4J8WB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wB00
3B0BA 5AVCC 5AV9A 3W96A 5B24B 1AOID 5B33A 3LZ1A 4J8WD 5B32G 1KX5A 3KXBD 3AV2C 5CPKD 4Z2MH 3X1UD 5B40C 5AV8A 5DNND 2NZDB 3RELB 3REHB 5AV5B 3LELC 3MGQC 3V9RA 5GXQB 4J8UD 3AZKD 2PYOB 2AROB 3AV2A 3W96D 5GSUC 1R4VA 5KDMA 3VH6T 4XUJC 5B33D 3AZNB 3LZ1D 2LY8A 5B0ZC 4KHAB 1KX5D 3AZID 3UTAD 5AY8C 3KWQB 3AYWB 3REIC 4Z5TC 4H9NB 5AV8D 5BNVA 5GSUA 3MVDC 3W97B 4ZUXC 4G92B 4XUJA 1Q9CA 1TAFA 3AFAB 5B0ZA 4H9RA 5B2JC 2BYMA 3AV2D 1U35B 5BNXA 5B32C 5B40D 3REIA 4Z5TA 5B31A 1AOIB 4CAYB 3B6FC 3MVDA 4ZUXA 3LELD 3MGQD 4J8WB 2IO5C 3KXBB 5CPKB 5FUGB 3X1UB 5B2JA 5GSUD 4QLCC 5B32A 5DNNB 4XUJD 3B6FA 5B0ZD 5AY8D 4J8UB 3AZKB 5C3IB 3LZ0C 3REID 5G49A 4Z5TD 3W96B 3NQUA 3MVDD 5B33B 4QLCA 4ZUXD 3NQJA 3LZ1B 3AZEC 4XZQC 1KX5B 5JRGC 5CP6C 3UTAB 3AZIB 2HUEC 5B2JD 3KUYC 3AZFC 3AZLC 1HQ3C 5B32D 5AV8B 3LZ0A 3B6FD 5E5AC 1TZYC 3AZEA 2YFWA 4XZQA 5CP6A 5JRGA 3AV2B 5B40B 1HQ3A 4QLCD 3C1CC 3LELB 3MGQB 1TZYA 5CPJC 1F66C 3WTPC 1P34C 1P3GC 3LZ0D 2FJ7C 5GSUB 3B0CW 4XUJB 1P3BC 3AZED 4H9SC 4ZBJC 5B0ZB 4XZQD 4H9RB 5JRGD 2BYMB 5CP6D 5BNXB 5AY8B 5CPJA 2RVQC 1F66A 3AZFD 3B0DB 3B0CT 1HQ3D 3WTPA 4Z5TB 3REIB 4KUDC 2FJ7A 3MVDB 4WV4B 4ZUXB 4M6BA 3AZHC 1TZYD 3X1UA 3AZGC 4H9SA 1H3OA 1S32C 4NE5A 5B2JB 1M18C 5B32B 4KUDA 3C1CD 3B6FB 2NQBC 3AZHA 3REJC 5AVBC 3AV1C 5CPJD 3AZGA 1F66D 2IO5B 5G49B 3WTPD 1P34D 1P3GD 5DNMC 3NQUB 3VH5A 2FJ7D 4QLCB 3NQJB 3AZIA 3UTAA 3X1SC 2NQBA 5B1LC 3LJAC 5AVCA 3WA9C 3REJA 5AVBA 3AV1A 2RVQD 3VH6W 3LZ0B 5DNMA 1KX3C 4KUDD 1ZLAC 4KGCC 4CSRB 4YM6C 3AZHD 4R8PC 3AZEB 2YFWB 3AZGD 3X1SA 5BT1C 4XZQB 5B40A 5JRGB 5CP6B 5B1LA 4X23C 3B6GC 3LJAA 3AZFB 1M18D 1HQ3B 1M1AC 3LELA 3MGQA 1KX3A 3O62C 1ZLAA 2NQBD 4KGCA 5CPIC 1P3AC 1TZYB 4YM6A 5AVCD 3REJD 5AVBD 3AV1D 4X23A 2F8NK 5DNMD 3B6GA 4E44A 1M1AA 5AV6C 3X1VC 3C1CB 2YFVA 5AY8A 5GT0C 3X1SD 4J8VC 1B6WA 5B1LD 5CPIA 1P3AA 1BFMA 3A6NC 3LJAD 5CPJB 1F66B 3WA9D 3WTPB 1P34B 3AZJC 3X1TC 4WU8C 1P3GB 2FJ7B 1KX3D 1ZLAD 2HIOC 4KGCD 4DRAA 3MGRC 4YM6D 3UTBC 3X1VA 4ZBJB 1H3OB 5GT0A 5BT1D 4X23D 3B6GD 3A6NA 1M1AD 3UT9C 4WU8A 3AZJA 3W99C 3X1TA 5BO0A 4KUDB 5GT3C 2F8NH 2HIOA 4JJNC 3AZHB 4YS3C 3MGRA 5CPID 1P3AD 3AZGB 3UTBA 5B24C 2CV5C 1M18B 4G91C 5AV6D 3UT9A 3X1VD 4Z2MG 1P3KC 2NQBB 5GT3A 5GT0D 4J8VD 5B1MC 5AVCB 3WKJC 3REJB 5AVBB 3AV1B 4YS3A 3A6ND 1P3OC 1P3FC 4CSRA 3X1TD 4E45A 5DNMB 4WZSB 3AZJD 4WU8D 2CV5A 3R45A 1BH8B 3C1BC 2HIOD 3MGRD 3KUYA 3X1SB 3UTBD 3AZFA 3AZLA 5B1LB 3LJAB 5B1MA 3WA9B 3WKJA 1P3OA 1P3IC 5E5AA 3UT9D 1KX3B 4UUZB 1ZLAB 4KGCB 5GT3D 4YM6B 3C1BA 4YS3D 1EQZC 4WNNA 3AYWC 4X23B 3B6GB 5F99C 1P3MC 2CV5D 3C1CA 1BH9A 1M1AB 3REKC 1P3IA 2YFVB 3WAAC 4H9OA 3KUYD 3AZLD 2JSSA 1P3KD 5CPIB 1P3AB 1P34A 1P3GA 5B1MD 4J8XC 3WKJD 1P3FD 4Z66C 1P3OD 1EQZA 3MGPC 3VH6A 1P3BA 5E5AD 1P3MA 1ID3C 5AV6B 3REKA 3C1BD 3TU4C 4H9QA 3X1VB 1P3LC 1A7WA 5GT0B 3AN2C 4J8VB 3A6NB 4Z66A 2L5AA 4HGAC 4WU8B 3MGPA 3AZJB 5BO0B 3X1TB 1P3ID 4WU9C 2HIOB 2F8NG 1ID3A 3MGRB 1KX4C 1WWIA 1S32A 1P3LA 3UTBB 1M18A 1EQZD 5AV9C 1P3BD 5JA4B 5F99D 1P3MD 1B67A 3MNNC 3UT9B 3REKD 4WU9A 5GT3B 3WAAD 1JFIA 4YS3B 5B31G 3AZMC 1KX4A 4J8XD 4Z66D 1BH8A 1F1EA 3MGPD 2CV5B 1M19C 3R45B 4NE6A 4G91B 4AWLC 1ID3D 3MNNA 2HUEB 1S32D 4DRBA 3KUYB 3TU4D 2BYKA 3AZLB 1P3KB 1P3LD 3WA9A 5B0YC 3AN2D 5B1MB 3WKJB 1P3FB 3AZMA 1P3OB 1N1JA 4UUZA 5E5AB 1M19A 4R8PA 4WU9D 3C1BB 1KX4D 4WNNB 5B0YA 5AV9D 1BH9B 1P3IB 3O62A 3MNND 4H9OB 4EO5C 3W98C 1P3PC 1EQZB 3AZMD 3B0DC 2F8NA 1P3BB 3VH5W 5B31C 1HTAA 5AV6A 5F99B 1P3MB 1M19D 4R8PD 3REKB 3MGSC 4J8VA 4H9QB 5B2IC 3WAAB 4LD9C 5B0YD 3VH5T 3W98A 1P3PA 4J8XB 4NE3A 4Z66B 3MGPB 4H9PA 3O62D 1ID3B 3MGSA 1S32B 1P3LB 3TU4B 5B2IA 5JA4A 4NFTA 3AN2B 4LD9A 2F8ND 3W99A 4HGAB 4JJNA 4WU9B 2CWEA 1JFIB 1KX4B 3W98D 1P3PD 5B24A 2NZDC 3RELC 3REHC 5AV5C 5AV9B 5B31D 5GXQC 1P3KA 3MNNB 3MGSD 2PYOC 2AROC 5B2ID 2BYKB 1P3FA 4LD9D 3AZMB 3AZNC 3W99D 1N1JB 2NZDA 3RELA 3REHA 5AV5A 4JJND 1M19B 4R8PB 3KWQC 5GXQA 4AWLB 1KU5A 2PYOA 3V9RB 5B24D 2AROA 3W97C 5B0YB 4G92C 3AZNA 5KDMB 3AFAC 3O62B 4KHAA 1U35C 3KWQA 3AYWA 5CHLB 1AOIC 4H9NA 5F99A 2NZDD 3KSYA 3RELD 2F8NB 3W97A 3REHD 5AV5D 5BNVB 1WWSA 4J8WC 3WAAA 3AFAA 5GXQD 3KXBC 5CPKC 3X1UC 2PYOD 1TAFB 2AROD 4J8XA 1U35A 4EO5B 3W98B 5DNNC 1P3PB 3WTPE 3AZND 1AOIA 4CAYA 4H9PB 5BS7C 5B31B 3TU4A 4J8WA 4J8UC 3AZKC 5C3IC 3KWQD 3AYWD 3AN2A 3MGSB 5B2IB 3W96C 3KXBA 5CPKA 5FUGA 4LD9B 3W97D 5B33C 3W99B 5DNNA 3LZ1C 1ULYA 3AFAD 1KX5C 4JJNB 3UTAC 3AZIC 5BS7A 1U35D 4J8UA 3AZKA 5AV8C
chains in the Genus database with same CATH superfamily
3B0BA 5AVCC 5AV9A 3W96A 5B24B 1AOID 5B33A 2W8SA 3LZ1A 4J8WD 5B32G 1KX5A 3KXBD 3AV2C 5CPKD 4Z2MH 3X1UD 5B40C 2ZM5A 5AV8A 5DNND 2Y2PA 2NZDB 3RELB 3REHB 5AV5B 3LELC 3MGQC 3V9RA 5GXQB 4J8UD 3AZKD 2PYOB 2AROB 3AV2A 3W96D 5GSUC 1R4VA 5KDMA 2G5HC 3VH6T 4XUJC 5B33D 3AZNB 3LZ1D 2Y2NA 2LY8A 5B0ZC 4KHAB 1KX5D 3AZID 3UTAD 5AY8C 3KWQB 3AYWB 3REIC 4Z5TC 4H9NB 2XD1A 5AV8D 5BNVA 5GSUA 3MVDC 3W97B 4ZUXC 4G92B 3H0MC 4XUJA 1Q9CA 1TAFA 3AFAB 5B0ZA 4H9RA 5B2JC 2BYMA 3AV2D 1U35B 5BNXA 5B32C 5B40D 3REIA 4Z5TA 5B31A 1AOIB 4CAYB 3B6FC 3MVDA 1T3UA 4ZUXA 3LELD 2VQRA 3MGQD 4J8WB 2IO5C 3KXBB 5CPKB 5FUGB 3X1UB 5B2JA 5GSUD 4QLCC 5B32A 2Y2JA 5DNNB 4XUJD 3B6FA 5B0ZD 5AY8D 4J8UB 3AZKB 5C3IB 3LZ0C 3REID 5G49A 4Z5TD 3W96B 3NQUA 3MVDD 5B33B 4QLCA 4ZUXD 3NQJA 3LZ1B 3EPLA 3AZEC 4XZQC 2G5IC 5CP6C 5JRGC 3UTAB 3AZIB 1KX5B 2HUEC 5B2JD 2FFFB 3KUYC 3AZFC 1HQ3C 3AZLC 5B32D 5AV8B 3LZ0A 2ZY2A 3B6FD 5E5AC 1TZYC 2F2AC 3AZEA 2YFWA 4XZQA 2ZY3A 5CP6A 5JRGA 3AV2B 5B40B 1HQ3A 4QLCD 3C1CC 3LELB 3MGQB 3EPKA 1TZYA 5CPJC 1F66C 3WTPC 1P34C 1P3GC 3EG5B 3LZ0D 2FJ7C 5GSUB 3B0CW 4XUJB 1P3BC 3AZED 4H9SC 4ZBJC 5B0ZB 4XZQD 4H9RB 5JRGD 2BYMB 5CP6D 5BNXB 5AY8B 5CPJA 2RVQC 1F66A 3AZFD 3B0DB 3B0CT 1HQ3D 3WTPA 4Z5TB 3REIB 4KUDC 2FJ7A 3MVDB 4WV4B 2XD5A 4ZUXB 4M6BA 3AZHC 1TZYD 3X1UA 3AZGC 4H9SA 1H3OA 1S32C 4NE5A 5B2JB 1M18C 5B32B 4KUDA 3C1CD 3B6FB 3A1IA 2NQBC 3AZHA 3REJC 5AVBC 3A1KA 3AV1C 5CPJD 3AZGA 1F66D 2IO5B 5G49B 3WTPD 1P34D 1P3GD 5DNMC 3NQUB 3VH5A 2FJ7D 4QLCB 3NQJB 3AZIA 3UTAA 3X1SC 2NQBA 5B1LC 3LJAC 5AVCA 3WA9C 3REJA 5AVBA 3AV1A 2RVQD 3VH6W 3LZ0B 5DNMA 1KX3C 4KUDD 3FDDA 1ZLAC 4KGCC 4CSRB 4YM6C 3AZHD 4R8PC 3AZEB 2YFWB 3AZGD 3X1SA 5BT1C 4XZQB 5B40A 5JRGB 5CP6B 5B1LA 4X23C 3B6GC 2Y2KA 3LJAA 3AZFB 1M18D 1Z2CB 1HQ3B 1M1AC 3H0RC 3LELA 3MGQA 1KX3A 3O62C 1ZLAA 2NQBD 4KGCA 5CPIC 1P3AC 1TZYB 4YM6A 5AVCD 3REJD 5AVBD 3AV1D 4X23A 2F8NK 5DNMD 3B6GA 4E44A 1M1AA 5AV6C 3X1VC 3C1CB 2YFVA 5AY8A 5GT0C 3X1SD 4J8VC 1B6WA 2JE5A 5B1LD 5CPIA 1P3AA 1BFMA 3A6NC 3LJAD 5CPJB 1F66B 3WA9D 3WTPB 1P34B 3AZJC 3X1TC 4WU8C 1P3GB 2FJ7B 2UWXA 1KX3D 1ZLAD 2HIOC 4KGCD 4DRAA 3MGRC 4YM6D 3UTBC 3X1VA 4ZBJB 1H3OB 5GT0A 5BT1D 4X23D 3B6GD 3A6NA 2Y2OA 1M1AD 3UT9C 4WU8A 3AZJA 3W99C 3X1TA 5BO0A 4KUDB 5GT3C 2F8NH 2HIOA 4JJNC 3AZHB 4YS3C 3MGRA 5CPID 1P3AD 3AZGB 3UTBA 5B24C 2CV5C 1M18B 4WJ3C 4G91C 5AV6D 2DQNC 3UT9A 3X1VD 4Z2MG 1P3KC 2NQBB 5GT3A 5GT0D 4J8VD 5B1MC 5AVCB 3WKJC 3REJB 5AVBB 3F6TA 3AV1B 3A6ND 4YS3A 1P3OC 1P3FC 4CSRA 3X1TD 4E45A 5DNMB 4WZSB 3AZJD 4WU8D 2CV5A 3R45A 1BH8B 3C1BC 2HIOD 3MGRD 2Y2HA 3KUYA 3X1SB 3UTBD 3AZFA 3AZLA 5B1LB 3LJAB 5B1MA 3WA9B 3WKJA 1P3OA 1P3IC 5E5AA 3UT9D 1KX3B 4UUZB 1ZLAB 4KGCB 5GT3D 4YM6B 3C1BA 4YS3D 1EQZC 4WNNA 3AYWC 4X23B 3B6GB 5F99C 1P3MC 2CV5D 3C1CA 1BH9A 1M1AB 3REKC 1P3IA 2YFVB 3WAAC 4H9OA 3KUYD 3AZLD 2JSSA 1P3KD 5CPIB 1P3AB 1P34A 1P3GA 5B1MD 4J8XC 2Y2GA 3WKJD 1P3FD 4Z66C 1P3OD 1EQZA 3MGPC 3VH6A 1P3BA 5E5AD 1P3MA 1ID3C 5AV6B 2DF4C 3REKA 3C1BD 3TU4C 4H9QA 3X1VB 1P3LC 1A7WA 5GT0B 3AN2C 4J8VB 3A6NB 4Z66A 2L5AA 4HGAC 4WU8B 3MGPA 3AZJB 5BO0B 3X1TB 1P3ID 4WU9C 2HIOB 2F8NG 1ID3A 3MGRB 1KX4C 1WWIA 1S32A 1P3LA 3UTBB 1M18A 1EQZD 1PZRA 5AV9C 1P3BD 5JA4B 5F99D 1P3MD 1B67A 3MNNC 3UT9B 3REKD 4WU9A 5GT3B 3WAAD 1JFIA 4YS3B 5B31G 3AZMC 1KX4A 4J8XD 4Z66D 1BH8A 1F1EA 3MGPD 2ZY5A 2CV5B 1M19C 3R45B 4NE6A 4G91B 4AWLC 1ID3D 3MNNA 2HUEB 1S32D 4DRBA 3KUYB 3TU4D 2BYKA 3AZLB 1P3KB 1P3LD 3WA9A 5B0YC 3AN2D 5B1MB 3WKJB 1P3FB 3AZMA 1P3OB 1N1JA 3IP4C 4UUZA 5E5AB 1M19A 4R8PA 4WU9D 2Y2IA 3C1BB 1KX4D 4WNNB 5B0YA 3KFUG 5AV9D 1BH9B 1P3IB 3O62A 3MNND 4H9OB 2Y2QA 2Y2MA 4EO5C 3W98C 1P3PC 1EQZB 3AZMD 3B0DC 2F8NA 1P3BB 3VH5W 5B31C 1HTAA 5AV6A 5F99B 1P3MB 1M19D 4R8PD 2JCHA 3REKB 3MGSC 4J8VA 4H9QB 5B2IC 3WAAB 4LD9C 5B0YD 3VH5T 3W98A 1P3PA 4J8XB 4NE3A 4Z66B 3MGPB 4H9PA 3O62D 1ID3B 3MGSA 1S32B 1P3LB 3TU4B 5B2IA 5JA4A 4NFTA 3AN2B 4LD9A 2F8ND 3W99A 2J8PA 4HGAB 4JJNA 4WU9B 2CWEA 1JFIB 3EPHA 1KX4B 3W98D 1P3PD 5B24A 2NZDC 3RELC 3REHC 5AV5C 5AV9B 1W2EA 5B31D 3P5JB 5GXQC 1P3KA 3MNNB 3EPJA 3MGSD 2PYOC 2AROC 5B2ID 2BYKB 1P3FA 4LD9D 3AZMB 3AZNC 3W99D 1N1JB 2NZDA 3RELA 3REHA 5AV5A 4JJND 1M19B 4R8PB 3AL0C 3KWQC 5GXQA 4AWLB 1KU5A 2PYOA 3V9RB 5B24D 2AROA 3W97C 5B0YB 4G92C 3AZNA 5KDMB 3AFAC 3O62B 4KHAA 4DQYB 1U35C 3KWQA 3AYWA 2ZY4A 5CHLB 1AOIC 4H9NA 2BG1A 5F99A 2NZDD 3KSYA 3RELD 2F8NB 3W97A 3REHD 2RIQA 5AV5D 5BNVB 1WWSA 3H0LC 2Y2LA 4J8WC 3WAAA 3AFAA 5GXQD 3KXBC 5CPKC 3X1UC 2PYOD 1TAFB 2AROD 4J8XA 1U35A 4EO5B 3W98B 5DNNC 1P3PB 3WTPE 3AZND 1AOIA 4CAYA 4H9PB 5BS7C 4UPKA 5B31B 3TU4A 4J8WA 4J8UC 3AZKC 5C3IC 3KWQD 3AYWD 3AN2A 3MGSB 5B2IB 3W96C 3KXBA 5CPKA 5FUGA 4LD9B 3W97D 5B33C 3W99B 5DNNA 3LZ1C 1ULYA 3AFAD 1KX5C 4JJNB 3UTAC 3AZIC 5BS7A 1U35D 4J8UA 3AZKA 5AV8C
chains in the Genus database with same CATH topology
3B0BA 5AVCC 5AV9A 3W96A 5B24B 1AOID 5B33A 2W8SA 3LZ1A 4J8WD 5B32G 1KX5A 3KXBD 3AV2C 5CPKD 4Z2MH 3X1UD 5B40C 2ZM5A 5AV8A 5DNND 2Y2PA 2NZDB 3RELB 3REHB 5AV5B 3LELC 3MGQC 3V9RA 5GXQB 4J8UD 3AZKD 2PYOB 2AROB 3AV2A 3W96D 5GSUC 1R4VA 5KDMA 2G5HC 3VH6T 4XUJC 5B33D 3AZNB 3LZ1D 2Y2NA 2LY8A 5B0ZC 4KHAB 1KX5D 3AZID 3UTAD 5AY8C 3KWQB 3AYWB 3REIC 4Z5TC 4H9NB 2XD1A 5AV8D 5BNVA 5GSUA 3MVDC 3W97B 4ZUXC 4G92B 3H0MC 4XUJA 1Q9CA 1TAFA 3AFAB 5B0ZA 4H9RA 5B2JC 2BYMA 3AV2D 1U35B 5BNXA 5B32C 5B40D 3REIA 4Z5TA 5B31A 1AOIB 4CAYB 3B6FC 3MVDA 1T3UA 4ZUXA 3LELD 2VQRA 3MGQD 4J8WB 2IO5C 3KXBB 5CPKB 5FUGB 3X1UB 5B2JA 5GSUD 4QLCC 5B32A 2Y2JA 5DNNB 4XUJD 3B6FA 5B0ZD 5AY8D 4J8UB 3AZKB 5C3IB 3LZ0C 3REID 5G49A 4Z5TD 3W96B 3NQUA 3MVDD 5B33B 4QLCA 4ZUXD 3NQJA 3LZ1B 3EPLA 3AZEC 4XZQC 2G5IC 5CP6C 5JRGC 3UTAB 3AZIB 1KX5B 2HUEC 5B2JD 2FFFB 3KUYC 3AZFC 1HQ3C 3AZLC 5B32D 5AV8B 3LZ0A 2ZY2A 3B6FD 5E5AC 1TZYC 2F2AC 3AZEA 2YFWA 4XZQA 2ZY3A 5CP6A 5JRGA 3AV2B 5B40B 1HQ3A 4QLCD 3C1CC 3LELB 3MGQB 3EPKA 1TZYA 5CPJC 1F66C 3WTPC 1P34C 1P3GC 3EG5B 3LZ0D 2FJ7C 5GSUB 3B0CW 4XUJB 1P3BC 3AZED 4H9SC 4ZBJC 5B0ZB 4XZQD 4H9RB 5JRGD 2BYMB 5CP6D 5BNXB 5AY8B 5CPJA 2RVQC 1F66A 3AZFD 3B0DB 3B0CT 1HQ3D 3WTPA 4Z5TB 3REIB 4KUDC 2FJ7A 3MVDB 4WV4B 2XD5A 4ZUXB 4M6BA 3AZHC 1TZYD 3X1UA 3AZGC 4H9SA 1H3OA 1S32C 4NE5A 5B2JB 1M18C 5B32B 4KUDA 3C1CD 3B6FB 3A1IA 2NQBC 3AZHA 3REJC 5AVBC 3A1KA 3AV1C 5CPJD 3AZGA 1F66D 2IO5B 5G49B 3WTPD 1P34D 1P3GD 5DNMC 3NQUB 3VH5A 2FJ7D 4QLCB 3NQJB 3AZIA 3UTAA 3X1SC 2NQBA 5B1LC 3LJAC 5AVCA 3WA9C 3REJA 5AVBA 3AV1A 2RVQD 3VH6W 3LZ0B 5DNMA 1KX3C 4KUDD 3FDDA 1ZLAC 4KGCC 4CSRB 4YM6C 3AZHD 4R8PC 3AZEB 2YFWB 3AZGD 3X1SA 5BT1C 4XZQB 5B40A 5JRGB 5CP6B 5B1LA 4X23C 3B6GC 2Y2KA 3LJAA 3AZFB 1M18D 1Z2CB 1HQ3B 1M1AC 3H0RC 3LELA 3MGQA 1KX3A 3O62C 1ZLAA 2NQBD 4KGCA 5CPIC 1P3AC 1TZYB 4YM6A 5AVCD 3REJD 5AVBD 3AV1D 4X23A 2F8NK 5DNMD 3B6GA 4E44A 1M1AA 5AV6C 3X1VC 3C1CB 2YFVA 5AY8A 5GT0C 3X1SD 4J8VC 1B6WA 2JE5A 5B1LD 5CPIA 1P3AA 1BFMA 3A6NC 3LJAD 5CPJB 1F66B 3WA9D 3WTPB 1P34B 3AZJC 3X1TC 4WU8C 1P3GB 2FJ7B 2UWXA 1KX3D 1ZLAD 2HIOC 4KGCD 4DRAA 3MGRC 4YM6D 3UTBC 3X1VA 4ZBJB 1H3OB 5GT0A 5BT1D 4X23D 3B6GD 3A6NA 2Y2OA 1M1AD 3UT9C 4WU8A 3AZJA 3W99C 3X1TA 5BO0A 4KUDB 5GT3C 2F8NH 2HIOA 4JJNC 3AZHB 4YS3C 3MGRA 5CPID 1P3AD 3AZGB 3UTBA 5B24C 2CV5C 1M18B 4WJ3C 4G91C 5AV6D 2DQNC 3UT9A 3X1VD 4Z2MG 1P3KC 2NQBB 5GT3A 5GT0D 4J8VD 5B1MC 5AVCB 3WKJC 3REJB 5AVBB 3F6TA 3AV1B 3A6ND 4YS3A 1P3OC 1P3FC 4CSRA 3X1TD 4E45A 5DNMB 4WZSB 3AZJD 4WU8D 2CV5A 3R45A 1BH8B 3C1BC 2HIOD 3MGRD 2Y2HA 3KUYA 3X1SB 3UTBD 3AZFA 3AZLA 5B1LB 3LJAB 5B1MA 3WA9B 3WKJA 1P3OA 1P3IC 5E5AA 3UT9D 1KX3B 4UUZB 1ZLAB 4KGCB 5GT3D 4YM6B 3C1BA 4YS3D 1EQZC 4WNNA 3AYWC 4X23B 3B6GB 5F99C 1P3MC 2CV5D 3C1CA 1BH9A 1M1AB 3REKC 1P3IA 2YFVB 3WAAC 4H9OA 3KUYD 3AZLD 2JSSA 1P3KD 5CPIB 1P3AB 1P34A 1P3GA 5B1MD 4J8XC 2Y2GA 3WKJD 1P3FD 4Z66C 1P3OD 1EQZA 3MGPC 3VH6A 1P3BA 5E5AD 1P3MA 1ID3C 5AV6B 2DF4C 3REKA 3C1BD 3TU4C 4H9QA 3X1VB 1P3LC 1A7WA 5GT0B 3AN2C 4J8VB 3A6NB 4Z66A 2L5AA 4HGAC 4WU8B 3MGPA 3AZJB 5BO0B 3X1TB 1P3ID 4WU9C 2HIOB 2F8NG 1ID3A 3MGRB 1KX4C 1WWIA 1S32A 1P3LA 3UTBB 1M18A 1EQZD 1PZRA 5AV9C 1P3BD 5JA4B 5F99D 1P3MD 1B67A 3MNNC 3UT9B 3REKD 4WU9A 5GT3B 3WAAD 1JFIA 4YS3B 5B31G 3AZMC 1KX4A 4J8XD 4Z66D 1BH8A 1F1EA 3MGPD 2ZY5A 2CV5B 1M19C 3R45B 4NE6A 4G91B 4AWLC 1ID3D 3MNNA 2HUEB 1S32D 4DRBA 3KUYB 3TU4D 2BYKA 3AZLB 1P3KB 1P3LD 3WA9A 5B0YC 3AN2D 5B1MB 3WKJB 1P3FB 3AZMA 1P3OB 1N1JA 3IP4C 4UUZA 5E5AB 1M19A 4R8PA 4WU9D 2Y2IA 3C1BB 1KX4D 4WNNB 5B0YA 3KFUG 5AV9D 1BH9B 1P3IB 3O62A 3MNND 4H9OB 2Y2QA 2Y2MA 4EO5C 3W98C 1P3PC 1EQZB 3AZMD 3B0DC 2F8NA 1P3BB 3VH5W 5B31C 1HTAA 5AV6A 5F99B 1P3MB 1M19D 4R8PD 2JCHA 3REKB 3MGSC 4J8VA 4H9QB 5B2IC 3WAAB 4LD9C 5B0YD 3VH5T 3W98A 1P3PA 4J8XB 4NE3A 4Z66B 3MGPB 4H9PA 3O62D 1ID3B 3MGSA 1S32B 1P3LB 3TU4B 5B2IA 5JA4A 4NFTA 3AN2B 4LD9A 2F8ND 3W99A 2J8PA 4HGAB 4JJNA 4WU9B 2CWEA 1JFIB 3EPHA 1KX4B 3W98D 1P3PD 5B24A 2NZDC 3RELC 3REHC 5AV5C 5AV9B 1W2EA 5B31D 3P5JB 5GXQC 1P3KA 3MNNB 3EPJA 3MGSD 2PYOC 2AROC 5B2ID 2BYKB 1P3FA 4LD9D 3AZMB 3AZNC 3W99D 1N1JB 2NZDA 3RELA 3REHA 5AV5A 4JJND 1M19B 4R8PB 3AL0C 3KWQC 5GXQA 4AWLB 1KU5A 2PYOA 3V9RB 5B24D 2AROA 3W97C 5B0YB 4G92C 3AZNA 5KDMB 3AFAC 3O62B 4KHAA 4DQYB 1U35C 3KWQA 3AYWA 2ZY4A 5CHLB 1AOIC 4H9NA 2BG1A 5F99A 2NZDD 3KSYA 3RELD 2F8NB 3W97A 3REHD 2RIQA 5AV5D 5BNVB 1WWSA 3H0LC 2Y2LA 4J8WC 3WAAA 3AFAA 5GXQD 3KXBC 5CPKC 3X1UC 2PYOD 1TAFB 2AROD 4J8XA 1U35A 4EO5B 3W98B 5DNNC 1P3PB 3WTPE 3AZND 1AOIA 4CAYA 4H9PB 5BS7C 4UPKA 5B31B 3TU4A 4J8WA 4J8UC 3AZKC 5C3IC 3KWQD 3AYWD 3AN2A 3MGSB 5B2IB 3W96C 3KXBA 5CPKA 5FUGA 4LD9B 3W97D 5B33C 3W99B 5DNNA 3LZ1C 1ULYA 3AFAD 1KX5C 4JJNB 3UTAC 3AZIC 5BS7A 1U35D 4J8UA 3AZKA 5AV8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0B A;  5AVC C;  5AV9 A;  3W96 A;  5B24 B;  1AOI D;  5B33 A;  3LZ1 A;  4J8W D;  5B32 G;  1KX5 A;  3KXB D;  3AV2 C;  5CPK D;  4Z2M H;  3X1U D;  5B40 C;  5AV8 A;  5DNN D;  2NZD B;  3REL B;  3REH B;  5AV5 B;  3LEL C;  3MGQ C;  3V9R A;  5GXQ B;  4J8U D;  3AZK D;  2PYO B;  2ARO B;  3AV2 A;  3W96 D;  5GSU C;  1R4V A;  5KDM A;  3VH6 T;  4XUJ C;  5B33 D;  3AZN B;  3LZ1 D;  2LY8 A;  5B0Z C;  4KHA B;  1KX5 D;  3AZI D;  3UTA D;  5AY8 C;  3KWQ B;  3AYW B;  3REI C;  4Z5T C;  4H9N B;  5AV8 D;  5BNV A;  5GSU A;  3MVD C;  3W97 B;  4ZUX C;  4G92 B;  4XUJ A;  1Q9C A;  1TAF A;  3AFA B;  5B0Z A;  4H9R A;  5B2J C;  2BYM A;  3AV2 D;  1U35 B;  5BNX A;  5B32 C;  5B40 D;  3REI A;  4Z5T A;  5B31 A;  1AOI B;  4CAY B;  3B6F C;  3MVD A;  4ZUX A;  3LEL D;  3MGQ D;  4J8W B;  2IO5 C;  3KXB B;  5CPK B;  5FUG B;  3X1U B;  5B2J A;  5GSU D;  4QLC C;  5B32 A;  5DNN B;  4XUJ D;  3B6F A;  5B0Z D;  5AY8 D;  4J8U B;  3AZK B;  5C3I B;  3LZ0 C;  3REI D;  5G49 A;  4Z5T D;  3W96 B;  3NQU A;  3MVD D;  5B33 B;  4QLC A;  4ZUX D;  3NQJ A;  3LZ1 B;  3AZE C;  4XZQ C;  1KX5 B;  5JRG C;  5CP6 C;  3UTA B;  3AZI B;  2HUE C;  5B2J D;  3KUY C;  3AZF C;  3AZL C;  1HQ3 C;  5B32 D;  5AV8 B;  3LZ0 A;  3B6F D;  5E5A C;  1TZY C;  3AZE A;  2YFW A;  4XZQ A;  5CP6 A;  5JRG A;  3AV2 B;  5B40 B;  1HQ3 A;  4QLC D;  3C1C C;  3LEL B;  3MGQ B;  1TZY A;  5CPJ C;  1F66 C;  3WTP C;  1P34 C;  1P3G C;  3LZ0 D;  2FJ7 C;  5GSU B;  3B0C W;  4XUJ B;  1P3B C;  3AZE D;  4H9S C;  4ZBJ C;  5B0Z B;  4XZQ D;  4H9R B;  5JRG D;  2BYM B;  5CP6 D;  5BNX B;  5AY8 B;  5CPJ A;  2RVQ C;  1F66 A;  3AZF D;  3B0D B;  3B0C T;  1HQ3 D;  3WTP A;  4Z5T B;  3REI B;  4KUD C;  2FJ7 A;  3MVD B;  4WV4 B;  4ZUX B;  4M6B A;  3AZH C;  1TZY D;  3X1U A;  3AZG C;  4H9S A;  1H3O A;  1S32 C;  4NE5 A;  5B2J B;  1M18 C;  5B32 B;  4KUD A;  3C1C D;  3B6F B;  2NQB C;  3AZH A;  3REJ C;  5AVB C;  3AV1 C;  5CPJ D;  3AZG A;  1F66 D;  2IO5 B;  5G49 B;  3WTP D;  1P34 D;  1P3G D;  5DNM C;  3NQU B;  3VH5 A;  2FJ7 D;  4QLC B;  3NQJ B;  3AZI A;  3UTA A;  3X1S C;  2NQB A;  5B1L C;  3LJA C;  5AVC A;  3WA9 C;  3REJ A;  5AVB A;  3AV1 A;  2RVQ D;  3VH6 W;  3LZ0 B;  5DNM A;  1KX3 C;  4KUD D;  1ZLA C;  4KGC C;  4CSR B;  4YM6 C;  3AZH D;  4R8P C;  3AZE B;  2YFW B;  3AZG D;  3X1S A;  5BT1 C;  4XZQ B;  5B40 A;  5JRG B;  5CP6 B;  5B1L A;  4X23 C;  3B6G C;  3LJA A;  3AZF B;  1M18 D;  1HQ3 B;  1M1A C;  3LEL A;  3MGQ A;  1KX3 A;  3O62 C;  1ZLA A;  2NQB D;  4KGC A;  5CPI C;  1P3A C;  1TZY B;  4YM6 A;  5AVC D;  3REJ D;  5AVB D;  3AV1 D;  4X23 A;  2F8N K;  5DNM D;  3B6G A;  4E44 A;  1M1A A;  5AV6 C;  3X1V C;  3C1C B;  2YFV A;  5AY8 A;  5GT0 C;  3X1S D;  4J8V C;  1B6W A;  5B1L D;  5CPI A;  1P3A A;  1BFM A;  3A6N C;  3LJA D;  5CPJ B;  1F66 B;  3WA9 D;  3WTP B;  1P34 B;  3AZJ C;  3X1T C;  4WU8 C;  1P3G B;  2FJ7 B;  1KX3 D;  1ZLA D;  2HIO C;  4KGC D;  4DRA A;  3MGR C;  4YM6 D;  3UTB C;  3X1V A;  4ZBJ B;  1H3O B;  5GT0 A;  5BT1 D;  4X23 D;  3B6G D;  3A6N A;  1M1A D;  3UT9 C;  4WU8 A;  3AZJ A;  3W99 C;  3X1T A;  5BO0 A;  4KUD B;  5GT3 C;  2F8N H;  2HIO A;  4JJN C;  3AZH B;  4YS3 C;  3MGR A;  5CPI D;  1P3A D;  3AZG B;  3UTB A;  5B24 C;  2CV5 C;  1M18 B;  4G91 C;  5AV6 D;  3UT9 A;  3X1V D;  4Z2M G;  1P3K C;  2NQB B;  5GT3 A;  5GT0 D;  4J8V D;  5B1M C;  5AVC B;  3WKJ C;  3REJ B;  5AVB B;  3AV1 B;  4YS3 A;  3A6N D;  1P3O C;  1P3F C;  4CSR A;  3X1T D;  4E45 A;  5DNM B;  4WZS B;  3AZJ D;  4WU8 D;  2CV5 A;  3R45 A;  1BH8 B;  3C1B C;  2HIO D;  3MGR D;  3KUY A;  3X1S B;  3UTB D;  3AZF A;  3AZL A;  5B1L B;  3LJA B;  5B1M A;  3WA9 B;  3WKJ A;  1P3O A;  1P3I C;  5E5A A;  3UT9 D;  1KX3 B;  4UUZ B;  1ZLA B;  4KGC B;  5GT3 D;  4YM6 B;  3C1B A;  4YS3 D;  1EQZ C;  4WNN A;  3AYW C;  4X23 B;  3B6G B;  5F99 C;  1P3M C;  2CV5 D;  3C1C A;  1BH9 A;  1M1A B;  3REK C;  1P3I A;  2YFV B;  3WAA C;  4H9O A;  3KUY D;  3AZL D;  2JSS A;  1P3K D;  5CPI B;  1P3A B;  1P34 A;  1P3G A;  5B1M D;  4J8X C;  3WKJ D;  1P3F D;  4Z66 C;  1P3O D;  1EQZ A;  3MGP C;  3VH6 A;  1P3B A;  5E5A D;  1P3M A;  1ID3 C;  5AV6 B;  3REK A;  3C1B D;  3TU4 C;  4H9Q A;  3X1V B;  1P3L C;  1A7W A;  5GT0 B;  3AN2 C;  4J8V B;  3A6N B;  4Z66 A;  2L5A A;  4HGA C;  4WU8 B;  3MGP A;  3AZJ B;  5BO0 B;  3X1T B;  1P3I D;  4WU9 C;  2HIO B;  2F8N G;  1ID3 A;  3MGR B;  1KX4 C;  1WWI A;  1S32 A;  1P3L A;  3UTB B;  1M18 A;  1EQZ D;  5AV9 C;  1P3B D;  5JA4 B;  5F99 D;  1P3M D;  1B67 A;  3MNN C;  3UT9 B;  3REK D;  4WU9 A;  5GT3 B;  3WAA D;  1JFI A;  4YS3 B;  5B31 G;  3AZM C;  1KX4 A;  4J8X D;  4Z66 D;  1BH8 A;  1F1E A;  3MGP D;  2CV5 B;  1M19 C;  3R45 B;  4NE6 A;  4G91 B;  4AWL C;  1ID3 D;  3MNN A;  2HUE B;  1S32 D;  4DRB A;  3KUY B;  3TU4 D;  2BYK A;  3AZL B;  1P3K B;  1P3L D;  3WA9 A;  5B0Y C;  3AN2 D;  5B1M B;  3WKJ B;  1P3F B;  3AZM A;  1P3O B;  1N1J A;  4UUZ A;  5E5A B;  1M19 A;  4R8P A;  4WU9 D;  3C1B B;  1KX4 D;  4WNN B;  5B0Y A;  5AV9 D;  1BH9 B;  1P3I B;  3O62 A;  3MNN D;  4H9O B;  4EO5 C;  3W98 C;  1P3P C;  1EQZ B;  3AZM D;  3B0D C;  2F8N A;  1P3B B;  3VH5 W;  5B31 C;  1HTA A;  5AV6 A;  5F99 B;  1P3M B;  1M19 D;  4R8P D;  3REK B;  3MGS C;  4J8V A;  4H9Q B;  5B2I C;  3WAA B;  4LD9 C;  5B0Y D;  3VH5 T;  3W98 A;  1P3P A;  4J8X B;  4NE3 A;  4Z66 B;  3MGP B;  4H9P A;  3O62 D;  1ID3 B;  3MGS A;  1S32 B;  1P3L B;  3TU4 B;  5B2I A;  5JA4 A;  4NFT A;  3AN2 B;  4LD9 A;  2F8N D;  3W99 A;  4HGA B;  4JJN A;  4WU9 B;  2CWE A;  1JFI B;  1KX4 B;  3W98 D;  1P3P D;  5B24 A;  2NZD C;  3REL C;  3REH C;  5AV5 C;  5AV9 B;  5B31 D;  5GXQ C;  1P3K A;  3MNN B;  3MGS D;  2PYO C;  2ARO C;  5B2I D;  2BYK B;  1P3F A;  4LD9 D;  3AZM B;  3AZN C;  3W99 D;  1N1J B;  2NZD A;  3REL A;  3REH A;  5AV5 A;  4JJN D;  1M19 B;  4R8P B;  3KWQ C;  5GXQ A;  4AWL B;  1KU5 A;  2PYO A;  3V9R B;  5B24 D;  2ARO A;  3W97 C;  5B0Y B;  4G92 C;  3AZN A;  5KDM B;  3AFA C;  3O62 B;  4KHA A;  1U35 C;  3KWQ A;  3AYW A;  5CHL B;  1AOI C;  4H9N A;  5F99 A;  2NZD D;  3KSY A;  3REL D;  2F8N B;  3W97 A;  3REH D;  5AV5 D;  5BNV B;  1WWS A;  4J8W C;  3WAA A;  3AFA A;  5GXQ D;  3KXB C;  5CPK C;  3X1U C;  2PYO D;  1TAF B;  2ARO D;  4J8X A;  1U35 A;  4EO5 B;  3W98 B;  5DNN C;  1P3P B;  3WTP E;  3AZN D;  1AOI A;  4CAY A;  4H9P B;  5BS7 C;  5B31 B;  3TU4 A;  4J8W A;  4J8U C;  3AZK C;  5C3I C;  3KWQ D;  3AYW D;  3AN2 A;  3MGS B;  5B2I B;  3W96 C;  3KXB A;  5CPK A;  5FUG A;  4LD9 B;  3W97 D;  5B33 C;  3W99 B;  5DNN A;  3LZ1 C;  1ULY A;  3AFA D;  1KX5 C;  4JJN B;  3UTA C;  3AZI C;  5BS7 A;  1U35 D;  4J8U A;  3AZK A;  5AV8 C; 
#chains in the Genus database with same CATH topology
 3B0B A;  5AVC C;  5AV9 A;  3W96 A;  5B24 B;  1AOI D;  5B33 A;  2W8S A;  3LZ1 A;  4J8W D;  5B32 G;  1KX5 A;  3KXB D;  3AV2 C;  5CPK D;  4Z2M H;  3X1U D;  5B40 C;  2ZM5 A;  5AV8 A;  5DNN D;  2Y2P A;  2NZD B;  3REL B;  3REH B;  5AV5 B;  3LEL C;  3MGQ C;  3V9R A;  5GXQ B;  4J8U D;  3AZK D;  2PYO B;  2ARO B;  3AV2 A;  3W96 D;  5GSU C;  1R4V A;  5KDM A;  2G5H C;  3VH6 T;  4XUJ C;  5B33 D;  3AZN B;  3LZ1 D;  2Y2N A;  2LY8 A;  5B0Z C;  4KHA B;  1KX5 D;  3AZI D;  3UTA D;  5AY8 C;  3KWQ B;  3AYW B;  3REI C;  4Z5T C;  4H9N B;  2XD1 A;  5AV8 D;  5BNV A;  5GSU A;  3MVD C;  3W97 B;  4ZUX C;  4G92 B;  3H0M C;  4XUJ A;  1Q9C A;  1TAF A;  3AFA B;  5B0Z A;  4H9R A;  5B2J C;  2BYM A;  3AV2 D;  1U35 B;  5BNX A;  5B32 C;  5B40 D;  3REI A;  4Z5T A;  5B31 A;  1AOI B;  4CAY B;  3B6F C;  3MVD A;  1T3U A;  4ZUX A;  3LEL D;  2VQR A;  3MGQ D;  4J8W B;  2IO5 C;  3KXB B;  5CPK B;  5FUG B;  3X1U B;  5B2J A;  5GSU D;  4QLC C;  5B32 A;  2Y2J A;  5DNN B;  4XUJ D;  3B6F A;  5B0Z D;  5AY8 D;  4J8U B;  3AZK B;  5C3I B;  3LZ0 C;  3REI D;  5G49 A;  4Z5T D;  3W96 B;  3NQU A;  3MVD D;  5B33 B;  4QLC A;  4ZUX D;  3NQJ A;  3LZ1 B;  3EPL A;  3AZE C;  4XZQ C;  2G5I C;  5CP6 C;  5JRG C;  3UTA B;  3AZI B;  1KX5 B;  2HUE C;  5B2J D;  2FFF B;  3KUY C;  3AZF C;  1HQ3 C;  3AZL C;  5B32 D;  5AV8 B;  3LZ0 A;  2ZY2 A;  3B6F D;  5E5A C;  1TZY C;  2F2A C;  3AZE A;  2YFW A;  4XZQ A;  2ZY3 A;  5CP6 A;  5JRG A;  3AV2 B;  5B40 B;  1HQ3 A;  4QLC D;  3C1C C;  3LEL B;  3MGQ B;  3EPK A;  1TZY A;  5CPJ C;  1F66 C;  3WTP C;  1P34 C;  1P3G C;  3EG5 B;  3LZ0 D;  2FJ7 C;  5GSU B;  3B0C W;  4XUJ B;  1P3B C;  3AZE D;  4H9S C;  4ZBJ C;  5B0Z B;  4XZQ D;  4H9R B;  5JRG D;  2BYM B;  5CP6 D;  5BNX B;  5AY8 B;  5CPJ A;  2RVQ C;  1F66 A;  3AZF D;  3B0D B;  3B0C T;  1HQ3 D;  3WTP A;  4Z5T B;  3REI B;  4KUD C;  2FJ7 A;  3MVD B;  4WV4 B;  2XD5 A;  4ZUX B;  4M6B A;  3AZH C;  1TZY D;  3X1U A;  3AZG C;  4H9S A;  1H3O A;  1S32 C;  4NE5 A;  5B2J B;  1M18 C;  5B32 B;  4KUD A;  3C1C D;  3B6F B;  3A1I A;  2NQB C;  3AZH A;  3REJ C;  5AVB C;  3A1K A;  3AV1 C;  5CPJ D;  3AZG A;  1F66 D;  2IO5 B;  5G49 B;  3WTP D;  1P34 D;  1P3G D;  5DNM C;  3NQU B;  3VH5 A;  2FJ7 D;  4QLC B;  3NQJ B;  3AZI A;  3UTA A;  3X1S C;  2NQB A;  5B1L C;  3LJA C;  5AVC A;  3WA9 C;  3REJ A;  5AVB A;  3AV1 A;  2RVQ D;  3VH6 W;  3LZ0 B;  5DNM A;  1KX3 C;  4KUD D;  3FDD A;  1ZLA C;  4KGC C;  4CSR B;  4YM6 C;  3AZH D;  4R8P C;  3AZE B;  2YFW B;  3AZG D;  3X1S A;  5BT1 C;  4XZQ B;  5B40 A;  5JRG B;  5CP6 B;  5B1L A;  4X23 C;  3B6G C;  2Y2K A;  3LJA A;  3AZF B;  1M18 D;  1Z2C B;  1HQ3 B;  1M1A C;  3H0R C;  3LEL A;  3MGQ A;  1KX3 A;  3O62 C;  1ZLA A;  2NQB D;  4KGC A;  5CPI C;  1P3A C;  1TZY B;  4YM6 A;  5AVC D;  3REJ D;  5AVB D;  3AV1 D;  4X23 A;  2F8N K;  5DNM D;  3B6G A;  4E44 A;  1M1A A;  5AV6 C;  3X1V C;  3C1C B;  2YFV A;  5AY8 A;  5GT0 C;  3X1S D;  4J8V C;  1B6W A;  2JE5 A;  5B1L D;  5CPI A;  1P3A A;  1BFM A;  3A6N C;  3LJA D;  5CPJ B;  1F66 B;  3WA9 D;  3WTP B;  1P34 B;  3AZJ C;  3X1T C;  4WU8 C;  1P3G B;  2FJ7 B;  2UWX A;  1KX3 D;  1ZLA D;  2HIO C;  4KGC D;  4DRA A;  3MGR C;  4YM6 D;  3UTB C;  3X1V A;  4ZBJ B;  1H3O B;  5GT0 A;  5BT1 D;  4X23 D;  3B6G D;  3A6N A;  2Y2O A;  1M1A D;  3UT9 C;  4WU8 A;  3AZJ A;  3W99 C;  3X1T A;  5BO0 A;  4KUD B;  5GT3 C;  2F8N H;  2HIO A;  4JJN C;  3AZH B;  4YS3 C;  3MGR A;  5CPI D;  1P3A D;  3AZG B;  3UTB A;  5B24 C;  2CV5 C;  1M18 B;  4WJ3 C;  4G91 C;  5AV6 D;  2DQN C;  3UT9 A;  3X1V D;  4Z2M G;  1P3K C;  2NQB B;  5GT3 A;  5GT0 D;  4J8V D;  5B1M C;  5AVC B;  3WKJ C;  3REJ B;  5AVB B;  3F6T A;  3AV1 B;  3A6N D;  4YS3 A;  1P3O C;  1P3F C;  4CSR A;  3X1T D;  4E45 A;  5DNM B;  4WZS B;  3AZJ D;  4WU8 D;  2CV5 A;  3R45 A;  1BH8 B;  3C1B C;  2HIO D;  3MGR D;  2Y2H A;  3KUY A;  3X1S B;  3UTB D;  3AZF A;  3AZL A;  5B1L B;  3LJA B;  5B1M A;  3WA9 B;  3WKJ A;  1P3O A;  1P3I C;  5E5A A;  3UT9 D;  1KX3 B;  4UUZ B;  1ZLA B;  4KGC B;  5GT3 D;  4YM6 B;  3C1B A;  4YS3 D;  1EQZ C;  4WNN A;  3AYW C;  4X23 B;  3B6G B;  5F99 C;  1P3M C;  2CV5 D;  3C1C A;  1BH9 A;  1M1A B;  3REK C;  1P3I A;  2YFV B;  3WAA C;  4H9O A;  3KUY D;  3AZL D;  2JSS A;  1P3K D;  5CPI B;  1P3A B;  1P34 A;  1P3G A;  5B1M D;  4J8X C;  2Y2G A;  3WKJ D;  1P3F D;  4Z66 C;  1P3O D;  1EQZ A;  3MGP C;  3VH6 A;  1P3B A;  5E5A D;  1P3M A;  1ID3 C;  5AV6 B;  2DF4 C;  3REK A;  3C1B D;  3TU4 C;  4H9Q A;  3X1V B;  1P3L C;  1A7W A;  5GT0 B;  3AN2 C;  4J8V B;  3A6N B;  4Z66 A;  2L5A A;  4HGA C;  4WU8 B;  3MGP A;  3AZJ B;  5BO0 B;  3X1T B;  1P3I D;  4WU9 C;  2HIO B;  2F8N G;  1ID3 A;  3MGR B;  1KX4 C;  1WWI A;  1S32 A;  1P3L A;  3UTB B;  1M18 A;  1EQZ D;  1PZR A;  5AV9 C;  1P3B D;  5JA4 B;  5F99 D;  1P3M D;  1B67 A;  3MNN C;  3UT9 B;  3REK D;  4WU9 A;  5GT3 B;  3WAA D;  1JFI A;  4YS3 B;  5B31 G;  3AZM C;  1KX4 A;  4J8X D;  4Z66 D;  1BH8 A;  1F1E A;  3MGP D;  2ZY5 A;  2CV5 B;  1M19 C;  3R45 B;  4NE6 A;  4G91 B;  4AWL C;  1ID3 D;  3MNN A;  2HUE B;  1S32 D;  4DRB A;  3KUY B;  3TU4 D;  2BYK A;  3AZL B;  1P3K B;  1P3L D;  3WA9 A;  5B0Y C;  3AN2 D;  5B1M B;  3WKJ B;  1P3F B;  3AZM A;  1P3O B;  1N1J A;  3IP4 C;  4UUZ A;  5E5A B;  1M19 A;  4R8P A;  4WU9 D;  2Y2I A;  3C1B B;  1KX4 D;  4WNN B;  5B0Y A;  3KFU G;  5AV9 D;  1BH9 B;  1P3I B;  3O62 A;  3MNN D;  4H9O B;  2Y2Q A;  2Y2M A;  4EO5 C;  3W98 C;  1P3P C;  1EQZ B;  3AZM D;  3B0D C;  2F8N A;  1P3B B;  3VH5 W;  5B31 C;  1HTA A;  5AV6 A;  5F99 B;  1P3M B;  1M19 D;  4R8P D;  2JCH A;  3REK B;  3MGS C;  4J8V A;  4H9Q B;  5B2I C;  3WAA B;  4LD9 C;  5B0Y D;  3VH5 T;  3W98 A;  1P3P A;  4J8X B;  4NE3 A;  4Z66 B;  3MGP B;  4H9P A;  3O62 D;  1ID3 B;  3MGS A;  1S32 B;  1P3L B;  3TU4 B;  5B2I A;  5JA4 A;  4NFT A;  3AN2 B;  4LD9 A;  2F8N D;  3W99 A;  2J8P A;  4HGA B;  4JJN A;  4WU9 B;  2CWE A;  1JFI B;  3EPH A;  1KX4 B;  3W98 D;  1P3P D;  5B24 A;  2NZD C;  3REL C;  3REH C;  5AV5 C;  5AV9 B;  1W2E A;  5B31 D;  3P5J B;  5GXQ C;  1P3K A;  3MNN B;  3EPJ A;  3MGS D;  2PYO C;  2ARO C;  5B2I D;  2BYK B;  1P3F A;  4LD9 D;  3AZM B;  3AZN C;  3W99 D;  1N1J B;  2NZD A;  3REL A;  3REH A;  5AV5 A;  4JJN D;  1M19 B;  4R8P B;  3AL0 C;  3KWQ C;  5GXQ A;  4AWL B;  1KU5 A;  2PYO A;  3V9R B;  5B24 D;  2ARO A;  3W97 C;  5B0Y B;  4G92 C;  3AZN A;  5KDM B;  3AFA C;  3O62 B;  4KHA A;  4DQY B;  1U35 C;  3KWQ A;  3AYW A;  2ZY4 A;  5CHL B;  1AOI C;  4H9N A;  2BG1 A;  5F99 A;  2NZD D;  3KSY A;  3REL D;  2F8N B;  3W97 A;  3REH D;  2RIQ A;  5AV5 D;  5BNV B;  1WWS A;  3H0L C;  2Y2L A;  4J8W C;  3WAA A;  3AFA A;  5GXQ D;  3KXB C;  5CPK C;  3X1U C;  2PYO D;  1TAF B;  2ARO D;  4J8X A;  1U35 A;  4EO5 B;  3W98 B;  5DNN C;  1P3P B;  3WTP E;  3AZN D;  1AOI A;  4CAY A;  4H9P B;  5BS7 C;  4UPK A;  5B31 B;  3TU4 A;  4J8W A;  4J8U C;  3AZK C;  5C3I C;  3KWQ D;  3AYW D;  3AN2 A;  3MGS B;  5B2I B;  3W96 C;  3KXB A;  5CPK A;  5FUG A;  4LD9 B;  3W97 D;  5B33 C;  3W99 B;  5DNN A;  3LZ1 C;  1ULY A;  3AFA D;  1KX5 C;  4JJN B;  3UTA C;  3AZI C;  5BS7 A;  1U35 D;  4J8U A;  3AZK A;  5AV8 C; 
#chains in the Genus database with same CATH homology
 3B0B A;  5AVC C;  5AV9 A;  3W96 A;  5B24 B;  1AOI D;  5B33 A;  2W8S A;  3LZ1 A;  4J8W D;  5B32 G;  1KX5 A;  3KXB D;  3AV2 C;  5CPK D;  4Z2M H;  3X1U D;  5B40 C;  2ZM5 A;  5AV8 A;  5DNN D;  2Y2P A;  2NZD B;  3REL B;  3REH B;  5AV5 B;  3LEL C;  3MGQ C;  3V9R A;  5GXQ B;  4J8U D;  3AZK D;  2PYO B;  2ARO B;  3AV2 A;  3W96 D;  5GSU C;  1R4V A;  5KDM A;  2G5H C;  3VH6 T;  4XUJ C;  5B33 D;  3AZN B;  3LZ1 D;  2Y2N A;  2LY8 A;  5B0Z C;  4KHA B;  1KX5 D;  3AZI D;  3UTA D;  5AY8 C;  3KWQ B;  3AYW B;  3REI C;  4Z5T C;  4H9N B;  2XD1 A;  5AV8 D;  5BNV A;  5GSU A;  3MVD C;  3W97 B;  4ZUX C;  4G92 B;  3H0M C;  4XUJ A;  1Q9C A;  1TAF A;  3AFA B;  5B0Z A;  4H9R A;  5B2J C;  2BYM A;  3AV2 D;  1U35 B;  5BNX A;  5B32 C;  5B40 D;  3REI A;  4Z5T A;  5B31 A;  1AOI B;  4CAY B;  3B6F C;  3MVD A;  1T3U A;  4ZUX A;  3LEL D;  2VQR A;  3MGQ D;  4J8W B;  2IO5 C;  3KXB B;  5CPK B;  5FUG B;  3X1U B;  5B2J A;  5GSU D;  4QLC C;  5B32 A;  2Y2J A;  5DNN B;  4XUJ D;  3B6F A;  5B0Z D;  5AY8 D;  4J8U B;  3AZK B;  5C3I B;  3LZ0 C;  3REI D;  5G49 A;  4Z5T D;  3W96 B;  3NQU A;  3MVD D;  5B33 B;  4QLC A;  4ZUX D;  3NQJ A;  3LZ1 B;  3EPL A;  3AZE C;  4XZQ C;  2G5I C;  5CP6 C;  5JRG C;  3UTA B;  3AZI B;  1KX5 B;  2HUE C;  5B2J D;  2FFF B;  3KUY C;  3AZF C;  1HQ3 C;  3AZL C;  5B32 D;  5AV8 B;  3LZ0 A;  2ZY2 A;  3B6F D;  5E5A C;  1TZY C;  2F2A C;  3AZE A;  2YFW A;  4XZQ A;  2ZY3 A;  5CP6 A;  5JRG A;  3AV2 B;  5B40 B;  1HQ3 A;  4QLC D;  3C1C C;  3LEL B;  3MGQ B;  3EPK A;  1TZY A;  5CPJ C;  1F66 C;  3WTP C;  1P34 C;  1P3G C;  3EG5 B;  3LZ0 D;  2FJ7 C;  5GSU B;  3B0C W;  4XUJ B;  1P3B C;  3AZE D;  4H9S C;  4ZBJ C;  5B0Z B;  4XZQ D;  4H9R B;  5JRG D;  2BYM B;  5CP6 D;  5BNX B;  5AY8 B;  5CPJ A;  2RVQ C;  1F66 A;  3AZF D;  3B0D B;  3B0C T;  1HQ3 D;  3WTP A;  4Z5T B;  3REI B;  4KUD C;  2FJ7 A;  3MVD B;  4WV4 B;  2XD5 A;  4ZUX B;  4M6B A;  3AZH C;  1TZY D;  3X1U A;  3AZG C;  4H9S A;  1H3O A;  1S32 C;  4NE5 A;  5B2J B;  1M18 C;  5B32 B;  4KUD A;  3C1C D;  3B6F B;  3A1I A;  2NQB C;  3AZH A;  3REJ C;  5AVB C;  3A1K A;  3AV1 C;  5CPJ D;  3AZG A;  1F66 D;  2IO5 B;  5G49 B;  3WTP D;  1P34 D;  1P3G D;  5DNM C;  3NQU B;  3VH5 A;  2FJ7 D;  4QLC B;  3NQJ B;  3AZI A;  3UTA A;  3X1S C;  2NQB A;  5B1L C;  3LJA C;  5AVC A;  3WA9 C;  3REJ A;  5AVB A;  3AV1 A;  2RVQ D;  3VH6 W;  3LZ0 B;  5DNM A;  1KX3 C;  4KUD D;  3FDD A;  1ZLA C;  4KGC C;  4CSR B;  4YM6 C;  3AZH D;  4R8P C;  3AZE B;  2YFW B;  3AZG D;  3X1S A;  5BT1 C;  4XZQ B;  5B40 A;  5JRG B;  5CP6 B;  5B1L A;  4X23 C;  3B6G C;  2Y2K A;  3LJA A;  3AZF B;  1M18 D;  1Z2C B;  1HQ3 B;  1M1A C;  3H0R C;  3LEL A;  3MGQ A;  1KX3 A;  3O62 C;  1ZLA A;  2NQB D;  4KGC A;  5CPI C;  1P3A C;  1TZY B;  4YM6 A;  5AVC D;  3REJ D;  5AVB D;  3AV1 D;  4X23 A;  2F8N K;  5DNM D;  3B6G A;  4E44 A;  1M1A A;  5AV6 C;  3X1V C;  3C1C B;  2YFV A;  5AY8 A;  5GT0 C;  3X1S D;  4J8V C;  1B6W A;  2JE5 A;  5B1L D;  5CPI A;  1P3A A;  1BFM A;  3A6N C;  3LJA D;  5CPJ B;  1F66 B;  3WA9 D;  3WTP B;  1P34 B;  3AZJ C;  3X1T C;  4WU8 C;  1P3G B;  2FJ7 B;  2UWX A;  1KX3 D;  1ZLA D;  2HIO C;  4KGC D;  4DRA A;  3MGR C;  4YM6 D;  3UTB C;  3X1V A;  4ZBJ B;  1H3O B;  5GT0 A;  5BT1 D;  4X23 D;  3B6G D;  3A6N A;  2Y2O A;  1M1A D;  3UT9 C;  4WU8 A;  3AZJ A;  3W99 C;  3X1T A;  5BO0 A;  4KUD B;  5GT3 C;  2F8N H;  2HIO A;  4JJN C;  3AZH B;  4YS3 C;  3MGR A;  5CPI D;  1P3A D;  3AZG B;  3UTB A;  5B24 C;  2CV5 C;  1M18 B;  4WJ3 C;  4G91 C;  5AV6 D;  2DQN C;  3UT9 A;  3X1V D;  4Z2M G;  1P3K C;  2NQB B;  5GT3 A;  5GT0 D;  4J8V D;  5B1M C;  5AVC B;  3WKJ C;  3REJ B;  5AVB B;  3F6T A;  3AV1 B;  3A6N D;  4YS3 A;  1P3O C;  1P3F C;  4CSR A;  3X1T D;  4E45 A;  5DNM B;  4WZS B;  3AZJ D;  4WU8 D;  2CV5 A;  3R45 A;  1BH8 B;  3C1B C;  2HIO D;  3MGR D;  2Y2H A;  3KUY A;  3X1S B;  3UTB D;  3AZF A;  3AZL A;  5B1L B;  3LJA B;  5B1M A;  3WA9 B;  3WKJ A;  1P3O A;  1P3I C;  5E5A A;  3UT9 D;  1KX3 B;  4UUZ B;  1ZLA B;  4KGC B;  5GT3 D;  4YM6 B;  3C1B A;  4YS3 D;  1EQZ C;  4WNN A;  3AYW C;  4X23 B;  3B6G B;  5F99 C;  1P3M C;  2CV5 D;  3C1C A;  1BH9 A;  1M1A B;  3REK C;  1P3I A;  2YFV B;  3WAA C;  4H9O A;  3KUY D;  3AZL D;  2JSS A;  1P3K D;  5CPI B;  1P3A B;  1P34 A;  1P3G A;  5B1M D;  4J8X C;  2Y2G A;  3WKJ D;  1P3F D;  4Z66 C;  1P3O D;  1EQZ A;  3MGP C;  3VH6 A;  1P3B A;  5E5A D;  1P3M A;  1ID3 C;  5AV6 B;  2DF4 C;  3REK A;  3C1B D;  3TU4 C;  4H9Q A;  3X1V B;  1P3L C;  1A7W A;  5GT0 B;  3AN2 C;  4J8V B;  3A6N B;  4Z66 A;  2L5A A;  4HGA C;  4WU8 B;  3MGP A;  3AZJ B;  5BO0 B;  3X1T B;  1P3I D;  4WU9 C;  2HIO B;  2F8N G;  1ID3 A;  3MGR B;  1KX4 C;  1WWI A;  1S32 A;  1P3L A;  3UTB B;  1M18 A;  1EQZ D;  1PZR A;  5AV9 C;  1P3B D;  5JA4 B;  5F99 D;  1P3M D;  1B67 A;  3MNN C;  3UT9 B;  3REK D;  4WU9 A;  5GT3 B;  3WAA D;  1JFI A;  4YS3 B;  5B31 G;  3AZM C;  1KX4 A;  4J8X D;  4Z66 D;  1BH8 A;  1F1E A;  3MGP D;  2ZY5 A;  2CV5 B;  1M19 C;  3R45 B;  4NE6 A;  4G91 B;  4AWL C;  1ID3 D;  3MNN A;  2HUE B;  1S32 D;  4DRB A;  3KUY B;  3TU4 D;  2BYK A;  3AZL B;  1P3K B;  1P3L D;  3WA9 A;  5B0Y C;  3AN2 D;  5B1M B;  3WKJ B;  1P3F B;  3AZM A;  1P3O B;  1N1J A;  3IP4 C;  4UUZ A;  5E5A B;  1M19 A;  4R8P A;  4WU9 D;  2Y2I A;  3C1B B;  1KX4 D;  4WNN B;  5B0Y A;  3KFU G;  5AV9 D;  1BH9 B;  1P3I B;  3O62 A;  3MNN D;  4H9O B;  2Y2Q A;  2Y2M A;  4EO5 C;  3W98 C;  1P3P C;  1EQZ B;  3AZM D;  3B0D C;  2F8N A;  1P3B B;  3VH5 W;  5B31 C;  1HTA A;  5AV6 A;  5F99 B;  1P3M B;  1M19 D;  4R8P D;  2JCH A;  3REK B;  3MGS C;  4J8V A;  4H9Q B;  5B2I C;  3WAA B;  4LD9 C;  5B0Y D;  3VH5 T;  3W98 A;  1P3P A;  4J8X B;  4NE3 A;  4Z66 B;  3MGP B;  4H9P A;  3O62 D;  1ID3 B;  3MGS A;  1S32 B;  1P3L B;  3TU4 B;  5B2I A;  5JA4 A;  4NFT A;  3AN2 B;  4LD9 A;  2F8N D;  3W99 A;  2J8P A;  4HGA B;  4JJN A;  4WU9 B;  2CWE A;  1JFI B;  3EPH A;  1KX4 B;  3W98 D;  1P3P D;  5B24 A;  2NZD C;  3REL C;  3REH C;  5AV5 C;  5AV9 B;  1W2E A;  5B31 D;  3P5J B;  5GXQ C;  1P3K A;  3MNN B;  3EPJ A;  3MGS D;  2PYO C;  2ARO C;  5B2I D;  2BYK B;  1P3F A;  4LD9 D;  3AZM B;  3AZN C;  3W99 D;  1N1J B;  2NZD A;  3REL A;  3REH A;  5AV5 A;  4JJN D;  1M19 B;  4R8P B;  3AL0 C;  3KWQ C;  5GXQ A;  4AWL B;  1KU5 A;  2PYO A;  3V9R B;  5B24 D;  2ARO A;  3W97 C;  5B0Y B;  4G92 C;  3AZN A;  5KDM B;  3AFA C;  3O62 B;  4KHA A;  4DQY B;  1U35 C;  3KWQ A;  3AYW A;  2ZY4 A;  5CHL B;  1AOI C;  4H9N A;  2BG1 A;  5F99 A;  2NZD D;  3KSY A;  3REL D;  2F8N B;  3W97 A;  3REH D;  2RIQ A;  5AV5 D;  5BNV B;  1WWS A;  3H0L C;  2Y2L A;  4J8W C;  3WAA A;  3AFA A;  5GXQ D;  3KXB C;  5CPK C;  3X1U C;  2PYO D;  1TAF B;  2ARO D;  4J8X A;  1U35 A;  4EO5 B;  3W98 B;  5DNN C;  1P3P B;  3WTP E;  3AZN D;  1AOI A;  4CAY A;  4H9P B;  5BS7 C;  4UPK A;  5B31 B;  3TU4 A;  4J8W A;  4J8U C;  3AZK C;  5C3I C;  3KWQ D;  3AYW D;  3AN2 A;  3MGS B;  5B2I B;  3W96 C;  3KXB A;  5CPK A;  5FUG A;  4LD9 B;  3W97 D;  5B33 C;  3W99 B;  5DNN A;  3LZ1 C;  1ULY A;  3AFA D;  1KX5 C;  4JJN B;  3UTA C;  3AZI C;  5BS7 A;  1U35 D;  4J8U A;  3AZK A;  5AV8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...