W97 A;  1B67 A;  3TU4 A;  3WA9 C;  4XUJ A;  4KUD A;  3A6N B;  1U35 C;  3AZN D;  1BH8 B;  2FJ7 D;  1ZLA D;  3KUY C;  5B32 C;  3AYW D;  2F8N G;  4WV4 B;  5AV6 D;  3AZF C;  1BH9 A;  4LD9 D;  3LZ1 A;  3AN2 A;  2BYM B;  4J8V B;  3AZL C;  3MVD A;  3LZ1 B;  3WKJ D;  3REL D;  1TZY D;  5AV5 C;  5JRG C;  4CAY B;  4E44 A;  4J8W C;  4NE3 A;  3KXB A;  3KWQ A;  1Q9C A;  5B31 B;  4X23 C;  3MGQ C;  4J8V C;  5DNM B;  3KUY D;  1S32 B;  5B32 D;  3MVD D;  5AVC B;  3AZF D;  3X1V C;  1P34 A;  1P34 B;  3REI C;  1P3O A;  4JJN C;  3AZL D;  4NE6 A;  1P3I B;  5AV5 D;  4HGA C;  4E45 A;  5GT0 C;  5JRG D;  5DNM C;  5B0Y B;  1S32 C;  4J8W D;  3C1B A;  5AVC C;  1M19 A;  5B0Z A;  1KU5 A;  3C1B B;  5GXQ C;  3AFA C;  5JA4 B;  4X23 D;  3MGQ D;  4J8V D;  1KX4 A;  1P3P B;  5CPK A;  3REH C;  2F8N A;  2HUE B;  5CPK B;  5B0Y C;  3X1V D;  4Z66 A;  5AY8 A;  4QLC A;  3REI D;  3AV2 C;  1M18 A;  4JJN D;  4R8P B;  2CV5 A;  3W98 C;  1P3P C;  3VH6 A;  5DNM D;  5GT0 D;  3B0B A;  5AV8 B;  1S32 D;  2HUE C;  5KDM B;  5AVC D;  3MNN B;  4J8X A;  5GXQ D;  2HIO A;  3AFA D;  3O62 A;  3AV1 A;  3AZM C;  3NQJ A;  5DNN A;  4R8P C;  1AOI A;  3B0D C;  3MGS D;  5AV9 A;  3NQJ B;  5DNN B;  3REH D;  3W99 B;  5E5A A;  4ZUX A;  5AV8 C;  2NQB B;  4J8U A;  3B6F A;  3MNN C;  3X1T B;  4XZQ C;  3B6F B;  3AV2 D;  1KX3 D;  1A7W A;  1M1A C;  3UTB A;  3W98 D;  1P3P D;  4CSR A;  2NZD C;  4CSR B;  3LZ0 B;  2NQB C;  3LJA D;  3KSY A;  3AZI B;  3X1T C;  3AZM D;  5B2J B;  1P3A C;  5BO0 B;  1TAF A;  1TAF B;  5AV8 D;  5G49 B;  3MNN D;  4XZQ D;  3AZI C;  3AZJ A;  3AZH A;  1M1A D;  5B2J C;  3REJ C;  5B40 C;  3AZN A;  2FJ7 A;  2NZD D;  1EQZ B;  1ZLA B;  2NQB D;  4LD9 A;  3AZE A;  3AYW B;  3X1T D;  5AV6 B;  4EO5 B;  1P3A D;  1F66 C;  5B31 G;  1P3K A;  3REL A;  1TZY A;  3AZK C;  3WKJ B;  5BNV B;  4Z2M H;  1EQZ C;  1TZY B;  3X1U A;  5CHL B;  3WA9 A;  5F99 B;  3AYW C;  4H9N B;  5B2J D;  3REJ D;  1U35 A;  5B40 D;  1JFI A;  3UT9 C;  1P3G C;  1P3F B;  4H9S C;  3WKJ C;  1ID3 B;  3KUY B;  3AZF A;  5B32 B;  2F8N H;  5C3I B;  3UTA C;  5F99 C;  3AZF B;  3A6N A;  3REK B;  4WU9 C;  3AZL A;  1F66 D;  1BH8 A;  4WU8 B;  3AZK D;  5AV5 A;  3AZL B;  5JRG A;  1P3F C;  1EQZ D;  5AV5 B;  5JRG B;  1ID3 C;  4DRB A;  4J8W B;  5C3I C;  3MGQ A;  3VH5 A;  2BYM A;  4J8V A;  3REK C;  3UT9 D;  1P3G D;  4X23 B;  3MGQ B;  4WU8 C;  3WTP E;  4G91 B;  4CAY A;  3UTA D;  5F99 D;  3X1V B;  4H9R A;  4WU9 D;  5B31 A;  4H9R B;  5B1L B;  3REI B;  4JJN B;  4AWL B;  1F1E A;  5GT0 A;  5DNM A;  1P3F D;  1S32 A;  4HGA B;  5GT0 B;  1ID3 D;  4G91 C;  5AVC A;  2BYK B;  5GXQ B;  3REK D;  3AFA B;  3VH6 W;  3W97 C;  3C1C D;  5B1L C;  3NQU B;  3V9R A;  1P3I A;  4AWL C;  4YM6 B;  4WU8 D;  4XUJ C;  3MGS B;  3V9R B;  5B0Y A;  3REH B;  2IO5 B;  1WWI A;  4YS3 B;  2YFW B;  3MGR D;  5JA4 A;  5CP6 B;  5B24 C;  3W96 C;  3AV2 B;  1P3P A;  1KX3 B;  3W98 B;  2LY8 A;  4YM6 C;  3MGS C;  1P3B D;  2IO5 C;  3B0C W;  3MVD C;  4YS3 C;  3LJA B;  3W97 D;  5CP6 C;  4R8P A;  3AZM B;  5B1L D;  3TU4 D;  1KX3 C;  3B0D B;  4XUJ D;  4KHA B;  5AV8 A;  2YFV B;  5CPJ B;  3WTP B;  1P3M B;  5KDM A;  3MNN A;  5B24 D;  4XZQ B;  1M1A A;  3LJA C;  2L5A A;  3W96 D;  2CWE A;  1M1A B;  3W99 A;  4YM6 D;  2JSS A;  4H9Q B;  2NQB A;  2NZD B;  1P3O C;  5CPJ C;  3WTP C;  5GSU B;  4YS3 D; 
#chains in the Genus database with same CATH topology
 3X1T A;  1P3A A;  5CP6 D;  1P3A B;  1P3M C;  5B0Z C;  3WAA C;  3KWQ D;  1PZR A;  3LZ0 A;  5B33 C;  5GSU C;  5B32 G;  3AZI A;  5B2J A;  5B40 A;  5BO0 A;  4Z66 C;  2Y2M A;  3REJ B;  5B40 B;  5GT3 B;  4H9O B;  3R45 B;  1P3O D;  5CPJ D;  3WTP D;  5G49 A;  4G92 B;  1P3M D;  2RVQ C;  2W8S A;  4ZBJ C;  2JCH A;  1F66 A;  5BS7 C;  1M19 D;  5B0Z D;  3WAA D;  1F66 B;  2HIO C;  5GT3 C;  3O62 C;  1EQZ A;  5B33 D;  3AZK B;  3AV1 C;  1ZLA A;  4G92 C;  5GSU D;  1AOI C;  3AYW A;  5AV6 A;  4DRA A;  2F8N D;  3X1S C;  4ZUX C;  3UT9 A;  5CPI C;  4Z66 D;  1P3G A;  4H9S A;  3UT9 B;  3WKJ A;  1P3G B;  5BNV A;  2ARO B;  2RVQ D;  4KGC B;  3UTB C;  5F99 A;  2Y2I A;  4H9N A;  4H9P B;  3UTA B;  1HQ3 C;  3AZG C;  4WU9 B;  2Y2L A;  1P3F A;  2HIO D;  1N1J A;  5GT3 D;  3O62 D;  3AV1 D;  1ID3 A;  3KUY A;  1N1J B;  5B32 A;  1AOI D;  2ARO C;  4KGC C;  5B1M B;  3X1S D;  4ZUX D;  3REK A;  2J8P A;  5CPI D;  4J8U D;  2F8N K;  4WU8 A;  3LEL C;  3C1C B;  3AZJ C;  3A1K A;  2Y2O A;  2PYO C;  3UTB D;  4J8W A;  5B1M C;  1HQ3 D;  5AVB B;  3AZG D;  3MGP B;  3MGR B;  1W2E A;  5FUG A;  4X23 A;  3AZE C;  2Y2G A;  5FUG B;  3C1C C;  2ARO D;  4KGC D;  5B2I C;  4WNN B;  4Z5T B;  3X1V A;  1P3B B;  1P3K C;  3B6G C;  3VH6 T;  5AVB C;  3X1U C;  5B1L A;  3MGP C;  3REI A;  3W97 B;  4JJN A;  3MGR C;  3LEL D;  3TU4 B;  3AZH D;  3AZJ D;  4XUJ B;  2PYO D;  4KUD B;  2BYK A;  1B6W A;  5B1M D;  4Z5T C;  1P3B C;  5B24 A;  3W96 A;  1P3L C;  5GXQ A;  1KX5 C;  3AFA A;  5B24 B;  3W96 B;  3NQU A;  3AZE D;  4YM6 A;  1BH9 B;  3MGS A;  3A6N C;  3TU4 C;  3REH A;  3B0C T;  4KUD C;  5B2I D;  4YS3 A;  3AN2 B;  2YFW A;  1P3K D;  3B6G D;  3MVD B;  5CP6 A;  5AVB D;  3X1U D;  3MGP D;  3AV2 A;  1KX3 A;  3WA9 D;  1BFM A;  3W98 A;  1U35 D;  3KXB B;  3KWQ B;  3LZ1 C;  4Z5T D;  3AN2 C;  3LJA A;  1P3L D;  1KX5 D;  3AZM A;  2DF4 C;  4KHA A;  3A6N D;  2YFV A;  2F2A C;  5CPJ A;  3WTP A;  1P3M A;  2JE5 A;  4KUD D;  5B31 C;  3KXB C;  2ZY3 A;  3KWQ C;  1P3O B;  4M6B A;  1ULY A;  4XZQ A;  1WWS A;  2ZY2 A;  3WAA A;  1M19 B;  5B0Z B;  4H9Q A;  5B33 A;  1P34 C;  3WAA B;  2NZD A;  4UUZ A;  5GSU A;  5B33 B;  3LZ1 D;  2DQN C;  3AN2 D;  1P3I C;  1KX4 B;  4UUZ B;  2F8N B;  4Z66 B;  5AY8 B;  4QLC B;  3C1B C;  1M19 C;  5B31 D;  3KXB D;  1M18 B;  2CV5 B;  1KX4 C;  5BS7 A;  4ZBJ B;  5CPK C;  3REJ A;  5GT3 A;  4NE5 A;  4H9O A;  3R45 A;  5AY8 C;  1P34 D;  4QLC C;  4J8X B;  3KFU G;  2HIO B;  3O62 B;  3P5J B;  3AV1 B;  1P3I D;  1M18 C;  3X1S A;  1H3O A;  1AOI B;  2RIQ A;  2CV5 C;  5AV9 B;  5B0Y D;  5CPI A;  5E5A B;  1H3O B;  5BT1 C;  3X1S B;  4ZUX B;  4DQY B;  5CPI B;  2Y2P A;  2FFF B;  4J8U B;  3C1B D;  1R4V A;  3AZK A;  4J8X C;  3VH5 T;  3W99 C;  3UTB B;  5DNN C;  1KX4 D;  1HQ3 A;  3AZG A;  5CPK D;  5AV9 C;  5E5A C;  1HQ3 B;  3AZG B;  4J8U C;  5AY8 D;  4QLC D;  3B6F C;  4R8P D;  2ARO A;  4KGC A;  1M18 D;  5BNX A;  2CV5 D;  4H9P A;  5BNX B;  3VH5 W;  5BT1 D;  3UTA A;  3LZ0 C;  4WU9 A;  3LEL A;  3LEL B;  4J8X D;  2PYO A;  3AZH B;  3AZJ B;  4WJ3 C;  2PYO B;  3W99 D;  3A1I A;  5B1M A;  5DNN D;  3AZN B;  5AV9 D;  2FJ7 B;  1HTA A;  5E5A D;  2Y2J A;  1T3U A;  4WZS B;  3C1C A;  4NFT A;  3AZE B;  3B6F D;  4LD9 B;  3EPH A;  5B2I A;  2ZY4 A;  3AZH C;  3B6G A;  5B2I B;  3AZN C;  1P3K B;  5AVB A;  3B6G B;  3LZ0 D;  3MGP A;  3REL B;  1ZLA C;  2FJ7 C;  3MGR A;  3EPK A;  3X1U B;  3AL0 C;  3AZI D;  5AV6 C;  3WA9 B;  4EO5 C;  4LD9 C;  1U35 B;  4WNN A;  4Z5T A;  1JFI B;  1P3B A;  3H0M C;  1P3L A;  1KX5 A;  4Z2M G;  3REL C;  1TZY C;  1P3L B;  1KX5 B;  3W97 A;  1B67 A;  3TU4 A;  3H0L C;  3WA9 C;  4XUJ A;  4KUD A;  3A6N B;  1U35 C;  3AZN D;  1BH8 B;  2FJ7 D;  1ZLA D;  3KUY C;  5B32 C;  3AYW D;  2F8N G;  4WV4 B;  5AV6 D;  3AZF C;  1BH9 A;  4LD9 D;  3LZ1 A;  3AN2 A;  2BYM B;  4J8V B;  3AZL C;  3MVD A;  3LZ1 B;  3WKJ D;  3REL D;  1TZY D;  5AV5 C;  5JRG C;  4CAY B;  4E44 A;  4J8W C;  4NE3 A;  3KXB A;  3H0R C;  3KWQ A;  1Q9C A;  5B31 B;  4X23 C;  3MGQ C;  3IP4 C;  4J8V C;  2ZY5 A;  5DNM B;  3KUY D;  1S32 B;  5B32 D;  3MVD D;  3F6T A;  5AVC B;  3AZF D;  3X1V C;  1P34 A;  1P34 B;  3REI C;  1P3O A;  4JJN C;  3AZL D;  4NE6 A;  1P3I B;  2Y2N A;  5AV5 D;  4HGA C;  5GT0 C;  4E45 A;  5JRG D;  5DNM C;  5B0Y B;  1S32 C;  4J8W D;  3C1B A;  5AVC C;  1M19 A;  5B0Z A;  1KU5 A;  3C1B B;  5GXQ C;  3AFA C;  5JA4 B;  4X23 D;  3MGQ D;  4J8V D;  1KX4 A;  1P3P B;  5CPK A;  3REH C;  2F8N A;  2HUE B;  5CPK B;  5B0Y C;  3X1V D;  4Z66 A;  5AY8 A;  4QLC A;  3REI D;  3AV2 C;  1M18 A;  4JJN D;  4R8P B;  2CV5 A;  3W98 C;  1P3P C;  3VH6 A;  5DNM D;  5GT0 D;  3B0B A;  5AV8 B;  1S32 D;  2XD5 A;  2HUE C;  5KDM B;  5AVC D;  2BG1 A;  3MNN B;  4J8X A;  5GXQ D;  2HIO A;  3AFA D;  3O62 A;  3AV1 A;  3AZM C;  3NQJ A;  5DNN A;  4R8P C;  1AOI A;  3B0D C;  3MGS D;  5AV9 A;  3NQJ B;  5DNN B;  3REH D;  3W99 B;  5E5A A;  4ZUX A;  5AV8 C;  2NQB B;  4J8U A;  3B6F A;  3MNN C;  3X1T B;  4XZQ C;  3B6F B;  3AV2 D;  1KX3 D;  1A7W A;  1M1A C;  2Y2H A;  3UTB A;  3W98 D;  1P3P D;  4CSR A;  2NZD C;  4CSR B;  3LZ0 B;  2NQB C;  3LJA D;  3KSY A;  3EPJ A;  3AZI B;  3X1T C;  3AZM D;  5B2J B;  1P3A C;  5BO0 B;  1TAF A;  1TAF B;  5AV8 D;  5G49 B;  3MNN D;  4XZQ D;  3AZI C;  3AZJ A;  3AZH A;  1M1A D;  5B2J C;  3REJ C;  5B40 C;  3AZN A;  2FJ7 A;  2NZD D;  1EQZ B;  3EPL A;  1ZLA B;  2NQB D;  4LD9 A;  3AZE A;  3AYW B;  3X1T D;  5AV6 B;  4EO5 B;  1P3A D;  1F66 C;  5B31 G;  1P3K A;  3REL A;  1TZY A;  3AZK C;  3WKJ B;  5BNV B;  4Z2M H;  1EQZ C;  1TZY B;  3X1U A;  5CHL B;  3WA9 A;  5F99 B;  3AYW C;  4H9N B;  5B2J D;  3REJ D;  1U35 A;  5B40 D;  1JFI A;  3UT9 C;  1P3G C;  1P3F B;  4H9S C;  3WKJ C;  1ID3 B;  3KUY B;  3AZF A;  5B32 B;  2F8N H;  2ZM5 A;  5C3I B;  3UTA C;  5F99 C;  3AZF B;  3A6N A;  3REK B;  4WU9 C;  3AZL A;  1F66 D;  1BH8 A;  4WU8 B;  3AZK D;  5AV5 A;  3AZL B;  5JRG A;  1P3F C;  4UPK A;  1EQZ D;  5AV5 B;  5JRG B;  1ID3 C;  4DRB A;  4J8W B;  5C3I C;  3MGQ A;  3VH5 A;  2BYM A;  4J8V A;  3REK C;  3UT9 D;  1P3G D;  4X23 B;  3MGQ B;  2VQR A;  4WU8 C;  3WTP E;  2XD1 A;  4G91 B;  4CAY A;  3UTA D;  2Y2K A;  5F99 D;  3X1V B;  4H9R A;  2UWX A;  4WU9 D;  5B31 A;  4H9R B;  2Y2Q A;  5B1L B;  3REI B;  4JJN B;  4AWL B;  1F1E A;  5GT0 A;  5DNM A;  1P3F D;  1S32 A;  4HGA B;  5GT0 B;  1ID3 D;  4G91 C;  5AVC A;  2BYK B;  3FDD A;  5GXQ B;  3REK D;  3AFA B;  3VH6 W;  3W97 C;  3C1C D;  5B1L C;  3NQU B;  3V9R A;  1P3I A;  4AWL C;  4YM6 B;  4WU8 D;  4XUJ C;  3MGS B;  3V9R B;  5B0Y A;  3REH B;  2IO5 B;  1WWI A;  4YS3 B;  2YFW B;  3MGR D;  5JA4 A;  5CP6 B;  5B24 C;  3W96 C;  3AV2 B;  1P3P A;  1KX3 B;  3W98 B;  2LY8 A;  4YM6 C;  2G5I C;  3MGS C;  1P3B D;  2IO5 C;  3B0C W;  3MVD C;  4YS3 C;  3LJA B;  3W97 D;  5CP6 C;  4R8P A;  3AZM B;  5B1L D;  3TU4 D;  2G5H C;  1KX3 C;  3B0D B;  4XUJ D;  4KHA B;  5AV8 A;  2YFV B;  3EG5 B;  5CPJ B;  3WTP B;  1P3M B;  5KDM A;  3MNN A;  5B24 D;  4XZQ B;  1M1A A;  3LJA C;  2L5A A;  3W96 D;  2CWE A;  1M1A B;  3W99 A;  4YM6 D;  2JSS A;  4H9Q B;  1Z2C B;  2NQB A;  2NZD B;  1P3O C;  5CPJ C;  3WTP C;  5GSU B;  4YS3 D; 
#chains in the Genus database with same CATH homology
 3X1T A;  1P3A A;  5CP6 D;  1P3A B;  1P3M C;  5B0Z C;  3WAA C;  3KWQ D;  1PZR A;  3LZ0 A;  5B33 C;  5GSU C;  5B32 G;  3AZI A;  5B2J A;  5B40 A;  5BO0 A;  4Z66 C;  2Y2M A;  3REJ B;  5B40 B;  5GT3 B;  4H9O B;  3R45 B;  1P3O D;  5CPJ D;  3WTP D;  5G49 A;  4G92 B;  1P3M D;  2RVQ C;  2W8S A;  4ZBJ C;  2JCH A;  1F66 A;  5BS7 C;  1M19 D;  5B0Z D;  3WAA D;  1F66 B;  2HIO C;  5GT3 C;  3O62 C;  1EQZ A;  5B33 D;  3AZK B;  3AV1 C;  1ZLA A;  4G92 C;  5GSU D;  1AOI C;  3AYW A;  5AV6 A;  4DRA A;  2F8N D;  3X1S C;  4ZUX C;  3UT9 A;  5CPI C;  4Z66 D;  1P3G A;  4H9S A;  3UT9 B;  3WKJ A;  1P3G B;  5BNV A;  2ARO B;  2RVQ D;  4KGC B;  3UTB C;  5F99 A;  2Y2I A;  4H9N A;  4H9P B;  3UTA B;  1HQ3 C;  3AZG C;  4WU9 B;  2Y2L A;  1P3F A;  2HIO D;  1N1J A;  5GT3 D;  3O62 D;  3AV1 D;  1ID3 A;  3KUY A;  1N1J B;  5B32 A;  1AOI D;  2ARO C;  4KGC C;  5B1M B;  3X1S D;  4ZUX D;  3REK A;  2J8P A;  5CPI D;  4J8U D;  2F8N K;  4WU8 A;  3LEL C;  3C1C B;  3AZJ C;  3A1K A;  2Y2O A;  2PYO C;  3UTB D;  4J8W A;  5B1M C;  1HQ3 D;  5AVB B;  3AZG D;  3MGP B;  3MGR B;  1W2E A;  5FUG A;  4X23 A;  3AZE C;  2Y2G A;  5FUG B;  3C1C C;  2ARO D;  4KGC D;  5B2I C;  4WNN B;  4Z5T B;  3X1V A;  1P3B B;  1P3K C;  3B6G C;  3VH6 T;  5AVB C;  3X1U C;  5B1L A;  3MGP C;  3REI A;  3W97 B;  4JJN A;  3MGR C;  3LEL D;  3TU4 B;  3AZH D;  3AZJ D;  4XUJ B;  2PYO D;  4KUD B;  2BYK A;  1B6W A;  5B1M D;  4Z5T C;  1P3B C;  5B24 A;  3W96 A;  1P3L C;  5GXQ A;  1KX5 C;  3AFA A;  5B24 B;  3W96 B;  3NQU A;  3AZE D;  4YM6 A;  1BH9 B;  3MGS A;  3A6N C;  3TU4 C;  3REH A;  3B0C T;  4KUD C;  5B2I D;  4YS3 A;  3AN2 B;  2YFW A;  1P3K D;  3B6G D;  3MVD B;  5CP6 A;  5AVB D;  3X1U D;  3MGP D;  3AV2 A;  1KX3 A;  3WA9 D;  1BFM A;  3W98 A;  1U35 D;  3KXB B;  3KWQ B;  3LZ1 C;  4Z5T D;  3AN2 C;  3LJA A;  1P3L D;  1KX5 D;  3AZM A;  2DF4 C;  4KHA A;  3A6N D;  2YFV A;  2F2A C;  5CPJ A;  3WTP A;  1P3M A;  2JE5 A;  4KUD D;  5B31 C;  3KXB C;  2ZY3 A;  3KWQ C;  1P3O B;  4M6B A;  1ULY A;  4XZQ A;  1WWS A;  2ZY2 A;  3WAA A;  1M19 B;  5B0Z B;  4H9Q A;  5B33 A;  1P34 C;  3WAA B;  2NZD A;  4UUZ A;  5GSU A;  5B33 B;  3LZ1 D;  2DQN C;  3AN2 D;  1P3I C;  1KX4 B;  4UUZ B;  2F8N B;  4Z66 B;  5AY8 B;  4QLC B;  3C1B C;  1M19 C;  5B31 D;  3KXB D;  1M18 B;  2CV5 B;  1KX4 C;  5BS7 A;  4ZBJ B;  5CPK C;  3REJ A;  5GT3 A;  4NE5 A;  4H9O A;  3R45 A;  5AY8 C;  1P34 D;  4QLC C;  4J8X B;  3KFU G;  2HIO B;  3O62 B;  3P5J B;  3AV1 B;  1P3I D;  1M18 C;  3X1S A;  1H3O A;  1AOI B;  2RIQ A;  2CV5 C;  5AV9 B;  5B0Y D;  5CPI A;  5E5A B;  1H3O B;  5BT1 C;  3X1S B;  4ZUX B;  4DQY B;  5CPI B;  2Y2P A;  2FFF B;  4J8U B;  3C1B D;  1R4V A;  3AZK A;  4J8X C;  3VH5 T;  3W99 C;  3UTB B;  5DNN C;  1KX4 D;  1HQ3 A;  3AZG A;  5CPK D;  5AV9 C;  5E5A C;  1HQ3 B;  3AZG B;  4J8U C;  5AY8 D;  4QLC D;  3B6F C;  4R8P D;  2ARO A;  4KGC A;  1M18 D;  5BNX A;  2CV5 D;  4H9P A;  5BNX B;  3VH5 W;  5BT1 D;  3UTA A;  3LZ0 C;  4WU9 A;  3LEL A;  3LEL B;  4J8X D;  2PYO A;  3AZH B;  3AZJ B;  4WJ3 C;  2PYO B;  3W99 D;  3A1I A;  5B1M A;  5DNN D;  3AZN B;  5AV9 D;  2FJ7 B;  1HTA A;  5E5A D;  2Y2J A;  1T3U A;  4WZS B;  3C1C A;  4NFT A;  3AZE B;  3B6F D;  4LD9 B;  3EPH A;  5B2I A;  2ZY4 A;  3AZH C;  3B6G A;  5B2I B;  3AZN C;  1P3K B;  5AVB A;  3B6G B;  3LZ0 D;  3MGP A;  3REL B;  1ZLA C;  2FJ7 C;  3MGR A;  3EPK A;  3X1U B;  3AL0 C;  3AZI D;  5AV6 C;  3WA9 B;  4EO5 C;  4LD9 C;  1U35 B;  4WNN A;  4Z5T A;  1JFI B;  1P3B A;  3H0M C;  1P3L A;  1KX5 A;  4Z2M G;  3REL C;  1TZY C;  1P3L B;  1KX5 B;  3W97 A;  1B67 A;  3TU4 A;  3H0L C;  3WA9 C;  4XUJ A;  4KUD A;  3A6N B;  1U35 C;  3AZN D;  1BH8 B;  2FJ7 D;  1ZLA D;  3KUY C;  5B32 C;  3AYW D;  2F8N G;  4WV4 B;  5AV6 D;  3AZF C;  1BH9 A;  4LD9 D;  3LZ1 A;  3AN2 A;  2BYM B;  4J8V B;  3AZL C;  3MVD A;  3LZ1 B;  3WKJ D;  3REL D;  1TZY D;  5AV5 C;  5JRG C;  4CAY B;  4E44 A;  4J8W C;  4NE3 A;  3KXB A;  3H0R C;  3KWQ A;  1Q9C A;  5B31 B;  4X23 C;  3MGQ C;  3IP4 C;  4J8V C;  2ZY5 A;  5DNM B;  3KUY D;  1S32 B;  5B32 D;  3MVD D;  3F6T A;  5AVC B;  3AZF D;  3X1V C;  1P34 A;  1P34 B;  3REI C;  1P3O A;  4JJN C;  3AZL D;  4NE6 A;  1P3I B;  2Y2N A;  5AV5 D;  4HGA C;  5GT0 C;  4E45 A;  5JRG D;  5DNM C;  5B0Y B;  1S32 C;  4J8W D;  3C1B A;  5AVC C;  1M19 A;  5B0Z A;  1KU5 A;  3C1B B;  5GXQ C;  3AFA C;  5JA4 B;  4X23 D;  3MGQ D;  4J8V D;  1KX4 A;  1P3P B;  5CPK A;  3REH C;  2F8N A;  2HUE B;  5CPK B;  5B0Y C;  3X1V D;  4Z66 A;  5AY8 A;  4QLC A;  3REI D;  3AV2 C;  1M18 A;  4JJN D;  4R8P B;  2CV5 A;  3W98 C;  1P3P C;  3VH6 A;  5DNM D;  5GT0 D;  3B0B A;  5AV8 B;  1S32 D;  2XD5 A;  2HUE C;  5KDM B;  5AVC D;  2BG1 A;  3MNN B;  4J8X A;  5GXQ D;  2HIO A;  3AFA D;  3O62 A;  3AV1 A;  3AZM C;  3NQJ A;  5DNN A;  4R8P C;  1AOI A;  3B0D C;  3MGS D;  5AV9 A;  3NQJ B;  5DNN B;  3REH D;  3W99 B;  5E5A A;  4ZUX A;  5AV8 C;  2NQB B;  4J8U A;  3B6F A;  3MNN C;  3X1T B;  4XZQ C;  3B6F B;  3AV2 D;  1KX3 D;  1A7W A;  1M1A C;  2Y2H A;  3UTB A;  3W98 D;  1P3P D;  4CSR A;  2NZD C;  4CSR B;  3LZ0 B;  2NQB C;  3LJA D;  3KSY A;  3EPJ A;  3AZI B;  3X1T C;  3AZM D;  5B2J B;  1P3A C;  5BO0 B;  1TAF A;  1TAF B;  5AV8 D;  5G49 B;  3MNN D;  4XZQ D;  3AZI C;  3AZJ A;  3AZH A;  1M1A D;  5B2J C;  3REJ C;  5B40 C;  3AZN A;  2FJ7 A;  2NZD D;  1EQZ B;  3EPL A;  1ZLA B;  2NQB D;  4LD9 A;  3AZE A;  3AYW B;  3X1T D;  5AV6 B;  4EO5 B;  1P3A D;  1F66 C;  5B31 G;  1P3K A;  3REL A;  1TZY A;  3AZK C;  3WKJ B;  5BNV B;  4Z2M H;  1EQZ C;  1TZY B;  3X1U A;  5CHL B;  3WA9 A;  5F99 B;  3AYW C;  4H9N B;  5B2J D;  3REJ D;  1U35 A;  5B40 D;  1JFI A;  3UT9 C;  1P3G C;  1P3F B;  4H9S C;  3WKJ C;  1ID3 B;  3KUY B;  3AZF A;  5B32 B;  2F8N H;  2ZM5 A;  5C3I B;  3UTA C;  5F99 C;  3AZF B;  3A6N A;  3REK B;  4WU9 C;  3AZL A;  1F66 D;  1BH8 A;  4WU8 B;  3AZK D;  5AV5 A;  3AZL B;  5JRG A;  1P3F C;  4UPK A;  1EQZ D;  5AV5 B;  5JRG B;  1ID3 C;  4DRB A;  4J8W B;  5C3I C;  3MGQ A;  3VH5 A;  2BYM A;  4J8V A;  3REK C;  3UT9 D;  1P3G D;  4X23 B;  3MGQ B;  2VQR A;  4WU8 C;  3WTP E;  2XD1 A;  4G91 B;  4CAY A;  3UTA D;  2Y2K A;  5F99 D;  3X1V B;  4H9R A;  2UWX A;  4WU9 D;  5B31 A;  4H9R B;  2Y2Q A;  5B1L B;  3REI B;  4JJN B;  4AWL B;  1F1E A;  5GT0 A;  5DNM A;  1P3F D;  1S32 A;  4HGA B;  5GT0 B;  1ID3 D;  4G91 C;  5AVC A;  2BYK B;  3FDD A;  5GXQ B;  3REK D;  3AFA B;  3VH6 W;  3W97 C;  3C1C D;  5B1L C;  3NQU B;  3V9R A;  1P3I A;  4AWL C;  4YM6 B;  4WU8 D;  4XUJ C;  3MGS B;  3V9R B;  5B0Y A;  3REH B;  2IO5 B;  1WWI A;  4YS3 B;  2YFW B;  3MGR D;  5JA4 A;  5CP6 B;  5B24 C;  3W96 C;  3AV2 B;  1P3P A;  1KX3 B;  3W98 B;  2LY8 A;  4YM6 C;  2G5I C;  3MGS C;  1P3B D;  2IO5 C;  3B0C W;  3MVD C;  4YS3 C;  3LJA B;  3W97 D;  5CP6 C;  4R8P A;  3AZM B;  5B1L D;  3TU4 D;  2G5H C;  1KX3 C;  3B0D B;  4XUJ D;  4KHA B;  5AV8 A;  2YFV B;  3EG5 B;  5CPJ B;  3WTP B;  1P3M B;  5KDM A;  3MNN A;  5B24 D;  4XZQ B;  1M1A A;  3LJA C;  2L5A A;  3W96 D;  2CWE A;  1M1A B;  3W99 A;  4YM6 D;  2JSS A;  4H9Q B;  1Z2C B;  2NQB A;  2NZD B;  1P3O C;  5CPJ C;  3WTP C;  5GSU B;  4YS3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...