3RELC

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
b'TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relC00
1P3PA 1P3FD 4J8UC 1KX4D 1KX3B 1B6WA 5B33A 1P3AA 5B0ZA 2HUEB 1F66D 5GT3B 3AZGA 3NQJA 3W96B 2IO5B 3WTPD 5AV9B 3KUYB 4NFTA 3KWQD 3AZHB 1P3LB 1P3OB 1N1JA 5B31C 3LZ1A 3REHA 5F99B 3UTAC 1S32D 3LZ0B 3REJA 1P3BA 1P3MD 4ZUXB 4J8VD 5JA4B 3A6NC 4Z2MG 1P34C 1P3IC 2F8NG 1P3FA 4KGCC 1M1AC 4J8XC 1H3OA 5B40D 5B0YD 3REIA 2RVQC 4XZQB 3X1UA 3REKB 5B1LC 3AZKD 5CPJA 1F66A 1BH9B 4X23D 3WTPA 1ZLAC 4R8PC 3W99B 5CP6C 4ZBJB 4H9QA 1EQZD 2F8NK 4H9NB 5G49A 2BYKB 4UUZA 3MNNB 1P3PC 2HIOB 3X1VB 2YFWB 5AVCB 3UT9A 1P3MA 5B33C 1P3AC 3O62D 3RELB 3C1BB 3W96C 1ID3B 5B40A 2IO5C 5B0YA 3KUYC 1M18D 3AZGC 5CHLB 3AZEB 2PYOB 3AZHC 4WU8A 4YS3B 1P3LC 1P3OC 4Z5TD 4JJND 5CPID 1P3BC 5BS7A 2L5AA 4WU9B 1EQZA 5GT0D 4HGAB 2BYMA 3UTBD 3KXBD 5BO0A 3REIC 1M19B 3WAAA 5B2IB 3REKC 4J8UD 3O62A 5GXQB 5CPJC 1KX5B 5KDMA 4E44A 4ZBJC 1HQ3B 5AVBC 4KHAA 3MNNC 2F8NB 5B2JC 5CPIA 2HIOC 3WKJC 4NE3A 3MGRB 3AZNC 1AOIA 4QLCB 4DRAA 5B31D 5GT0A 3UT9C 3AZLC 1P3GC 3UTAD 3UTBA 5DNNB 3C1BC 3KXBA 5E5AA 5CPKA 1JFIB 3A6ND 5JRGB 1P34D 1P3ID 4J8UA 4WU8C 4KGCD 1M1AD 4J8XD 3MGQB 3AZFB 2RVQD 3AZMC 3AZJB 5C3IC 4XUJC 5GSUB 4Z2MH 4H9OA 5B1LD 2F8NH 3AZIC 4HGAC 3C1CA 1ZLAD 2AROC 4R8PD 1U35B 5CP6D 1R4VA 3B0DC 1KU5A 5B2IC 1BH8A 3WAAC 5GXQC 1P3PD 4J8WB 3WA9B 2YFVB 5B33D 3A6NA 1P34A 1P3IA 1P3AD 4KGCA 1M1AA 4J8XA 3W96D 5BT1C 3KUYD 3B6FB 3AZGD 5AV8B 3AZHD 1P3LD 5AY8B 3MVDB 1P3OD 4QLCC 5B1LA 1AOIC 5AV5B 1ZLAA 4R8PA 5CP6A 3AN2B 1P3BD 5E5AC 5CPKC 3X1TB 3MGQC 1KX3A 3AZFC 3REID 4YM6C 4E45A 2NZDB 3REKD 1A7WA 3X1UD 3MGSB 5GT3A 3W96A 5CPJD 3KUYA 3C1CC 1U35C 3AZHA 1P3LA 1P3OA 5FUGB 5AVBD 4AWLC 3MNND 3LZ0A 5B2JD 2HIOD 3WKJD 1P3KB 4J8WC 3AZND 2LY8A 3LELB 1TZYB 5JA4A 4DRBA 3AZLD 3UT9D 3MGPB 1P3GD 3C1BD 3B6FC 4XZQA 3B6GC 1Q9CA 3REKA 4WU8D 5DNMB 1BH9A 5B0ZB 3AZMD 4XUJD 4H9NA 5AVBA 3AZID 2BYKA 4H9SC 1N1JB 2AROD 3MNNA 5B2JA 2HIOA 3WKJA 2YFWA 3AZNA 3R45A 1KX3C 3REJB 3AZLA 1P3GA 5B2ID 2NZDC 3LJAB 3WAAD 3MGSC 5GXQD 3RELA 3C1BA 1ID3A 2HUEC 1P3FB 5GT3C 1KX4B 5AV9C 4LD9B 5BT1D 3AZMA 2F8ND 5F99C 3LZ0C 4XUJA 4QLCD 3KWQB 4WU9A 3AZIA 5B32G 4ZUXC 1AOID 4H9PB 4EO5B 2AROA 5G49B 1S32B 5E5AD 1M19A 5CPKD 4XZQC 5B2IA 1P3MB 4J8VB 5GXQA 2JSSA 3B0CT 3MGQD 3AZFD 4YM6D 5B0YB 3W99C 1HQ3A 5B31G 3AZKB 2F8NA 3C1CD 1U35D 3MGRA 4X23B 2CV5B 4QLCA 3X1VC 4G92B 3NQUA 5AV6B 5AVCC 3LJAC 1EQZB 3AV1B 5DNNA 3AYWB 4J8WD 3RELC 1JFIA 1ID3C 4LD9C 3AZEC 4NE6A 2PYOC 4YS3C 3MGQA 3AZFA 3B6FD 4YM6A 3AZJA 3B6GD 3X1SB 4WNNB 1M18B 4CSRB 5GSUA 2FJ7B 4WU9C 1U35A 4Z5TB 4JJNB 3AFAB 5CPIB 3AV2B 1TAFB 1M19C 4J8WA 4G91B 3UTBB 1KX3D 1KX5C 2YFVA 2NZDD 4CAYA 3MGSD 3TU4B 1HQ3C 5B1MB 5B32B 1F1EA 5GT3D 4J8UB 3B6FA 5AV9D 4H9RB 5AV8A 3B6GA 3W98B 5AY8A 2CV5C 3MGRC 5AV6C 5AV5A 3AV1C 3AYWC 5F99D 3LZ0D 3AN2A 5DNNC 4ZUXD 3V9RB 4H9SA 4KUDB 5JRGC 5B31B 3UTAB 3X1SC 3VH5T 5BNVB 4XZQD 3AZJC 2NZDA 2FJ7C 3MGSA 4WV4B 5GSUC 1P3IB 4Z66B 4KGCB 5AV9A 3W99D 3W97B 5BNXB 5FUGA 3AFAC 3AV2C 5F99A 5B24B 4G91C 1WWIA 1TZYA 3LELA 4R8PB 3X1VD 5CP6B 5AVCD 3WA9C 4ZUXA 3LJAD 3TU4C 5B1MC 5B32C 3RELD 1ID3D 2NQBB 1P3PB 3W98C 4LD9D 4M6BA 3AZED 2PYOD 5AV8C 4YS3D 5AY8C 3MVDC 5DNMA 5B33B 1P3AB 5AV5C 3VH5A 3W99A 3AZGB 3NQJB 3AN2C 4WU9D 4KUDC 4NE5A 3X1TC 3LZ1B 3REHB 3X1VA 5AVCA 1M19D 1P3BB 3LJAA 4Z66C 1KX4A 4LD9A 1KX5D 3AZEA 2PYOA 1H3OB 3REIB 3W97C 4YS3A 1HQ3D 3X1UB 5B24C 5CPJB 2CV5D 1F66B 3MGRD 1P3KC 3KWQA 3WTPB 5AV6D 3LELC 1TZYC 4H9PA 3AV1D 4H9QB 5AVBB 3MGPC 3AYWD 5DNND 1S32A 4UUZB 5B2JB 2NQBC 3WKJB 3AZNB 3R45B 4J8VA 5JRGD 3AZLB 3UT9B 1P3GB 5DNMC 5B0ZC 3X1SD 1KX5A 3AZJD 5B40B 2FJ7D 2CWEA 5GSUD 4WU8B 3AZKA 3B0BA 3WTPE 4X23A 3AZMB 3LZ1C 3AFAD 3REHC 2CV5A 3AV2D 5C3IB 5AV6A 4XUJB 3REJC 3AV1A 3AZIB 3AYWA 2AROB 1P3FC 2BYMB 3WA9D 1KX4C 3B0CW 5BO0B 3B0DB 3TU4D 5JRGA 5B1MD 5B32D 3WAAB 3X1UC 3W98D 3O62B 3X1SA 4WNNA 1M18A 1F66C 4CSRA 5AV8D 5AY8D 3WTPC 3MVDD 2FJ7A 3KWQC 5KDMB 4EO5C 5AV5D 4Z5TA 4JJNA 4KHAB 3AFAA 3AN2D 3AV2A 1S32C 1TAFA 4KUDD 3NQUB 1P3MC 4J8VC 1AOIB 3X1TD 5GT0B 3WA9A 3KXBB 5E5AB 5B40C 5B0YC 3VH6T 3TU4A 5CPKB 5B1MA 5B32A 4Z66D 4H9RA 3W98A 3AZKC 3W97D 4YM6B 1WWSA 4X23C 3MVDA 4G92C 1BFMA 5BS7C 1EQZC 4H9OB 1HTAA 5B24D 1P3KD 3C1CB 3LELD 1TZYD 3V9RA 4KUDA 3MGPD 4AWLB 5B31A 3UTAA 3X1TA 3VH6W 2NQBD 1BH8B 3O62C 5BNVA 1M18C 4CAYB 5DNMD 4Z66A 4WZSB 3A6NB 1P34B 5B0ZD 1M1AB 3W97A 5BNXA 4J8XB 1B67A 4Z5TC 3VH6A 4JJNC 3B6GB 5CPIC 5B1LB 5B24A 5GT0C 3LZ1D 3REHD 1P3KA 3UTBC 1ZLAB 1ULYA 3KXBC 3REJD 3MGPA 3KSYA 3VH5W 2NQBA
chains in the Genus database with same CATH superfamily
1P3PA 1P3FD 4J8UC 1KX4D 1KX3B 1B6WA 5B33A 1P3AA 2Y2QA 5B0ZA 2HUEB 1F66D 5GT3B 3AZGA 3NQJA 3W96B 2IO5B 3WTPD 5AV9B 3KUYB 4NFTA 3KWQD 3AZHB 1P3LB 1P3OB 1N1JA 5B31C 3LZ1A 3REHA 5F99B 3UTAC 1S32D 3LZ0B 2BG1A 3REJA 1P3BA 1P3MD 4ZUXB 4J8VD 5JA4B 3A6NC 4Z2MG 1P34C 1P3IC 2F8NG 1P3FA 4KGCC 1M1AC 4J8XC 1H3OA 5B40D 5B0YD 3REIA 2RVQC 4XZQB 3X1UA 3REKB 5B1LC 3AZKD 5CPJA 1F66A 1BH9B 4X23D 3WTPA 1ZLAC 4R8PC 3W99B 5CP6C 4ZBJB 4H9QA 1EQZD 2F8NK 4H9NB 5G49A 2BYKB 4UUZA 1W2EA 3MNNB 1P3PC 2HIOB 3X1VB 2YFWB 5AVCB 3UT9A 1P3MA 5B33C 1P3AC 3O62D 3RELB 3C1BB 3W96C 1ID3B 5B40A 2IO5C 5B0YA 3KUYC 1M18D 3AZGC 2ZY3A 5CHLB 3AZEB 2PYOB 3AZHC 2F2AC 4WU8A 4YS3B 1P3LC 1P3OC 2Y2HA 4Z5TD 4JJND 5CPID 1P3BC 5BS7A 2L5AA 4WU9B 1EQZA 5GT0D 4HGAB 2BYMA 3UTBD 3KXBD 5BO0A 3REIC 1M19B 3WAAA 5B2IB 3REKC 4J8UD 3O62A 5GXQB 5CPJC 1KX5B 5KDMA 4E44A 4ZBJC 1HQ3B 5AVBC 4KHAA 2XD5A 3MNNC 2F8NB 5B2JC 5CPIA 2HIOC 3WKJC 4NE3A 3MGRB 3AZNC 3AL0C 3IP4C 4QLCB 1AOIA 4DRAA 5B31D 5GT0A 3UT9C 3AZLC 1P3GC 3UTAD 3UTBA 5DNNB 3C1BC 3KXBA 5E5AA 5CPKA 1JFIB 3EG5B 3A6ND 5JRGB 1P34D 1P3ID 4J8UA 4WU8C 4KGCD 1M1AD 2G5HC 4J8XD 3MGQB 3AZFB 2RVQD 3AZMC 3AZJB 5C3IC 4XUJC 1T3UA 5GSUB 4Z2MH 4H9OA 5B1LD 2F8NH 3AZIC 4HGAC 3C1CA 1ZLAD 2AROC 4R8PD 2ZM5A 1U35B 5CP6D 1R4VA 3B0DC 1KU5A 5B2IC 1BH8A 3WAAC 3EPLA 5GXQC 1P3PD 4J8WB 3WA9B 3A1IA 3FDDA 2YFVB 5B33D 3A6NA 1P34A 1P3IA 1P3AD 4KGCA 1M1AA 4J8XA 3W96D 5BT1C 3KUYD 3H0RC 3AZGD 3B6FB 5AV8B 3AZHD 1P3LD 5AY8B 3MVDB 3EPKA 1P3OD 4QLCC 3P5JB 4DQYB 5B1LA 1AOIC 5AV5B 1ZLAA 4R8PA 5CP6A 3AN2B 1P3BD 5E5AC 5CPKC 3X1TB 3MGQC 1KX3A 3AZFC 3REID 4YM6C 4E45A 2NZDB 3REKD 1A7WA 3X1UD 3MGSB 5GT3A 3W96A 5CPJD 3KUYA 3C1CC 1U35C 3AZHA 1P3LA 4UPKA 1P3OA 5FUGB 5AVBD 4AWLC 3MNND 3LZ0A 5B2JD 2HIOD 3WKJD 1P3KB 4J8WC 3AZND 2LY8A 3LELB 1TZYB 5JA4A 4DRBA 3AZLD 3UT9D 3MGPB 1P3GD 2Y2MA 3C1BD 3B6FC 4XZQA 3B6GC 1Q9CA 3REKA 4WU8D 5DNMB 1BH9A 5B0ZB 3AZMD 4XUJD 4H9NA 5AVBA 3AZID 2BYKA 2JCHA 4H9SC 1N1JB 2AROD 2Y2LA 3MNNA 5B2JA 2HIOA 3WKJA 2YFWA 3AZNA 3R45A 1KX3C 3REJB 3AZLA 1P3GA 5B2ID 2NZDC 3LJAB 3WAAD 3MGSC 5GXQD 3RELA 3C1BA 1ID3A 2HUEC 2G5IC 3H0LC 1P3FB 5GT3C 1KX4B 5AV9C 4LD9B 5BT1D 2Y2OA 3AZMA 2F8ND 5F99C 3LZ0C 4XUJA 4QLCD 3KWQB 4WU9A 3AZIA 5B32G 4ZUXC 1AOID 3H0MC 4H9PB 4EO5B 2AROA 5G49B 1S32B 5E5AD 1M19A 5CPKD 3EPHA 4XZQC 5B2IA 1P3MB 4J8VB 5GXQA 2JSSA 3B0CT 1PZRA 3MGQD 3AZFD 4YM6D 5B0YB 3W99C 1HQ3A 5B31G 3KFUG 3AZKB 2F8NA 3C1CD 1U35D 3MGRA 4X23B 2CV5B 4QLCA 3X1VC 4G92B 2Y2IA 3NQUA 5AV6B 5AVCC 3LJAC 1EQZB 3AV1B 5DNNA 3AYWB 4J8WD 3RELC 2DQNC 1ID3C 1JFIA 4LD9C 3AZEC 4NE6A 2PYOC 4YS3C 3MGQA 2Y2PA 3AZFA 3B6FD 4YM6A 3AZJA 3B6GD 3X1SB 4WNNB 1M18B 4CSRB 5GSUA 2FJ7B 4WU9C 2RIQA 1U35A 4Z5TB 4JJNB 3AFAB 2VQRA 5CPIB 3AV2B 1TAFB 1M19C 4J8WA 4G91B 3A1KA 3UTBB 1KX3D 1KX5C 2YFVA 2NZDD 4CAYA 3MGSD 3TU4B 4WJ3C 1HQ3C 5B1MB 5B32B 1F1EA 5GT3D 4J8UB 3B6FA 5AV9D 4H9RB 2ZY4A 5AV8A 3B6GA 3W98B 5AY8A 2CV5C 3MGRC 5AV6C 5AV5A 3AV1C 3AYWC 5F99D 3LZ0D 3AN2A 5DNNC 4ZUXD 3V9RB 4H9SA 4KUDB 5JRGC 5B31B 3UTAB 3X1SC 3VH5T 5BNVB 4XZQD 3AZJC 2NZDA 2FJ7C 3MGSA 4WV4B 5GSUC 1P3IB 4Z66B 4KGCB 5AV9A 3W99D 3W97B 5BNXB 5FUGA 3AFAC 3AV2C 1Z2CB 5F99A 5B24B 4G91C 1WWIA 1TZYA 3LELA 4R8PB 3X1VD 5CP6B 5AVCD 3WA9C 4ZUXA 3LJAD 3TU4C 5B1MC 5B32C 3RELD 1ID3D 2NQBB 1P3PB 3W98C 4LD9D 4M6BA 3AZED 2PYOD 5AV8C 4YS3D 5AY8C 3MVDC 5DNMA 5B33B 1P3AB 3F6TA 5AV5C 3VH5A 3W99A 3AZGB 3NQJB 3AN2C 4WU9D 4KUDC 4NE5A 3X1TC 2Y2KA 3LZ1B 3REHB 2Y2JA 3X1VA 5AVCA 1M19D 1P3BB 3LJAA 4Z66C 1KX4A 2UWXA 4LD9A 1KX5D 3AZEA 2PYOA 1H3OB 3REIB 3W97C 4YS3A 1HQ3D 3X1UB 5B24C 5CPJB 2CV5D 1F66B 3MGRD 1P3KC 2FFFB 3KWQA 3WTPB 5AV6D 3LELC 1TZYC 4H9PA 3AV1D 4H9QB 5AVBB 3MGPC 3AYWD 5DNND 1S32A 4UUZB 5B2JB 2NQBC 3WKJB 3AZNB 3R45B 4J8VA 5JRGD 3AZLB 3UT9B 1P3GB 5DNMC 5B0ZC 3X1SD 1KX5A 3AZJD 5B40B 2FJ7D 2CWEA 5GSUD 2ZY2A 2XD1A 4WU8B 3AZKA 3B0BA 3WTPE 4X23A 3AZMB 3LZ1C 3AFAD 3REHC 2CV5A 3AV2D 5C3IB 5AV6A 4XUJB 3REJC 3AV1A 3AZIB 3AYWA 2AROB 1P3FC 2BYMB 3WA9D 1KX4C 3B0CW 5BO0B 3B0DB 3TU4D 5JRGA 5B1MD 5B32D 2W8SA 3WAAB 3X1UC 3W98D 2Y2NA 3O62B 3X1SA 4WNNA 1M18A 1F66C 4CSRA 5AV8D 5AY8D 3WTPC 3MVDD 2FJ7A 3KWQC 5KDMB 4EO5C 2ZY5A 5AV5D 2DF4C 4Z5TA 4JJNA 4KHAB 3AFAA 3AN2D 3AV2A 1S32C 1TAFA 4KUDD 3NQUB 1P3MC 4J8VC 1AOIB 3X1TD 5GT0B 2J8PA 3WA9A 3KXBB 5E5AB 5B40C 5B0YC 3VH6T 3TU4A 5CPKB 5B1MA 5B32A 4Z66D 4H9RA 3W98A 3AZKC 2JE5A 3W97D 4YM6B 3EPJA 1WWSA 4X23C 3MVDA 4G92C 1BFMA 5BS7C 1EQZC 4H9OB 1HTAA 5B24D 1P3KD 3C1CB 3LELD 1TZYD 3V9RA 4KUDA 3MGPD 4AWLB 5B31A 3UTAA 3X1TA 3VH6W 2NQBD 1BH8B 3O62C 5BNVA 1M18C 4CAYB 5DNMD 4Z66A 4WZSB 3A6NB 1P34B 5B0ZD 1M1AB 3W97A 5BNXA 4J8XB 1B67A 4Z5TC 3VH6A 4JJNC 3B6GB 5CPIC 2Y2GA 5B1LB 5B24A 5GT0C 3LZ1D 3REHD 1P3KA 3UTBC 1ZLAB 1ULYA 3KXBC 3REJD 3MGPA 3KSYA 3VH5W 2NQBA
chains in the Genus database with same CATH topology
1P3PA 1P3FD 4J8UC 1KX4D 1KX3B 1B6WA 5B33A 1P3AA 2Y2QA 5B0ZA 2HUEB 1F66D 5GT3B 3AZGA 3NQJA 3W96B 2IO5B 3WTPD 5AV9B 3KUYB 4NFTA 3KWQD 3AZHB 1P3LB 1P3OB 1N1JA 5B31C 3LZ1A 3REHA 5F99B 3UTAC 1S32D 3LZ0B 2BG1A 3REJA 1P3BA 1P3MD 4ZUXB 4J8VD 5JA4B 3A6NC 4Z2MG 1P34C 1P3IC 2F8NG 1P3FA 4KGCC 1M1AC 4J8XC 1H3OA 5B40D 5B0YD 3REIA 2RVQC 4XZQB 3X1UA 3REKB 5B1LC 3AZKD 5CPJA 1F66A 1BH9B 4X23D 3WTPA 1ZLAC 4R8PC 3W99B 5CP6C 4ZBJB 4H9QA 1EQZD 2F8NK 4H9NB 5G49A 2BYKB 4UUZA 1W2EA 3MNNB 1P3PC 2HIOB 3X1VB 2YFWB 5AVCB 3UT9A 1P3MA 5B33C 1P3AC 3O62D 3RELB 3C1BB 3W96C 1ID3B 5B40A 2IO5C 5B0YA 3KUYC 1M18D 3AZGC 2ZY3A 5CHLB 3AZEB 2PYOB 3AZHC 2F2AC 4WU8A 4YS3B 1P3LC 1P3OC 2Y2HA 4Z5TD 4JJND 5CPID 1P3BC 5BS7A 2L5AA 4WU9B 1EQZA 5GT0D 4HGAB 2BYMA 3UTBD 3KXBD 5BO0A 3REIC 1M19B 3WAAA 5B2IB 3REKC 4J8UD 3O62A 5GXQB 5CPJC 1KX5B 5KDMA 4E44A 4ZBJC 1HQ3B 5AVBC 4KHAA 2XD5A 3MNNC 2F8NB 5B2JC 5CPIA 2HIOC 3WKJC 4NE3A 3MGRB 3AZNC 3AL0C 3IP4C 4QLCB 1AOIA 4DRAA 5B31D 5GT0A 3UT9C 3AZLC 1P3GC 3UTAD 3UTBA 5DNNB 3C1BC 3KXBA 5E5AA 5CPKA 1JFIB 3EG5B 3A6ND 5JRGB 1P34D 1P3ID 4J8UA 4WU8C 4KGCD 1M1AD 2G5HC 4J8XD 3MGQB 3AZFB 2RVQD 3AZMC 3AZJB 5C3IC 4XUJC 1T3UA 5GSUB 4Z2MH 4H9OA 5B1LD 2F8NH 3AZIC 4HGAC 3C1CA 1ZLAD 2AROC 4R8PD 2ZM5A 1U35B 5CP6D 1R4VA 3B0DC 1KU5A 5B2IC 1BH8A 3WAAC 3EPLA 5GXQC 1P3PD 4J8WB 3WA9B 3A1IA 3FDDA 2YFVB 5B33D 3A6NA 1P34A 1P3IA 1P3AD 4KGCA 1M1AA 4J8XA 3W96D 5BT1C 3KUYD 3H0RC 3AZGD 3B6FB 5AV8B 3AZHD 1P3LD 5AY8B 3MVDB 3EPKA 1P3OD 4QLCC 3P5JB 4DQYB 5B1LA 1AOIC 5AV5B 1ZLAA 4R8PA 5CP6A 3AN2B 1P3BD 5E5AC 5CPKC 3X1TB 3MGQC 1KX3A 3AZFC 3REID 4YM6C 4E45A 2NZDB 3REKD 1A7WA 3X1UD 3MGSB 5GT3A 3W96A 5CPJD 3KUYA 3C1CC 1U35C 3AZHA 1P3LA 4UPKA 1P3OA 5FUGB 5AVBD 4AWLC 3MNND 3LZ0A 5B2JD 2HIOD 3WKJD 1P3KB 4J8WC 3AZND 2LY8A 3LELB 1TZYB 5JA4A 4DRBA 3AZLD 3UT9D 3MGPB 1P3GD 2Y2MA 3C1BD 3B6FC 4XZQA 3B6GC 1Q9CA 3REKA 4WU8D 5DNMB 1BH9A 5B0ZB 3AZMD 4XUJD 4H9NA 5AVBA 3AZID 2BYKA 2JCHA 4H9SC 1N1JB 2AROD 2Y2LA 3MNNA 5B2JA 2HIOA 3WKJA 2YFWA 3AZNA 3R45A 1KX3C 3REJB 3AZLA 1P3GA 5B2ID 2NZDC 3LJAB 3WAAD 3MGSC 5GXQD 3RELA 3C1BA 1ID3A 2HUEC 2G5IC 3H0LC 1P3FB 5GT3C 1KX4B 5AV9C 4LD9B 5BT1D 2Y2OA 3AZMA 2F8ND 5F99C 3LZ0C 4XUJA 4QLCD 3KWQB 4WU9A 3AZIA 5B32G 4ZUXC 1AOID 3H0MC 4H9PB 4EO5B 2AROA 5G49B 1S32B 5E5AD 1M19A 5CPKD 3EPHA 4XZQC 5B2IA 1P3MB 4J8VB 5GXQA 2JSSA 3B0CT 1PZRA 3MGQD 3AZFD 4YM6D 5B0YB 3W99C 1HQ3A 5B31G 3KFUG 3AZKB 2F8NA 3C1CD 1U35D 3MGRA 4X23B 2CV5B 4QLCA 3X1VC 4G92B 2Y2IA 3NQUA 5AV6B 5AVCC 3LJAC 1EQZB 3AV1B 5DNNA 3AYWB 4J8WD 3RELC 2DQNC 1ID3C 1JFIA 4LD9C 3AZEC 4NE6A 2PYOC 4YS3C 3MGQA 2Y2PA 3AZFA 3B6FD 4YM6A 3AZJA 3B6GD 3X1SB 4WNNB 1M18B 4CSRB 5GSUA 2FJ7B 4WU9C 2RIQA 1U35A 4Z5TB 4JJNB 3AFAB 2VQRA 5CPIB 3AV2B 1TAFB 1M19C 4J8WA 4G91B 3A1KA 3UTBB 1KX3D 1KX5C 2YFVA 2NZDD 4CAYA 3MGSD 3TU4B 4WJ3C 1HQ3C 5B1MB 5B32B 1F1EA 5GT3D 4J8UB 3B6FA 5AV9D 4H9RB 2ZY4A 5AV8A 3B6GA 3W98B 5AY8A 2CV5C 3MGRC 5AV6C 5AV5A 3AV1C 3AYWC 5F99D 3LZ0D 3AN2A 5DNNC 4ZUXD 3V9RB 4H9SA 4KUDB 5JRGC 5B31B 3UTAB 3X1SC 3VH5T 5BNVB 4XZQD 3AZJC 2NZDA 2FJ7C 3MGSA 4WV4B 5GSUC 1P3IB 4Z66B 4KGCB 5AV9A 3W99D 3W97B 5BNXB 5FUGA 3AFAC 3AV2C 1Z2CB 5F99A 5B24B 4G91C 1WWIA 1TZYA 3LELA 4R8PB 3X1VD 5CP6B 5AVCD 3WA9C 4ZUXA 3LJAD 3TU4C 5B1MC 5B32C 3RELD 1ID3D 2NQBB 1P3PB 3W98C 4LD9D 4M6BA 3AZED 2PYOD 5AV8C 4YS3D 5AY8C 3MVDC 5DNMA 5B33B 1P3AB 3F6TA 5AV5C 3VH5A 3W99A 3AZGB 3NQJB 3AN2C 4WU9D 4KUDC 4NE5A 3X1TC 2Y2KA 3LZ1B 3REHB 2Y2JA 3X1VA 5AVCA 1M19D 1P3BB 3LJAA 4Z66C 1KX4A 2UWXA 4LD9A 1KX5D 3AZEA 2PYOA 1H3OB 3REIB 3W97C 4YS3A 1HQ3D 3X1UB 5B24C 5CPJB 2CV5D 1F66B 3MGRD 1P3KC 2FFFB 3KWQA 3WTPB 5AV6D 3LELC 1TZYC 4H9PA 3AV1D 4H9QB 5AVBB 3MGPC 3AYWD 5DNND 1S32A 4UUZB 5B2JB 2NQBC 3WKJB 3AZNB 3R45B 4J8VA 5JRGD 3AZLB 3UT9B 1P3GB 5DNMC 5B0ZC 3X1SD 1KX5A 3AZJD 5B40B 2FJ7D 2CWEA 5GSUD 2ZY2A 2XD1A 4WU8B 3AZKA 3B0BA 3WTPE 4X23A 3AZMB 3LZ1C 3AFAD 3REHC 2CV5A 3AV2D 5C3IB 5AV6A 4XUJB 3REJC 3AV1A 3AZIB 3AYWA 2AROB 1P3FC 2BYMB 3WA9D 1KX4C 3B0CW 5BO0B 3B0DB 3TU4D 5JRGA 5B1MD 5B32D 2W8SA 3WAAB 3X1UC 3W98D 2Y2NA 3O62B 3X1SA 4WNNA 1M18A 1F66C 4CSRA 5AV8D 5AY8D 3WTPC 3MVDD 2FJ7A 3KWQC 5KDMB 4EO5C 2ZY5A 5AV5D 2DF4C 4Z5TA 4JJNA 4KHAB 3AFAA 3AN2D 3AV2A 1S32C 1TAFA 4KUDD 3NQUB 1P3MC 4J8VC 1AOIB 3X1TD 5GT0B 2J8PA 3WA9A 3KXBB 5E5AB 5B40C 5B0YC 3VH6T 3TU4A 5CPKB 5B1MA 5B32A 4Z66D 4H9RA 3W98A 3AZKC 2JE5A 3W97D 4YM6B 3EPJA 1WWSA 4X23C 3MVDA 4G92C 1BFMA 5BS7C 1EQZC 4H9OB 1HTAA 5B24D 1P3KD 3C1CB 3LELD 1TZYD 3V9RA 4KUDA 3MGPD 4AWLB 5B31A 3UTAA 3X1TA 3VH6W 2NQBD 1BH8B 3O62C 5BNVA 1M18C 4CAYB 5DNMD 4Z66A 4WZSB 3A6NB 1P34B 5B0ZD 1M1AB 3W97A 5BNXA 4J8XB 1B67A 4Z5TC 3VH6A 4JJNC 3B6GB 5CPIC 2Y2GA 5B1LB 5B24A 5GT0C 3LZ1D 3REHD 1P3KA 3UTBC 1ZLAB 1ULYA 3KXBC 3REJD 3MGPA 3KSYA 3VH5W 2NQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P A;  1P3F D;  4J8U C;  1KX4 D;  1KX3 B;  1B6W A;  5B33 A;  1P3A A;  5B0Z A;  2HUE B;  1F66 D;  5GT3 B;  3AZG A;  3NQJ A;  3W96 B;  2IO5 B;  3WTP D;  5AV9 B;  3KUY B;  4NFT A;  3KWQ D;  3AZH B;  1P3L B;  1P3O B;  1N1J A;  5B31 C;  3LZ1 A;  3REH A;  5F99 B;  3UTA C;  1S32 D;  3LZ0 B;  3REJ A;  1P3B A;  1P3M D;  4ZUX B;  4J8V D;  5JA4 B;  3A6N C;  4Z2M G;  1P34 C;  1P3I C;  2F8N G;  1P3F A;  4KGC C;  1M1A C;  4J8X C;  1H3O A;  5B40 D;  5B0Y D;  3REI A;  2RVQ C;  4XZQ B;  3X1U A;  3REK B;  5B1L C;  3AZK D;  5CPJ A;  1F66 A;  1BH9 B;  4X23 D;  3WTP A;  1ZLA C;  4R8P C;  3W99 B;  5CP6 C;  4ZBJ B;  4H9Q A;  1EQZ D;  2F8N K;  4H9N B;  5G49 A;  2BYK B;  4UUZ A;  3MNN B;  1P3P C;  2HIO B;  3X1V B;  2YFW B;  5AVC B;  3UT9 A;  1P3M A;  5B33 C;  1P3A C;  3O62 D;  3REL B;  3C1B B;  3W96 C;  1ID3 B;  5B40 A;  2IO5 C;  5B0Y A;  3KUY C;  1M18 D;  3AZG C;  5CHL B;  3AZE B;  2PYO B;  3AZH C;  4WU8 A;  4YS3 B;  1P3L C;  1P3O C;  4Z5T D;  4JJN D;  5CPI D;  1P3B C;  5BS7 A;  2L5A A;  4WU9 B;  1EQZ A;  5GT0 D;  4HGA B;  2BYM A;  3UTB D;  3KXB D;  5BO0 A;  3REI C;  1M19 B;  3WAA A;  5B2I B;  3REK C;  4J8U D;  3O62 A;  5GXQ B;  5CPJ C;  1KX5 B;  5KDM A;  4E44 A;  4ZBJ C;  1HQ3 B;  5AVB C;  4KHA A;  3MNN C;  2F8N B;  5B2J C;  5CPI A;  2HIO C;  3WKJ C;  4NE3 A;  3MGR B;  3AZN C;  1AOI A;  4QLC B;  4DRA A;  5B31 D;  5GT0 A;  3UT9 C;  3AZL C;  1P3G C;  3UTA D;  3UTB A;  5DNN B;  3C1B C;  3KXB A;  5E5A A;  5CPK A;  1JFI B;  3A6N D;  5JRG B;  1P34 D;  1P3I D;  4J8U A;  4WU8 C;  4KGC D;  1M1A D;  4J8X D;  3MGQ B;  3AZF B;  2RVQ D;  3AZM C;  3AZJ B;  5C3I C;  4XUJ C;  5GSU B;  4Z2M H;  4H9O A;  5B1L D;  2F8N H;  3AZI C;  4HGA C;  3C1C A;  1ZLA D;  2ARO C;  4R8P D;  1U35 B;  5CP6 D;  1R4V A;  3B0D C;  1KU5 A;  5B2I C;  1BH8 A;  3WAA C;  5GXQ C;  1P3P D;  4J8W B;  3WA9 B;  2YFV B;  5B33 D;  3A6N A;  1P34 A;  1P3I A;  1P3A D;  4KGC A;  1M1A A;  4J8X A;  3W96 D;  5BT1 C;  3KUY D;  3B6F B;  3AZG D;  5AV8 B;  3AZH D;  1P3L D;  5AY8 B;  3MVD B;  1P3O D;  4QLC C;  5B1L A;  1AOI C;  5AV5 B;  1ZLA A;  4R8P A;  5CP6 A;  3AN2 B;  1P3B D;  5E5A C;  5CPK C;  3X1T B;  3MGQ C;  1KX3 A;  3AZF C;  3REI D;  4YM6 C;  4E45 A;  2NZD B;  3REK D;  1A7W A;  3X1U D;  3MGS B;  5GT3 A;  3W96 A;  5CPJ D;  3KUY A;  3C1C C;  1U35 C;  3AZH A;  1P3L A;  1P3O A;  5FUG B;  5AVB D;  4AWL C;  3MNN D;  3LZ0 A;  5B2J D;  2HIO D;  3WKJ D;  1P3K B;  4J8W C;  3AZN D;  2LY8 A;  3LEL B;  1TZY B;  5JA4 A;  4DRB A;  3AZL D;  3UT9 D;  3MGP B;  1P3G D;  3C1B D;  3B6F C;  4XZQ A;  3B6G C;  1Q9C A;  3REK A;  4WU8 D;  5DNM B;  1BH9 A;  5B0Z B;  3AZM D;  4XUJ D;  4H9N A;  5AVB A;  3AZI D;  2BYK A;  4H9S C;  1N1J B;  2ARO D;  3MNN A;  5B2J A;  2HIO A;  3WKJ A;  2YFW A;  3AZN A;  3R45 A;  1KX3 C;  3REJ B;  3AZL A;  1P3G A;  5B2I D;  2NZD C;  3LJA B;  3WAA D;  3MGS C;  5GXQ D;  3REL A;  3C1B A;  1ID3 A;  2HUE C;  1P3F B;  5GT3 C;  1KX4 B;  5AV9 C;  4LD9 B;  5BT1 D;  3AZM A;  2F8N D;  5F99 C;  3LZ0 C;  4XUJ A;  4QLC D;  3KWQ B;  4WU9 A;  3AZI A;  5B32 G;  4ZUX C;  1AOI D;  4H9P B;  4EO5 B;  2ARO A;  5G49 B;  1S32 B;  5E5A D;  1M19 A;  5CPK D;  4XZQ C;  5B2I A;  1P3M B;  4J8V B;  5GXQ A;  2JSS A;  3B0C T;  3MGQ D;  3AZF D;  4YM6 D;  5B0Y B;  3W99 C;  1HQ3 A;  5B31 G;  3AZK B;  2F8N A;  3C1C D;  1U35 D;  3MGR A;  4X23 B;  2CV5 B;  4QLC A;  3X1V C;  4G92 B;  3NQU A;  5AV6 B;  5AVC C;  3LJA C;  1EQZ B;  3AV1 B;  5DNN A;  3AYW B;  4J8W D;  3REL C;  1JFI A;  1ID3 C;  4LD9 C;  3AZE C;  4NE6 A;  2PYO C;  4YS3 C;  3MGQ A;  3AZF A;  3B6F D;  4YM6 A;  3AZJ A;  3B6G D;  3X1S B;  4WNN B;  1M18 B;  4CSR B;  5GSU A;  2FJ7 B;  4WU9 C;  1U35 A;  4Z5T B;  4JJN B;  3AFA B;  5CPI B;  3AV2 B;  1TAF B;  1M19 C;  4J8W A;  4G91 B;  3UTB B;  1KX3 D;  1KX5 C;  2YFV A;  2NZD D;  4CAY A;  3MGS D;  3TU4 B;  1HQ3 C;  5B1M B;  5B32 B;  1F1E A;  5GT3 D;  4J8U B;  3B6F A;  5AV9 D;  4H9R B;  5AV8 A;  3B6G A;  3W98 B;  5AY8 A;  2CV5 C;  3MGR C;  5AV6 C;  5AV5 A;  3AV1 C;  3AYW C;  5F99 D;  3LZ0 D;  3AN2 A;  5DNN C;  4ZUX D;  3V9R B;  4H9S A;  4KUD B;  5JRG C;  5B31 B;  3UTA B;  3X1S C;  3VH5 T;  5BNV B;  4XZQ D;  3AZJ C;  2NZD A;  2FJ7 C;  3MGS A;  4WV4 B;  5GSU C;  1P3I B;  4Z66 B;  4KGC B;  5AV9 A;  3W99 D;  3W97 B;  5BNX B;  5FUG A;  3AFA C;  3AV2 C;  5F99 A;  5B24 B;  4G91 C;  1WWI A;  1TZY A;  3LEL A;  4R8P B;  3X1V D;  5CP6 B;  5AVC D;  3WA9 C;  4ZUX A;  3LJA D;  3TU4 C;  5B1M C;  5B32 C;  3REL D;  1ID3 D;  2NQB B;  1P3P B;  3W98 C;  4LD9 D;  4M6B A;  3AZE D;  2PYO D;  5AV8 C;  4YS3 D;  5AY8 C;  3MVD C;  5DNM A;  5B33 B;  1P3A B;  5AV5 C;  3VH5 A;  3W99 A;  3AZG B;  3NQJ B;  3AN2 C;  4WU9 D;  4KUD C;  4NE5 A;  3X1T C;  3LZ1 B;  3REH B;  3X1V A;  5AVC A;  1M19 D;  1P3B B;  3LJA A;  4Z66 C;  1KX4 A;  4LD9 A;  1KX5 D;  3AZE A;  2PYO A;  1H3O B;  3REI B;  3W97 C;  4YS3 A;  1HQ3 D;  3X1U B;  5B24 C;  5CPJ B;  2CV5 D;  1F66 B;  3MGR D;  1P3K C;  3KWQ A;  3WTP B;  5AV6 D;  3LEL C;  1TZY C;  4H9P A;  3AV1 D;  4H9Q B;  5AVB B;  3MGP C;  3AYW D;  5DNN D;  1S32 A;  4UUZ B;  5B2J B;  2NQB C;  3WKJ B;  3AZN B;  3R45 B;  4J8V A;  5JRG D;  3AZL B;  3UT9 B;  1P3G B;  5DNM C;  5B0Z C;  3X1S D;  1KX5 A;  3AZJ D;  5B40 B;  2FJ7 D;  2CWE A;  5GSU D;  4WU8 B;  3AZK A;  3B0B A;  3WTP E;  4X23 A;  3AZM B;  3LZ1 C;  3AFA D;  3REH C;  2CV5 A;  3AV2 D;  5C3I B;  5AV6 A;  4XUJ B;  3REJ C;  3AV1 A;  3AZI B;  3AYW A;  2ARO B;  1P3F C;  2BYM B;  3WA9 D;  1KX4 C;  3B0C W;  5BO0 B;  3B0D B;  3TU4 D;  5JRG A;  5B1M D;  5B32 D;  3WAA B;  3X1U C;  3W98 D;  3O62 B;  3X1S A;  4WNN A;  1M18 A;  1F66 C;  4CSR A;  5AV8 D;  5AY8 D;  3WTP C;  3MVD D;  2FJ7 A;  3KWQ C;  5KDM B;  4EO5 C;  5AV5 D;  4Z5T A;  4JJN A;  4KHA B;  3AFA A;  3AN2 D;  3AV2 A;  1S32 C;  1TAF A;  4KUD D;  3NQU B;  1P3M C;  4J8V C;  1AOI B;  3X1T D;  5GT0 B;  3WA9 A;  3KXB B;  5E5A B;  5B40 C;  5B0Y C;  3VH6 T;  3TU4 A;  5CPK B;  5B1M A;  5B32 A;  4Z66 D;  4H9R A;  3W98 A;  3AZK C;  3W97 D;  4YM6 B;  1WWS A;  4X23 C;  3MVD A;  4G92 C;  1BFM A;  5BS7 C;  1EQZ C;  4H9O B;  1HTA A;  5B24 D;  1P3K D;  3C1C B;  3LEL D;  1TZY D;  3V9R A;  4KUD A;  3MGP D;  4AWL B;  5B31 A;  3UTA A;  3X1T A;  3VH6 W;  2NQB D;  1BH8 B;  3O62 C;  5BNV A;  1M18 C;  4CAY B;  5DNM D;  4Z66 A;  4WZS B;  3A6N B;  1P34 B;  5B0Z D;  1M1A B;  3W97 A;  5BNX A;  4J8X B;  1B67 A;  4Z5T C;  3VH6 A;  4JJN C;  3B6G B;  5CPI C;  5B1L B;  5B24 A;  5GT0 C;  3LZ1 D;  3REH D;  1P3K A;  3UTB C;  1ZLA B;  1ULY A;  3KXB C;  3REJ D;  3MGP A;  3KSY A;  3VH5 W;  2NQB A; 
#chains in the Genus database with same CATH topology
 1P3P A;  1P3F D;  4J8U C;  1KX4 D;  1KX3 B;  1B6W A;  5B33 A;  1P3A A;  2Y2Q A;  5B0Z A;  2HUE B;  1F66 D;  5GT3 B;  3AZG A;  3NQJ A;  3W96 B;  2IO5 B;  3WTP D;  5AV9 B;  3KUY B;  4NFT A;  3KWQ D;  3AZH B;  1P3L B;  1P3O B;  1N1J A;  5B31 C;  3LZ1 A;  3REH A;  5F99 B;  3UTA C;  1S32 D;  3LZ0 B;  2BG1 A;  3REJ A;  1P3B A;  1P3M D;  4ZUX B;  4J8V D;  5JA4 B;  3A6N C;  4Z2M G;  1P34 C;  1P3I C;  2F8N G;  1P3F A;  4KGC C;  1M1A C;  4J8X C;  1H3O A;  5B40 D;  5B0Y D;  3REI A;  2RVQ C;  4XZQ B;  3X1U A;  3REK B;  5B1L C;  3AZK D;  5CPJ A;  1F66 A;  1BH9 B;  4X23 D;  3WTP A;  1ZLA C;  4R8P C;  3W99 B;  5CP6 C;  4ZBJ B;  4H9Q A;  1EQZ D;  2F8N K;  4H9N B;  5G49 A;  2BYK B;  4UUZ A;  1W2E A;  3MNN B;  1P3P C;  2HIO B;  3X1V B;  2YFW B;  5AVC B;  3UT9 A;  1P3M A;  5B33 C;  1P3A C;  3O62 D;  3REL B;  3C1B B;  3W96 C;  1ID3 B;  5B40 A;  2IO5 C;  5B0Y A;  3KUY C;  1M18 D;  3AZG C;  2ZY3 A;  5CHL B;  3AZE B;  2PYO B;  3AZH C;  2F2A C;  4WU8 A;  4YS3 B;  1P3L C;  1P3O C;  2Y2H A;  4Z5T D;  4JJN D;  5CPI D;  1P3B C;  5BS7 A;  2L5A A;  4WU9 B;  1EQZ A;  5GT0 D;  4HGA B;  2BYM A;  3UTB D;  3KXB D;  5BO0 A;  3REI C;  1M19 B;  3WAA A;  5B2I B;  3REK C;  4J8U D;  3O62 A;  5GXQ B;  5CPJ C;  1KX5 B;  5KDM A;  4E44 A;  4ZBJ C;  1HQ3 B;  5AVB C;  4KHA A;  2XD5 A;  3MNN C;  2F8N B;  5B2J C;  5CPI A;  2HIO C;  3WKJ C;  4NE3 A;  3MGR B;  3AZN C;  3AL0 C;  3IP4 C;  4QLC B;  1AOI A;  4DRA A;  5B31 D;  5GT0 A;  3UT9 C;  3AZL C;  1P3G C;  3UTA D;  3UTB A;  5DNN B;  3C1B C;  3KXB A;  5E5A A;  5CPK A;  1JFI B;  3EG5 B;  3A6N D;  5JRG B;  1P34 D;  1P3I D;  4J8U A;  4WU8 C;  4KGC D;  1M1A D;  2G5H C;  4J8X D;  3MGQ B;  3AZF B;  2RVQ D;  3AZM C;  3AZJ B;  5C3I C;  4XUJ C;  1T3U A;  5GSU B;  4Z2M H;  4H9O A;  5B1L D;  2F8N H;  3AZI C;  4HGA C;  3C1C A;  1ZLA D;  2ARO C;  4R8P D;  2ZM5 A;  1U35 B;  5CP6 D;  1R4V A;  3B0D C;  1KU5 A;  5B2I C;  1BH8 A;  3WAA C;  3EPL A;  5GXQ C;  1P3P D;  4J8W B;  3WA9 B;  3A1I A;  3FDD A;  2YFV B;  5B33 D;  3A6N A;  1P34 A;  1P3I A;  1P3A D;  4KGC A;  1M1A A;  4J8X A;  3W96 D;  5BT1 C;  3KUY D;  3H0R C;  3AZG D;  3B6F B;  5AV8 B;  3AZH D;  1P3L D;  5AY8 B;  3MVD B;  3EPK A;  1P3O D;  4QLC C;  3P5J B;  4DQY B;  5B1L A;  1AOI C;  5AV5 B;  1ZLA A;  4R8P A;  5CP6 A;  3AN2 B;  1P3B D;  5E5A C;  5CPK C;  3X1T B;  3MGQ C;  1KX3 A;  3AZF C;  3REI D;  4YM6 C;  4E45 A;  2NZD B;  3REK D;  1A7W A;  3X1U D;  3MGS B;  5GT3 A;  3W96 A;  5CPJ D;  3KUY A;  3C1C C;  1U35 C;  3AZH A;  1P3L A;  4UPK A;  1P3O A;  5FUG B;  5AVB D;  4AWL C;  3MNN D;  3LZ0 A;  5B2J D;  2HIO D;  3WKJ D;  1P3K B;  4J8W C;  3AZN D;  2LY8 A;  3LEL B;  1TZY B;  5JA4 A;  4DRB A;  3AZL D;  3UT9 D;  3MGP B;  1P3G D;  2Y2M A;  3C1B D;  3B6F C;  4XZQ A;  3B6G C;  1Q9C A;  3REK A;  4WU8 D;  5DNM B;  1BH9 A;  5B0Z B;  3AZM D;  4XUJ D;  4H9N A;  5AVB A;  3AZI D;  2BYK A;  2JCH A;  4H9S C;  1N1J B;  2ARO D;  2Y2L A;  3MNN A;  5B2J A;  2HIO A;  3WKJ A;  2YFW A;  3AZN A;  3R45 A;  1KX3 C;  3REJ B;  3AZL A;  1P3G A;  5B2I D;  2NZD C;  3LJA B;  3WAA D;  3MGS C;  5GXQ D;  3REL A;  3C1B A;  1ID3 A;  2HUE C;  2G5I C;  3H0L C;  1P3F B;  5GT3 C;  1KX4 B;  5AV9 C;  4LD9 B;  5BT1 D;  2Y2O A;  3AZM A;  2F8N D;  5F99 C;  3LZ0 C;  4XUJ A;  4QLC D;  3KWQ B;  4WU9 A;  3AZI A;  5B32 G;  4ZUX C;  1AOI D;  3H0M C;  4H9P B;  4EO5 B;  2ARO A;  5G49 B;  1S32 B;  5E5A D;  1M19 A;  5CPK D;  3EPH A;  4XZQ C;  5B2I A;  1P3M B;  4J8V B;  5GXQ A;  2JSS A;  3B0C T;  1PZR A;  3MGQ D;  3AZF D;  4YM6 D;  5B0Y B;  3W99 C;  1HQ3 A;  5B31 G;  3KFU G;  3AZK B;  2F8N A;  3C1C D;  1U35 D;  3MGR A;  4X23 B;  2CV5 B;  4QLC A;  3X1V C;  4G92 B;  2Y2I A;  3NQU A;  5AV6 B;  5AVC C;  3LJA C;  1EQZ B;  3AV1 B;  5DNN A;  3AYW B;  4J8W D;  3REL C;  2DQN C;  1ID3 C;  1JFI A;  4LD9 C;  3AZE C;  4NE6 A;  2PYO C;  4YS3 C;  3MGQ A;  2Y2P A;  3AZF A;  3B6F D;  4YM6 A;  3AZJ A;  3B6G D;  3X1S B;  4WNN B;  1M18 B;  4CSR B;  5GSU A;  2FJ7 B;  4WU9 C;  2RIQ A;  1U35 A;  4Z5T B;  4JJN B;  3AFA B;  2VQR A;  5CPI B;  3AV2 B;  1TAF B;  1M19 C;  4J8W A;  4G91 B;  3A1K A;  3UTB B;  1KX3 D;  1KX5 C;  2YFV A;  2NZD D;  4CAY A;  3MGS D;  3TU4 B;  4WJ3 C;  1HQ3 C;  5B1M B;  5B32 B;  1F1E A;  5GT3 D;  4J8U B;  3B6F A;  5AV9 D;  4H9R B;  2ZY4 A;  5AV8 A;  3B6G A;  3W98 B;  5AY8 A;  2CV5 C;  3MGR C;  5AV6 C;  5AV5 A;  3AV1 C;  3AYW C;  5F99 D;  3LZ0 D;  3AN2 A;  5DNN C;  4ZUX D;  3V9R B;  4H9S A;  4KUD B;  5JRG C;  5B31 B;  3UTA B;  3X1S C;  3VH5 T;  5BNV B;  4XZQ D;  3AZJ C;  2NZD A;  2FJ7 C;  3MGS A;  4WV4 B;  5GSU C;  1P3I B;  4Z66 B;  4KGC B;  5AV9 A;  3W99 D;  3W97 B;  5BNX B;  5FUG A;  3AFA C;  3AV2 C;  1Z2C B;  5F99 A;  5B24 B;  4G91 C;  1WWI A;  1TZY A;  3LEL A;  4R8P B;  3X1V D;  5CP6 B;  5AVC D;  3WA9 C;  4ZUX A;  3LJA D;  3TU4 C;  5B1M C;  5B32 C;  3REL D;  1ID3 D;  2NQB B;  1P3P B;  3W98 C;  4LD9 D;  4M6B A;  3AZE D;  2PYO D;  5AV8 C;  4YS3 D;  5AY8 C;  3MVD C;  5DNM A;  5B33 B;  1P3A B;  3F6T A;  5AV5 C;  3VH5 A;  3W99 A;  3AZG B;  3NQJ B;  3AN2 C;  4WU9 D;  4KUD C;  4NE5 A;  3X1T C;  2Y2K A;  3LZ1 B;  3REH B;  2Y2J A;  3X1V A;  5AVC A;  1M19 D;  1P3B B;  3LJA A;  4Z66 C;  1KX4 A;  2UWX A;  4LD9 A;  1KX5 D;  3AZE A;  2PYO A;  1H3O B;  3REI B;  3W97 C;  4YS3 A;  1HQ3 D;  3X1U B;  5B24 C;  5CPJ B;  2CV5 D;  1F66 B;  3MGR D;  1P3K C;  2FFF B;  3KWQ A;  3WTP B;  5AV6 D;  3LEL C;  1TZY C;  4H9P A;  3AV1 D;  4H9Q B;  5AVB B;  3MGP C;  3AYW D;  5DNN D;  1S32 A;  4UUZ B;  5B2J B;  2NQB C;  3WKJ B;  3AZN B;  3R45 B;  4J8V A;  5JRG D;  3AZL B;  3UT9 B;  1P3G B;  5DNM C;  5B0Z C;  3X1S D;  1KX5 A;  3AZJ D;  5B40 B;  2FJ7 D;  2CWE A;  5GSU D;  2ZY2 A;  2XD1 A;  4WU8 B;  3AZK A;  3B0B A;  3WTP E;  4X23 A;  3AZM B;  3LZ1 C;  3AFA D;  3REH C;  2CV5 A;  3AV2 D;  5C3I B;  5AV6 A;  4XUJ B;  3REJ C;  3AV1 A;  3AZI B;  3AYW A;  2ARO B;  1P3F C;  2BYM B;  3WA9 D;  1KX4 C;  3B0C W;  5BO0 B;  3B0D B;  3TU4 D;  5JRG A;  5B1M D;  5B32 D;  2W8S A;  3WAA B;  3X1U C;  3W98 D;  2Y2N A;  3O62 B;  3X1S A;  4WNN A;  1M18 A;  1F66 C;  4CSR A;  5AV8 D;  5AY8 D;  3WTP C;  3MVD D;  2FJ7 A;  3KWQ C;  5KDM B;  4EO5 C;  2ZY5 A;  5AV5 D;  2DF4 C;  4Z5T A;  4JJN A;  4KHA B;  3AFA A;  3AN2 D;  3AV2 A;  1S32 C;  1TAF A;  4KUD D;  3NQU B;  1P3M C;  4J8V C;  1AOI B;  3X1T D;  5GT0 B;  2J8P A;  3WA9 A;  3KXB B;  5E5A B;  5B40 C;  5B0Y C;  3VH6 T;  3TU4 A;  5CPK B;  5B1M A;  5B32 A;  4Z66 D;  4H9R A;  3W98 A;  3AZK C;  2JE5 A;  3W97 D;  4YM6 B;  3EPJ A;  1WWS A;  4X23 C;  3MVD A;  4G92 C;  1BFM A;  5BS7 C;  1EQZ C;  4H9O B;  1HTA A;  5B24 D;  1P3K D;  3C1C B;  3LEL D;  1TZY D;  3V9R A;  4KUD A;  3MGP D;  4AWL B;  5B31 A;  3UTA A;  3X1T A;  3VH6 W;  2NQB D;  1BH8 B;  3O62 C;  5BNV A;  1M18 C;  4CAY B;  5DNM D;  4Z66 A;  4WZS B;  3A6N B;  1P34 B;  5B0Z D;  1M1A B;  3W97 A;  5BNX A;  4J8X B;  1B67 A;  4Z5T C;  3VH6 A;  4JJN C;  3B6G B;  5CPI C;  2Y2G A;  5B1L B;  5B24 A;  5GT0 C;  3LZ1 D;  3REH D;  1P3K A;  3UTB C;  1ZLA B;  1ULY A;  3KXB C;  3REJ D;  3MGP A;  3KSY A;  3VH5 W;  2NQB A; 
#chains in the Genus database with same CATH homology
 1P3P A;  1P3F D;  4J8U C;  1KX4 D;  1KX3 B;  1B6W A;  5B33 A;  1P3A A;  2Y2Q A;  5B0Z A;  2HUE B;  1F66 D;  5GT3 B;  3AZG A;  3NQJ A;  3W96 B;  2IO5 B;  3WTP D;  5AV9 B;  3KUY B;  4NFT A;  3KWQ D;  3AZH B;  1P3L B;  1P3O B;  1N1J A;  5B31 C;  3LZ1 A;  3REH A;  5F99 B;  3UTA C;  1S32 D;  3LZ0 B;  2BG1 A;  3REJ A;  1P3B A;  1P3M D;  4ZUX B;  4J8V D;  5JA4 B;  3A6N C;  4Z2M G;  1P34 C;  1P3I C;  2F8N G;  1P3F A;  4KGC C;  1M1A C;  4J8X C;  1H3O A;  5B40 D;  5B0Y D;  3REI A;  2RVQ C;  4XZQ B;  3X1U A;  3REK B;  5B1L C;  3AZK D;  5CPJ A;  1F66 A;  1BH9 B;  4X23 D;  3WTP A;  1ZLA C;  4R8P C;  3W99 B;  5CP6 C;  4ZBJ B;  4H9Q A;  1EQZ D;  2F8N K;  4H9N B;  5G49 A;  2BYK B;  4UUZ A;  1W2E A;  3MNN B;  1P3P C;  2HIO B;  3X1V B;  2YFW B;  5AVC B;  3UT9 A;  1P3M A;  5B33 C;  1P3A C;  3O62 D;  3REL B;  3C1B B;  3W96 C;  1ID3 B;  5B40 A;  2IO5 C;  5B0Y A;  3KUY C;  1M18 D;  3AZG C;  2ZY3 A;  5CHL B;  3AZE B;  2PYO B;  3AZH C;  2F2A C;  4WU8 A;  4YS3 B;  1P3L C;  1P3O C;  2Y2H A;  4Z5T D;  4JJN D;  5CPI D;  1P3B C;  5BS7 A;  2L5A A;  4WU9 B;  1EQZ A;  5GT0 D;  4HGA B;  2BYM A;  3UTB D;  3KXB D;  5BO0 A;  3REI C;  1M19 B;  3WAA A;  5B2I B;  3REK C;  4J8U D;  3O62 A;  5GXQ B;  5CPJ C;  1KX5 B;  5KDM A;  4E44 A;  4ZBJ C;  1HQ3 B;  5AVB C;  4KHA A;  2XD5 A;  3MNN C;  2F8N B;  5B2J C;  5CPI A;  2HIO C;  3WKJ C;  4NE3 A;  3MGR B;  3AZN C;  3AL0 C;  3IP4 C;  4QLC B;  1AOI A;  4DRA A;  5B31 D;  5GT0 A;  3UT9 C;  3AZL C;  1P3G C;  3UTA D;  3UTB A;  5DNN B;  3C1B C;  3KXB A;  5E5A A;  5CPK A;  1JFI B;  3EG5 B;  3A6N D;  5JRG B;  1P34 D;  1P3I D;  4J8U A;  4WU8 C;  4KGC D;  1M1A D;  2G5H C;  4J8X D;  3MGQ B;  3AZF B;  2RVQ D;  3AZM C;  3AZJ B;  5C3I C;  4XUJ C;  1T3U A;  5GSU B;  4Z2M H;  4H9O A;  5B1L D;  2F8N H;  3AZI C;  4HGA C;  3C1C A;  1ZLA D;  2ARO C;  4R8P D;  2ZM5 A;  1U35 B;  5CP6 D;  1R4V A;  3B0D C;  1KU5 A;  5B2I C;  1BH8 A;  3WAA C;  3EPL A;  5GXQ C;  1P3P D;  4J8W B;  3WA9 B;  3A1I A;  3FDD A;  2YFV B;  5B33 D;  3A6N A;  1P34 A;  1P3I A;  1P3A D;  4KGC A;  1M1A A;  4J8X A;  3W96 D;  5BT1 C;  3KUY D;  3H0R C;  3AZG D;  3B6F B;  5AV8 B;  3AZH D;  1P3L D;  5AY8 B;  3MVD B;  3EPK A;  1P3O D;  4QLC C;  3P5J B;  4DQY B;  5B1L A;  1AOI C;  5AV5 B;  1ZLA A;  4R8P A;  5CP6 A;  3AN2 B;  1P3B D;  5E5A C;  5CPK C;  3X1T B;  3MGQ C;  1KX3 A;  3AZF C;  3REI D;  4YM6 C;  4E45 A;  2NZD B;  3REK D;  1A7W A;  3X1U D;  3MGS B;  5GT3 A;  3W96 A;  5CPJ D;  3KUY A;  3C1C C;  1U35 C;  3AZH A;  1P3L A;  4UPK A;  1P3O A;  5FUG B;  5AVB D;  4AWL C;  3MNN D;  3LZ0 A;  5B2J D;  2HIO D;  3WKJ D;  1P3K B;  4J8W C;  3AZN D;  2LY8 A;  3LEL B;  1TZY B;  5JA4 A;  4DRB A;  3AZL D;  3UT9 D;  3MGP B;  1P3G D;  2Y2M A;  3C1B D;  3B6F C;  4XZQ A;  3B6G C;  1Q9C A;  3REK A;  4WU8 D;  5DNM B;  1BH9 A;  5B0Z B;  3AZM D;  4XUJ D;  4H9N A;  5AVB A;  3AZI D;  2BYK A;  2JCH A;  4H9S C;  1N1J B;  2ARO D;  2Y2L A;  3MNN A;  5B2J A;  2HIO A;  3WKJ A;  2YFW A;  3AZN A;  3R45 A;  1KX3 C;  3REJ B;  3AZL A;  1P3G A;  5B2I D;  2NZD C;  3LJA B;  3WAA D;  3MGS C;  5GXQ D;  3REL A;  3C1B A;  1ID3 A;  2HUE C;  2G5I C;  3H0L C;  1P3F B;  5GT3 C;  1KX4 B;  5AV9 C;  4LD9 B;  5BT1 D;  2Y2O A;  3AZM A;  2F8N D;  5F99 C;  3LZ0 C;  4XUJ A;  4QLC D;  3KWQ B;  4WU9 A;  3AZI A;  5B32 G;  4ZUX C;  1AOI D;  3H0M C;  4H9P B;  4EO5 B;  2ARO A;  5G49 B;  1S32 B;  5E5A D;  1M19 A;  5CPK D;  3EPH A;  4XZQ C;  5B2I A;  1P3M B;  4J8V B;  5GXQ A;  2JSS A;  3B0C T;  1PZR A;  3MGQ D;  3AZF D;  4YM6 D;  5B0Y B;  3W99 C;  1HQ3 A;  5B31 G;  3KFU G;  3AZK B;  2F8N A;  3C1C D;  1U35 D;  3MGR A;  4X23 B;  2CV5 B;  4QLC A;  3X1V C;  4G92 B;  2Y2I A;  3NQU A;  5AV6 B;  5AVC C;  3LJA C;  1EQZ B;  3AV1 B;  5DNN A;  3AYW B;  4J8W D;  3REL C;  2DQN C;  1ID3 C;  1JFI A;  4LD9 C;  3AZE C;  4NE6 A;  2PYO C;  4YS3 C;  3MGQ A;  2Y2P A;  3AZF A;  3B6F D;  4YM6 A;  3AZJ A;  3B6G D;  3X1S B;  4WNN B;  1M18 B;  4CSR B;  5GSU A;  2FJ7 B;  4WU9 C;  2RIQ A;  1U35 A;  4Z5T B;  4JJN B;  3AFA B;  2VQR A;  5CPI B;  3AV2 B;  1TAF B;  1M19 C;  4J8W A;  4G91 B;  3A1K A;  3UTB B;  1KX3 D;  1KX5 C;  2YFV A;  2NZD D;  4CAY A;  3MGS D;  3TU4 B;  4WJ3 C;  1HQ3 C;  5B1M B;  5B32 B;  1F1E A;  5GT3 D;  4J8U B;  3B6F A;  5AV9 D;  4H9R B;  2ZY4 A;  5AV8 A;  3B6G A;  3W98 B;  5AY8 A;  2CV5 C;  3MGR C;  5AV6 C;  5AV5 A;  3AV1 C;  3AYW C;  5F99 D;  3LZ0 D;  3AN2 A;  5DNN C;  4ZUX D;  3V9R B;  4H9S A;  4KUD B;  5JRG C;  5B31 B;  3UTA B;  3X1S C;  3VH5 T;  5BNV B;  4XZQ D;  3AZJ C;  2NZD A;  2FJ7 C;  3MGS A;  4WV4 B;  5GSU C;  1P3I B;  4Z66 B;  4KGC B;  5AV9 A;  3W99 D;  3W97 B;  5BNX B;  5FUG A;  3AFA C;  3AV2 C;  1Z2C B;  5F99 A;  5B24 B;  4G91 C;  1WWI A;  1TZY A;  3LEL A;  4R8P B;  3X1V D;  5CP6 B;  5AVC D;  3WA9 C;  4ZUX A;  3LJA D;  3TU4 C;  5B1M C;  5B32 C;  3REL D;  1ID3 D;  2NQB B;  1P3P B;  3W98 C;  4LD9 D;  4M6B A;  3AZE D;  2PYO D;  5AV8 C;  4YS3 D;  5AY8 C;  3MVD C;  5DNM A;  5B33 B;  1P3A B;  3F6T A;  5AV5 C;  3VH5 A;  3W99 A;  3AZG B;  3NQJ B;  3AN2 C;  4WU9 D;  4KUD C;  4NE5 A;  3X1T C;  2Y2K A;  3LZ1 B;  3REH B;  2Y2J A;  3X1V A;  5AVC A;  1M19 D;  1P3B B;  3LJA A;  4Z66 C;  1KX4 A;  2UWX A;  4LD9 A;  1KX5 D;  3AZE A;  2PYO A;  1H3O B;  3REI B;  3W97 C;  4YS3 A;  1HQ3 D;  3X1U B;  5B24 C;  5CPJ B;  2CV5 D;  1F66 B;  3MGR D;  1P3K C;  2FFF B;  3KWQ A;  3WTP B;  5AV6 D;  3LEL C;  1TZY C;  4H9P A;  3AV1 D;  4H9Q B;  5AVB B;  3MGP C;  3AYW D;  5DNN D;  1S32 A;  4UUZ B;  5B2J B;  2NQB C;  3WKJ B;  3AZN B;  3R45 B;  4J8V A;  5JRG D;  3AZL B;  3UT9 B;  1P3G B;  5DNM C;  5B0Z C;  3X1S D;  1KX5 A;  3AZJ D;  5B40 B;  2FJ7 D;  2CWE A;  5GSU D;  2ZY2 A;  2XD1 A;  4WU8 B;  3AZK A;  3B0B A;  3WTP E;  4X23 A;  3AZM B;  3LZ1 C;  3AFA D;  3REH C;  2CV5 A;  3AV2 D;  5C3I B;  5AV6 A;  4XUJ B;  3REJ C;  3AV1 A;  3AZI B;  3AYW A;  2ARO B;  1P3F C;  2BYM B;  3WA9 D;  1KX4 C;  3B0C W;  5BO0 B;  3B0D B;  3TU4 D;  5JRG A;  5B1M D;  5B32 D;  2W8S A;  3WAA B;  3X1U C;  3W98 D;  2Y2N A;  3O62 B;  3X1S A;  4WNN A;  1M18 A;  1F66 C;  4CSR A;  5AV8 D;  5AY8 D;  3WTP C;  3MVD D;  2FJ7 A;  3KWQ C;  5KDM B;  4EO5 C;  2ZY5 A;  5AV5 D;  2DF4 C;  4Z5T A;  4JJN A;  4KHA B;  3AFA A;  3AN2 D;  3AV2 A;  1S32 C;  1TAF A;  4KUD D;  3NQU B;  1P3M C;  4J8V C;  1AOI B;  3X1T D;  5GT0 B;  2J8P A;  3WA9 A;  3KXB B;  5E5A B;  5B40 C;  5B0Y C;  3VH6 T;  3TU4 A;  5CPK B;  5B1M A;  5B32 A;  4Z66 D;  4H9R A;  3W98 A;  3AZK C;  2JE5 A;  3W97 D;  4YM6 B;  3EPJ A;  1WWS A;  4X23 C;  3MVD A;  4G92 C;  1BFM A;  5BS7 C;  1EQZ C;  4H9O B;  1HTA A;  5B24 D;  1P3K D;  3C1C B;  3LEL D;  1TZY D;  3V9R A;  4KUD A;  3MGP D;  4AWL B;  5B31 A;  3UTA A;  3X1T A;  3VH6 W;  2NQB D;  1BH8 B;  3O62 C;  5BNV A;  1M18 C;  4CAY B;  5DNM D;  4Z66 A;  4WZS B;  3A6N B;  1P34 B;  5B0Z D;  1M1A B;  3W97 A;  5BNX A;  4J8X B;  1B67 A;  4Z5T C;  3VH6 A;  4JJN C;  3B6G B;  5CPI C;  2Y2G A;  5B1L B;  5B24 A;  5GT0 C;  3LZ1 D;  3REH D;  1P3K A;  3UTB C;  1ZLA B;  1ULY A;  3KXB C;  3REJ D;  3MGP A;  3KSY A;  3VH5 W;  2NQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...