3RELC

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relC00
4X23B 3W97A 4KHAB 5B31D 4J8VA 3LELA 3WTPC 1F1EA 1KX5C 3AZGD 1M18C 3MVDC 5B2JB 3W98A 5CPIA 5DNMA 3AZHC 3AV1B 2FJ7C 1H3OA 2BYMB 5GXQD 3C1BD 3MGRB 1HQ3D 3C1CC 3REJD 3MGPB 1AOIC 5BO0A 4UUZA 3VH6A 1P3IC 3O62C 3AZHB 4QLCB 3AZGB 4X23A 4KHAA 5AV8D 2FJ7B 3X1UC 3REKD 2F8NB 3WKJC 5E5AD 5B2JA 5GXQB 5CP6D 3C1BB 4ZUXD 4H9OB 5B1MC 5B0YC 3AV1A 1P3IB 1P3LC 3REJB 2BYMA 3REID 3MGRA 3WTPA 4G92C 3MGPA 1F66D 2HIOB 5AV8B 5AV6D 3REKB 5GT0C 4J8WC 3AZHA 4QLCA 3AZGA 1P3LB 5E5AB 4WV4B 2FJ7A 1P3MC 2F8NA 1BH8B 2AROD 4G92B 5GXQA 3C1BA 4H9OA 5CPKC 5GT0B 4YM6D 3RELC 3AZJC 1P3IA 5B32G 3REJA 1F66B 3LZ0C 5AV6B 4Z66C 2HIOA 4XZQC 5AV8A 4AWLC 3REKA 3TU4D 3MGSD 3KSYA 1P3LA 5E5AA 1S32C 3W96C 1BH8A 4JJND 4YM6B 5GT3D 5BS7A 3WA9C 4H9RB 5GT0A 3AV2C 5AY8C 3VH6T 5AVBD 1F66A 5AV6A 3VH6W 5BT1C 3MGSB 4H9SC 3KXBD 3NQJB 3LZ1D 4JJNB 5GT3B 3AV2B 1P3KD 1KU5A 4YS3D 1ID3C 4YM6A 3B6GC 3WAAD 4J8XD 2YFWB 3UTAD 4H9RA 5CPJC 1ZLAD 3A6NC 1WWSA 5AVCB 3WTPE 1B6WA 3AN2C 4Z5TC 5B33D 5B2IB 3UT9D 1P3FC 3MGSA 3AFAC 3NQJA 4WU9D 5CPJB 4JJNA 5GT3A 3WAAB 3AV2A 5AY8A 3AZEC 3W99C 3UTAB 4J8VC 3X1SD 3LELC 2L5AA 1P3FB 1KX3D 2RVQD 4H9SA 2YFWA 4ZBJB 5CPIC 5G49B 4R8PD 5AVCA 1M1AD 4KUDD 3AZEB 3W99B 5B0ZD 4WU9B 5B2IA 5DNND 2CV5D 3MGQC 5CPJA 3REHC 3X1SB 3WAAA 1Q9CA 1KX3B 3UTAA 5JA4B 4CSRB 3AZND 1P3FA 1M1AB 3AFAA 4EO5B 5KDMB 5G49A 3MGQB 5AV9C 3REHB 4WU8D 2PYOD 5B40D 1P3GB 1P3PD 3AZEA 3W99A 3B0DB 3MGRC 4WU9A 1KX4C 1P3BD 2HUEC 4J8UD 3MGPC 3KWQC 5B31C 5AV5D 3X1SA 5AV9B 3AZNB 3KUYD 4QLCC 4G91C 3AZGC 1KX3A 5JA4A 4CSRA 1KX4B 2PYOB 4WU8B 1M1AA 5B40B 2HUEB 1P3PB 4LD9D 5KDMA 5GXQC 3KWQB 5B31B 3MGQA 1HQ3C 3C1BC 3REHA 1P3GA 4WNNB 3REJC 4G91B 1M18D 5B1LD 2F8NK 3AZLD 2HIOC 5AV8C 5AV9A 1HQ3B 3REKC 3AZNA 3C1CD 5E5AC 4LD9B 5CP6C 1HTAA 1KX4A 2PYOA 4WU8A 1P3OD 5B40A 5BS7C 5BNXB 1P3PA 4H9NB 1JFIB 3KWQA 5B31A 3AYWD 2F8NH 3X1UD 4WNNA 3AZID 5B32D 2F8NG 1F66C 5CP6B 5AV6C 4ZUXB 5BNVB 5B1MD 5B0YD 3REIB 1HQ3A 4LD9A 4YM6C 4XUJD 5BNXA 4H9NA 1JFIA 3B0CT 4J8WD 3B6FD 2AROB 5CP6A 4KGCD 4ZUXA 3TU4C 3MGSC 5BNVA 5JRGD 3AZJD 4E44A 3X1TD 3REIA 4JJNC 5GT3C 1EQZD 4Z66D 3LJAD 3TU4B 1M19D 5AVBC 5C3IB 2IO5B 3AZKD 5AVCC 2AROA 5JRGB 4NE6A 3LZ1C 3X1TB 5B2IC 3WA9D 2JSSA 2NZDD 1P34D 5B24D 5GSUD 4YS3C 5AVBB 5CHLB 3LJAB 1N1JB 3WAAC 5BT1D 4J8XC 3KXBB 3UTAC 1ZLAC 3UTBD 5FUGB 3LZ1B 3TU4A 1U35D 3R45B 4ZBJC 1P3KB 4YS3B 5B33C 3VH5T 4J8XB 2NZDB 1P34B 5GSUB 1TZYD 3X1TA 4WU9C 1ZLAB 3AZMD 5AVBA 3UTBB 3AZFD 3X1SC 3LJAA 5B33B 1N1JA 3UT9B 1KX3C 2RVQC 3KXBA 1U35B 5FUGA 3LZ1A 1BFMA 2YFVB 3X1VD 1M1AC 4EO5C 3MNND 2NQBD 3R45A 1P3KA 4YS3A 3W97D 5DNNC 1P3GC 4J8XA 2CV5C 2NZDA 1P34A 5GSUA 3B0DC 1ZLAA 3AZFB 3W98D 4R8PB 5CPID 4KUDB 5DNMD 3UTBA 5B0ZB 5B33A 3UT9A 3AZNC 5DNNB 2CV5B 1U35A 2NQBB 2PYOC 5F99D 4WU8C 2YFVA 4E45A 5B40C 1P3PC 2LY8A 4X23D 1P3AD 5AV5C 4H9QB 1TAFB 5B2JD 4R8PA 4KUDA 4WZSB 3AV1D 5B0ZA 5F99B 4H9PB 1P3BB 5DNNA 4J8UB 4Z2MH 2CV5A 4LD9C 3WTPD 2NQBA 1KX5D 5AV5B 3MVDD 3KUYB 1P3AB 3AZHD 4QLCD 2FJ7D 2BYKB 5B1LC 2F8ND 3AZLC 4H9QA 1TAFA 4ZUXC 5B31G 1AOID 3WTPB 1P3ID 3REIC 3O62D 1KX5B 1BH9B 1M18B 5F99A 3MVDB 1P3OC 4H9PA 1P3BA 5B1LB 4J8UA 3WKJD 3AZLB 5AV5A 4DRAA 2HIOD 3AYWC 3KUYA 3AZIC 5B32C 3C1CB 1P3AA 3VH5A 1P3LD 1P3OB 2BYKA 1AOIB 2AROC 3O62B 3AYWB 3X1UB 3AZIB 5GT0D 5B32B 3WKJB 1KX5A 1BH9A 1M18A 3B0CW 3MVDA 1P3MD 4XUJC 5B1LA 3AZLA 5B1MB 4DRBA 5B0YB 3V9RB 3B6FC 3C1CA 4M6BA 5CPKD 5C3IC 3RELD 2IO5C 4KGCC 1P3OA 1AOIA 3LZ0D 4XUJB 2CWEA 5JRGC 4J8WB 3O62A 3X1TC 3NQUB 4XZQD 1P3MB 3AYWA 3X1UA 3AZIA 3B6FB 5B32A 1EQZC 3WKJA 4KGCB 3LJAC 1S32D 3W96D 1M19C 4CAYB 5CPKB 3KXBC 5B1MA 5B0YA 3RELB 1A7WA 3AZJB 3AZKC 3V9RA 3LZ0B 1EQZB 1P3KC 4Z66B 3AV2D 5AY8D 4HGAC 4XZQB 4XUJA 1M19B 4AWLB 2NZDC 4J8WA 5B24C 1P34C 5GSUC 3NQUA 3AZKB 1S32B 1P3MA 3W96B 3B6FA 5AVCD 3UTBC 4KGCA 3WA9B 3UT9C 4HGAB 5B2ID 1ID3D 4CAYA 1WWIA 3VH5W 5CPKA 5JRGA 1U35C 5B24B 3RELA 3AZJA 1ULYA 3B6GD 5AY8B 5CPJD 3LZ0A 1EQZA 3B0BA 3A6ND 4Z66A 1TZYC 3AN2D 4Z5TD 4XZQA 1M19A 4NFTA 1P3FD 3AFAD 3AZMC 3AZFC 3AZKA 4R8PC 1S32A 3W96A 4KUDC 1ID3B 3B6GB 5B0ZC 1TZYB 3WA9A 3AZED 3W99D 3X1VC 4J8VD 3LELD 3MNNC 2NQBC 5B24A 3A6NB 4NE5A 3AZMB 3AN2B 4Z5TB 3W97C 3AFAB 3W98C 3X1VB 1R4VA 4NE3A 3MNNB 5DNMC 1B67A 3MGQD 3W97B 3REHD 1ID3A 4J8VB 3LELB 1P3GD 3B6GA 1TZYA 5F99C 3W98B 1P3BC 5CPIB 4J8UC 3A6NA 5DNMB 3AZMA 3AZFA 4Z5TA 4X23C 3AN2A 1H3OB 3KUYC 5AV9D 1P3AC 5B2JC 3MGRD 3X1VA 5BO0B 1KX4D 4UUZB 4Z2MG 3MNNA 3AV1C 3MGPD 3KWQD
chains in the Genus database with same CATH superfamily
4X23B 3W97A 2BG1A 4KHAB 5B31D 4J8VA 3LELA 3WTPC 1F1EA 1KX5C 3AZGD 1M18C 3MVDC 5B2JB 3W98A 5CPIA 5DNMA 3AZHC 3AV1B 2FJ7C 1H3OA 2BYMB 5GXQD 3C1BD 3MGRB 1HQ3D 3AL0C 3C1CC 3REJD 3MGPB 1AOIC 5BO0A 4UUZA 3VH6A 1P3IC 3O62C 3AZHB 4QLCB 3AZGB 4X23A 2Y2KA 4KHAA 5AV8D 2FJ7B 3X1UC 3REKD 2F8NB 3WKJC 5E5AD 5B2JA 5GXQB 5CP6D 3C1BB 4ZUXD 2Y2OA 4H9OB 5B1MC 5B0YC 3AV1A 1P3IB 1P3LC 3REJB 2BYMA 3REID 3MGRA 2VQRA 3WTPA 4G92C 3MGPA 1F66D 2HIOB 5AV8B 5AV6D 3REKB 5GT0C 4J8WC 3AZHA 4QLCA 3AZGA 1P3LB 5E5AB 4WV4B 2FJ7A 1P3MC 2F8NA 1BH8B 2AROD 4G92B 5GXQA 3C1BA 4H9OA 5CPKC 5GT0B 4YM6D 3RELC 3AZJC 1P3IA 2Y2HA 5B32G 3REJA 1F66B 3LZ0C 5AV6B 2JCHA 4Z66C 2HIOA 4XZQC 5AV8A 4AWLC 3REKA 3TU4D 3MGSD 3KSYA 1P3LA 5E5AA 1S32C 3W96C 1BH8A 4JJND 2Y2QA 4YM6B 5GT3D 2Y2MA 5BS7A 3WA9C 4H9RB 5GT0A 3AV2C 5AY8C 3VH6T 5AVBD 1F66A 5AV6A 3VH6W 5BT1C 3MGSB 4H9SC 3KXBD 3NQJB 3LZ1D 4JJNB 3H0LC 5GT3B 3AV2B 1P3KD 1KU5A 4YS3D 1ID3C 4YM6A 3B6GC 3WAAD 4J8XD 2YFWB 3UTAD 4H9RA 5CPJC 1ZLAD 2Y2LA 3A6NC 1WWSA 5AVCB 3WTPE 1B6WA 3AN2C 4Z5TC 5B33D 5B2IB 3UT9D 1P3FC 3MGSA 3AFAC 3NQJA 4WJ3C 4WU9D 5CPJB 4JJNA 5GT3A 3A1IA 3WAAB 3AV2A 5AY8A 3AZEC 2RIQA 3W99C 4UPKA 3UTAB 4J8VC 3X1SD 3LELC 2L5AA 3F6TA 1P3FB 1KX3D 2RVQD 4H9SA 2YFWA 4ZBJB 5CPIC 5G49B 4R8PD 5AVCA 1M1AD 4KUDD 3AZEB 3W99B 5B0ZD 4WU9B 5B2IA 5DNND 2CV5D 3MGQC 5CPJA 3REHC 3X1SB 2FFFB 3WAAA 1Q9CA 1KX3B 3UTAA 5JA4B 4CSRB 3AZND 1P3FA 1M1AB 3AFAA 4EO5B 5KDMB 5G49A 3MGQB 5AV9C 3REHB 4WU8D 2PYOD 5B40D 1P3GB 1P3PD 3AZEA 3W99A 2Y2NA 3B0DB 3MGRC 4WU9A 1KX4C 1P3BD 2HUEC 4J8UD 3MGPC 3KWQC 5B31C 5AV5D 3X1SA 2Y2JA 5AV9B 3AZNB 3KUYD 4QLCC 4G91C 3AZGC 1KX3A 5JA4A 4CSRA 1KX4B 2PYOB 4WU8B 1M1AA 5B40B 2HUEB 1P3PB 4LD9D 5KDMA 5GXQC 3KWQB 5B31B 3MGQA 1HQ3C 3C1BC 3REHA 1P3GA 4WNNB 3REJC 4G91B 1M18D 5B1LD 2F8NK 3AZLD 2HIOC 5AV8C 5AV9A 1HQ3B 3REKC 3IP4C 3AZNA 3C1CD 5E5AC 4LD9B 5CP6C 1HTAA 1KX4A 2PYOA 4WU8A 1P3OD 3EG5B 5B40A 5BS7C 5BNXB 1P3PA 4H9NB 1JFIB 3KWQA 2ZY5A 5B31A 3AYWD 2F8NH 3X1UD 4WNNA 3AZID 5B32D 2F8NG 1F66C 5CP6B 5AV6C 4ZUXB 3H0RC 5BNVB 5B1MD 5B0YD 3REIB 1HQ3A 2UWXA 4LD9A 2Y2PA 4YM6C 4XUJD 5BNXA 4H9NA 1JFIA 3B0CT 4J8WD 2ZY3A 3B6FD 2AROB 5CP6A 4KGCD 4ZUXA 3TU4C 3MGSC 5BNVA 5JRGD 3AZJD 4E44A 3X1TD 3REIA 4JJNC 5GT3C 1EQZD 4Z66D 3LJAD 3TU4B 1M19D 2ZY4A 5AVBC 5C3IB 2IO5B 2XD1A 3AZKD 5AVCC 2AROA 5JRGB 4NE6A 3LZ1C 3X1TB 5B2IC 3WA9D 2JSSA 2W8SA 2NZDD 1P34D 5B24D 5GSUD 4YS3C 5AVBB 5CHLB 3LJAB 1N1JB 3WAAC 5BT1D 4J8XC 2Y2IA 3KXBB 3UTAC 1ZLAC 3UTBD 5FUGB 3LZ1B 3TU4A 1U35D 3R45B 4ZBJC 1P3KB 4YS3B 5B33C 3VH5T 1T3UA 4J8XB 2NZDB 1P34B 5GSUB 1TZYD 3X1TA 4WU9C 1ZLAB 3EPLA 3AZMD 5AVBA 3UTBB 3AZFD 3X1SC 3LJAA 5B33B 1N1JA 3UT9B 1KX3C 2RVQC 3KXBA 1U35B 5FUGA 2DQNC 3LZ1A 1BFMA 2YFVB 3X1VD 1M1AC 4EO5C 3MNND 2NQBD 3R45A 1P3KA 4YS3A 3W97D 5DNNC 1P3GC 4J8XA 2CV5C 2NZDA 1P34A 5GSUA 3B0DC 1ZLAA 3AZFB 3W98D 4R8PB 5CPID 2DF4C 4KUDB 5DNMD 3UTBA 5B0ZB 5B33A 3UT9A 3AZNC 2J8PA 5DNNB 2G5IC 2CV5B 2G5HC 1U35A 2NQBB 2PYOC 5F99D 4WU8C 2YFVA 4E45A 5B40C 1P3PC 2LY8A 4X23D 1P3AD 2ZY2A 5AV5C 4H9QB 1TAFB 5B2JD 4R8PA 4KUDA 4WZSB 3AV1D 5B0ZA 5F99B 4H9PB 1P3BB 5DNNA 4J8UB 4Z2MH 2CV5A 4LD9C 3WTPD 2NQBA 1KX5D 5AV5B 3MVDD 3KUYB 3FDDA 1P3AB 3AZHD 4QLCD 2FJ7D 2BYKB 5B1LC 2F8ND 3AZLC 4H9QA 1TAFA 4ZUXC 5B31G 1AOID 3WTPB 1P3ID 3REIC 3O62D 1KX5B 1BH9B 1M18B 5F99A 3MVDB 1P3OC 4H9PA 1P3BA 5B1LB 4J8UA 3WKJD 3AZLB 1Z2CB 3H0MC 5AV5A 4DRAA 2HIOD 3AYWC 3KUYA 3AZIC 5B32C 3C1CB 1P3AA 3VH5A 1P3LD 1P3OB 2BYKA 1AOIB 2AROC 3P5JB 3O62B 3AYWB 3X1UB 3AZIB 5GT0D 1PZRA 5B32B 3WKJB 1KX5A 1BH9A 1M18A 3B0CW 3MVDA 1P3MD 4XUJC 5B1LA 3AZLA 5B1MB 4DRBA 5B0YB 3V9RB 3B6FC 3C1CA 4M6BA 5CPKD 5C3IC 3RELD 2IO5C 4KGCC 1P3OA 1AOIA 3LZ0D 4XUJB 2CWEA 5JRGC 4J8WB 4DQYB 3O62A 3X1TC 3NQUB 4XZQD 1P3MB 3AYWA 3X1UA 3AZIA 3B6FB 5B32A 1EQZC 3WKJA 2F2AC 4KGCB 3LJAC 3EPJA 1S32D 3W96D 1M19C 4CAYB 5CPKB 3KXBC 5B1MA 5B0YA 3RELB 1A7WA 3AZJB 3AZKC 3V9RA 3LZ0B 1EQZB 1P3KC 4Z66B 3AV2D 5AY8D 4HGAC 4XZQB 4XUJA 1M19B 4AWLB 2NZDC 4J8WA 5B24C 1P34C 3A1KA 5GSUC 2ZM5A 3NQUA 3AZKB 1W2EA 1S32B 1P3MA 3W96B 3B6FA 5AVCD 3UTBC 4KGCA 3WA9B 3UT9C 4HGAB 5B2ID 1ID3D 4CAYA 1WWIA 3VH5W 5CPKA 5JRGA 1U35C 5B24B 3RELA 3AZJA 1ULYA 3B6GD 5AY8B 5CPJD 3LZ0A 1EQZA 3B0BA 3A6ND 4Z66A 1TZYC 3AN2D 4Z5TD 4XZQA 1M19A 4NFTA 1P3FD 3AFAD 3AZMC 3AZFC 3AZKA 4R8PC 1S32A 3W96A 3EPKA 4KUDC 1ID3B 3B6GB 5B0ZC 1TZYB 3WA9A 3AZED 3W99D 3X1VC 4J8VD 2Y2GA 3LELD 3MNNC 2NQBC 5B24A 3A6NB 2JE5A 4NE5A 3AZMB 3AN2B 4Z5TB 3W97C 2XD5A 3AFAB 3W98C 3X1VB 1R4VA 4NE3A 3MNNB 5DNMC 1B67A 3MGQD 3W97B 3REHD 1ID3A 4J8VB 3LELB 3KFUG 1P3GD 3B6GA 1TZYA 5F99C 3W98B 1P3BC 5CPIB 4J8UC 3A6NA 5DNMB 3AZMA 3AZFA 4Z5TA 4X23C 3AN2A 1H3OB 3EPHA 3KUYC 5AV9D 1P3AC 5B2JC 3MGRD 3X1VA 5BO0B 1KX4D 4UUZB 4Z2MG 3MNNA 3AV1C 3MGPD 3KWQD
chains in the Genus database with same CATH topology
4X23B 3W97A 2BG1A 4KHAB 5B31D 4J8VA 3LELA 3WTPC 1F1EA 1KX5C 3AZGD 1M18C 3MVDC 5B2JB 3W98A 5CPIA 5DNMA 3AZHC 3AV1B 2FJ7C 1H3OA 2BYMB 5GXQD 3C1BD 3MGRB 1HQ3D 3AL0C 3C1CC 3REJD 3MGPB 1AOIC 5BO0A 4UUZA 3VH6A 1P3IC 3O62C 3AZHB 4QLCB 3AZGB 4X23A 2Y2KA 4KHAA 5AV8D 2FJ7B 3X1UC 3REKD 2F8NB 3WKJC 5E5AD 5B2JA 5GXQB 5CP6D 3C1BB 4ZUXD 2Y2OA 4H9OB 5B1MC 5B0YC 3AV1A 1P3IB 1P3LC 3REJB 2BYMA 3REID 3MGRA 2VQRA 3WTPA 4G92C 3MGPA 1F66D 2HIOB 5AV8B 5AV6D 3REKB 5GT0C 4J8WC 3AZHA 4QLCA 3AZGA 1P3LB 5E5AB 4WV4B 2FJ7A 1P3MC 2F8NA 1BH8B 2AROD 4G92B 5GXQA 3C1BA 4H9OA 5CPKC 5GT0B 4YM6D 3RELC 3AZJC 1P3IA 2Y2HA 5B32G 3REJA 1F66B 3LZ0C 5AV6B 2JCHA 4Z66C 2HIOA 4XZQC 5AV8A 4AWLC 3REKA 3TU4D 3MGSD 3KSYA 1P3LA 5E5AA 1S32C 3W96C 1BH8A 4JJND 2Y2QA 4YM6B 5GT3D 2Y2MA 5BS7A 3WA9C 4H9RB 5GT0A 3AV2C 5AY8C 3VH6T 5AVBD 1F66A 5AV6A 3VH6W 5BT1C 3MGSB 4H9SC 3KXBD 3NQJB 3LZ1D 4JJNB 3H0LC 5GT3B 3AV2B 1P3KD 1KU5A 4YS3D 1ID3C 4YM6A 3B6GC 3WAAD 4J8XD 2YFWB 3UTAD 4H9RA 5CPJC 1ZLAD 2Y2LA 3A6NC 1WWSA 5AVCB 3WTPE 1B6WA 3AN2C 4Z5TC 5B33D 5B2IB 3UT9D 1P3FC 3MGSA 3AFAC 3NQJA 4WJ3C 4WU9D 5CPJB 4JJNA 5GT3A 3A1IA 3WAAB 3AV2A 5AY8A 3AZEC 2RIQA 3W99C 4UPKA 3UTAB 4J8VC 3X1SD 3LELC 2L5AA 3F6TA 1P3FB 1KX3D 2RVQD 4H9SA 2YFWA 4ZBJB 5CPIC 5G49B 4R8PD 5AVCA 1M1AD 4KUDD 3AZEB 3W99B 5B0ZD 4WU9B 5B2IA 5DNND 2CV5D 3MGQC 5CPJA 3REHC 3X1SB 2FFFB 3WAAA 1Q9CA 1KX3B 3UTAA 5JA4B 4CSRB 3AZND 1P3FA 1M1AB 3AFAA 4EO5B 5KDMB 5G49A 3MGQB 5AV9C 3REHB 4WU8D 2PYOD 5B40D 1P3GB 1P3PD 3AZEA 3W99A 2Y2NA 3B0DB 3MGRC 4WU9A 1KX4C 1P3BD 2HUEC 4J8UD 3MGPC 3KWQC 5B31C 5AV5D 3X1SA 2Y2JA 5AV9B 3AZNB 3KUYD 4QLCC 4G91C 3AZGC 1KX3A 5JA4A 4CSRA 1KX4B 2PYOB 4WU8B 1M1AA 5B40B 2HUEB 1P3PB 4LD9D 5KDMA 5GXQC 3KWQB 5B31B 3MGQA 1HQ3C 3C1BC 3REHA 1P3GA 4WNNB 3REJC 4G91B 1M18D 5B1LD 2F8NK 3AZLD 2HIOC 5AV8C 5AV9A 1HQ3B 3REKC 3IP4C 3AZNA 3C1CD 5E5AC 4LD9B 5CP6C 1HTAA 1KX4A 2PYOA 4WU8A 1P3OD 3EG5B 5B40A 5BS7C 5BNXB 1P3PA 4H9NB 1JFIB 3KWQA 2ZY5A 5B31A 3AYWD 2F8NH 3X1UD 4WNNA 3AZID 5B32D 2F8NG 1F66C 5CP6B 5AV6C 4ZUXB 3H0RC 5BNVB 5B1MD 5B0YD 3REIB 1HQ3A 2UWXA 4LD9A 2Y2PA 4YM6C 4XUJD 5BNXA 4H9NA 1JFIA 3B0CT 4J8WD 2ZY3A 3B6FD 2AROB 5CP6A 4KGCD 4ZUXA 3TU4C 3MGSC 5BNVA 5JRGD 3AZJD 4E44A 3X1TD 3REIA 4JJNC 5GT3C 1EQZD 4Z66D 3LJAD 3TU4B 1M19D 2ZY4A 5AVBC 5C3IB 2IO5B 2XD1A 3AZKD 5AVCC 2AROA 5JRGB 4NE6A 3LZ1C 3X1TB 5B2IC 3WA9D 2JSSA 2W8SA 2NZDD 1P34D 5B24D 5GSUD 4YS3C 5AVBB 5CHLB 3LJAB 1N1JB 3WAAC 5BT1D 4J8XC 2Y2IA 3KXBB 3UTAC 1ZLAC 3UTBD 5FUGB 3LZ1B 3TU4A 1U35D 3R45B 4ZBJC 1P3KB 4YS3B 5B33C 3VH5T 1T3UA 4J8XB 2NZDB 1P34B 5GSUB 1TZYD 3X1TA 4WU9C 1ZLAB 3EPLA 3AZMD 5AVBA 3UTBB 3AZFD 3X1SC 3LJAA 5B33B 1N1JA 3UT9B 1KX3C 2RVQC 3KXBA 1U35B 5FUGA 2DQNC 3LZ1A 1BFMA 2YFVB 3X1VD 1M1AC 4EO5C 3MNND 2NQBD 3R45A 1P3KA 4YS3A 3W97D 5DNNC 1P3GC 4J8XA 2CV5C 2NZDA 1P34A 5GSUA 3B0DC 1ZLAA 3AZFB 3W98D 4R8PB 5CPID 2DF4C 4KUDB 5DNMD 3UTBA 5B0ZB 5B33A 3UT9A 3AZNC 2J8PA 5DNNB 2G5IC 2CV5B 2G5HC 1U35A 2NQBB 2PYOC 5F99D 4WU8C 2YFVA 4E45A 5B40C 1P3PC 2LY8A 4X23D 1P3AD 2ZY2A 5AV5C 4H9QB 1TAFB 5B2JD 4R8PA 4KUDA 4WZSB 3AV1D 5B0ZA 5F99B 4H9PB 1P3BB 5DNNA 4J8UB 4Z2MH 2CV5A 4LD9C 3WTPD 2NQBA 1KX5D 5AV5B 3MVDD 3KUYB 3FDDA 1P3AB 3AZHD 4QLCD 2FJ7D 2BYKB 5B1LC 2F8ND 3AZLC 4H9QA 1TAFA 4ZUXC 5B31G 1AOID 3WTPB 1P3ID 3REIC 3O62D 1KX5B 1BH9B 1M18B 5F99A 3MVDB 1P3OC 4H9PA 1P3BA 5B1LB 4J8UA 3WKJD 3AZLB 1Z2CB 3H0MC 5AV5A 4DRAA 2HIOD 3AYWC 3KUYA 3AZIC 5B32C 3C1CB 1P3AA 3VH5A 1P3LD 1P3OB 2BYKA 1AOIB 2AROC 3P5JB 3O62B 3AYWB 3X1UB 3AZIB 5GT0D 1PZRA 5B32B 3WKJB 1KX5A 1BH9A 1M18A 3B0CW 3MVDA 1P3MD 4XUJC 5B1LA 3AZLA 5B1MB 4DRBA 5B0YB 3V9RB 3B6FC 3C1CA 4M6BA 5CPKD 5C3IC 3RELD 2IO5C 4KGCC 1P3OA 1AOIA 3LZ0D 4XUJB 2CWEA 5JRGC 4J8WB 4DQYB 3O62A 3X1TC 3NQUB 4XZQD 1P3MB 3AYWA 3X1UA 3AZIA 3B6FB 5B32A 1EQZC 3WKJA 2F2AC 4KGCB 3LJAC 3EPJA 1S32D 3W96D 1M19C 4CAYB 5CPKB 3KXBC 5B1MA 5B0YA 3RELB 1A7WA 3AZJB 3AZKC 3V9RA 3LZ0B 1EQZB 1P3KC 4Z66B 3AV2D 5AY8D 4HGAC 4XZQB 4XUJA 1M19B 4AWLB 2NZDC 4J8WA 5B24C 1P34C 3A1KA 5GSUC 2ZM5A 3NQUA 3AZKB 1W2EA 1S32B 1P3MA 3W96B 3B6FA 5AVCD 3UTBC 4KGCA 3WA9B 3UT9C 4HGAB 5B2ID 1ID3D 4CAYA 1WWIA 3VH5W 5CPKA 5JRGA 1U35C 5B24B 3RELA 3AZJA 1ULYA 3B6GD 5AY8B 5CPJD 3LZ0A 1EQZA 3B0BA 3A6ND 4Z66A 1TZYC 3AN2D 4Z5TD 4XZQA 1M19A 4NFTA 1P3FD 3AFAD 3AZMC 3AZFC 3AZKA 4R8PC 1S32A 3W96A 3EPKA 4KUDC 1ID3B 3B6GB 5B0ZC 1TZYB 3WA9A 3AZED 3W99D 3X1VC 4J8VD 2Y2GA 3LELD 3MNNC 2NQBC 5B24A 3A6NB 2JE5A 4NE5A 3AZMB 3AN2B 4Z5TB 3W97C 2XD5A 3AFAB 3W98C 3X1VB 1R4VA 4NE3A 3MNNB 5DNMC 1B67A 3MGQD 3W97B 3REHD 1ID3A 4J8VB 3LELB 3KFUG 1P3GD 3B6GA 1TZYA 5F99C 3W98B 1P3BC 5CPIB 4J8UC 3A6NA 5DNMB 3AZMA 3AZFA 4Z5TA 4X23C 3AN2A 1H3OB 3EPHA 3KUYC 5AV9D 1P3AC 5B2JC 3MGRD 3X1VA 5BO0B 1KX4D 4UUZB 4Z2MG 3MNNA 3AV1C 3MGPD 3KWQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 B;  3W97 A;  4KHA B;  5B31 D;  4J8V A;  3LEL A;  3WTP C;  1F1E A;  1KX5 C;  3AZG D;  1M18 C;  3MVD C;  5B2J B;  3W98 A;  5CPI A;  5DNM A;  3AZH C;  3AV1 B;  2FJ7 C;  1H3O A;  2BYM B;  5GXQ D;  3C1B D;  3MGR B;  1HQ3 D;  3C1C C;  3REJ D;  3MGP B;  1AOI C;  5BO0 A;  4UUZ A;  3VH6 A;  1P3I C;  3O62 C;  3AZH B;  4QLC B;  3AZG B;  4X23 A;  4KHA A;  5AV8 D;  2FJ7 B;  3X1U C;  3REK D;  2F8N B;  3WKJ C;  5E5A D;  5B2J A;  5GXQ B;  5CP6 D;  3C1B B;  4ZUX D;  4H9O B;  5B1M C;  5B0Y C;  3AV1 A;  1P3I B;  1P3L C;  3REJ B;  2BYM A;  3REI D;  3MGR A;  3WTP A;  4G92 C;  3MGP A;  1F66 D;  2HIO B;  5AV8 B;  5AV6 D;  3REK B;  5GT0 C;  4J8W C;  3AZH A;  4QLC A;  3AZG A;  1P3L B;  5E5A B;  4WV4 B;  2FJ7 A;  1P3M C;  2F8N A;  1BH8 B;  2ARO D;  4G92 B;  5GXQ A;  3C1B A;  4H9O A;  5CPK C;  5GT0 B;  4YM6 D;  3REL C;  3AZJ C;  1P3I A;  5B32 G;  3REJ A;  1F66 B;  3LZ0 C;  5AV6 B;  4Z66 C;  2HIO A;  4XZQ C;  5AV8 A;  4AWL C;  3REK A;  3TU4 D;  3MGS D;  3KSY A;  1P3L A;  5E5A A;  1S32 C;  3W96 C;  1BH8 A;  4JJN D;  4YM6 B;  5GT3 D;  5BS7 A;  3WA9 C;  4H9R B;  5GT0 A;  3AV2 C;  5AY8 C;  3VH6 T;  5AVB D;  1F66 A;  5AV6 A;  3VH6 W;  5BT1 C;  3MGS B;  4H9S C;  3KXB D;  3NQJ B;  3LZ1 D;  4JJN B;  5GT3 B;  3AV2 B;  1P3K D;  1KU5 A;  4YS3 D;  1ID3 C;  4YM6 A;  3B6G C;  3WAA D;  4J8X D;  2YFW B;  3UTA D;  4H9R A;  5CPJ C;  1ZLA D;  3A6N C;  1WWS A;  5AVC B;  3WTP E;  1B6W A;  3AN2 C;  4Z5T C;  5B33 D;  5B2I B;  3UT9 D;  1P3F C;  3MGS A;  3AFA C;  3NQJ A;  4WU9 D;  5CPJ B;  4JJN A;  5GT3 A;  3WAA B;  3AV2 A;  5AY8 A;  3AZE C;  3W99 C;  3UTA B;  4J8V C;  3X1S D;  3LEL C;  2L5A A;  1P3F B;  1KX3 D;  2RVQ D;  4H9S A;  2YFW A;  4ZBJ B;  5CPI C;  5G49 B;  4R8P D;  5AVC A;  1M1A D;  4KUD D;  3AZE B;  3W99 B;  5B0Z D;  4WU9 B;  5B2I A;  5DNN D;  2CV5 D;  3MGQ C;  5CPJ A;  3REH C;  3X1S B;  3WAA A;  1Q9C A;  1KX3 B;  3UTA A;  5JA4 B;  4CSR B;  3AZN D;  1P3F A;  1M1A B;  3AFA A;  4EO5 B;  5KDM B;  5G49 A;  3MGQ B;  5AV9 C;  3REH B;  4WU8 D;  2PYO D;  5B40 D;  1P3G B;  1P3P D;  3AZE A;  3W99 A;  3B0D B;  3MGR C;  4WU9 A;  1KX4 C;  1P3B D;  2HUE C;  4J8U D;  3MGP C;  3KWQ C;  5B31 C;  5AV5 D;  3X1S A;  5AV9 B;  3AZN B;  3KUY D;  4QLC C;  4G91 C;  3AZG C;  1KX3 A;  5JA4 A;  4CSR A;  1KX4 B;  2PYO B;  4WU8 B;  1M1A A;  5B40 B;  2HUE B;  1P3P B;  4LD9 D;  5KDM A;  5GXQ C;  3KWQ B;  5B31 B;  3MGQ A;  1HQ3 C;  3C1B C;  3REH A;  1P3G A;  4WNN B;  3REJ C;  4G91 B;  1M18 D;  5B1L D;  2F8N K;  3AZL D;  2HIO C;  5AV8 C;  5AV9 A;  1HQ3 B;  3REK C;  3AZN A;  3C1C D;  5E5A C;  4LD9 B;  5CP6 C;  1HTA A;  1KX4 A;  2PYO A;  4WU8 A;  1P3O D;  5B40 A;  5BS7 C;  5BNX B;  1P3P A;  4H9N B;  1JFI B;  3KWQ A;  5B31 A;  3AYW D;  2F8N H;  3X1U D;  4WNN A;  3AZI D;  5B32 D;  2F8N G;  1F66 C;  5CP6 B;  5AV6 C;  4ZUX B;  5BNV B;  5B1M D;  5B0Y D;  3REI B;  1HQ3 A;  4LD9 A;  4YM6 C;  4XUJ D;  5BNX A;  4H9N A;  1JFI A;  3B0C T;  4J8W D;  3B6F D;  2ARO B;  5CP6 A;  4KGC D;  4ZUX A;  3TU4 C;  3MGS C;  5BNV A;  5JRG D;  3AZJ D;  4E44 A;  3X1T D;  3REI A;  4JJN C;  5GT3 C;  1EQZ D;  4Z66 D;  3LJA D;  3TU4 B;  1M19 D;  5AVB C;  5C3I B;  2IO5 B;  3AZK D;  5AVC C;  2ARO A;  5JRG B;  4NE6 A;  3LZ1 C;  3X1T B;  5B2I C;  3WA9 D;  2JSS A;  2NZD D;  1P34 D;  5B24 D;  5GSU D;  4YS3 C;  5AVB B;  5CHL B;  3LJA B;  1N1J B;  3WAA C;  5BT1 D;  4J8X C;  3KXB B;  3UTA C;  1ZLA C;  3UTB D;  5FUG B;  3LZ1 B;  3TU4 A;  1U35 D;  3R45 B;  4ZBJ C;  1P3K B;  4YS3 B;  5B33 C;  3VH5 T;  4J8X B;  2NZD B;  1P34 B;  5GSU B;  1TZY D;  3X1T A;  4WU9 C;  1ZLA B;  3AZM D;  5AVB A;  3UTB B;  3AZF D;  3X1S C;  3LJA A;  5B33 B;  1N1J A;  3UT9 B;  1KX3 C;  2RVQ C;  3KXB A;  1U35 B;  5FUG A;  3LZ1 A;  1BFM A;  2YFV B;  3X1V D;  1M1A C;  4EO5 C;  3MNN D;  2NQB D;  3R45 A;  1P3K A;  4YS3 A;  3W97 D;  5DNN C;  1P3G C;  4J8X A;  2CV5 C;  2NZD A;  1P34 A;  5GSU A;  3B0D C;  1ZLA A;  3AZF B;  3W98 D;  4R8P B;  5CPI D;  4KUD B;  5DNM D;  3UTB A;  5B0Z B;  5B33 A;  3UT9 A;  3AZN C;  5DNN B;  2CV5 B;  1U35 A;  2NQB B;  2PYO C;  5F99 D;  4WU8 C;  2YFV A;  4E45 A;  5B40 C;  1P3P C;  2LY8 A;  4X23 D;  1P3A D;  5AV5 C;  4H9Q B;  1TAF B;  5B2J D;  4R8P A;  4KUD A;  4WZS B;  3AV1 D;  5B0Z A;  5F99 B;  4H9P B;  1P3B B;  5DNN A;  4J8U B;  4Z2M H;  2CV5 A;  4LD9 C;  3WTP D;  2NQB A;  1KX5 D;  5AV5 B;  3MVD D;  3KUY B;  1P3A B;  3AZH D;  4QLC D;  2FJ7 D;  2BYK B;  5B1L C;  2F8N D;  3AZL C;  4H9Q A;  1TAF A;  4ZUX C;  5B31 G;  1AOI D;  3WTP B;  1P3I D;  3REI C;  3O62 D;  1KX5 B;  1BH9 B;  1M18 B;  5F99 A;  3MVD B;  1P3O C;  4H9P A;  1P3B A;  5B1L B;  4J8U A;  3WKJ D;  3AZL B;  5AV5 A;  4DRA A;  2HIO D;  3AYW C;  3KUY A;  3AZI C;  5B32 C;  3C1C B;  1P3A A;  3VH5 A;  1P3L D;  1P3O B;  2BYK A;  1AOI B;  2ARO C;  3O62 B;  3AYW B;  3X1U B;  3AZI B;  5GT0 D;  5B32 B;  3WKJ B;  1KX5 A;  1BH9 A;  1M18 A;  3B0C W;  3MVD A;  1P3M D;  4XUJ C;  5B1L A;  3AZL A;  5B1M B;  4DRB A;  5B0Y B;  3V9R B;  3B6F C;  3C1C A;  4M6B A;  5CPK D;  5C3I C;  3REL D;  2IO5 C;  4KGC C;  1P3O A;  1AOI A;  3LZ0 D;  4XUJ B;  2CWE A;  5JRG C;  4J8W B;  3O62 A;  3X1T C;  3NQU B;  4XZQ D;  1P3M B;  3AYW A;  3X1U A;  3AZI A;  3B6F B;  5B32 A;  1EQZ C;  3WKJ A;  4KGC B;  3LJA C;  1S32 D;  3W96 D;  1M19 C;  4CAY B;  5CPK B;  3KXB C;  5B1M A;  5B0Y A;  3REL B;  1A7W A;  3AZJ B;  3AZK C;  3V9R A;  3LZ0 B;  1EQZ B;  1P3K C;  4Z66 B;  3AV2 D;  5AY8 D;  4HGA C;  4XZQ B;  4XUJ A;  1M19 B;  4AWL B;  2NZD C;  4J8W A;  5B24 C;  1P34 C;  5GSU C;  3NQU A;  3AZK B;  1S32 B;  1P3M A;  3W96 B;  3B6F A;  5AVC D;  3UTB C;  4KGC A;  3WA9 B;  3UT9 C;  4HGA B;  5B2I D;  1ID3 D;  4CAY A;  1WWI A;  3VH5 W;  5CPK A;  5JRG A;  1U35 C;  5B24 B;  3REL A;  3AZJ A;  1ULY A;  3B6G D;  5AY8 B;  5CPJ D;  3LZ0 A;  1EQZ A;  3B0B A;  3A6N D;  4Z66 A;  1TZY C;  3AN2 D;  4Z5T D;  4XZQ A;  1M19 A;  4NFT A;  1P3F D;  3AFA D;  3AZM C;  3AZF C;  3AZK A;  4R8P C;  1S32 A;  3W96 A;  4KUD C;  1ID3 B;  3B6G B;  5B0Z C;  1TZY B;  3WA9 A;  3AZE D;  3W99 D;  3X1V C;  4J8V D;  3LEL D;  3MNN C;  2NQB C;  5B24 A;  3A6N B;  4NE5 A;  3AZM B;  3AN2 B;  4Z5T B;  3W97 C;  3AFA B;  3W98 C;  3X1V B;  1R4V A;  4NE3 A;  3MNN B;  5DNM C;  1B67 A;  3MGQ D;  3W97 B;  3REH D;  1ID3 A;  4J8V B;  3LEL B;  1P3G D;  3B6G A;  1TZY A;  5F99 C;  3W98 B;  1P3B C;  5CPI B;  4J8U C;  3A6N A;  5DNM B;  3AZM A;  3AZF A;  4Z5T A;  4X23 C;  3AN2 A;  1H3O B;  3KUY C;  5AV9 D;  1P3A C;  5B2J C;  3MGR D;  3X1V A;  5BO0 B;  1KX4 D;  4UUZ B;  4Z2M G;  3MNN A;  3AV1 C;  3MGP D;  3KWQ D; 
#chains in the Genus database with same CATH topology
 4X23 B;  3W97 A;  2BG1 A;  4KHA B;  5B31 D;  4J8V A;  3LEL A;  3WTP C;  1F1E A;  1KX5 C;  3AZG D;  1M18 C;  3MVD C;  5B2J B;  3W98 A;  5CPI A;  5DNM A;  3AZH C;  3AV1 B;  2FJ7 C;  1H3O A;  2BYM B;  5GXQ D;  3C1B D;  3MGR B;  1HQ3 D;  3AL0 C;  3C1C C;  3REJ D;  3MGP B;  1AOI C;  5BO0 A;  4UUZ A;  3VH6 A;  1P3I C;  3O62 C;  3AZH B;  4QLC B;  3AZG B;  4X23 A;  2Y2K A;  4KHA A;  5AV8 D;  2FJ7 B;  3X1U C;  3REK D;  2F8N B;  3WKJ C;  5E5A D;  5B2J A;  5GXQ B;  5CP6 D;  3C1B B;  4ZUX D;  2Y2O A;  4H9O B;  5B1M C;  5B0Y C;  3AV1 A;  1P3I B;  1P3L C;  3REJ B;  2BYM A;  3REI D;  3MGR A;  2VQR A;  3WTP A;  4G92 C;  3MGP A;  1F66 D;  2HIO B;  5AV8 B;  5AV6 D;  3REK B;  5GT0 C;  4J8W C;  3AZH A;  4QLC A;  3AZG A;  1P3L B;  5E5A B;  4WV4 B;  2FJ7 A;  1P3M C;  2F8N A;  1BH8 B;  2ARO D;  4G92 B;  5GXQ A;  3C1B A;  4H9O A;  5CPK C;  5GT0 B;  4YM6 D;  3REL C;  3AZJ C;  1P3I A;  2Y2H A;  5B32 G;  3REJ A;  1F66 B;  3LZ0 C;  5AV6 B;  2JCH A;  4Z66 C;  2HIO A;  4XZQ C;  5AV8 A;  4AWL C;  3REK A;  3TU4 D;  3MGS D;  3KSY A;  1P3L A;  5E5A A;  1S32 C;  3W96 C;  1BH8 A;  4JJN D;  2Y2Q A;  4YM6 B;  5GT3 D;  2Y2M A;  5BS7 A;  3WA9 C;  4H9R B;  5GT0 A;  3AV2 C;  5AY8 C;  3VH6 T;  5AVB D;  1F66 A;  5AV6 A;  3VH6 W;  5BT1 C;  3MGS B;  4H9S C;  3KXB D;  3NQJ B;  3LZ1 D;  4JJN B;  3H0L C;  5GT3 B;  3AV2 B;  1P3K D;  1KU5 A;  4YS3 D;  1ID3 C;  4YM6 A;  3B6G C;  3WAA D;  4J8X D;  2YFW B;  3UTA D;  4H9R A;  5CPJ C;  1ZLA D;  2Y2L A;  3A6N C;  1WWS A;  5AVC B;  3WTP E;  1B6W A;  3AN2 C;  4Z5T C;  5B33 D;  5B2I B;  3UT9 D;  1P3F C;  3MGS A;  3AFA C;  3NQJ A;  4WJ3 C;  4WU9 D;  5CPJ B;  4JJN A;  5GT3 A;  3A1I A;  3WAA B;  3AV2 A;  5AY8 A;  3AZE C;  2RIQ A;  3W99 C;  4UPK A;  3UTA B;  4J8V C;  3X1S D;  3LEL C;  2L5A A;  3F6T A;  1P3F B;  1KX3 D;  2RVQ D;  4H9S A;  2YFW A;  4ZBJ B;  5CPI C;  5G49 B;  4R8P D;  5AVC A;  1M1A D;  4KUD D;  3AZE B;  3W99 B;  5B0Z D;  4WU9 B;  5B2I A;  5DNN D;  2CV5 D;  3MGQ C;  5CPJ A;  3REH C;  3X1S B;  2FFF B;  3WAA A;  1Q9C A;  1KX3 B;  3UTA A;  5JA4 B;  4CSR B;  3AZN D;  1P3F A;  1M1A B;  3AFA A;  4EO5 B;  5KDM B;  5G49 A;  3MGQ B;  5AV9 C;  3REH B;  4WU8 D;  2PYO D;  5B40 D;  1P3G B;  1P3P D;  3AZE A;  3W99 A;  2Y2N A;  3B0D B;  3MGR C;  4WU9 A;  1KX4 C;  1P3B D;  2HUE C;  4J8U D;  3MGP C;  3KWQ C;  5B31 C;  5AV5 D;  3X1S A;  2Y2J A;  5AV9 B;  3AZN B;  3KUY D;  4QLC C;  4G91 C;  3AZG C;  1KX3 A;  5JA4 A;  4CSR A;  1KX4 B;  2PYO B;  4WU8 B;  1M1A A;  5B40 B;  2HUE B;  1P3P B;  4LD9 D;  5KDM A;  5GXQ C;  3KWQ B;  5B31 B;  3MGQ A;  1HQ3 C;  3C1B C;  3REH A;  1P3G A;  4WNN B;  3REJ C;  4G91 B;  1M18 D;  5B1L D;  2F8N K;  3AZL D;  2HIO C;  5AV8 C;  5AV9 A;  1HQ3 B;  3REK C;  3IP4 C;  3AZN A;  3C1C D;  5E5A C;  4LD9 B;  5CP6 C;  1HTA A;  1KX4 A;  2PYO A;  4WU8 A;  1P3O D;  3EG5 B;  5B40 A;  5BS7 C;  5BNX B;  1P3P A;  4H9N B;  1JFI B;  3KWQ A;  2ZY5 A;  5B31 A;  3AYW D;  2F8N H;  3X1U D;  4WNN A;  3AZI D;  5B32 D;  2F8N G;  1F66 C;  5CP6 B;  5AV6 C;  4ZUX B;  3H0R C;  5BNV B;  5B1M D;  5B0Y D;  3REI B;  1HQ3 A;  2UWX A;  4LD9 A;  2Y2P A;  4YM6 C;  4XUJ D;  5BNX A;  4H9N A;  1JFI A;  3B0C T;  4J8W D;  2ZY3 A;  3B6F D;  2ARO B;  5CP6 A;  4KGC D;  4ZUX A;  3TU4 C;  3MGS C;  5BNV A;  5JRG D;  3AZJ D;  4E44 A;  3X1T D;  3REI A;  4JJN C;  5GT3 C;  1EQZ D;  4Z66 D;  3LJA D;  3TU4 B;  1M19 D;  2ZY4 A;  5AVB C;  5C3I B;  2IO5 B;  2XD1 A;  3AZK D;  5AVC C;  2ARO A;  5JRG B;  4NE6 A;  3LZ1 C;  3X1T B;  5B2I C;  3WA9 D;  2JSS A;  2W8S A;  2NZD D;  1P34 D;  5B24 D;  5GSU D;  4YS3 C;  5AVB B;  5CHL B;  3LJA B;  1N1J B;  3WAA C;  5BT1 D;  4J8X C;  2Y2I A;  3KXB B;  3UTA C;  1ZLA C;  3UTB D;  5FUG B;  3LZ1 B;  3TU4 A;  1U35 D;  3R45 B;  4ZBJ C;  1P3K B;  4YS3 B;  5B33 C;  3VH5 T;  1T3U A;  4J8X B;  2NZD B;  1P34 B;  5GSU B;  1TZY D;  3X1T A;  4WU9 C;  1ZLA B;  3EPL A;  3AZM D;  5AVB A;  3UTB B;  3AZF D;  3X1S C;  3LJA A;  5B33 B;  1N1J A;  3UT9 B;  1KX3 C;  2RVQ C;  3KXB A;  1U35 B;  5FUG A;  2DQN C;  3LZ1 A;  1BFM A;  2YFV B;  3X1V D;  1M1A C;  4EO5 C;  3MNN D;  2NQB D;  3R45 A;  1P3K A;  4YS3 A;  3W97 D;  5DNN C;  1P3G C;  4J8X A;  2CV5 C;  2NZD A;  1P34 A;  5GSU A;  3B0D C;  1ZLA A;  3AZF B;  3W98 D;  4R8P B;  5CPI D;  2DF4 C;  4KUD B;  5DNM D;  3UTB A;  5B0Z B;  5B33 A;  3UT9 A;  3AZN C;  2J8P A;  5DNN B;  2G5I C;  2CV5 B;  2G5H C;  1U35 A;  2NQB B;  2PYO C;  5F99 D;  4WU8 C;  2YFV A;  4E45 A;  5B40 C;  1P3P C;  2LY8 A;  4X23 D;  1P3A D;  2ZY2 A;  5AV5 C;  4H9Q B;  1TAF B;  5B2J D;  4R8P A;  4KUD A;  4WZS B;  3AV1 D;  5B0Z A;  5F99 B;  4H9P B;  1P3B B;  5DNN A;  4J8U B;  4Z2M H;  2CV5 A;  4LD9 C;  3WTP D;  2NQB A;  1KX5 D;  5AV5 B;  3MVD D;  3KUY B;  3FDD A;  1P3A B;  3AZH D;  4QLC D;  2FJ7 D;  2BYK B;  5B1L C;  2F8N D;  3AZL C;  4H9Q A;  1TAF A;  4ZUX C;  5B31 G;  1AOI D;  3WTP B;  1P3I D;  3REI C;  3O62 D;  1KX5 B;  1BH9 B;  1M18 B;  5F99 A;  3MVD B;  1P3O C;  4H9P A;  1P3B A;  5B1L B;  4J8U A;  3WKJ D;  3AZL B;  1Z2C B;  3H0M C;  5AV5 A;  4DRA A;  2HIO D;  3AYW C;  3KUY A;  3AZI C;  5B32 C;  3C1C B;  1P3A A;  3VH5 A;  1P3L D;  1P3O B;  2BYK A;  1AOI B;  2ARO C;  3P5J B;  3O62 B;  3AYW B;  3X1U B;  3AZI B;  5GT0 D;  1PZR A;  5B32 B;  3WKJ B;  1KX5 A;  1BH9 A;  1M18 A;  3B0C W;  3MVD A;  1P3M D;  4XUJ C;  5B1L A;  3AZL A;  5B1M B;  4DRB A;  5B0Y B;  3V9R B;  3B6F C;  3C1C A;  4M6B A;  5CPK D;  5C3I C;  3REL D;  2IO5 C;  4KGC C;  1P3O A;  1AOI A;  3LZ0 D;  4XUJ B;  2CWE A;  5JRG C;  4J8W B;  4DQY B;  3O62 A;  3X1T C;  3NQU B;  4XZQ D;  1P3M B;  3AYW A;  3X1U A;  3AZI A;  3B6F B;  5B32 A;  1EQZ C;  3WKJ A;  2F2A C;  4KGC B;  3LJA C;  3EPJ A;  1S32 D;  3W96 D;  1M19 C;  4CAY B;  5CPK B;  3KXB C;  5B1M A;  5B0Y A;  3REL B;  1A7W A;  3AZJ B;  3AZK C;  3V9R A;  3LZ0 B;  1EQZ B;  1P3K C;  4Z66 B;  3AV2 D;  5AY8 D;  4HGA C;  4XZQ B;  4XUJ A;  1M19 B;  4AWL B;  2NZD C;  4J8W A;  5B24 C;  1P34 C;  3A1K A;  5GSU C;  2ZM5 A;  3NQU A;  3AZK B;  1W2E A;  1S32 B;  1P3M A;  3W96 B;  3B6F A;  5AVC D;  3UTB C;  4KGC A;  3WA9 B;  3UT9 C;  4HGA B;  5B2I D;  1ID3 D;  4CAY A;  1WWI A;  3VH5 W;  5CPK A;  5JRG A;  1U35 C;  5B24 B;  3REL A;  3AZJ A;  1ULY A;  3B6G D;  5AY8 B;  5CPJ D;  3LZ0 A;  1EQZ A;  3B0B A;  3A6N D;  4Z66 A;  1TZY C;  3AN2 D;  4Z5T D;  4XZQ A;  1M19 A;  4NFT A;  1P3F D;  3AFA D;  3AZM C;  3AZF C;  3AZK A;  4R8P C;  1S32 A;  3W96 A;  3EPK A;  4KUD C;  1ID3 B;  3B6G B;  5B0Z C;  1TZY B;  3WA9 A;  3AZE D;  3W99 D;  3X1V C;  4J8V D;  2Y2G A;  3LEL D;  3MNN C;  2NQB C;  5B24 A;  3A6N B;  2JE5 A;  4NE5 A;  3AZM B;  3AN2 B;  4Z5T B;  3W97 C;  2XD5 A;  3AFA B;  3W98 C;  3X1V B;  1R4V A;  4NE3 A;  3MNN B;  5DNM C;  1B67 A;  3MGQ D;  3W97 B;  3REH D;  1ID3 A;  4J8V B;  3LEL B;  3KFU G;  1P3G D;  3B6G A;  1TZY A;  5F99 C;  3W98 B;  1P3B C;  5CPI B;  4J8U C;  3A6N A;  5DNM B;  3AZM A;  3AZF A;  4Z5T A;  4X23 C;  3AN2 A;  1H3O B;  3EPH A;  3KUY C;  5AV9 D;  1P3A C;  5B2J C;  3MGR D;  3X1V A;  5BO0 B;  1KX4 D;  4UUZ B;  4Z2M G;  3MNN A;  3AV1 C;  3MGP D;  3KWQ D; 
#chains in the Genus database with same CATH homology
 4X23 B;  3W97 A;  2BG1 A;  4KHA B;  5B31 D;  4J8V A;  3LEL A;  3WTP C;  1F1E A;  1KX5 C;  3AZG D;  1M18 C;  3MVD C;  5B2J B;  3W98 A;  5CPI A;  5DNM A;  3AZH C;  3AV1 B;  2FJ7 C;  1H3O A;  2BYM B;  5GXQ D;  3C1B D;  3MGR B;  1HQ3 D;  3AL0 C;  3C1C C;  3REJ D;  3MGP B;  1AOI C;  5BO0 A;  4UUZ A;  3VH6 A;  1P3I C;  3O62 C;  3AZH B;  4QLC B;  3AZG B;  4X23 A;  2Y2K A;  4KHA A;  5AV8 D;  2FJ7 B;  3X1U C;  3REK D;  2F8N B;  3WKJ C;  5E5A D;  5B2J A;  5GXQ B;  5CP6 D;  3C1B B;  4ZUX D;  2Y2O A;  4H9O B;  5B1M C;  5B0Y C;  3AV1 A;  1P3I B;  1P3L C;  3REJ B;  2BYM A;  3REI D;  3MGR A;  2VQR A;  3WTP A;  4G92 C;  3MGP A;  1F66 D;  2HIO B;  5AV8 B;  5AV6 D;  3REK B;  5GT0 C;  4J8W C;  3AZH A;  4QLC A;  3AZG A;  1P3L B;  5E5A B;  4WV4 B;  2FJ7 A;  1P3M C;  2F8N A;  1BH8 B;  2ARO D;  4G92 B;  5GXQ A;  3C1B A;  4H9O A;  5CPK C;  5GT0 B;  4YM6 D;  3REL C;  3AZJ C;  1P3I A;  2Y2H A;  5B32 G;  3REJ A;  1F66 B;  3LZ0 C;  5AV6 B;  2JCH A;  4Z66 C;  2HIO A;  4XZQ C;  5AV8 A;  4AWL C;  3REK A;  3TU4 D;  3MGS D;  3KSY A;  1P3L A;  5E5A A;  1S32 C;  3W96 C;  1BH8 A;  4JJN D;  2Y2Q A;  4YM6 B;  5GT3 D;  2Y2M A;  5BS7 A;  3WA9 C;  4H9R B;  5GT0 A;  3AV2 C;  5AY8 C;  3VH6 T;  5AVB D;  1F66 A;  5AV6 A;  3VH6 W;  5BT1 C;  3MGS B;  4H9S C;  3KXB D;  3NQJ B;  3LZ1 D;  4JJN B;  3H0L C;  5GT3 B;  3AV2 B;  1P3K D;  1KU5 A;  4YS3 D;  1ID3 C;  4YM6 A;  3B6G C;  3WAA D;  4J8X D;  2YFW B;  3UTA D;  4H9R A;  5CPJ C;  1ZLA D;  2Y2L A;  3A6N C;  1WWS A;  5AVC B;  3WTP E;  1B6W A;  3AN2 C;  4Z5T C;  5B33 D;  5B2I B;  3UT9 D;  1P3F C;  3MGS A;  3AFA C;  3NQJ A;  4WJ3 C;  4WU9 D;  5CPJ B;  4JJN A;  5GT3 A;  3A1I A;  3WAA B;  3AV2 A;  5AY8 A;  3AZE C;  2RIQ A;  3W99 C;  4UPK A;  3UTA B;  4J8V C;  3X1S D;  3LEL C;  2L5A A;  3F6T A;  1P3F B;  1KX3 D;  2RVQ D;  4H9S A;  2YFW A;  4ZBJ B;  5CPI C;  5G49 B;  4R8P D;  5AVC A;  1M1A D;  4KUD D;  3AZE B;  3W99 B;  5B0Z D;  4WU9 B;  5B2I A;  5DNN D;  2CV5 D;  3MGQ C;  5CPJ A;  3REH C;  3X1S B;  2FFF B;  3WAA A;  1Q9C A;  1KX3 B;  3UTA A;  5JA4 B;  4CSR B;  3AZN D;  1P3F A;  1M1A B;  3AFA A;  4EO5 B;  5KDM B;  5G49 A;  3MGQ B;  5AV9 C;  3REH B;  4WU8 D;  2PYO D;  5B40 D;  1P3G B;  1P3P D;  3AZE A;  3W99 A;  2Y2N A;  3B0D B;  3MGR C;  4WU9 A;  1KX4 C;  1P3B D;  2HUE C;  4J8U D;  3MGP C;  3KWQ C;  5B31 C;  5AV5 D;  3X1S A;  2Y2J A;  5AV9 B;  3AZN B;  3KUY D;  4QLC C;  4G91 C;  3AZG C;  1KX3 A;  5JA4 A;  4CSR A;  1KX4 B;  2PYO B;  4WU8 B;  1M1A A;  5B40 B;  2HUE B;  1P3P B;  4LD9 D;  5KDM A;  5GXQ C;  3KWQ B;  5B31 B;  3MGQ A;  1HQ3 C;  3C1B C;  3REH A;  1P3G A;  4WNN B;  3REJ C;  4G91 B;  1M18 D;  5B1L D;  2F8N K;  3AZL D;  2HIO C;  5AV8 C;  5AV9 A;  1HQ3 B;  3REK C;  3IP4 C;  3AZN A;  3C1C D;  5E5A C;  4LD9 B;  5CP6 C;  1HTA A;  1KX4 A;  2PYO A;  4WU8 A;  1P3O D;  3EG5 B;  5B40 A;  5BS7 C;  5BNX B;  1P3P A;  4H9N B;  1JFI B;  3KWQ A;  2ZY5 A;  5B31 A;  3AYW D;  2F8N H;  3X1U D;  4WNN A;  3AZI D;  5B32 D;  2F8N G;  1F66 C;  5CP6 B;  5AV6 C;  4ZUX B;  3H0R C;  5BNV B;  5B1M D;  5B0Y D;  3REI B;  1HQ3 A;  2UWX A;  4LD9 A;  2Y2P A;  4YM6 C;  4XUJ D;  5BNX A;  4H9N A;  1JFI A;  3B0C T;  4J8W D;  2ZY3 A;  3B6F D;  2ARO B;  5CP6 A;  4KGC D;  4ZUX A;  3TU4 C;  3MGS C;  5BNV A;  5JRG D;  3AZJ D;  4E44 A;  3X1T D;  3REI A;  4JJN C;  5GT3 C;  1EQZ D;  4Z66 D;  3LJA D;  3TU4 B;  1M19 D;  2ZY4 A;  5AVB C;  5C3I B;  2IO5 B;  2XD1 A;  3AZK D;  5AVC C;  2ARO A;  5JRG B;  4NE6 A;  3LZ1 C;  3X1T B;  5B2I C;  3WA9 D;  2JSS A;  2W8S A;  2NZD D;  1P34 D;  5B24 D;  5GSU D;  4YS3 C;  5AVB B;  5CHL B;  3LJA B;  1N1J B;  3WAA C;  5BT1 D;  4J8X C;  2Y2I A;  3KXB B;  3UTA C;  1ZLA C;  3UTB D;  5FUG B;  3LZ1 B;  3TU4 A;  1U35 D;  3R45 B;  4ZBJ C;  1P3K B;  4YS3 B;  5B33 C;  3VH5 T;  1T3U A;  4J8X B;  2NZD B;  1P34 B;  5GSU B;  1TZY D;  3X1T A;  4WU9 C;  1ZLA B;  3EPL A;  3AZM D;  5AVB A;  3UTB B;  3AZF D;  3X1S C;  3LJA A;  5B33 B;  1N1J A;  3UT9 B;  1KX3 C;  2RVQ C;  3KXB A;  1U35 B;  5FUG A;  2DQN C;  3LZ1 A;  1BFM A;  2YFV B;  3X1V D;  1M1A C;  4EO5 C;  3MNN D;  2NQB D;  3R45 A;  1P3K A;  4YS3 A;  3W97 D;  5DNN C;  1P3G C;  4J8X A;  2CV5 C;  2NZD A;  1P34 A;  5GSU A;  3B0D C;  1ZLA A;  3AZF B;  3W98 D;  4R8P B;  5CPI D;  2DF4 C;  4KUD B;  5DNM D;  3UTB A;  5B0Z B;  5B33 A;  3UT9 A;  3AZN C;  2J8P A;  5DNN B;  2G5I C;  2CV5 B;  2G5H C;  1U35 A;  2NQB B;  2PYO C;  5F99 D;  4WU8 C;  2YFV A;  4E45 A;  5B40 C;  1P3P C;  2LY8 A;  4X23 D;  1P3A D;  2ZY2 A;  5AV5 C;  4H9Q B;  1TAF B;  5B2J D;  4R8P A;  4KUD A;  4WZS B;  3AV1 D;  5B0Z A;  5F99 B;  4H9P B;  1P3B B;  5DNN A;  4J8U B;  4Z2M H;  2CV5 A;  4LD9 C;  3WTP D;  2NQB A;  1KX5 D;  5AV5 B;  3MVD D;  3KUY B;  3FDD A;  1P3A B;  3AZH D;  4QLC D;  2FJ7 D;  2BYK B;  5B1L C;  2F8N D;  3AZL C;  4H9Q A;  1TAF A;  4ZUX C;  5B31 G;  1AOI D;  3WTP B;  1P3I D;  3REI C;  3O62 D;  1KX5 B;  1BH9 B;  1M18 B;  5F99 A;  3MVD B;  1P3O C;  4H9P A;  1P3B A;  5B1L B;  4J8U A;  3WKJ D;  3AZL B;  1Z2C B;  3H0M C;  5AV5 A;  4DRA A;  2HIO D;  3AYW C;  3KUY A;  3AZI C;  5B32 C;  3C1C B;  1P3A A;  3VH5 A;  1P3L D;  1P3O B;  2BYK A;  1AOI B;  2ARO C;  3P5J B;  3O62 B;  3AYW B;  3X1U B;  3AZI B;  5GT0 D;  1PZR A;  5B32 B;  3WKJ B;  1KX5 A;  1BH9 A;  1M18 A;  3B0C W;  3MVD A;  1P3M D;  4XUJ C;  5B1L A;  3AZL A;  5B1M B;  4DRB A;  5B0Y B;  3V9R B;  3B6F C;  3C1C A;  4M6B A;  5CPK D;  5C3I C;  3REL D;  2IO5 C;  4KGC C;  1P3O A;  1AOI A;  3LZ0 D;  4XUJ B;  2CWE A;  5JRG C;  4J8W B;  4DQY B;  3O62 A;  3X1T C;  3NQU B;  4XZQ D;  1P3M B;  3AYW A;  3X1U A;  3AZI A;  3B6F B;  5B32 A;  1EQZ C;  3WKJ A;  2F2A C;  4KGC B;  3LJA C;  3EPJ A;  1S32 D;  3W96 D;  1M19 C;  4CAY B;  5CPK B;  3KXB C;  5B1M A;  5B0Y A;  3REL B;  1A7W A;  3AZJ B;  3AZK C;  3V9R A;  3LZ0 B;  1EQZ B;  1P3K C;  4Z66 B;  3AV2 D;  5AY8 D;  4HGA C;  4XZQ B;  4XUJ A;  1M19 B;  4AWL B;  2NZD C;  4J8W A;  5B24 C;  1P34 C;  3A1K A;  5GSU C;  2ZM5 A;  3NQU A;  3AZK B;  1W2E A;  1S32 B;  1P3M A;  3W96 B;  3B6F A;  5AVC D;  3UTB C;  4KGC A;  3WA9 B;  3UT9 C;  4HGA B;  5B2I D;  1ID3 D;  4CAY A;  1WWI A;  3VH5 W;  5CPK A;  5JRG A;  1U35 C;  5B24 B;  3REL A;  3AZJ A;  1ULY A;  3B6G D;  5AY8 B;  5CPJ D;  3LZ0 A;  1EQZ A;  3B0B A;  3A6N D;  4Z66 A;  1TZY C;  3AN2 D;  4Z5T D;  4XZQ A;  1M19 A;  4NFT A;  1P3F D;  3AFA D;  3AZM C;  3AZF C;  3AZK A;  4R8P C;  1S32 A;  3W96 A;  3EPK A;  4KUD C;  1ID3 B;  3B6G B;  5B0Z C;  1TZY B;  3WA9 A;  3AZE D;  3W99 D;  3X1V C;  4J8V D;  2Y2G A;  3LEL D;  3MNN C;  2NQB C;  5B24 A;  3A6N B;  2JE5 A;  4NE5 A;  3AZM B;  3AN2 B;  4Z5T B;  3W97 C;  2XD5 A;  3AFA B;  3W98 C;  3X1V B;  1R4V A;  4NE3 A;  3MNN B;  5DNM C;  1B67 A;  3MGQ D;  3W97 B;  3REH D;  1ID3 A;  4J8V B;  3LEL B;  3KFU G;  1P3G D;  3B6G A;  1TZY A;  5F99 C;  3W98 B;  1P3B C;  5CPI B;  4J8U C;  3A6N A;  5DNM B;  3AZM A;  3AZF A;  4Z5T A;  4X23 C;  3AN2 A;  1H3O B;  3EPH A;  3KUY C;  5AV9 D;  1P3A C;  5B2J C;  3MGR D;  3X1V A;  5BO0 B;  1KX4 D;  4UUZ B;  4Z2M G;  3MNN A;  3AV1 C;  3MGP D;  3KWQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...