3RELC

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relC00
3X1TB 2PYOD 5E5AD 5B2IC 3RELA 1KX5C 3LZ1D 3X1UC 4KHAB 3LZ1B 1P3LA 5B1MD 3C1CA 1P34C 5CPID 3AFAA 4LD9A 3B0CW 1P3IA 1P3BD 1TZYD 1P3BB 1TZYB 5AV5B 5JA4B 5AV6A 4J8WD 4H9PB 3MVDD 4J8WB 1P3PD 3MVDB 1P3PB 3O62D 5AVBC 5CPKA 4H9OA 3O62B 3REID 2NQBC 1P3GA 3REHB 3R45B 1F1EA 4KGCB 4HGAB 4R8PD 5CHLB 4R8PB 5G49B 1M1AC 5AV9A 1BH9A 3X1SA 5GT0A 5GT3A 3W99D 3AN2D 3AZFA 2RVQD 5B24D 5B31C 5B24B 5B2IA 1KX5A 5GSUC 3KUYC 5BNVB 1P34A 2HUEB 2HIOA 5CP6C 3W97B 5DNMC 3AZIC 5CPJD 3LJAA 5FUGA 3VH6T 5CPJB 3WTPC 4WU9A 5B32D 5AVBA 5B32B 1M18D 1H3OB 1M18B 1U35A 5GXQB 2NQBA 1AOIA 2LY8A 3AZLC 2NZDA 3B6FC 4YS3C 3LZ0C 4CAYB 3AZJD 4J8UC 5C3IB 3AZJB 3REJD 1M1AA 5BT1C 1JFIB 5B33B 3MGQD 3MGQB 4H9QB 5BNXB 5GSUA 3B6GC 2F8NG 2YFVB 1S32A 3B0DB 3A6NC 3UTBC 5CP6A 3MGSC 2FJ7C 3AZIA 1HQ3C 1EQZD 1TAFB 1EQZB 1F66C 4Z5TB 3UTAD 3UTAB 3WTPA 1KX3D 3TU4B 1P3AD 4G92B 1KX3B 5AV8C 1P3AB 1ZLAA 1N1JA 3AZLA 3B6FA 1KX4A 3LZ0A 4J8UA 3AV2D 3AV2B 4AWLC 3AZED 3AZEB 1ULYA 3C1CD 1P3MD 4YM6A 3C1CB 1P3MB 4ZUXD 5AY8D 4ZUXB 5AVCC 2L5AA 4XUJD 5B2JA 5AY8B 3A6NA 3AFAB 3UTBA 3WA9D 3KWQC 2FJ7A 4H9SC 3WA9B 1HQ3A 1F66A 5DNNC 3KSYA 3RELC 4WNNB 5B1LD 5B0ZD 1M19D 3AZMC 3WKJD 1HTAA 5B1LB 3WKJB 1P3GB 4QLCD 4QLCB 1P3IC 3MNNA 1P3KA 2F8NA 3X1SB 4XZQC 3VH5A 4NE6A 5GT0B 4J8VC 5CPKC 3V9RB 5B2ID 3WAAD 5B2IB 3WAAB 1KX5B 3VH6W 3X1UD 3X1UB 4CSRA 5AVCA 2YFWA 4Z66D 3AZNC 5AV9C 1P3FC 3KWQA 4H9SA 3AZFC 3X1TD 5DNNA 5B40C 2BYKA 3MGRA 3AZMA 2JSSA 3AV1A 2HIOC 1A7WA 4EO5C 5AV5D 3LJAC 2IO5C 4XZQA 4WU9C 4J8VA 5B31D 4WZSB 3LELC 5B31B 3REHD 1U35C 4H9RB 1AOIC 4WU8A 3X1VD 4KGCD 2CV5C 3KUYD 2NZDC 3X1VB 3KUYB 3NQJB 4JJNC 5CP6B 5DNMD 1P3OC 3AZID 5DNMB 3AZNA 3AZIB 1P3FA 5B40A 3UT9C 5JRGC 1ID3A 5B0YD 4J8XD 5B0YB 5F99C 4X23C 4J8XB 1S32C 3W97D 4YS3D 5E5AC 2PYOC 4YS3B 3W96C 5B1MC 5CPIC 1P3BC 1TZYC 5GXQD 3LELA 1ZLAC 3B6GD 3B6GB 3MVDC 1P3PC 2CV5A 1KX4C 5KDMA 4E44A 3REIC 3AYWD 3MGSD 4JJNA 1P3OA 2AROD 3AYWB 3B0BA 3MGSB 2FJ7B 2AROB 2FJ7D 1HQ3B 5B33D 4R8PC 3AZKA 4KUDC 5BO0A 3MGPD 1B6WA 3UT9A 3MGPB 5JRGA 5B32G 3W98D 3C1BD 3W98B 5AV8D 5F99A 4X23A 3C1BB 3W99C 5AV8B 4YM6C 3AZGD 3AN2C 2RVQC 3AZGB 5B2JC 2PYOA 5E5AA 4KHAA 3W96A 4Z5TD 5B1MA 2HUEC 5CPIA 4NE3A 4AWLB 1P3BA 1KU5A 1TZYA 3TU4D 4H9PA 4J8WA 4NE5A 3MVDA 3REKC 1P3PA 3MNNC 1P3KC 3O62A 4G91C 1M18C 5AVCB 3REIA 3KWQD 3R45A 3KWQB 4H9NA 4R8PA 2BYMB 3AZJC 5G49A 3RELD 4KUDA 3REJC 3RELB 1P3LD 4WV4B 1P3LB 3AN2A 3W99A 3AFAD 4LD9D 1P3ID 5B24A 4LD9B 1P3IB 1WWIA 5AV6D 5BNVA 5AV6B 4XZQB 5CPKD 3MGRC 5CPKB 4H9OB 1P3GD 3AV1C 5CPJA 3UTAC 3REKA 1BH8A 5B32A 2CWEA 4G92C 1M18A 4UUZA 3KXBC 1P3AC 5AV9D 3X1SD 3AZNB 5AV9B 1BH9B 5GT0D 5GT3D 5GT3B 3AZFD 4CAYA 3AZFB 3AZJA 5B40B 1KX5D 3REJA 4WU8C 1P34D 3AZEC 2HIOD 1P34B 2HIOB 4DRBA 5BNXA 4EO5B 3LJAD 1P3MC 3LJAB 5FUGB 2IO5B 4WU9D 5AY8C 3AZHC 4WU9B 4XUJC 5AVBD 3WA9C 1ID3C 4ZBJC 5AVBB 3LELD 1U35D 1EQZA 2NQBD 3LELB 1U35B 2NQBB 1AOID 3UTAA 1AOIB 2NZDD 4NFTA 2CV5B 2NZDB 5B1LC 5B0ZC 1M19C 1M1AD 3KXBA 1P3AA 1M1AB 4QLCC 3VH5T 3UT9B 5GSUD 5GSUB 5F99B 1S32D 1S32B 3AZEA 5CP6D 3WAAC 2PYOB 5E5AB 3W96D 1Q9CA 3W96B 1P3MA 4M6BA 5B1MB 3AZKC 3WTPD 4ZUXA 3AZHA 5AY8A 5CPIB 3WTPB 4XUJA 3VH6A 4Z66C 3WA9A 5B31G 1ZLAD 1ZLAB 3X1TC 3AZLD 1N1JB 3B6FD 4WNNA 3AZLB 1KX4D 3B6FB 3LZ0D 1KX4B 4J8UD 3LZ0B 3LZ1C 5B1LA 5B0ZA 4J8UB 1M19A 3REIB 3WKJA 5BT1D 4H9NB 4QLCA 4KUDD 1B67A 4KUDB 2F8NK 5AV5C 4J8WC 4YM6D 3AN2B 4YM6B 3V9RA 3W99B 3O62C 3A6ND 5B2JD 3UTBD 3A6NB 5B2JB 3REHC 3UTBB 3WAAA 1HQ3D 3X1UA 3X1VC 4KGCC 1F66D 4HGAC 3NQUA 1F66B 1WWSA 3WTPE 4Z66A 3REKD 3X1TA 3REKB 5B24C 3MNND 1BH8B 3MNNB 1P3KD 1P3KB 5B0YC 4G91B 4J8XC 3LZ1A 2F8NB 4UUZB 2F8ND 3W97C 5AV5A 3REJB 5JA4A 5CPJC 4CSRB 5B32C 4E45A 5AVCD 5B31A 3B0CT 5GXQC 2YFWB 3REHA 4H9RA 3X1VA 4KGCA 3KUYA 3NQJA 5DNND 5C3IC 5DNNB 3AYWC 3MGRD 2BYKB 1BFMA 5DNMA 2AROC 3MGRB 3AZMD 3AZMB 3AV1D 5B33C 3AV1B 3VH5W 3MGQC 3MGPC 3W98C 5BS7C 5B0YA 3KXBD 3C1BC 4J8XA 3KXBB 4XZQD 3AZGC 3B0DC 4J8VD 3W97A 1R4VA 4J8VB 4YS3A 1EQZC 4Z5TC 4WU8D 4WU8B 2F8NH 3TU4C 1H3OA 1KX3C 5GXQA 3AZND 1P3FD 1P3FB 3B6GA 3AZHD 5B40D 3AZHB 4XUJB 3AYWA 1ID3D 3MGSA 2AROA 1ID3B 4ZBJB 4DRAA 3AV2C 1JFIA 4Z2MG 5B33A 3MGQA 3MGPA 4H9QA 1P3LC 3W98A 5B0ZB 5BS7A 3C1BA 1M19B 2YFVA 5AV8A 3C1CC 3AZGA 4ZUXC 3AFAC 4LD9C 1TAFA 5AV6C 4Z5TA 2CV5D 5KDMB 4JJND 3TU4A 1P3GC 1P3OD 1KX3A 4JJNB 1P3OB 3WKJC 3AZKD 3NQUB 3AZKB 3UT9D 4Z2MH 5BO0B 5JRGD 3X1SC 5JRGB 4Z66B 5F99D 5GT0C 5GT3C 4X23D 3AV2A 4X23B 2BYMA
chains in the Genus database with same CATH superfamily
3X1TB 2PYOD 5E5AD 5B2IC 3RELA 1KX5C 3LZ1D 3X1UC 4KHAB 3LZ1B 1P3LA 5B1MD 3C1CA 1P34C 5CPID 3AFAA 4LD9A 3B0CW 1P3IA 1P3BD 1TZYD 1P3BB 1TZYB 5AV5B 5JA4B 5AV6A 4J8WD 4H9PB 3MVDD 4J8WB 1P3PD 3MVDB 1P3PB 3EPHA 3O62D 5AVBC 5CPKA 4H9OA 3O62B 3REID 2NQBC 1P3GA 3REHB 3R45B 1F1EA 4KGCB 4HGAB 4R8PD 5CHLB 4R8PB 5G49B 1M1AC 5AV9A 1BH9A 3X1SA 5GT0A 5GT3A 3W99D 3AN2D 3AZFA 2RVQD 4WJ3C 5B24D 5B31C 5B24B 2JCHA 5B2IA 1KX5A 5GSUC 3KUYC 5BNVB 1P34A 2HUEB 2HIOA 5CP6C 3W97B 5DNMC 3AZIC 5CPJD 3LJAA 5FUGA 3VH6T 5CPJB 3WTPC 4WU9A 5B32D 5AVBA 5B32B 1M18D 1H3OB 1M18B 1U35A 5GXQB 2NQBA 3KFUG 1AOIA 2LY8A 3AZLC 2NZDA 3B6FC 4YS3C 3LZ0C 4CAYB 3AZJD 4J8UC 5C3IB 3AZJB 3REJD 3H0LC 1M1AA 5BT1C 1JFIB 5B33B 3MGQD 3MGQB 4H9QB 5BNXB 5GSUA 3B6GC 2F8NG 2YFVB 1S32A 3B0DB 3A6NC 3UTBC 5CP6A 3MGSC 2FJ7C 3AZIA 1HQ3C 1EQZD 1TAFB 1EQZB 1F66C 4Z5TB 3UTAD 3UTAB 3WTPA 2RIQA 1KX3D 3TU4B 1P3AD 2DF4C 4G92B 5AV8C 1KX3B 1P3AB 1ZLAA 3EPKA 1N1JA 3AZLA 3B6FA 1KX4A 3LZ0A 2F2AC 4J8UA 2Y2LA 3AV2D 3AV2B 4AWLC 3AZED 3AZEB 1ULYA 3C1CD 1P3MD 4YM6A 3C1CB 1P3MB 2G5IC 4ZUXD 5AY8D 4ZUXB 2L5AA 5AY8B 4XUJD 5B2JA 5AVCC 3A6NA 3AFAB 4DQYB 3UTBA 3KWQC 2FJ7A 4H9SC 3WA9B 3WA9D 1HQ3A 1F66A 5DNNC 3KSYA 3RELC 4WNNB 3EPLA 5B1LD 5B0ZD 1M19D 3AZMC 3WKJD 1HTAA 5B1LB 2Y2HA 1P3GB 3WKJB 4QLCD 4QLCB 1P3IC 3MNNA 1P3KA 2DQNC 2F8NA 3X1SB 4XZQC 3VH5A 4NE6A 5GT0B 4J8VC 2Y2KA 3V9RB 5CPKC 5B2ID 3WAAD 5B2IB 3WAAB 1KX5B 3VH6W 3X1UD 3X1UB 4CSRA 5AVCA 2YFWA 4Z66D 3AZNC 5AV9C 1P3FC 3KWQA 4H9SA 3AZFC 3X1TD 5DNNA 5B40C 2BYKA 3MGRA 3AZMA 2JSSA 3AV1A 2HIOC 1A7WA 4EO5C 5AV5D 3LJAC 2IO5C 4XZQA 4WU9C 4J8VA 5B31D 4WZSB 3LELC 5B31B 3REHD 1U35C 4H9RB 1AOIC 4WU8A 3X1VD 4KGCD 2CV5C 3KUYD 2NZDC 3X1VB 3KUYB 3NQJB 2XD5A 4JJNC 5CP6B 5DNMD 1P3OC 3AZID 5DNMB 3AZNA 3AZIB 1P3FA 5B40A 3UT9C 5JRGC 1ID3A 5B0YD 4J8XD 5B0YB 5F99C 4X23C 4J8XB 1S32C 3W97D 4YS3D 5E5AC 2PYOC 4YS3B 3P5JB 3W96C 2JE5A 5B1MC 5CPIC 1P3BC 2Y2IA 1TZYC 5GXQD 3LELA 1ZLAC 3B6GD 3B6GB 3MVDC 1P3PC 2CV5A 1PZRA 1KX4C 5KDMA 4E44A 3REIC 3AYWD 3MGSD 4JJNA 1P3OA 2AROD 3AYWB 3B0BA 3MGSB 2FJ7B 2AROB 2FJ7D 1HQ3B 5B33D 4R8PC 3AZKA 4KUDC 5BO0A 3MGPD 1B6WA 2XD1A 3UT9A 3MGPB 5JRGA 5B32G 3W98D 3C1BD 3W98B 5AV8D 5F99A 4X23A 3C1BB 3W99C 5AV8B 4YM6C 3AZGD 3AN2C 2RVQC 3AZGB 5B2JC 2PYOA 5E5AA 4KHAA 3W96A 1Z2CB 4Z5TD 5B1MA 2HUEC 5CPIA 4NE3A 4AWLB 1P3BA 1KU5A 1TZYA 3TU4D 2G5HC 4H9PA 4J8WA 4NE5A 3MVDA 3REKC 1P3PA 3MNNC 1P3KC 3O62A 4G91C 1M18C 5AVCB 3REIA 2W8SA 3KWQD 3R45A 3KWQB 4H9NA 4R8PA 2BYMB 3AZJC 5G49A 3RELD 4KUDA 3REJC 3RELB 1P3LD 3EPJA 4WV4B 2FFFB 1P3LB 2BG1A 3AN2A 3W99A 3F6TA 3AFAD 4LD9D 1P3ID 5B24A 4LD9B 1P3IB 1WWIA 5AV6D 5BNVA 5AV6B 4XZQB 3FDDA 3H0RC 5CPKD 3MGRC 5CPKB 4H9OB 1P3GD 3AV1C 5CPJA 3UTAC 3REKA 1BH8A 5B32A 2CWEA 4G92C 1M18A 4UUZA 3KXBC 1P3AC 5AV9D 3X1SD 3AZNB 5AV9B 1BH9B 5GT0D 5GT3D 2Y2OA 5GT3B 3AZFD 4CAYA 3AZFB 3EG5B 3AZJA 5B40B 1KX5D 3REJA 4WU8C 2J8PA 1P34D 3AZEC 2HIOD 1P34B 2HIOB 4DRBA 5BNXA 4EO5B 3LJAD 1P3MC 3LJAB 5FUGB 2IO5B 4WU9D 5AY8C 3AZHC 2ZY3A 4WU9B 4XUJC 5AVBD 3WA9C 1ID3C 4ZBJC 5AVBB 3LELD 1U35D 1EQZA 2NQBD 3LELB 1U35B 2NQBB 1AOID 3UTAA 1AOIB 2NZDD 4NFTA 2CV5B 2NZDB 5B1LC 5B0ZC 1M19C 1M1AD 3KXBA 1P3AA 1M1AB 4QLCC 2UWXA 3VH5T 3UT9B 5GSUD 5GSUB 5F99B 1S32D 1S32B 3AZEA 5CP6D 2Y2GA 3WAAC 2PYOB 5E5AB 2VQRA 3W96D 1Q9CA 3W96B 1P3MA 4M6BA 5B1MB 3AZKC 1T3UA 3WTPD 4ZUXA 3AZHA 5AY8A 5CPIB 3WTPB 4XUJA 3VH6A 4Z66C 3WA9A 5B31G 1ZLAD 1ZLAB 3X1TC 3AZLD 1N1JB 3B6FD 4WNNA 3AZLB 1KX4D 3B6FB 3LZ0D 1KX4B 4J8UD 3LZ0B 3LZ1C 5B1LA 5B0ZA 4J8UB 1M19A 3REIB 3WKJA 5BT1D 4H9NB 2Y2JA 4QLCA 4KUDD 1B67A 4KUDB 2F8NK 5AV5C 2ZY2A 4J8WC 4YM6D 3AN2B 4YM6B 3V9RA 3W99B 3O62C 3A6ND 2ZY5A 5B2JD 3UTBD 3A6NB 5B2JB 3REHC 3UTBB 3WAAA 1HQ3D 3X1UA 3X1VC 4KGCC 1F66D 4HGAC 3NQUA 1F66B 1WWSA 3WTPE 4Z66A 2ZM5A 3REKD 3X1TA 3REKB 5B24C 3MNND 1BH8B 3MNNB 1P3KD 2Y2NA 1P3KB 5B0YC 4G91B 4J8XC 3LZ1A 2F8NB 4UUZB 2F8ND 3A1IA 3W97C 5AV5A 3REJB 5JA4A 4UPKA 5CPJC 4CSRB 5B32C 4E45A 3A1KA 5AVCD 5B31A 3B0CT 5GXQC 2YFWB 3REHA 4H9RA 3X1VA 4KGCA 3KUYA 2Y2PA 3NQJA 5DNND 1W2EA 5C3IC 5DNNB 3AYWC 3MGRD 2BYKB 1BFMA 5DNMA 2AROC 3MGRB 3AZMD 3H0MC 3AZMB 3AV1D 5B33C 3AV1B 3VH5W 3MGQC 3MGPC 2ZY4A 3W98C 5BS7C 5B0YA 3KXBD 3C1BC 4J8XA 3KXBB 4XZQD 3AZGC 3B0DC 4J8VD 3W97A 1R4VA 4J8VB 4YS3A 1EQZC 4Z5TC 4WU8D 4WU8B 2F8NH 3TU4C 1H3OA 1KX3C 5GXQA 3AZND 1P3FD 1P3FB 3B6GA 3AZHD 2Y2QA 5B40D 3AZHB 4XUJB 3AYWA 1ID3D 3MGSA 2AROA 1ID3B 4ZBJB 4DRAA 3AV2C 1JFIA 4Z2MG 5B33A 3MGQA 3MGPA 4H9QA 1P3LC 3W98A 5B0ZB 5BS7A 3C1BA 2Y2MA 1M19B 2YFVA 5AV8A 3C1CC 3AZGA 3AL0C 4ZUXC 3AFAC 4LD9C 1TAFA 5AV6C 4Z5TA 2CV5D 5KDMB 4JJND 3TU4A 1P3GC 1P3OD 1KX3A 4JJNB 1P3OB 3WKJC 3AZKD 3NQUB 3AZKB 3UT9D 4Z2MH 5BO0B 3IP4C 5JRGD 3X1SC 5JRGB 4Z66B 5F99D 5GT0C 5GT3C 4X23D 3AV2A 4X23B 2BYMA
chains in the Genus database with same CATH topology
3X1TB 2PYOD 5E5AD 5B2IC 3RELA 1KX5C 3LZ1D 3X1UC 4KHAB 3LZ1B 1P3LA 5B1MD 3C1CA 1P34C 5CPID 3AFAA 4LD9A 3B0CW 1P3IA 1P3BD 1TZYD 1P3BB 1TZYB 5AV5B 5JA4B 5AV6A 4J8WD 4H9PB 3MVDD 4J8WB 1P3PD 3MVDB 1P3PB 3EPHA 3O62D 5AVBC 5CPKA 4H9OA 3O62B 3REID 2NQBC 1P3GA 3REHB 3R45B 1F1EA 4KGCB 4HGAB 4R8PD 5CHLB 4R8PB 5G49B 1M1AC 5AV9A 1BH9A 3X1SA 5GT0A 5GT3A 3W99D 3AN2D 3AZFA 2RVQD 4WJ3C 5B24D 5B31C 5B24B 2JCHA 5B2IA 1KX5A 5GSUC 3KUYC 5BNVB 1P34A 2HUEB 2HIOA 5CP6C 3W97B 5DNMC 3AZIC 5CPJD 3LJAA 5FUGA 3VH6T 5CPJB 3WTPC 4WU9A 5B32D 5AVBA 5B32B 1M18D 1H3OB 1M18B 1U35A 5GXQB 2NQBA 3KFUG 1AOIA 2LY8A 3AZLC 2NZDA 3B6FC 4YS3C 3LZ0C 4CAYB 3AZJD 4J8UC 5C3IB 3AZJB 3REJD 3H0LC 1M1AA 5BT1C 1JFIB 5B33B 3MGQD 3MGQB 4H9QB 5BNXB 5GSUA 3B6GC 2F8NG 2YFVB 1S32A 3B0DB 3A6NC 3UTBC 5CP6A 3MGSC 2FJ7C 3AZIA 1HQ3C 1EQZD 1TAFB 1EQZB 1F66C 4Z5TB 3UTAD 3UTAB 3WTPA 2RIQA 1KX3D 3TU4B 1P3AD 2DF4C 4G92B 5AV8C 1KX3B 1P3AB 1ZLAA 3EPKA 1N1JA 3AZLA 3B6FA 1KX4A 3LZ0A 2F2AC 4J8UA 2Y2LA 3AV2D 3AV2B 4AWLC 3AZED 3AZEB 1ULYA 3C1CD 1P3MD 4YM6A 3C1CB 1P3MB 2G5IC 4ZUXD 5AY8D 4ZUXB 2L5AA 5AY8B 4XUJD 5B2JA 5AVCC 3A6NA 3AFAB 4DQYB 3UTBA 3KWQC 2FJ7A 4H9SC 3WA9B 3WA9D 1HQ3A 1F66A 5DNNC 3KSYA 3RELC 4WNNB 3EPLA 5B1LD 5B0ZD 1M19D 3AZMC 3WKJD 1HTAA 5B1LB 2Y2HA 1P3GB 3WKJB 4QLCD 4QLCB 1P3IC 3MNNA 1P3KA 2DQNC 2F8NA 3X1SB 4XZQC 3VH5A 4NE6A 5GT0B 4J8VC 2Y2KA 3V9RB 5CPKC 5B2ID 3WAAD 5B2IB 3WAAB 1KX5B 3VH6W 3X1UD 3X1UB 4CSRA 5AVCA 2YFWA 4Z66D 3AZNC 5AV9C 1P3FC 3KWQA 4H9SA 3AZFC 3X1TD 5DNNA 5B40C 2BYKA 3MGRA 3AZMA 2JSSA 3AV1A 2HIOC 1A7WA 4EO5C 5AV5D 3LJAC 2IO5C 4XZQA 4WU9C 4J8VA 5B31D 4WZSB 3LELC 5B31B 3REHD 1U35C 4H9RB 1AOIC 4WU8A 3X1VD 4KGCD 2CV5C 3KUYD 2NZDC 3X1VB 3KUYB 3NQJB 2XD5A 4JJNC 5CP6B 5DNMD 1P3OC 3AZID 5DNMB 3AZNA 3AZIB 1P3FA 5B40A 3UT9C 5JRGC 1ID3A 5B0YD 4J8XD 5B0YB 5F99C 4X23C 4J8XB 1S32C 3W97D 4YS3D 5E5AC 2PYOC 4YS3B 3P5JB 3W96C 2JE5A 5B1MC 5CPIC 1P3BC 2Y2IA 1TZYC 5GXQD 3LELA 1ZLAC 3B6GD 3B6GB 3MVDC 1P3PC 2CV5A 1PZRA 1KX4C 5KDMA 4E44A 3REIC 3AYWD 3MGSD 4JJNA 1P3OA 2AROD 3AYWB 3B0BA 3MGSB 2FJ7B 2AROB 2FJ7D 1HQ3B 5B33D 4R8PC 3AZKA 4KUDC 5BO0A 3MGPD 1B6WA 2XD1A 3UT9A 3MGPB 5JRGA 5B32G 3W98D 3C1BD 3W98B 5AV8D 5F99A 4X23A 3C1BB 3W99C 5AV8B 4YM6C 3AZGD 3AN2C 2RVQC 3AZGB 5B2JC 2PYOA 5E5AA 4KHAA 3W96A 1Z2CB 4Z5TD 5B1MA 2HUEC 5CPIA 4NE3A 4AWLB 1P3BA 1KU5A 1TZYA 3TU4D 2G5HC 4H9PA 4J8WA 4NE5A 3MVDA 3REKC 1P3PA 3MNNC 1P3KC 3O62A 4G91C 1M18C 5AVCB 3REIA 2W8SA 3KWQD 3R45A 3KWQB 4H9NA 4R8PA 2BYMB 3AZJC 5G49A 3RELD 4KUDA 3REJC 3RELB 1P3LD 3EPJA 4WV4B 2FFFB 1P3LB 2BG1A 3AN2A 3W99A 3F6TA 3AFAD 4LD9D 1P3ID 5B24A 4LD9B 1P3IB 1WWIA 5AV6D 5BNVA 5AV6B 4XZQB 3FDDA 3H0RC 5CPKD 3MGRC 5CPKB 4H9OB 1P3GD 3AV1C 5CPJA 3UTAC 3REKA 1BH8A 5B32A 2CWEA 4G92C 1M18A 4UUZA 3KXBC 1P3AC 5AV9D 3X1SD 3AZNB 5AV9B 1BH9B 5GT0D 5GT3D 2Y2OA 5GT3B 3AZFD 4CAYA 3AZFB 3EG5B 3AZJA 5B40B 1KX5D 3REJA 4WU8C 2J8PA 1P34D 3AZEC 2HIOD 1P34B 2HIOB 4DRBA 5BNXA 4EO5B 3LJAD 1P3MC 3LJAB 5FUGB 2IO5B 4WU9D 5AY8C 3AZHC 2ZY3A 4WU9B 4XUJC 5AVBD 3WA9C 1ID3C 4ZBJC 5AVBB 3LELD 1U35D 1EQZA 2NQBD 3LELB 1U35B 2NQBB 1AOID 3UTAA 1AOIB 2NZDD 4NFTA 2CV5B 2NZDB 5B1LC 5B0ZC 1M19C 1M1AD 3KXBA 1P3AA 1M1AB 4QLCC 2UWXA 3VH5T 3UT9B 5GSUD 5GSUB 5F99B 1S32D 1S32B 3AZEA 5CP6D 2Y2GA 3WAAC 2PYOB 5E5AB 2VQRA 3W96D 1Q9CA 3W96B 1P3MA 4M6BA 5B1MB 3AZKC 1T3UA 3WTPD 4ZUXA 3AZHA 5AY8A 5CPIB 3WTPB 4XUJA 3VH6A 4Z66C 3WA9A 5B31G 1ZLAD 1ZLAB 3X1TC 3AZLD 1N1JB 3B6FD 4WNNA 3AZLB 1KX4D 3B6FB 3LZ0D 1KX4B 4J8UD 3LZ0B 3LZ1C 5B1LA 5B0ZA 4J8UB 1M19A 3REIB 3WKJA 5BT1D 4H9NB 2Y2JA 4QLCA 4KUDD 1B67A 4KUDB 2F8NK 5AV5C 2ZY2A 4J8WC 4YM6D 3AN2B 4YM6B 3V9RA 3W99B 3O62C 3A6ND 2ZY5A 5B2JD 3UTBD 3A6NB 5B2JB 3REHC 3UTBB 3WAAA 1HQ3D 3X1UA 3X1VC 4KGCC 1F66D 4HGAC 3NQUA 1F66B 1WWSA 3WTPE 4Z66A 2ZM5A 3REKD 3X1TA 3REKB 5B24C 3MNND 1BH8B 3MNNB 1P3KD 2Y2NA 1P3KB 5B0YC 4G91B 4J8XC 3LZ1A 2F8NB 4UUZB 2F8ND 3A1IA 3W97C 5AV5A 3REJB 5JA4A 4UPKA 5CPJC 4CSRB 5B32C 4E45A 3A1KA 5AVCD 5B31A 3B0CT 5GXQC 2YFWB 3REHA 4H9RA 3X1VA 4KGCA 3KUYA 2Y2PA 3NQJA 5DNND 1W2EA 5C3IC 5DNNB 3AYWC 3MGRD 2BYKB 1BFMA 5DNMA 2AROC 3MGRB 3AZMD 3H0MC 3AZMB 3AV1D 5B33C 3AV1B 3VH5W 3MGQC 3MGPC 2ZY4A 3W98C 5BS7C 5B0YA 3KXBD 3C1BC 4J8XA 3KXBB 4XZQD 3AZGC 3B0DC 4J8VD 3W97A 1R4VA 4J8VB 4YS3A 1EQZC 4Z5TC 4WU8D 4WU8B 2F8NH 3TU4C 1H3OA 1KX3C 5GXQA 3AZND 1P3FD 1P3FB 3B6GA 3AZHD 2Y2QA 5B40D 3AZHB 4XUJB 3AYWA 1ID3D 3MGSA 2AROA 1ID3B 4ZBJB 4DRAA 3AV2C 1JFIA 4Z2MG 5B33A 3MGQA 3MGPA 4H9QA 1P3LC 3W98A 5B0ZB 5BS7A 3C1BA 2Y2MA 1M19B 2YFVA 5AV8A 3C1CC 3AZGA 3AL0C 4ZUXC 3AFAC 4LD9C 1TAFA 5AV6C 4Z5TA 2CV5D 5KDMB 4JJND 3TU4A 1P3GC 1P3OD 1KX3A 4JJNB 1P3OB 3WKJC 3AZKD 3NQUB 3AZKB 3UT9D 4Z2MH 5BO0B 3IP4C 5JRGD 3X1SC 5JRGB 4Z66B 5F99D 5GT0C 5GT3C 4X23D 3AV2A 4X23B 2BYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T B;  2PYO D;  5E5A D;  5B2I C;  3REL A;  1KX5 C;  3LZ1 D;  3X1U C;  4KHA B;  3LZ1 B;  1P3L A;  5B1M D;  3C1C A;  1P34 C;  5CPI D;  3AFA A;  4LD9 A;  3B0C W;  1P3I A;  1P3B D;  1TZY D;  1P3B B;  1TZY B;  5AV5 B;  5JA4 B;  5AV6 A;  4J8W D;  4H9P B;  3MVD D;  4J8W B;  1P3P D;  3MVD B;  1P3P B;  3O62 D;  5AVB C;  5CPK A;  4H9O A;  3O62 B;  3REI D;  2NQB C;  1P3G A;  3REH B;  3R45 B;  1F1E A;  4KGC B;  4HGA B;  4R8P D;  5CHL B;  4R8P B;  5G49 B;  1M1A C;  5AV9 A;  1BH9 A;  3X1S A;  5GT0 A;  5GT3 A;  3W99 D;  3AN2 D;  3AZF A;  2RVQ D;  5B24 D;  5B31 C;  5B24 B;  5B2I A;  1KX5 A;  5GSU C;  3KUY C;  5BNV B;  1P34 A;  2HUE B;  2HIO A;  5CP6 C;  3W97 B;  5DNM C;  3AZI C;  5CPJ D;  3LJA A;  5FUG A;  3VH6 T;  5CPJ B;  3WTP C;  4WU9 A;  5B32 D;  5AVB A;  5B32 B;  1M18 D;  1H3O B;  1M18 B;  1U35 A;  5GXQ B;  2NQB A;  1AOI A;  2LY8 A;  3AZL C;  2NZD A;  3B6F C;  4YS3 C;  3LZ0 C;  4CAY B;  3AZJ D;  4J8U C;  5C3I B;  3AZJ B;  3REJ D;  1M1A A;  5BT1 C;  1JFI B;  5B33 B;  3MGQ D;  3MGQ B;  4H9Q B;  5BNX B;  5GSU A;  3B6G C;  2F8N G;  2YFV B;  1S32 A;  3B0D B;  3A6N C;  3UTB C;  5CP6 A;  3MGS C;  2FJ7 C;  3AZI A;  1HQ3 C;  1EQZ D;  1TAF B;  1EQZ B;  1F66 C;  4Z5T B;  3UTA D;  3UTA B;  3WTP A;  1KX3 D;  3TU4 B;  1P3A D;  4G92 B;  1KX3 B;  5AV8 C;  1P3A B;  1ZLA A;  1N1J A;  3AZL A;  3B6F A;  1KX4 A;  3LZ0 A;  4J8U A;  3AV2 D;  3AV2 B;  4AWL C;  3AZE D;  3AZE B;  1ULY A;  3C1C D;  1P3M D;  4YM6 A;  3C1C B;  1P3M B;  4ZUX D;  5AY8 D;  4ZUX B;  5AVC C;  2L5A A;  4XUJ D;  5B2J A;  5AY8 B;  3A6N A;  3AFA B;  3UTB A;  3WA9 D;  3KWQ C;  2FJ7 A;  4H9S C;  3WA9 B;  1HQ3 A;  1F66 A;  5DNN C;  3KSY A;  3REL C;  4WNN B;  5B1L D;  5B0Z D;  1M19 D;  3AZM C;  3WKJ D;  1HTA A;  5B1L B;  3WKJ B;  1P3G B;  4QLC D;  4QLC B;  1P3I C;  3MNN A;  1P3K A;  2F8N A;  3X1S B;  4XZQ C;  3VH5 A;  4NE6 A;  5GT0 B;  4J8V C;  5CPK C;  3V9R B;  5B2I D;  3WAA D;  5B2I B;  3WAA B;  1KX5 B;  3VH6 W;  3X1U D;  3X1U B;  4CSR A;  5AVC A;  2YFW A;  4Z66 D;  3AZN C;  5AV9 C;  1P3F C;  3KWQ A;  4H9S A;  3AZF C;  3X1T D;  5DNN A;  5B40 C;  2BYK A;  3MGR A;  3AZM A;  2JSS A;  3AV1 A;  2HIO C;  1A7W A;  4EO5 C;  5AV5 D;  3LJA C;  2IO5 C;  4XZQ A;  4WU9 C;  4J8V A;  5B31 D;  4WZS B;  3LEL C;  5B31 B;  3REH D;  1U35 C;  4H9R B;  1AOI C;  4WU8 A;  3X1V D;  4KGC D;  2CV5 C;  3KUY D;  2NZD C;  3X1V B;  3KUY B;  3NQJ B;  4JJN C;  5CP6 B;  5DNM D;  1P3O C;  3AZI D;  5DNM B;  3AZN A;  3AZI B;  1P3F A;  5B40 A;  3UT9 C;  5JRG C;  1ID3 A;  5B0Y D;  4J8X D;  5B0Y B;  5F99 C;  4X23 C;  4J8X B;  1S32 C;  3W97 D;  4YS3 D;  5E5A C;  2PYO C;  4YS3 B;  3W96 C;  5B1M C;  5CPI C;  1P3B C;  1TZY C;  5GXQ D;  3LEL A;  1ZLA C;  3B6G D;  3B6G B;  3MVD C;  1P3P C;  2CV5 A;  1KX4 C;  5KDM A;  4E44 A;  3REI C;  3AYW D;  3MGS D;  4JJN A;  1P3O A;  2ARO D;  3AYW B;  3B0B A;  3MGS B;  2FJ7 B;  2ARO B;  2FJ7 D;  1HQ3 B;  5B33 D;  4R8P C;  3AZK A;  4KUD C;  5BO0 A;  3MGP D;  1B6W A;  3UT9 A;  3MGP B;  5JRG A;  5B32 G;  3W98 D;  3C1B D;  3W98 B;  5AV8 D;  5F99 A;  4X23 A;  3C1B B;  3W99 C;  5AV8 B;  4YM6 C;  3AZG D;  3AN2 C;  2RVQ C;  3AZG B;  5B2J C;  2PYO A;  5E5A A;  4KHA A;  3W96 A;  4Z5T D;  5B1M A;  2HUE C;  5CPI A;  4NE3 A;  4AWL B;  1P3B A;  1KU5 A;  1TZY A;  3TU4 D;  4H9P A;  4J8W A;  4NE5 A;  3MVD A;  3REK C;  1P3P A;  3MNN C;  1P3K C;  3O62 A;  4G91 C;  1M18 C;  5AVC B;  3REI A;  3KWQ D;  3R45 A;  3KWQ B;  4H9N A;  4R8P A;  2BYM B;  3AZJ C;  5G49 A;  3REL D;  4KUD A;  3REJ C;  3REL B;  1P3L D;  4WV4 B;  1P3L B;  3AN2 A;  3W99 A;  3AFA D;  4LD9 D;  1P3I D;  5B24 A;  4LD9 B;  1P3I B;  1WWI A;  5AV6 D;  5BNV A;  5AV6 B;  4XZQ B;  5CPK D;  3MGR C;  5CPK B;  4H9O B;  1P3G D;  3AV1 C;  5CPJ A;  3UTA C;  3REK A;  1BH8 A;  5B32 A;  2CWE A;  4G92 C;  1M18 A;  4UUZ A;  3KXB C;  1P3A C;  5AV9 D;  3X1S D;  3AZN B;  5AV9 B;  1BH9 B;  5GT0 D;  5GT3 D;  5GT3 B;  3AZF D;  4CAY A;  3AZF B;  3AZJ A;  5B40 B;  1KX5 D;  3REJ A;  4WU8 C;  1P34 D;  3AZE C;  2HIO D;  1P34 B;  2HIO B;  4DRB A;  5BNX A;  4EO5 B;  3LJA D;  1P3M C;  3LJA B;  5FUG B;  2IO5 B;  4WU9 D;  5AY8 C;  3AZH C;  4WU9 B;  4XUJ C;  5AVB D;  3WA9 C;  1ID3 C;  4ZBJ C;  5AVB B;  3LEL D;  1U35 D;  1EQZ A;  2NQB D;  3LEL B;  1U35 B;  2NQB B;  1AOI D;  3UTA A;  1AOI B;  2NZD D;  4NFT A;  2CV5 B;  2NZD B;  5B1L C;  5B0Z C;  1M19 C;  1M1A D;  3KXB A;  1P3A A;  1M1A B;  4QLC C;  3VH5 T;  3UT9 B;  5GSU D;  5GSU B;  5F99 B;  1S32 D;  1S32 B;  3AZE A;  5CP6 D;  3WAA C;  2PYO B;  5E5A B;  3W96 D;  1Q9C A;  3W96 B;  1P3M A;  4M6B A;  5B1M B;  3AZK C;  3WTP D;  4ZUX A;  3AZH A;  5AY8 A;  5CPI B;  3WTP B;  4XUJ A;  3VH6 A;  4Z66 C;  3WA9 A;  5B31 G;  1ZLA D;  1ZLA B;  3X1T C;  3AZL D;  1N1J B;  3B6F D;  4WNN A;  3AZL B;  1KX4 D;  3B6F B;  3LZ0 D;  1KX4 B;  4J8U D;  3LZ0 B;  3LZ1 C;  5B1L A;  5B0Z A;  4J8U B;  1M19 A;  3REI B;  3WKJ A;  5BT1 D;  4H9N B;  4QLC A;  4KUD D;  1B67 A;  4KUD B;  2F8N K;  5AV5 C;  4J8W C;  4YM6 D;  3AN2 B;  4YM6 B;  3V9R A;  3W99 B;  3O62 C;  3A6N D;  5B2J D;  3UTB D;  3A6N B;  5B2J B;  3REH C;  3UTB B;  3WAA A;  1HQ3 D;  3X1U A;  3X1V C;  4KGC C;  1F66 D;  4HGA C;  3NQU A;  1F66 B;  1WWS A;  3WTP E;  4Z66 A;  3REK D;  3X1T A;  3REK B;  5B24 C;  3MNN D;  1BH8 B;  3MNN B;  1P3K D;  1P3K B;  5B0Y C;  4G91 B;  4J8X C;  3LZ1 A;  2F8N B;  4UUZ B;  2F8N D;  3W97 C;  5AV5 A;  3REJ B;  5JA4 A;  5CPJ C;  4CSR B;  5B32 C;  4E45 A;  5AVC D;  5B31 A;  3B0C T;  5GXQ C;  2YFW B;  3REH A;  4H9R A;  3X1V A;  4KGC A;  3KUY A;  3NQJ A;  5DNN D;  5C3I C;  5DNN B;  3AYW C;  3MGR D;  2BYK B;  1BFM A;  5DNM A;  2ARO C;  3MGR B;  3AZM D;  3AZM B;  3AV1 D;  5B33 C;  3AV1 B;  3VH5 W;  3MGQ C;  3MGP C;  3W98 C;  5BS7 C;  5B0Y A;  3KXB D;  3C1B C;  4J8X A;  3KXB B;  4XZQ D;  3AZG C;  3B0D C;  4J8V D;  3W97 A;  1R4V A;  4J8V B;  4YS3 A;  1EQZ C;  4Z5T C;  4WU8 D;  4WU8 B;  2F8N H;  3TU4 C;  1H3O A;  1KX3 C;  5GXQ A;  3AZN D;  1P3F D;  1P3F B;  3B6G A;  3AZH D;  5B40 D;  3AZH B;  4XUJ B;  3AYW A;  1ID3 D;  3MGS A;  2ARO A;  1ID3 B;  4ZBJ B;  4DRA A;  3AV2 C;  1JFI A;  4Z2M G;  5B33 A;  3MGQ A;  3MGP A;  4H9Q A;  1P3L C;  3W98 A;  5B0Z B;  5BS7 A;  3C1B A;  1M19 B;  2YFV A;  5AV8 A;  3C1C C;  3AZG A;  4ZUX C;  3AFA C;  4LD9 C;  1TAF A;  5AV6 C;  4Z5T A;  2CV5 D;  5KDM B;  4JJN D;  3TU4 A;  1P3G C;  1P3O D;  1KX3 A;  4JJN B;  1P3O B;  3WKJ C;  3AZK D;  3NQU B;  3AZK B;  3UT9 D;  4Z2M H;  5BO0 B;  5JRG D;  3X1S C;  5JRG B;  4Z66 B;  5F99 D;  5GT0 C;  5GT3 C;  4X23 D;  3AV2 A;  4X23 B;  2BYM A; 
#chains in the Genus database with same CATH topology
 3X1T B;  2PYO D;  5E5A D;  5B2I C;  3REL A;  1KX5 C;  3LZ1 D;  3X1U C;  4KHA B;  3LZ1 B;  1P3L A;  5B1M D;  3C1C A;  1P34 C;  5CPI D;  3AFA A;  4LD9 A;  3B0C W;  1P3I A;  1P3B D;  1TZY D;  1P3B B;  1TZY B;  5AV5 B;  5JA4 B;  5AV6 A;  4J8W D;  4H9P B;  3MVD D;  4J8W B;  1P3P D;  3MVD B;  1P3P B;  3EPH A;  3O62 D;  5AVB C;  5CPK A;  4H9O A;  3O62 B;  3REI D;  2NQB C;  1P3G A;  3REH B;  3R45 B;  1F1E A;  4KGC B;  4HGA B;  4R8P D;  5CHL B;  4R8P B;  5G49 B;  1M1A C;  5AV9 A;  1BH9 A;  3X1S A;  5GT0 A;  5GT3 A;  3W99 D;  3AN2 D;  3AZF A;  2RVQ D;  4WJ3 C;  5B24 D;  5B31 C;  5B24 B;  2JCH A;  5B2I A;  1KX5 A;  5GSU C;  3KUY C;  5BNV B;  1P34 A;  2HUE B;  2HIO A;  5CP6 C;  3W97 B;  5DNM C;  3AZI C;  5CPJ D;  3LJA A;  5FUG A;  3VH6 T;  5CPJ B;  3WTP C;  4WU9 A;  5B32 D;  5AVB A;  5B32 B;  1M18 D;  1H3O B;  1M18 B;  1U35 A;  5GXQ B;  2NQB A;  3KFU G;  1AOI A;  2LY8 A;  3AZL C;  2NZD A;  3B6F C;  4YS3 C;  3LZ0 C;  4CAY B;  3AZJ D;  4J8U C;  5C3I B;  3AZJ B;  3REJ D;  3H0L C;  1M1A A;  5BT1 C;  1JFI B;  5B33 B;  3MGQ D;  3MGQ B;  4H9Q B;  5BNX B;  5GSU A;  3B6G C;  2F8N G;  2YFV B;  1S32 A;  3B0D B;  3A6N C;  3UTB C;  5CP6 A;  3MGS C;  2FJ7 C;  3AZI A;  1HQ3 C;  1EQZ D;  1TAF B;  1EQZ B;  1F66 C;  4Z5T B;  3UTA D;  3UTA B;  3WTP A;  2RIQ A;  1KX3 D;  3TU4 B;  1P3A D;  2DF4 C;  4G92 B;  5AV8 C;  1KX3 B;  1P3A B;  1ZLA A;  3EPK A;  1N1J A;  3AZL A;  3B6F A;  1KX4 A;  3LZ0 A;  2F2A C;  4J8U A;  2Y2L A;  3AV2 D;  3AV2 B;  4AWL C;  3AZE D;  3AZE B;  1ULY A;  3C1C D;  1P3M D;  4YM6 A;  3C1C B;  1P3M B;  2G5I C;  4ZUX D;  5AY8 D;  4ZUX B;  2L5A A;  5AY8 B;  4XUJ D;  5B2J A;  5AVC C;  3A6N A;  3AFA B;  4DQY B;  3UTB A;  3KWQ C;  2FJ7 A;  4H9S C;  3WA9 B;  3WA9 D;  1HQ3 A;  1F66 A;  5DNN C;  3KSY A;  3REL C;  4WNN B;  3EPL A;  5B1L D;  5B0Z D;  1M19 D;  3AZM C;  3WKJ D;  1HTA A;  5B1L B;  2Y2H A;  1P3G B;  3WKJ B;  4QLC D;  4QLC B;  1P3I C;  3MNN A;  1P3K A;  2DQN C;  2F8N A;  3X1S B;  4XZQ C;  3VH5 A;  4NE6 A;  5GT0 B;  4J8V C;  2Y2K A;  3V9R B;  5CPK C;  5B2I D;  3WAA D;  5B2I B;  3WAA B;  1KX5 B;  3VH6 W;  3X1U D;  3X1U B;  4CSR A;  5AVC A;  2YFW A;  4Z66 D;  3AZN C;  5AV9 C;  1P3F C;  3KWQ A;  4H9S A;  3AZF C;  3X1T D;  5DNN A;  5B40 C;  2BYK A;  3MGR A;  3AZM A;  2JSS A;  3AV1 A;  2HIO C;  1A7W A;  4EO5 C;  5AV5 D;  3LJA C;  2IO5 C;  4XZQ A;  4WU9 C;  4J8V A;  5B31 D;  4WZS B;  3LEL C;  5B31 B;  3REH D;  1U35 C;  4H9R B;  1AOI C;  4WU8 A;  3X1V D;  4KGC D;  2CV5 C;  3KUY D;  2NZD C;  3X1V B;  3KUY B;  3NQJ B;  2XD5 A;  4JJN C;  5CP6 B;  5DNM D;  1P3O C;  3AZI D;  5DNM B;  3AZN A;  3AZI B;  1P3F A;  5B40 A;  3UT9 C;  5JRG C;  1ID3 A;  5B0Y D;  4J8X D;  5B0Y B;  5F99 C;  4X23 C;  4J8X B;  1S32 C;  3W97 D;  4YS3 D;  5E5A C;  2PYO C;  4YS3 B;  3P5J B;  3W96 C;  2JE5 A;  5B1M C;  5CPI C;  1P3B C;  2Y2I A;  1TZY C;  5GXQ D;  3LEL A;  1ZLA C;  3B6G D;  3B6G B;  3MVD C;  1P3P C;  2CV5 A;  1PZR A;  1KX4 C;  5KDM A;  4E44 A;  3REI C;  3AYW D;  3MGS D;  4JJN A;  1P3O A;  2ARO D;  3AYW B;  3B0B A;  3MGS B;  2FJ7 B;  2ARO B;  2FJ7 D;  1HQ3 B;  5B33 D;  4R8P C;  3AZK A;  4KUD C;  5BO0 A;  3MGP D;  1B6W A;  2XD1 A;  3UT9 A;  3MGP B;  5JRG A;  5B32 G;  3W98 D;  3C1B D;  3W98 B;  5AV8 D;  5F99 A;  4X23 A;  3C1B B;  3W99 C;  5AV8 B;  4YM6 C;  3AZG D;  3AN2 C;  2RVQ C;  3AZG B;  5B2J C;  2PYO A;  5E5A A;  4KHA A;  3W96 A;  1Z2C B;  4Z5T D;  5B1M A;  2HUE C;  5CPI A;  4NE3 A;  4AWL B;  1P3B A;  1KU5 A;  1TZY A;  3TU4 D;  2G5H C;  4H9P A;  4J8W A;  4NE5 A;  3MVD A;  3REK C;  1P3P A;  3MNN C;  1P3K C;  3O62 A;  4G91 C;  1M18 C;  5AVC B;  3REI A;  2W8S A;  3KWQ D;  3R45 A;  3KWQ B;  4H9N A;  4R8P A;  2BYM B;  3AZJ C;  5G49 A;  3REL D;  4KUD A;  3REJ C;  3REL B;  1P3L D;  3EPJ A;  4WV4 B;  2FFF B;  1P3L B;  2BG1 A;  3AN2 A;  3W99 A;  3F6T A;  3AFA D;  4LD9 D;  1P3I D;  5B24 A;  4LD9 B;  1P3I B;  1WWI A;  5AV6 D;  5BNV A;  5AV6 B;  4XZQ B;  3FDD A;  3H0R C;  5CPK D;  3MGR C;  5CPK B;  4H9O B;  1P3G D;  3AV1 C;  5CPJ A;  3UTA C;  3REK A;  1BH8 A;  5B32 A;  2CWE A;  4G92 C;  1M18 A;  4UUZ A;  3KXB C;  1P3A C;  5AV9 D;  3X1S D;  3AZN B;  5AV9 B;  1BH9 B;  5GT0 D;  5GT3 D;  2Y2O A;  5GT3 B;  3AZF D;  4CAY A;  3AZF B;  3EG5 B;  3AZJ A;  5B40 B;  1KX5 D;  3REJ A;  4WU8 C;  2J8P A;  1P34 D;  3AZE C;  2HIO D;  1P34 B;  2HIO B;  4DRB A;  5BNX A;  4EO5 B;  3LJA D;  1P3M C;  3LJA B;  5FUG B;  2IO5 B;  4WU9 D;  5AY8 C;  3AZH C;  2ZY3 A;  4WU9 B;  4XUJ C;  5AVB D;  3WA9 C;  1ID3 C;  4ZBJ C;  5AVB B;  3LEL D;  1U35 D;  1EQZ A;  2NQB D;  3LEL B;  1U35 B;  2NQB B;  1AOI D;  3UTA A;  1AOI B;  2NZD D;  4NFT A;  2CV5 B;  2NZD B;  5B1L C;  5B0Z C;  1M19 C;  1M1A D;  3KXB A;  1P3A A;  1M1A B;  4QLC C;  2UWX A;  3VH5 T;  3UT9 B;  5GSU D;  5GSU B;  5F99 B;  1S32 D;  1S32 B;  3AZE A;  5CP6 D;  2Y2G A;  3WAA C;  2PYO B;  5E5A B;  2VQR A;  3W96 D;  1Q9C A;  3W96 B;  1P3M A;  4M6B A;  5B1M B;  3AZK C;  1T3U A;  3WTP D;  4ZUX A;  3AZH A;  5AY8 A;  5CPI B;  3WTP B;  4XUJ A;  3VH6 A;  4Z66 C;  3WA9 A;  5B31 G;  1ZLA D;  1ZLA B;  3X1T C;  3AZL D;  1N1J B;  3B6F D;  4WNN A;  3AZL B;  1KX4 D;  3B6F B;  3LZ0 D;  1KX4 B;  4J8U D;  3LZ0 B;  3LZ1 C;  5B1L A;  5B0Z A;  4J8U B;  1M19 A;  3REI B;  3WKJ A;  5BT1 D;  4H9N B;  2Y2J A;  4QLC A;  4KUD D;  1B67 A;  4KUD B;  2F8N K;  5AV5 C;  2ZY2 A;  4J8W C;  4YM6 D;  3AN2 B;  4YM6 B;  3V9R A;  3W99 B;  3O62 C;  3A6N D;  2ZY5 A;  5B2J D;  3UTB D;  3A6N B;  5B2J B;  3REH C;  3UTB B;  3WAA A;  1HQ3 D;  3X1U A;  3X1V C;  4KGC C;  1F66 D;  4HGA C;  3NQU A;  1F66 B;  1WWS A;  3WTP E;  4Z66 A;  2ZM5 A;  3REK D;  3X1T A;  3REK B;  5B24 C;  3MNN D;  1BH8 B;  3MNN B;  1P3K D;  2Y2N A;  1P3K B;  5B0Y C;  4G91 B;  4J8X C;  3LZ1 A;  2F8N B;  4UUZ B;  2F8N D;  3A1I A;  3W97 C;  5AV5 A;  3REJ B;  5JA4 A;  4UPK A;  5CPJ C;  4CSR B;  5B32 C;  4E45 A;  3A1K A;  5AVC D;  5B31 A;  3B0C T;  5GXQ C;  2YFW B;  3REH A;  4H9R A;  3X1V A;  4KGC A;  3KUY A;  2Y2P A;  3NQJ A;  5DNN D;  1W2E A;  5C3I C;  5DNN B;  3AYW C;  3MGR D;  2BYK B;  1BFM A;  5DNM A;  2ARO C;  3MGR B;  3AZM D;  3H0M C;  3AZM B;  3AV1 D;  5B33 C;  3AV1 B;  3VH5 W;  3MGQ C;  3MGP C;  2ZY4 A;  3W98 C;  5BS7 C;  5B0Y A;  3KXB D;  3C1B C;  4J8X A;  3KXB B;  4XZQ D;  3AZG C;  3B0D C;  4J8V D;  3W97 A;  1R4V A;  4J8V B;  4YS3 A;  1EQZ C;  4Z5T C;  4WU8 D;  4WU8 B;  2F8N H;  3TU4 C;  1H3O A;  1KX3 C;  5GXQ A;  3AZN D;  1P3F D;  1P3F B;  3B6G A;  3AZH D;  2Y2Q A;  5B40 D;  3AZH B;  4XUJ B;  3AYW A;  1ID3 D;  3MGS A;  2ARO A;  1ID3 B;  4ZBJ B;  4DRA A;  3AV2 C;  1JFI A;  4Z2M G;  5B33 A;  3MGQ A;  3MGP A;  4H9Q A;  1P3L C;  3W98 A;  5B0Z B;  5BS7 A;  3C1B A;  2Y2M A;  1M19 B;  2YFV A;  5AV8 A;  3C1C C;  3AZG A;  3AL0 C;  4ZUX C;  3AFA C;  4LD9 C;  1TAF A;  5AV6 C;  4Z5T A;  2CV5 D;  5KDM B;  4JJN D;  3TU4 A;  1P3G C;  1P3O D;  1KX3 A;  4JJN B;  1P3O B;  3WKJ C;  3AZK D;  3NQU B;  3AZK B;  3UT9 D;  4Z2M H;  5BO0 B;  3IP4 C;  5JRG D;  3X1S C;  5JRG B;  4Z66 B;  5F99 D;  5GT0 C;  5GT3 C;  4X23 D;  3AV2 A;  4X23 B;  2BYM A; 
#chains in the Genus database with same CATH homology
 3X1T B;  2PYO D;  5E5A D;  5B2I C;  3REL A;  1KX5 C;  3LZ1 D;  3X1U C;  4KHA B;  3LZ1 B;  1P3L A;  5B1M D;  3C1C A;  1P34 C;  5CPI D;  3AFA A;  4LD9 A;  3B0C W;  1P3I A;  1P3B D;  1TZY D;  1P3B B;  1TZY B;  5AV5 B;  5JA4 B;  5AV6 A;  4J8W D;  4H9P B;  3MVD D;  4J8W B;  1P3P D;  3MVD B;  1P3P B;  3EPH A;  3O62 D;  5AVB C;  5CPK A;  4H9O A;  3O62 B;  3REI D;  2NQB C;  1P3G A;  3REH B;  3R45 B;  1F1E A;  4KGC B;  4HGA B;  4R8P D;  5CHL B;  4R8P B;  5G49 B;  1M1A C;  5AV9 A;  1BH9 A;  3X1S A;  5GT0 A;  5GT3 A;  3W99 D;  3AN2 D;  3AZF A;  2RVQ D;  4WJ3 C;  5B24 D;  5B31 C;  5B24 B;  2JCH A;  5B2I A;  1KX5 A;  5GSU C;  3KUY C;  5BNV B;  1P34 A;  2HUE B;  2HIO A;  5CP6 C;  3W97 B;  5DNM C;  3AZI C;  5CPJ D;  3LJA A;  5FUG A;  3VH6 T;  5CPJ B;  3WTP C;  4WU9 A;  5B32 D;  5AVB A;  5B32 B;  1M18 D;  1H3O B;  1M18 B;  1U35 A;  5GXQ B;  2NQB A;  3KFU G;  1AOI A;  2LY8 A;  3AZL C;  2NZD A;  3B6F C;  4YS3 C;  3LZ0 C;  4CAY B;  3AZJ D;  4J8U C;  5C3I B;  3AZJ B;  3REJ D;  3H0L C;  1M1A A;  5BT1 C;  1JFI B;  5B33 B;  3MGQ D;  3MGQ B;  4H9Q B;  5BNX B;  5GSU A;  3B6G C;  2F8N G;  2YFV B;  1S32 A;  3B0D B;  3A6N C;  3UTB C;  5CP6 A;  3MGS C;  2FJ7 C;  3AZI A;  1HQ3 C;  1EQZ D;  1TAF B;  1EQZ B;  1F66 C;  4Z5T B;  3UTA D;  3UTA B;  3WTP A;  2RIQ A;  1KX3 D;  3TU4 B;  1P3A D;  2DF4 C;  4G92 B;  5AV8 C;  1KX3 B;  1P3A B;  1ZLA A;  3EPK A;  1N1J A;  3AZL A;  3B6F A;  1KX4 A;  3LZ0 A;  2F2A C;  4J8U A;  2Y2L A;  3AV2 D;  3AV2 B;  4AWL C;  3AZE D;  3AZE B;  1ULY A;  3C1C D;  1P3M D;  4YM6 A;  3C1C B;  1P3M B;  2G5I C;  4ZUX D;  5AY8 D;  4ZUX B;  2L5A A;  5AY8 B;  4XUJ D;  5B2J A;  5AVC C;  3A6N A;  3AFA B;  4DQY B;  3UTB A;  3KWQ C;  2FJ7 A;  4H9S C;  3WA9 B;  3WA9 D;  1HQ3 A;  1F66 A;  5DNN C;  3KSY A;  3REL C;  4WNN B;  3EPL A;  5B1L D;  5B0Z D;  1M19 D;  3AZM C;  3WKJ D;  1HTA A;  5B1L B;  2Y2H A;  1P3G B;  3WKJ B;  4QLC D;  4QLC B;  1P3I C;  3MNN A;  1P3K A;  2DQN C;  2F8N A;  3X1S B;  4XZQ C;  3VH5 A;  4NE6 A;  5GT0 B;  4J8V C;  2Y2K A;  3V9R B;  5CPK C;  5B2I D;  3WAA D;  5B2I B;  3WAA B;  1KX5 B;  3VH6 W;  3X1U D;  3X1U B;  4CSR A;  5AVC A;  2YFW A;  4Z66 D;  3AZN C;  5AV9 C;  1P3F C;  3KWQ A;  4H9S A;  3AZF C;  3X1T D;  5DNN A;  5B40 C;  2BYK A;  3MGR A;  3AZM A;  2JSS A;  3AV1 A;  2HIO C;  1A7W A;  4EO5 C;  5AV5 D;  3LJA C;  2IO5 C;  4XZQ A;  4WU9 C;  4J8V A;  5B31 D;  4WZS B;  3LEL C;  5B31 B;  3REH D;  1U35 C;  4H9R B;  1AOI C;  4WU8 A;  3X1V D;  4KGC D;  2CV5 C;  3KUY D;  2NZD C;  3X1V B;  3KUY B;  3NQJ B;  2XD5 A;  4JJN C;  5CP6 B;  5DNM D;  1P3O C;  3AZI D;  5DNM B;  3AZN A;  3AZI B;  1P3F A;  5B40 A;  3UT9 C;  5JRG C;  1ID3 A;  5B0Y D;  4J8X D;  5B0Y B;  5F99 C;  4X23 C;  4J8X B;  1S32 C;  3W97 D;  4YS3 D;  5E5A C;  2PYO C;  4YS3 B;  3P5J B;  3W96 C;  2JE5 A;  5B1M C;  5CPI C;  1P3B C;  2Y2I A;  1TZY C;  5GXQ D;  3LEL A;  1ZLA C;  3B6G D;  3B6G B;  3MVD C;  1P3P C;  2CV5 A;  1PZR A;  1KX4 C;  5KDM A;  4E44 A;  3REI C;  3AYW D;  3MGS D;  4JJN A;  1P3O A;  2ARO D;  3AYW B;  3B0B A;  3MGS B;  2FJ7 B;  2ARO B;  2FJ7 D;  1HQ3 B;  5B33 D;  4R8P C;  3AZK A;  4KUD C;  5BO0 A;  3MGP D;  1B6W A;  2XD1 A;  3UT9 A;  3MGP B;  5JRG A;  5B32 G;  3W98 D;  3C1B D;  3W98 B;  5AV8 D;  5F99 A;  4X23 A;  3C1B B;  3W99 C;  5AV8 B;  4YM6 C;  3AZG D;  3AN2 C;  2RVQ C;  3AZG B;  5B2J C;  2PYO A;  5E5A A;  4KHA A;  3W96 A;  1Z2C B;  4Z5T D;  5B1M A;  2HUE C;  5CPI A;  4NE3 A;  4AWL B;  1P3B A;  1KU5 A;  1TZY A;  3TU4 D;  2G5H C;  4H9P A;  4J8W A;  4NE5 A;  3MVD A;  3REK C;  1P3P A;  3MNN C;  1P3K C;  3O62 A;  4G91 C;  1M18 C;  5AVC B;  3REI A;  2W8S A;  3KWQ D;  3R45 A;  3KWQ B;  4H9N A;  4R8P A;  2BYM B;  3AZJ C;  5G49 A;  3REL D;  4KUD A;  3REJ C;  3REL B;  1P3L D;  3EPJ A;  4WV4 B;  2FFF B;  1P3L B;  2BG1 A;  3AN2 A;  3W99 A;  3F6T A;  3AFA D;  4LD9 D;  1P3I D;  5B24 A;  4LD9 B;  1P3I B;  1WWI A;  5AV6 D;  5BNV A;  5AV6 B;  4XZQ B;  3FDD A;  3H0R C;  5CPK D;  3MGR C;  5CPK B;  4H9O B;  1P3G D;  3AV1 C;  5CPJ A;  3UTA C;  3REK A;  1BH8 A;  5B32 A;  2CWE A;  4G92 C;  1M18 A;  4UUZ A;  3KXB C;  1P3A C;  5AV9 D;  3X1S D;  3AZN B;  5AV9 B;  1BH9 B;  5GT0 D;  5GT3 D;  2Y2O A;  5GT3 B;  3AZF D;  4CAY A;  3AZF B;  3EG5 B;  3AZJ A;  5B40 B;  1KX5 D;  3REJ A;  4WU8 C;  2J8P A;  1P34 D;  3AZE C;  2HIO D;  1P34 B;  2HIO B;  4DRB A;  5BNX A;  4EO5 B;  3LJA D;  1P3M C;  3LJA B;  5FUG B;  2IO5 B;  4WU9 D;  5AY8 C;  3AZH C;  2ZY3 A;  4WU9 B;  4XUJ C;  5AVB D;  3WA9 C;  1ID3 C;  4ZBJ C;  5AVB B;  3LEL D;  1U35 D;  1EQZ A;  2NQB D;  3LEL B;  1U35 B;  2NQB B;  1AOI D;  3UTA A;  1AOI B;  2NZD D;  4NFT A;  2CV5 B;  2NZD B;  5B1L C;  5B0Z C;  1M19 C;  1M1A D;  3KXB A;  1P3A A;  1M1A B;  4QLC C;  2UWX A;  3VH5 T;  3UT9 B;  5GSU D;  5GSU B;  5F99 B;  1S32 D;  1S32 B;  3AZE A;  5CP6 D;  2Y2G A;  3WAA C;  2PYO B;  5E5A B;  2VQR A;  3W96 D;  1Q9C A;  3W96 B;  1P3M A;  4M6B A;  5B1M B;  3AZK C;  1T3U A;  3WTP D;  4ZUX A;  3AZH A;  5AY8 A;  5CPI B;  3WTP B;  4XUJ A;  3VH6 A;  4Z66 C;  3WA9 A;  5B31 G;  1ZLA D;  1ZLA B;  3X1T C;  3AZL D;  1N1J B;  3B6F D;  4WNN A;  3AZL B;  1KX4 D;  3B6F B;  3LZ0 D;  1KX4 B;  4J8U D;  3LZ0 B;  3LZ1 C;  5B1L A;  5B0Z A;  4J8U B;  1M19 A;  3REI B;  3WKJ A;  5BT1 D;  4H9N B;  2Y2J A;  4QLC A;  4KUD D;  1B67 A;  4KUD B;  2F8N K;  5AV5 C;  2ZY2 A;  4J8W C;  4YM6 D;  3AN2 B;  4YM6 B;  3V9R A;  3W99 B;  3O62 C;  3A6N D;  2ZY5 A;  5B2J D;  3UTB D;  3A6N B;  5B2J B;  3REH C;  3UTB B;  3WAA A;  1HQ3 D;  3X1U A;  3X1V C;  4KGC C;  1F66 D;  4HGA C;  3NQU A;  1F66 B;  1WWS A;  3WTP E;  4Z66 A;  2ZM5 A;  3REK D;  3X1T A;  3REK B;  5B24 C;  3MNN D;  1BH8 B;  3MNN B;  1P3K D;  2Y2N A;  1P3K B;  5B0Y C;  4G91 B;  4J8X C;  3LZ1 A;  2F8N B;  4UUZ B;  2F8N D;  3A1I A;  3W97 C;  5AV5 A;  3REJ B;  5JA4 A;  4UPK A;  5CPJ C;  4CSR B;  5B32 C;  4E45 A;  3A1K A;  5AVC D;  5B31 A;  3B0C T;  5GXQ C;  2YFW B;  3REH A;  4H9R A;  3X1V A;  4KGC A;  3KUY A;  2Y2P A;  3NQJ A;  5DNN D;  1W2E A;  5C3I C;  5DNN B;  3AYW C;  3MGR D;  2BYK B;  1BFM A;  5DNM A;  2ARO C;  3MGR B;  3AZM D;  3H0M C;  3AZM B;  3AV1 D;  5B33 C;  3AV1 B;  3VH5 W;  3MGQ C;  3MGP C;  2ZY4 A;  3W98 C;  5BS7 C;  5B0Y A;  3KXB D;  3C1B C;  4J8X A;  3KXB B;  4XZQ D;  3AZG C;  3B0D C;  4J8V D;  3W97 A;  1R4V A;  4J8V B;  4YS3 A;  1EQZ C;  4Z5T C;  4WU8 D;  4WU8 B;  2F8N H;  3TU4 C;  1H3O A;  1KX3 C;  5GXQ A;  3AZN D;  1P3F D;  1P3F B;  3B6G A;  3AZH D;  2Y2Q A;  5B40 D;  3AZH B;  4XUJ B;  3AYW A;  1ID3 D;  3MGS A;  2ARO A;  1ID3 B;  4ZBJ B;  4DRA A;  3AV2 C;  1JFI A;  4Z2M G;  5B33 A;  3MGQ A;  3MGP A;  4H9Q A;  1P3L C;  3W98 A;  5B0Z B;  5BS7 A;  3C1B A;  2Y2M A;  1M19 B;  2YFV A;  5AV8 A;  3C1C C;  3AZG A;  3AL0 C;  4ZUX C;  3AFA C;  4LD9 C;  1TAF A;  5AV6 C;  4Z5T A;  2CV5 D;  5KDM B;  4JJN D;  3TU4 A;  1P3G C;  1P3O D;  1KX3 A;  4JJN B;  1P3O B;  3WKJ C;  3AZK D;  3NQU B;  3AZK B;  3UT9 D;  4Z2M H;  5BO0 B;  3IP4 C;  5JRG D;  3X1S C;  5JRG B;  4Z66 B;  5F99 D;  5GT0 C;  5GT3 C;  4X23 D;  3AV2 A;  4X23 B;  2BYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...