3LJAB

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaB00
3AZGC 3TU4D 2CV5A 3RELC 5KDMB 3AN2C 5B0YC 5BS7A 3VH6A 5B2JB 1P3KB 3WKJD 3AYWB 1M18D 5AV8D 4H9RB 1M19D 4QLCA 4DRAA 3X1UC 2CV5B 1P3MB 3W97C 5AV6D 1HQ3D 3MGPA 4E45A 5F99D 4X23C 1P3FB 1P3OA 5BNXB 3WAAA 5E5AC 5AV5C 1EQZC 5AVBD 3LJAB 1P3GD 1JFIA 3AZNA 3W96C 3WKJA 3VH5W 3MGPB 1M19B 1P34C 3AZKA 3TU4B 1KX3A 1N1JB 3MGQD 2BYMB 5BT1C 3LZ0D 4KUDA 3AFAD 3B0DB 5F99A 3AZNB 3W98C 3UTAC 3WKJB 1M18B 5AV8B 4J8WD 4Z2MG 5AVBA 2PYOC 5B2JC 3REJD 5B24A 3WTPD 3C1BC 2F8NG 1P3KC 3AYWC 4YM6A 2IO5B 5AV6B 4JJND 4H9OA 1HQ3B 4HGAB 1KX5A 5F99B 5JA4B 1P3MC 3MVDD 3C1CC 3B6GD 5GXQC 2HIOC 5BO0A 5AVBB 4ZUXC 1P3GB 1P3FC 5DNND 4AWLC 5B31C 3UT9D 4J8WA 4H9OB 1BFMA 2F8ND 4Z66D 3AZGD 3MGQB 3LZ0B 4JJNA 1M19C 4NE6A 3TU4C 3AFAB 3AZJD 3AN2D 3MVDA 3B6GA 3A6ND 4J8WB 2NQBC 3REJB 4WU8C 3AV1C 1M18C 5AV8C 3X1UD 3MNNA 4JJNB 5B0ZA 4KGCA 5B1MA 3W97D 5CHLB 2AROA 5AV6C 3MVDB 3AZGA 3B6GB 1HQ3C 5B40A 4J8VC 4NFTA 3RELA 5AV5D 1B6WA 3AN2A 1EQZD 4WNNB 5B0YA 5GT0D 5DNNB 3UT9B 1P3GC 5AY8D 1P3ID 3W96D 4KGCB 5FUGA 2F8NB 1WWIA 4H9NB 2AROB 4Z66B 3AZGB 3X1UA 1H3OA 5BT1D 3AZJB 3AN2B 3MGQC 3REHD 4X23A 3A6NB 3W98D 5BNVA 1KX4D 3UTAD 5E5AA 3R45B 5B31G 5CPJD 2PYOD 1KU5A 3X1UB 3C1BD 5AVCC 3WTPC 3W97B 5CPID 4M6BA 4J8XD 3AZHC 1P34A 3W99A 4X23B 1Q9CA 5AV5B 1WWSA 1EQZB 2HIOD 5GT0B 4ZUXD 1P3IB 3W96B 5KDMA 5B31D 4KHAB 5DNNC 5B2ID 4CAYA 3UT9C 4ZBJC 5B32C 4Z5TC 5B2JA 1P34B 4YS3D 1S32D 5AV9D 3C1BA 1P3KA 3AYWA 4XZQC 4H9RA 2YFVB 4Z66C 4J8UD 5B1LC 5CP6C 3REHB 1P3MA 3W98B 3C1CA 3AZJC 3VH5T 3UTAB 4WU9C 1KX4B 2RVQC 5GXQA 4CAYB 2HIOA 5CPJB 2PYOB 1P3FA 2NQBD 3A6NC 4WU8D 5BNXA 3C1BB 3AV1D 3LJAA 1TAFB 5CPIB 4J8XB 3C1CB 5DNMD 3X1TC 1M19A 5GXQB 2HIOB 3MGRD 3TU4A 4J8VD 4ZUXB 1N1JA 5GSUC 2BYMA 4AWLB 5B31B 4G92C 5GT0C 5JRGC 4XUJD 5AY8C 1P3IC 5AV9B 1M18A 5AV8A 4J8UB 1TZYD 1F66C 4H9QA 4H9PB 5AV6A 3KWQC 1HQ3A 5JA4A 3REHC 4J8VA 2NQBB 1U35C 4WU8B 1KX4C 1P3BD 3AZID 3AV1B 5CPJC 5B32G 1P3GA 5AVCD 4H9QB 3REKD 3UTBD 5CPIC 3AZHD 5DNMB 4J8XC 3MGRB 4J8VB 3MGQA 3LZ0A 1ID3C 1BH9A 1AOIC 3X1SD 3AFAA 4XUJB 3AZED 3X1VD 5B2IC 5B32D 4Z5TD 2BYKB 3REJA 4XZQD 5AVCA 1TZYB 5AV9C 4YS3C 3WTPA 1S32C 1BH8A 1P3LC 5B1LD 5CP6D 4J8UC 1BH9B 3B6FD 4WU9D 1ULYA 2RVQD 1P3BB 3B0CT 3LELD 3MGSC 5AVCB 3WTPB 4WNNA 5DNNA 3REKB 1BH8B 4CSRB 3UT9A 3UTBB 5B32A 3AZHB 2HUEC 3AV2D 2F8NA 5C3IC 4H9NA 4QLCC 3X1TD 4Z66A 5B1LA 5DNMC 5CP6A 3X1SB 3MGRC 5GSUD 4NE5A 3REID 3AZJA 4WU9A 1A7WA 3AZEB 3X1VB 3AZMC 5JRGD 4ZBJB 4R8PC 4Z5TB 5B32B 3A6NA 4XUJC 1M1AC 3R45A 4XZQB 5B1LB 1F66D 5CP6B 1TZYC 2FJ7D 3W97A 3KWQD 4WU9B 3X1TA 3AZKC 5CPKD 1KX3C 3KUYC 1U35D 4KUDC 5AV5A 1P3BC 1EQZA 5GT0A 3AZIC 5G49A 3V9RA 1ZLAC 5AY8A 3W96A 1P3IA 2NZDD 4KHAA 3AV2B 3REKC 3UTBC 3X1TB 5B24C 1F66A 4YM6C 3REIB 5GSUB 2YFVA 1ID3D 3AZFD 1P3PC 1AOID 4G92B 2L5AA 1KX5C 5G49B 5JRGB 3REHA 3X1SC 3V9RB 4LD9D 5AY8B 4G91C 1U35A 3W98A 1KX4A 3UTAA 3AZEC 3X1VC 5CPJA 2PYOA 2F8NK 2CWEA 3AZLC 1F66B 3KXBC 2FJ7B 1P3LD 3KWQB 1TAFA 5CPIA 4DRBA 4J8XA 5CPKB 3B6FC 1HTAA 1U35B 1ID3A 1AOIA 3MGSD 4ZUXA 3LELC 5B31A 5B2IA 3KSYA 4YS3A 1S32A 5AV9A 4QLCD 5GT3C 3VH6W 3MNNC 3AV2C 1P3LA 4UUZB 1P3AC 1ID3B 3AZFB 4J8UA 1AOIB 2YFWB 4H9PA 3REIC 3AZMD 1P3OD 5B2IB 5B40C 4R8PD 4EO5C 3MGSA 3WAAD 3B0BA 1M1AD 2NQBA 4WU8A 4YS3B 1S32B 3AV1A 3LZ1C 3AZND 1P3LB 1R4VA 3WA9C 2FJ7C 3AZKD 5DNMA 1KX3D 3KUYD 4KUDD 3MGSB 3MGRA 5CPKC 4NE3A 3AZMA 3O62C 3VH5A 1ZLAD 4R8PA 4XUJA 1M1AA 2HUEB 2NZDC 5C3IB 4QLCB 5B24D 2BYKA 4H9SC 1TZYA 4YM6D 4E44A 1P3PD 1KX5D 5B33C 3AZMB 3W99C 3AZFC 1P3OB 4R8PB 3KUYA 3WAAB 4LD9C 1M1AB 4WZSB 1P3BA 3AZIA 1JFIB 1ZLAA 3AZLD 3KXBD 3REKA 4CSRA 3UTBA 3AZKB 3AZHA 1KX3B 3KUYB 4KUDB 1P3PA 3AZIB 2CV5C 3X1SA 1ZLAB 3AZEA 3X1VA 5BS7C 3NQJA 5B24B 4Z5TA 3AZLA 3WTPE 5GT3D 3KXBA 4XZQA 4YM6B 3MNND 3LJAC 1P3AD 5B0ZD 1P3PB 4KGCD 5B1MD 1KX5B 2AROD 3B6FA 4G91B 3MGPC 5BO0B 5B40D 4WV4B 3NQJB 1P3OC 3RELD 3WAAC 3LELA 5B0YD 3AZLB 3KXBB 3LZ1D 3B0DC 3AZNC 3WKJC 3WA9D 3B6FB 5GT3A 3AV2A 1P3AA 3NQUA 3LELB 3REIA 2IO5C 5GSUA 3O62D 4X23D 4HGAC 5F99C 5JRGA 5E5AD 5GT3B 3LZ1A 3MNNB 5AVBC 1P3AB 5B0ZB 3NQUB 5B1MB 3WA9A 2FJ7A 5B33D 3B0CW 3KWQA 3W99D 1P34D 5B40B 4EO5B 5CPKA 3RELB 3LZ0C 5B0YB 3VH6T 1F1EA 3O62A 3LZ1B 3AFAC 5FUGB 2JSSA 2NZDA 3WA9B 5B2JD 4J8WC 1H3OB 1P3KD 3REJC 3AYWD 4H9SA 1B67A 4JJNC 4UUZA 5B33A 4Z2MH 3AZFA 3O62B 2CV5D 1P3MD 5BNVB 2YFWA 3C1CD 2F8NH 4LD9A 5E5AB 3MVDC 5GXQD 3B6GC 2NZDB 1P3FD 2LY8A 3LJAD 5B33B 5B0ZC 3W99B 4KGCC 5B1MC 2AROC 4LD9B 3MGPD
chains in the Genus database with same CATH superfamily
3AZGC 3TU4D 2CV5A 3EPLA 3RELC 5KDMB 3AN2C 5B0YC 2XD1A 5BS7A 3VH6A 5B2JB 1P3KB 3WKJD 3AYWB 1M18D 5AV8D 4H9RB 1M19D 4QLCA 4DRAA 3X1UC 2CV5B 1P3MB 3W97C 5AV6D 2Y2KA 1HQ3D 3MGPA 2XD5A 4E45A 5F99D 4X23C 1P3FB 1P3OA 5BNXB 3WAAA 5E5AC 5AV5C 2VQRA 2Y2JA 1EQZC 5AVBD 3LJAB 1P3GD 1JFIA 3AZNA 3W96C 3WKJA 3VH5W 3MGPB 1M19B 1P34C 3AZKA 2Y2HA 3TU4B 1KX3A 1N1JB 3MGQD 2BYMB 5BT1C 3LZ0D 4KUDA 2ZY4A 3AFAD 3B0DB 5F99A 3AZNB 3W98C 3UTAC 3WKJB 1M18B 5AV8B 2F2AC 4J8WD 4Z2MG 5AVBA 2PYOC 5B2JC 3REJD 5B24A 3WTPD 3C1BC 2F8NG 1P3KC 3AYWC 4YM6A 2IO5B 5AV6B 4JJND 4H9OA 1HQ3B 4HGAB 1KX5A 5F99B 5JA4B 1P3MC 2Y2OA 3MVDD 3C1CC 3B6GD 3EG5B 5GXQC 2HIOC 2Y2IA 5BO0A 5AVBB 4ZUXC 2ZM5A 1P3GB 1P3FC 5DNND 4AWLC 5B31C 3UT9D 4J8WA 4H9OB 4UPKA 1BFMA 2F8ND 4Z66D 3AZGD 3MGQB 3LZ0B 4JJNA 1M19C 4NE6A 3TU4C 3AFAB 2G5HC 3AZJD 2Y2QA 3AN2D 3MVDA 3B6GA 3A6ND 4J8WB 2NQBC 3REJB 4WU8C 3AV1C 1M18C 5AV8C 3X1UD 3MNNA 4JJNB 5B0ZA 4KGCA 5B1MA 3W97D 5CHLB 2AROA 5AV6C 3MVDB 1Z2CB 3AZGA 3B6GB 1HQ3C 3EPHA 5B40A 4J8VC 4NFTA 3RELA 5AV5D 1B6WA 3AN2A 1EQZD 4WNNB 5B0YA 5DNNB 5GT0D 3UT9B 1P3GC 5AY8D 1P3ID 2FFFB 3W96D 4KGCB 5FUGA 2F8NB 1WWIA 2DF4C 4H9NB 2AROB 4Z66B 3AZGB 3X1UA 1H3OA 2ZY2A 5BT1D 3AZJB 3AN2B 3MGQC 2BG1A 3REHD 4X23A 3A6NB 3W98D 5BNVA 1KX4D 3UTAD 5E5AA 3R45B 5B31G 5CPJD 2PYOD 1KU5A 2G5IC 3X1UB 3C1BD 3A1IA 5AVCC 3WTPC 3W97B 5CPID 4M6BA 4J8XD 3AZHC 1P34A 3W99A 4X23B 1Q9CA 5AV5B 1WWSA 1EQZB 2HIOD 5GT0B 4ZUXD 1P3IB 3W96B 5KDMA 5B31D 4KHAB 5DNNC 5B2ID 4CAYA 3EPKA 3UT9C 4ZBJC 5B32C 4Z5TC 2DQNC 5B2JA 4YS3D 1S32D 5AV9D 3C1BA 1P34B 1P3KA 3AYWA 4XZQC 4H9RA 2YFVB 4Z66C 4J8UD 2Y2GA 5B1LC 2RIQA 2Y2MA 5CP6C 3REHB 1P3MA 3W98B 2JCHA 3C1CA 3VH5T 3UTAB 3AZJC 4WU9C 1KX4B 2RVQC 5GXQA 4CAYB 2HIOA 5CPJB 2PYOB 1P3FA 2NQBD 3A6NC 4WU8D 2Y2PA 5BNXA 3C1BB 3AV1D 3A1KA 3LJAA 1TAFB 5CPIB 3KFUG 4J8XB 3C1CB 5DNMD 3X1TC 1M19A 5GXQB 2HIOB 3MGRD 3TU4A 4J8VD 4ZUXB 1N1JA 5GSUC 2BYMA 4AWLB 5B31B 4G92C 5GT0C 5JRGC 4XUJD 5AY8C 1P3IC 5AV9B 1M18A 5AV8A 4J8UB 1TZYD 1F66C 4H9QA 4H9PB 5AV6A 3KWQC 1HQ3A 5JA4A 3REHC 4J8VA 2NQBB 1U35C 4WU8B 1KX4C 1P3BD 3AZID 3AV1B 5CPJC 5B32G 1P3GA 5AVCD 4H9QB 3REKD 3UTBD 5CPIC 3AZHD 5DNMB 4J8XC 1W2EA 3MGRB 4J8VB 3MGQA 3LZ0A 1ID3C 1BH9A 1AOIC 3X1SD 3AFAA 4XUJB 3AZED 3X1VD 5B2IC 5B32D 4Z5TD 2BYKB 3REJA 4XZQD 5AVCA 1TZYB 5AV9C 4YS3C 3WTPA 1S32C 1BH8A 1P3LC 5B1LD 5CP6D 4J8UC 1BH9B 3B6FD 4WU9D 2JE5A 1ULYA 2RVQD 1P3BB 3B0CT 3LELD 3MGSC 5AVCB 3WTPB 4WNNA 5DNNA 3REKB 1BH8B 4CSRB 3UT9A 3UTBB 5B32A 3AZHB 2HUEC 3AV2D 2F8NA 5C3IC 4H9NA 4QLCC 3X1TD 4Z66A 5B1LA 5DNMC 2UWXA 5CP6A 3X1SB 3MGRC 5GSUD 4NE5A 3REID 3AZJA 4WU9A 1A7WA 3AZEB 3X1VB 3AZMC 5JRGD 4ZBJB 4R8PC 4Z5TB 5B32B 3A6NA 4XUJC 1M1AC 3FDDA 3R45A 4XZQB 5B1LB 1F66D 5CP6B 1TZYC 2FJ7D 3W97A 3KWQD 4WU9B 3X1TA 3AZKC 5CPKD 1KX3C 3KUYC 1U35D 4KUDC 5AV5A 1P3BC 1EQZA 5GT0A 3AZIC 5G49A 3V9RA 1ZLAC 5AY8A 3W96A 1P3IA 2NZDD 4KHAA 3AV2B 3REKC 3UTBC 3X1TB 5B24C 1F66A 4YM6C 3REIB 5GSUB 2YFVA 1ID3D 3AZFD 1P3PC 1AOID 4G92B 2L5AA 1KX5C 5G49B 5JRGB 3REHA 3X1SC 3V9RB 4LD9D 5AY8B 4G91C 1U35A 3W98A 1KX4A 3UTAA 3AZEC 3X1VC 5CPJA 2PYOA 2F8NK 2CWEA 3AZLC 1F66B 3KXBC 2FJ7B 1P3LD 3KWQB 1TAFA 5CPIA 4DRBA 4J8XA 5CPKB 3B6FC 1HTAA 1U35B 1ID3A 1AOIA 3MGSD 4ZUXA 3LELC 5B31A 5B2IA 3KSYA 4YS3A 1S32A 5AV9A 4QLCD 5GT3C 3VH6W 3MNNC 3AV2C 1P3LA 4UUZB 1P3AC 1ID3B 3AZFB 4J8UA 1AOIB 2YFWB 4H9PA 3REIC 3AZMD 1P3OD 5B2IB 5B40C 4R8PD 4EO5C 3MGSA 3WAAD 3B0BA 1M1AD 2NQBA 4WU8A 4YS3B 1S32B 3AV1A 3LZ1C 3AZND 1P3LB 1R4VA 3WA9C 4WJ3C 2FJ7C 3AZKD 5DNMA 1KX3D 3KUYD 4KUDD 3MGSB 3MGRA 5CPKC 4NE3A 3AZMA 3O62C 3VH5A 1ZLAD 4R8PA 4XUJA 1M1AA 2HUEB 2NZDC 5C3IB 4QLCB 5B24D 3F6TA 2BYKA 4H9SC 1TZYA 4YM6D 2Y2NA 4E44A 1P3PD 1KX5D 5B33C 3AZMB 3W99C 3AZFC 1P3OB 4R8PB 3KUYA 3WAAB 4LD9C 1M1AB 4WZSB 1P3BA 3AZIA 1JFIB 3H0MC 2ZY5A 1ZLAA 3AZLD 3KXBD 3REKA 4CSRA 3UTBA 3AZKB 3AZHA 2J8PA 1KX3B 3KUYB 4KUDB 1P3PA 3AZIB 2CV5C 3X1SA 1ZLAB 3AZEA 3X1VA 5BS7C 3NQJA 5B24B 4Z5TA 3AZLA 3WTPE 5GT3D 3KXBA 4XZQA 4YM6B 3MNND 3LJAC 1P3AD 5B0ZD 1P3PB 4KGCD 5B1MD 1KX5B 2AROD 3B6FA 4G91B 3MGPC 5BO0B 5B40D 4WV4B 3NQJB 1P3OC 3RELD 3WAAC 3LELA 5B0YD 3AZLB 3KXBB 3LZ1D 3B0DC 3AZNC 4DQYB 3P5JB 3WKJC 1T3UA 3B6FB 3WA9D 5GT3A 3IP4C 3AV2A 1P3AA 3NQUA 3LELB 3REIA 2IO5C 5GSUA 3O62D 4X23D 4HGAC 5F99C 5JRGA 5E5AD 3H0LC 5GT3B 3LZ1A 3MNNB 5AVBC 1P3AB 5B0ZB 3NQUB 5B1MB 3WA9A 2FJ7A 5B33D 3B0CW 3KWQA 3W99D 1P34D 5B40B 4EO5B 5CPKA 3RELB 1PZRA 3LZ0C 5B0YB 3VH6T 1F1EA 3O62A 3LZ1B 3AFAC 3AL0C 2W8SA 2Y2LA 2JSSA 5FUGB 2NZDA 3WA9B 5B2JD 4J8WC 1H3OB 1P3KD 3REJC 3AYWD 4H9SA 1B67A 4JJNC 4UUZA 5B33A 4Z2MH 2ZY3A 3O62B 3AZFA 2CV5D 1P3MD 5BNVB 2YFWA 3C1CD 2F8NH 4LD9A 5E5AB 3MVDC 5GXQD 3B6GC 2NZDB 1P3FD 2LY8A 3EPJA 3LJAD 5B33B 5B0ZC 3W99B 3H0RC 4KGCC 5B1MC 2AROC 4LD9B 3MGPD
chains in the Genus database with same CATH topology
3AZGC 3TU4D 2CV5A 3EPLA 3RELC 5KDMB 3AN2C 5B0YC 2XD1A 5BS7A 3VH6A 5B2JB 1P3KB 3WKJD 3AYWB 1M18D 5AV8D 4H9RB 1M19D 4QLCA 4DRAA 3X1UC 2CV5B 1P3MB 3W97C 5AV6D 2Y2KA 1HQ3D 3MGPA 2XD5A 4E45A 5F99D 4X23C 1P3FB 1P3OA 5BNXB 3WAAA 5E5AC 5AV5C 2VQRA 2Y2JA 1EQZC 5AVBD 3LJAB 1P3GD 1JFIA 3AZNA 3W96C 3WKJA 3VH5W 3MGPB 1M19B 1P34C 3AZKA 2Y2HA 3TU4B 1KX3A 1N1JB 3MGQD 2BYMB 5BT1C 3LZ0D 4KUDA 2ZY4A 3AFAD 3B0DB 5F99A 3AZNB 3W98C 3UTAC 3WKJB 1M18B 5AV8B 2F2AC 4J8WD 4Z2MG 5AVBA 2PYOC 5B2JC 3REJD 5B24A 3WTPD 3C1BC 2F8NG 1P3KC 3AYWC 4YM6A 2IO5B 5AV6B 4JJND 4H9OA 1HQ3B 4HGAB 1KX5A 5F99B 5JA4B 1P3MC 2Y2OA 3MVDD 3C1CC 3B6GD 3EG5B 5GXQC 2HIOC 2Y2IA 5BO0A 5AVBB 4ZUXC 2ZM5A 1P3GB 1P3FC 5DNND 4AWLC 5B31C 3UT9D 4J8WA 4H9OB 4UPKA 1BFMA 2F8ND 4Z66D 3AZGD 3MGQB 3LZ0B 4JJNA 1M19C 4NE6A 3TU4C 3AFAB 2G5HC 3AZJD 2Y2QA 3AN2D 3MVDA 3B6GA 3A6ND 4J8WB 2NQBC 3REJB 4WU8C 3AV1C 1M18C 5AV8C 3X1UD 3MNNA 4JJNB 5B0ZA 4KGCA 5B1MA 3W97D 5CHLB 2AROA 5AV6C 3MVDB 1Z2CB 3AZGA 3B6GB 1HQ3C 3EPHA 5B40A 4J8VC 4NFTA 3RELA 5AV5D 1B6WA 3AN2A 1EQZD 4WNNB 5B0YA 5DNNB 5GT0D 3UT9B 1P3GC 5AY8D 1P3ID 2FFFB 3W96D 4KGCB 5FUGA 2F8NB 1WWIA 2DF4C 4H9NB 2AROB 4Z66B 3AZGB 3X1UA 1H3OA 2ZY2A 5BT1D 3AZJB 3AN2B 3MGQC 2BG1A 3REHD 4X23A 3A6NB 3W98D 5BNVA 1KX4D 3UTAD 5E5AA 3R45B 5B31G 5CPJD 2PYOD 1KU5A 2G5IC 3X1UB 3C1BD 3A1IA 5AVCC 3WTPC 3W97B 5CPID 4M6BA 4J8XD 3AZHC 1P34A 3W99A 4X23B 1Q9CA 5AV5B 1WWSA 1EQZB 2HIOD 5GT0B 4ZUXD 1P3IB 3W96B 5KDMA 5B31D 4KHAB 5DNNC 5B2ID 4CAYA 3EPKA 3UT9C 4ZBJC 5B32C 4Z5TC 2DQNC 5B2JA 4YS3D 1S32D 5AV9D 3C1BA 1P34B 1P3KA 3AYWA 4XZQC 4H9RA 2YFVB 4Z66C 4J8UD 2Y2GA 5B1LC 2RIQA 2Y2MA 5CP6C 3REHB 1P3MA 3W98B 2JCHA 3C1CA 3VH5T 3UTAB 3AZJC 4WU9C 1KX4B 2RVQC 5GXQA 4CAYB 2HIOA 5CPJB 2PYOB 1P3FA 2NQBD 3A6NC 4WU8D 2Y2PA 5BNXA 3C1BB 3AV1D 3A1KA 3LJAA 1TAFB 5CPIB 3KFUG 4J8XB 3C1CB 5DNMD 3X1TC 1M19A 5GXQB 2HIOB 3MGRD 3TU4A 4J8VD 4ZUXB 1N1JA 5GSUC 2BYMA 4AWLB 5B31B 4G92C 5GT0C 5JRGC 4XUJD 5AY8C 1P3IC 5AV9B 1M18A 5AV8A 4J8UB 1TZYD 1F66C 4H9QA 4H9PB 5AV6A 3KWQC 1HQ3A 5JA4A 3REHC 4J8VA 2NQBB 1U35C 4WU8B 1KX4C 1P3BD 3AZID 3AV1B 5CPJC 5B32G 1P3GA 5AVCD 4H9QB 3REKD 3UTBD 5CPIC 3AZHD 5DNMB 4J8XC 1W2EA 3MGRB 4J8VB 3MGQA 3LZ0A 1ID3C 1BH9A 1AOIC 3X1SD 3AFAA 4XUJB 3AZED 3X1VD 5B2IC 5B32D 4Z5TD 2BYKB 3REJA 4XZQD 5AVCA 1TZYB 5AV9C 4YS3C 3WTPA 1S32C 1BH8A 1P3LC 5B1LD 5CP6D 4J8UC 1BH9B 3B6FD 4WU9D 2JE5A 1ULYA 2RVQD 1P3BB 3B0CT 3LELD 3MGSC 5AVCB 3WTPB 4WNNA 5DNNA 3REKB 1BH8B 4CSRB 3UT9A 3UTBB 5B32A 3AZHB 2HUEC 3AV2D 2F8NA 5C3IC 4H9NA 4QLCC 3X1TD 4Z66A 5B1LA 5DNMC 2UWXA 5CP6A 3X1SB 3MGRC 5GSUD 4NE5A 3REID 3AZJA 4WU9A 1A7WA 3AZEB 3X1VB 3AZMC 5JRGD 4ZBJB 4R8PC 4Z5TB 5B32B 3A6NA 4XUJC 1M1AC 3FDDA 3R45A 4XZQB 5B1LB 1F66D 5CP6B 1TZYC 2FJ7D 3W97A 3KWQD 4WU9B 3X1TA 3AZKC 5CPKD 1KX3C 3KUYC 1U35D 4KUDC 5AV5A 1P3BC 1EQZA 5GT0A 3AZIC 5G49A 3V9RA 1ZLAC 5AY8A 3W96A 1P3IA 2NZDD 4KHAA 3AV2B 3REKC 3UTBC 3X1TB 5B24C 1F66A 4YM6C 3REIB 5GSUB 2YFVA 1ID3D 3AZFD 1P3PC 1AOID 4G92B 2L5AA 1KX5C 5G49B 5JRGB 3REHA 3X1SC 3V9RB 4LD9D 5AY8B 4G91C 1U35A 3W98A 1KX4A 3UTAA 3AZEC 3X1VC 5CPJA 2PYOA 2F8NK 2CWEA 3AZLC 1F66B 3KXBC 2FJ7B 1P3LD 3KWQB 1TAFA 5CPIA 4DRBA 4J8XA 5CPKB 3B6FC 1HTAA 1U35B 1ID3A 1AOIA 3MGSD 4ZUXA 3LELC 5B31A 5B2IA 3KSYA 4YS3A 1S32A 5AV9A 4QLCD 5GT3C 3VH6W 3MNNC 3AV2C 1P3LA 4UUZB 1P3AC 1ID3B 3AZFB 4J8UA 1AOIB 2YFWB 4H9PA 3REIC 3AZMD 1P3OD 5B2IB 5B40C 4R8PD 4EO5C 3MGSA 3WAAD 3B0BA 1M1AD 2NQBA 4WU8A 4YS3B 1S32B 3AV1A 3LZ1C 3AZND 1P3LB 1R4VA 3WA9C 4WJ3C 2FJ7C 3AZKD 5DNMA 1KX3D 3KUYD 4KUDD 3MGSB 3MGRA 5CPKC 4NE3A 3AZMA 3O62C 3VH5A 1ZLAD 4R8PA 4XUJA 1M1AA 2HUEB 2NZDC 5C3IB 4QLCB 5B24D 3F6TA 2BYKA 4H9SC 1TZYA 4YM6D 2Y2NA 4E44A 1P3PD 1KX5D 5B33C 3AZMB 3W99C 3AZFC 1P3OB 4R8PB 3KUYA 3WAAB 4LD9C 1M1AB 4WZSB 1P3BA 3AZIA 1JFIB 3H0MC 2ZY5A 1ZLAA 3AZLD 3KXBD 3REKA 4CSRA 3UTBA 3AZKB 3AZHA 2J8PA 1KX3B 3KUYB 4KUDB 1P3PA 3AZIB 2CV5C 3X1SA 1ZLAB 3AZEA 3X1VA 5BS7C 3NQJA 5B24B 4Z5TA 3AZLA 3WTPE 5GT3D 3KXBA 4XZQA 4YM6B 3MNND 3LJAC 1P3AD 5B0ZD 1P3PB 4KGCD 5B1MD 1KX5B 2AROD 3B6FA 4G91B 3MGPC 5BO0B 5B40D 4WV4B 3NQJB 1P3OC 3RELD 3WAAC 3LELA 5B0YD 3AZLB 3KXBB 3LZ1D 3B0DC 3AZNC 4DQYB 3P5JB 3WKJC 1T3UA 3B6FB 3WA9D 5GT3A 3IP4C 3AV2A 1P3AA 3NQUA 3LELB 3REIA 2IO5C 5GSUA 3O62D 4X23D 4HGAC 5F99C 5JRGA 5E5AD 3H0LC 5GT3B 3LZ1A 3MNNB 5AVBC 1P3AB 5B0ZB 3NQUB 5B1MB 3WA9A 2FJ7A 5B33D 3B0CW 3KWQA 3W99D 1P34D 5B40B 4EO5B 5CPKA 3RELB 1PZRA 3LZ0C 5B0YB 3VH6T 1F1EA 3O62A 3LZ1B 3AFAC 3AL0C 2W8SA 2Y2LA 2JSSA 5FUGB 2NZDA 3WA9B 5B2JD 4J8WC 1H3OB 1P3KD 3REJC 3AYWD 4H9SA 1B67A 4JJNC 4UUZA 5B33A 4Z2MH 2ZY3A 3O62B 3AZFA 2CV5D 1P3MD 5BNVB 2YFWA 3C1CD 2F8NH 4LD9A 5E5AB 3MVDC 5GXQD 3B6GC 2NZDB 1P3FD 2LY8A 3EPJA 3LJAD 5B33B 5B0ZC 3W99B 3H0RC 4KGCC 5B1MC 2AROC 4LD9B 3MGPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG C;  3TU4 D;  2CV5 A;  3REL C;  5KDM B;  3AN2 C;  5B0Y C;  5BS7 A;  3VH6 A;  5B2J B;  1P3K B;  3WKJ D;  3AYW B;  1M18 D;  5AV8 D;  4H9R B;  1M19 D;  4QLC A;  4DRA A;  3X1U C;  2CV5 B;  1P3M B;  3W97 C;  5AV6 D;  1HQ3 D;  3MGP A;  4E45 A;  5F99 D;  4X23 C;  1P3F B;  1P3O A;  5BNX B;  3WAA A;  5E5A C;  5AV5 C;  1EQZ C;  5AVB D;  3LJA B;  1P3G D;  1JFI A;  3AZN A;  3W96 C;  3WKJ A;  3VH5 W;  3MGP B;  1M19 B;  1P34 C;  3AZK A;  3TU4 B;  1KX3 A;  1N1J B;  3MGQ D;  2BYM B;  5BT1 C;  3LZ0 D;  4KUD A;  3AFA D;  3B0D B;  5F99 A;  3AZN B;  3W98 C;  3UTA C;  3WKJ B;  1M18 B;  5AV8 B;  4J8W D;  4Z2M G;  5AVB A;  2PYO C;  5B2J C;  3REJ D;  5B24 A;  3WTP D;  3C1B C;  2F8N G;  1P3K C;  3AYW C;  4YM6 A;  2IO5 B;  5AV6 B;  4JJN D;  4H9O A;  1HQ3 B;  4HGA B;  1KX5 A;  5F99 B;  5JA4 B;  1P3M C;  3MVD D;  3C1C C;  3B6G D;  5GXQ C;  2HIO C;  5BO0 A;  5AVB B;  4ZUX C;  1P3G B;  1P3F C;  5DNN D;  4AWL C;  5B31 C;  3UT9 D;  4J8W A;  4H9O B;  1BFM A;  2F8N D;  4Z66 D;  3AZG D;  3MGQ B;  3LZ0 B;  4JJN A;  1M19 C;  4NE6 A;  3TU4 C;  3AFA B;  3AZJ D;  3AN2 D;  3MVD A;  3B6G A;  3A6N D;  4J8W B;  2NQB C;  3REJ B;  4WU8 C;  3AV1 C;  1M18 C;  5AV8 C;  3X1U D;  3MNN A;  4JJN B;  5B0Z A;  4KGC A;  5B1M A;  3W97 D;  5CHL B;  2ARO A;  5AV6 C;  3MVD B;  3AZG A;  3B6G B;  1HQ3 C;  5B40 A;  4J8V C;  4NFT A;  3REL A;  5AV5 D;  1B6W A;  3AN2 A;  1EQZ D;  4WNN B;  5B0Y A;  5GT0 D;  5DNN B;  3UT9 B;  1P3G C;  5AY8 D;  1P3I D;  3W96 D;  4KGC B;  5FUG A;  2F8N B;  1WWI A;  4H9N B;  2ARO B;  4Z66 B;  3AZG B;  3X1U A;  1H3O A;  5BT1 D;  3AZJ B;  3AN2 B;  3MGQ C;  3REH D;  4X23 A;  3A6N B;  3W98 D;  5BNV A;  1KX4 D;  3UTA D;  5E5A A;  3R45 B;  5B31 G;  5CPJ D;  2PYO D;  1KU5 A;  3X1U B;  3C1B D;  5AVC C;  3WTP C;  3W97 B;  5CPI D;  4M6B A;  4J8X D;  3AZH C;  1P34 A;  3W99 A;  4X23 B;  1Q9C A;  5AV5 B;  1WWS A;  1EQZ B;  2HIO D;  5GT0 B;  4ZUX D;  1P3I B;  3W96 B;  5KDM A;  5B31 D;  4KHA B;  5DNN C;  5B2I D;  4CAY A;  3UT9 C;  4ZBJ C;  5B32 C;  4Z5T C;  5B2J A;  1P34 B;  4YS3 D;  1S32 D;  5AV9 D;  3C1B A;  1P3K A;  3AYW A;  4XZQ C;  4H9R A;  2YFV B;  4Z66 C;  4J8U D;  5B1L C;  5CP6 C;  3REH B;  1P3M A;  3W98 B;  3C1C A;  3AZJ C;  3VH5 T;  3UTA B;  4WU9 C;  1KX4 B;  2RVQ C;  5GXQ A;  4CAY B;  2HIO A;  5CPJ B;  2PYO B;  1P3F A;  2NQB D;  3A6N C;  4WU8 D;  5BNX A;  3C1B B;  3AV1 D;  3LJA A;  1TAF B;  5CPI B;  4J8X B;  3C1C B;  5DNM D;  3X1T C;  1M19 A;  5GXQ B;  2HIO B;  3MGR D;  3TU4 A;  4J8V D;  4ZUX B;  1N1J A;  5GSU C;  2BYM A;  4AWL B;  5B31 B;  4G92 C;  5GT0 C;  5JRG C;  4XUJ D;  5AY8 C;  1P3I C;  5AV9 B;  1M18 A;  5AV8 A;  4J8U B;  1TZY D;  1F66 C;  4H9Q A;  4H9P B;  5AV6 A;  3KWQ C;  1HQ3 A;  5JA4 A;  3REH C;  4J8V A;  2NQB B;  1U35 C;  4WU8 B;  1KX4 C;  1P3B D;  3AZI D;  3AV1 B;  5CPJ C;  5B32 G;  1P3G A;  5AVC D;  4H9Q B;  3REK D;  3UTB D;  5CPI C;  3AZH D;  5DNM B;  4J8X C;  3MGR B;  4J8V B;  3MGQ A;  3LZ0 A;  1ID3 C;  1BH9 A;  1AOI C;  3X1S D;  3AFA A;  4XUJ B;  3AZE D;  3X1V D;  5B2I C;  5B32 D;  4Z5T D;  2BYK B;  3REJ A;  4XZQ D;  5AVC A;  1TZY B;  5AV9 C;  4YS3 C;  3WTP A;  1S32 C;  1BH8 A;  1P3L C;  5B1L D;  5CP6 D;  4J8U C;  1BH9 B;  3B6F D;  4WU9 D;  1ULY A;  2RVQ D;  1P3B B;  3B0C T;  3LEL D;  3MGS C;  5AVC B;  3WTP B;  4WNN A;  5DNN A;  3REK B;  1BH8 B;  4CSR B;  3UT9 A;  3UTB B;  5B32 A;  3AZH B;  2HUE C;  3AV2 D;  2F8N A;  5C3I C;  4H9N A;  4QLC C;  3X1T D;  4Z66 A;  5B1L A;  5DNM C;  5CP6 A;  3X1S B;  3MGR C;  5GSU D;  4NE5 A;  3REI D;  3AZJ A;  4WU9 A;  1A7W A;  3AZE B;  3X1V B;  3AZM C;  5JRG D;  4ZBJ B;  4R8P C;  4Z5T B;  5B32 B;  3A6N A;  4XUJ C;  1M1A C;  3R45 A;  4XZQ B;  5B1L B;  1F66 D;  5CP6 B;  1TZY C;  2FJ7 D;  3W97 A;  3KWQ D;  4WU9 B;  3X1T A;  3AZK C;  5CPK D;  1KX3 C;  3KUY C;  1U35 D;  4KUD C;  5AV5 A;  1P3B C;  1EQZ A;  5GT0 A;  3AZI C;  5G49 A;  3V9R A;  1ZLA C;  5AY8 A;  3W96 A;  1P3I A;  2NZD D;  4KHA A;  3AV2 B;  3REK C;  3UTB C;  3X1T B;  5B24 C;  1F66 A;  4YM6 C;  3REI B;  5GSU B;  2YFV A;  1ID3 D;  3AZF D;  1P3P C;  1AOI D;  4G92 B;  2L5A A;  1KX5 C;  5G49 B;  5JRG B;  3REH A;  3X1S C;  3V9R B;  4LD9 D;  5AY8 B;  4G91 C;  1U35 A;  3W98 A;  1KX4 A;  3UTA A;  3AZE C;  3X1V C;  5CPJ A;  2PYO A;  2F8N K;  2CWE A;  3AZL C;  1F66 B;  3KXB C;  2FJ7 B;  1P3L D;  3KWQ B;  1TAF A;  5CPI A;  4DRB A;  4J8X A;  5CPK B;  3B6F C;  1HTA A;  1U35 B;  1ID3 A;  1AOI A;  3MGS D;  4ZUX A;  3LEL C;  5B31 A;  5B2I A;  3KSY A;  4YS3 A;  1S32 A;  5AV9 A;  4QLC D;  5GT3 C;  3VH6 W;  3MNN C;  3AV2 C;  1P3L A;  4UUZ B;  1P3A C;  1ID3 B;  3AZF B;  4J8U A;  1AOI B;  2YFW B;  4H9P A;  3REI C;  3AZM D;  1P3O D;  5B2I B;  5B40 C;  4R8P D;  4EO5 C;  3MGS A;  3WAA D;  3B0B A;  1M1A D;  2NQB A;  4WU8 A;  4YS3 B;  1S32 B;  3AV1 A;  3LZ1 C;  3AZN D;  1P3L B;  1R4V A;  3WA9 C;  2FJ7 C;  3AZK D;  5DNM A;  1KX3 D;  3KUY D;  4KUD D;  3MGS B;  3MGR A;  5CPK C;  4NE3 A;  3AZM A;  3O62 C;  3VH5 A;  1ZLA D;  4R8P A;  4XUJ A;  1M1A A;  2HUE B;  2NZD C;  5C3I B;  4QLC B;  5B24 D;  2BYK A;  4H9S C;  1TZY A;  4YM6 D;  4E44 A;  1P3P D;  1KX5 D;  5B33 C;  3AZM B;  3W99 C;  3AZF C;  1P3O B;  4R8P B;  3KUY A;  3WAA B;  4LD9 C;  1M1A B;  4WZS B;  1P3B A;  3AZI A;  1JFI B;  1ZLA A;  3AZL D;  3KXB D;  3REK A;  4CSR A;  3UTB A;  3AZK B;  3AZH A;  1KX3 B;  3KUY B;  4KUD B;  1P3P A;  3AZI B;  2CV5 C;  3X1S A;  1ZLA B;  3AZE A;  3X1V A;  5BS7 C;  3NQJ A;  5B24 B;  4Z5T A;  3AZL A;  3WTP E;  5GT3 D;  3KXB A;  4XZQ A;  4YM6 B;  3MNN D;  3LJA C;  1P3A D;  5B0Z D;  1P3P B;  4KGC D;  5B1M D;  1KX5 B;  2ARO D;  3B6F A;  4G91 B;  3MGP C;  5BO0 B;  5B40 D;  4WV4 B;  3NQJ B;  1P3O C;  3REL D;  3WAA C;  3LEL A;  5B0Y D;  3AZL B;  3KXB B;  3LZ1 D;  3B0D C;  3AZN C;  3WKJ C;  3WA9 D;  3B6F B;  5GT3 A;  3AV2 A;  1P3A A;  3NQU A;  3LEL B;  3REI A;  2IO5 C;  5GSU A;  3O62 D;  4X23 D;  4HGA C;  5F99 C;  5JRG A;  5E5A D;  5GT3 B;  3LZ1 A;  3MNN B;  5AVB C;  1P3A B;  5B0Z B;  3NQU B;  5B1M B;  3WA9 A;  2FJ7 A;  5B33 D;  3B0C W;  3KWQ A;  3W99 D;  1P34 D;  5B40 B;  4EO5 B;  5CPK A;  3REL B;  3LZ0 C;  5B0Y B;  3VH6 T;  1F1E A;  3O62 A;  3LZ1 B;  3AFA C;  5FUG B;  2JSS A;  2NZD A;  3WA9 B;  5B2J D;  4J8W C;  1H3O B;  1P3K D;  3REJ C;  3AYW D;  4H9S A;  1B67 A;  4JJN C;  4UUZ A;  5B33 A;  4Z2M H;  3AZF A;  3O62 B;  2CV5 D;  1P3M D;  5BNV B;  2YFW A;  3C1C D;  2F8N H;  4LD9 A;  5E5A B;  3MVD C;  5GXQ D;  3B6G C;  2NZD B;  1P3F D;  2LY8 A;  3LJA D;  5B33 B;  5B0Z C;  3W99 B;  4KGC C;  5B1M C;  2ARO C;  4LD9 B;  3MGP D; 
#chains in the Genus database with same CATH topology
 3AZG C;  3TU4 D;  2CV5 A;  3EPL A;  3REL C;  5KDM B;  3AN2 C;  5B0Y C;  2XD1 A;  5BS7 A;  3VH6 A;  5B2J B;  1P3K B;  3WKJ D;  3AYW B;  1M18 D;  5AV8 D;  4H9R B;  1M19 D;  4QLC A;  4DRA A;  3X1U C;  2CV5 B;  1P3M B;  3W97 C;  5AV6 D;  2Y2K A;  1HQ3 D;  3MGP A;  2XD5 A;  4E45 A;  5F99 D;  4X23 C;  1P3F B;  1P3O A;  5BNX B;  3WAA A;  5E5A C;  5AV5 C;  2VQR A;  2Y2J A;  1EQZ C;  5AVB D;  3LJA B;  1P3G D;  1JFI A;  3AZN A;  3W96 C;  3WKJ A;  3VH5 W;  3MGP B;  1M19 B;  1P34 C;  3AZK A;  2Y2H A;  3TU4 B;  1KX3 A;  1N1J B;  3MGQ D;  2BYM B;  5BT1 C;  3LZ0 D;  4KUD A;  2ZY4 A;  3AFA D;  3B0D B;  5F99 A;  3AZN B;  3W98 C;  3UTA C;  3WKJ B;  1M18 B;  5AV8 B;  2F2A C;  4J8W D;  4Z2M G;  5AVB A;  2PYO C;  5B2J C;  3REJ D;  5B24 A;  3WTP D;  3C1B C;  2F8N G;  1P3K C;  3AYW C;  4YM6 A;  2IO5 B;  5AV6 B;  4JJN D;  4H9O A;  1HQ3 B;  4HGA B;  1KX5 A;  5F99 B;  5JA4 B;  1P3M C;  2Y2O A;  3MVD D;  3C1C C;  3B6G D;  3EG5 B;  5GXQ C;  2HIO C;  2Y2I A;  5BO0 A;  5AVB B;  4ZUX C;  2ZM5 A;  1P3G B;  1P3F C;  5DNN D;  4AWL C;  5B31 C;  3UT9 D;  4J8W A;  4H9O B;  4UPK A;  1BFM A;  2F8N D;  4Z66 D;  3AZG D;  3MGQ B;  3LZ0 B;  4JJN A;  1M19 C;  4NE6 A;  3TU4 C;  3AFA B;  2G5H C;  3AZJ D;  2Y2Q A;  3AN2 D;  3MVD A;  3B6G A;  3A6N D;  4J8W B;  2NQB C;  3REJ B;  4WU8 C;  3AV1 C;  1M18 C;  5AV8 C;  3X1U D;  3MNN A;  4JJN B;  5B0Z A;  4KGC A;  5B1M A;  3W97 D;  5CHL B;  2ARO A;  5AV6 C;  3MVD B;  1Z2C B;  3AZG A;  3B6G B;  1HQ3 C;  3EPH A;  5B40 A;  4J8V C;  4NFT A;  3REL A;  5AV5 D;  1B6W A;  3AN2 A;  1EQZ D;  4WNN B;  5B0Y A;  5DNN B;  5GT0 D;  3UT9 B;  1P3G C;  5AY8 D;  1P3I D;  2FFF B;  3W96 D;  4KGC B;  5FUG A;  2F8N B;  1WWI A;  2DF4 C;  4H9N B;  2ARO B;  4Z66 B;  3AZG B;  3X1U A;  1H3O A;  2ZY2 A;  5BT1 D;  3AZJ B;  3AN2 B;  3MGQ C;  2BG1 A;  3REH D;  4X23 A;  3A6N B;  3W98 D;  5BNV A;  1KX4 D;  3UTA D;  5E5A A;  3R45 B;  5B31 G;  5CPJ D;  2PYO D;  1KU5 A;  2G5I C;  3X1U B;  3C1B D;  3A1I A;  5AVC C;  3WTP C;  3W97 B;  5CPI D;  4M6B A;  4J8X D;  3AZH C;  1P34 A;  3W99 A;  4X23 B;  1Q9C A;  5AV5 B;  1WWS A;  1EQZ B;  2HIO D;  5GT0 B;  4ZUX D;  1P3I B;  3W96 B;  5KDM A;  5B31 D;  4KHA B;  5DNN C;  5B2I D;  4CAY A;  3EPK A;  3UT9 C;  4ZBJ C;  5B32 C;  4Z5T C;  2DQN C;  5B2J A;  4YS3 D;  1S32 D;  5AV9 D;  3C1B A;  1P34 B;  1P3K A;  3AYW A;  4XZQ C;  4H9R A;  2YFV B;  4Z66 C;  4J8U D;  2Y2G A;  5B1L C;  2RIQ A;  2Y2M A;  5CP6 C;  3REH B;  1P3M A;  3W98 B;  2JCH A;  3C1C A;  3VH5 T;  3UTA B;  3AZJ C;  4WU9 C;  1KX4 B;  2RVQ C;  5GXQ A;  4CAY B;  2HIO A;  5CPJ B;  2PYO B;  1P3F A;  2NQB D;  3A6N C;  4WU8 D;  2Y2P A;  5BNX A;  3C1B B;  3AV1 D;  3A1K A;  3LJA A;  1TAF B;  5CPI B;  3KFU G;  4J8X B;  3C1C B;  5DNM D;  3X1T C;  1M19 A;  5GXQ B;  2HIO B;  3MGR D;  3TU4 A;  4J8V D;  4ZUX B;  1N1J A;  5GSU C;  2BYM A;  4AWL B;  5B31 B;  4G92 C;  5GT0 C;  5JRG C;  4XUJ D;  5AY8 C;  1P3I C;  5AV9 B;  1M18 A;  5AV8 A;  4J8U B;  1TZY D;  1F66 C;  4H9Q A;  4H9P B;  5AV6 A;  3KWQ C;  1HQ3 A;  5JA4 A;  3REH C;  4J8V A;  2NQB B;  1U35 C;  4WU8 B;  1KX4 C;  1P3B D;  3AZI D;  3AV1 B;  5CPJ C;  5B32 G;  1P3G A;  5AVC D;  4H9Q B;  3REK D;  3UTB D;  5CPI C;  3AZH D;  5DNM B;  4J8X C;  1W2E A;  3MGR B;  4J8V B;  3MGQ A;  3LZ0 A;  1ID3 C;  1BH9 A;  1AOI C;  3X1S D;  3AFA A;  4XUJ B;  3AZE D;  3X1V D;  5B2I C;  5B32 D;  4Z5T D;  2BYK B;  3REJ A;  4XZQ D;  5AVC A;  1TZY B;  5AV9 C;  4YS3 C;  3WTP A;  1S32 C;  1BH8 A;  1P3L C;  5B1L D;  5CP6 D;  4J8U C;  1BH9 B;  3B6F D;  4WU9 D;  2JE5 A;  1ULY A;  2RVQ D;  1P3B B;  3B0C T;  3LEL D;  3MGS C;  5AVC B;  3WTP B;  4WNN A;  5DNN A;  3REK B;  1BH8 B;  4CSR B;  3UT9 A;  3UTB B;  5B32 A;  3AZH B;  2HUE C;  3AV2 D;  2F8N A;  5C3I C;  4H9N A;  4QLC C;  3X1T D;  4Z66 A;  5B1L A;  5DNM C;  2UWX A;  5CP6 A;  3X1S B;  3MGR C;  5GSU D;  4NE5 A;  3REI D;  3AZJ A;  4WU9 A;  1A7W A;  3AZE B;  3X1V B;  3AZM C;  5JRG D;  4ZBJ B;  4R8P C;  4Z5T B;  5B32 B;  3A6N A;  4XUJ C;  1M1A C;  3FDD A;  3R45 A;  4XZQ B;  5B1L B;  1F66 D;  5CP6 B;  1TZY C;  2FJ7 D;  3W97 A;  3KWQ D;  4WU9 B;  3X1T A;  3AZK C;  5CPK D;  1KX3 C;  3KUY C;  1U35 D;  4KUD C;  5AV5 A;  1P3B C;  1EQZ A;  5GT0 A;  3AZI C;  5G49 A;  3V9R A;  1ZLA C;  5AY8 A;  3W96 A;  1P3I A;  2NZD D;  4KHA A;  3AV2 B;  3REK C;  3UTB C;  3X1T B;  5B24 C;  1F66 A;  4YM6 C;  3REI B;  5GSU B;  2YFV A;  1ID3 D;  3AZF D;  1P3P C;  1AOI D;  4G92 B;  2L5A A;  1KX5 C;  5G49 B;  5JRG B;  3REH A;  3X1S C;  3V9R B;  4LD9 D;  5AY8 B;  4G91 C;  1U35 A;  3W98 A;  1KX4 A;  3UTA A;  3AZE C;  3X1V C;  5CPJ A;  2PYO A;  2F8N K;  2CWE A;  3AZL C;  1F66 B;  3KXB C;  2FJ7 B;  1P3L D;  3KWQ B;  1TAF A;  5CPI A;  4DRB A;  4J8X A;  5CPK B;  3B6F C;  1HTA A;  1U35 B;  1ID3 A;  1AOI A;  3MGS D;  4ZUX A;  3LEL C;  5B31 A;  5B2I A;  3KSY A;  4YS3 A;  1S32 A;  5AV9 A;  4QLC D;  5GT3 C;  3VH6 W;  3MNN C;  3AV2 C;  1P3L A;  4UUZ B;  1P3A C;  1ID3 B;  3AZF B;  4J8U A;  1AOI B;  2YFW B;  4H9P A;  3REI C;  3AZM D;  1P3O D;  5B2I B;  5B40 C;  4R8P D;  4EO5 C;  3MGS A;  3WAA D;  3B0B A;  1M1A D;  2NQB A;  4WU8 A;  4YS3 B;  1S32 B;  3AV1 A;  3LZ1 C;  3AZN D;  1P3L B;  1R4V A;  3WA9 C;  4WJ3 C;  2FJ7 C;  3AZK D;  5DNM A;  1KX3 D;  3KUY D;  4KUD D;  3MGS B;  3MGR A;  5CPK C;  4NE3 A;  3AZM A;  3O62 C;  3VH5 A;  1ZLA D;  4R8P A;  4XUJ A;  1M1A A;  2HUE B;  2NZD C;  5C3I B;  4QLC B;  5B24 D;  3F6T A;  2BYK A;  4H9S C;  1TZY A;  4YM6 D;  2Y2N A;  4E44 A;  1P3P D;  1KX5 D;  5B33 C;  3AZM B;  3W99 C;  3AZF C;  1P3O B;  4R8P B;  3KUY A;  3WAA B;  4LD9 C;  1M1A B;  4WZS B;  1P3B A;  3AZI A;  1JFI B;  3H0M C;  2ZY5 A;  1ZLA A;  3AZL D;  3KXB D;  3REK A;  4CSR A;  3UTB A;  3AZK B;  3AZH A;  2J8P A;  1KX3 B;  3KUY B;  4KUD B;  1P3P A;  3AZI B;  2CV5 C;  3X1S A;  1ZLA B;  3AZE A;  3X1V A;  5BS7 C;  3NQJ A;  5B24 B;  4Z5T A;  3AZL A;  3WTP E;  5GT3 D;  3KXB A;  4XZQ A;  4YM6 B;  3MNN D;  3LJA C;  1P3A D;  5B0Z D;  1P3P B;  4KGC D;  5B1M D;  1KX5 B;  2ARO D;  3B6F A;  4G91 B;  3MGP C;  5BO0 B;  5B40 D;  4WV4 B;  3NQJ B;  1P3O C;  3REL D;  3WAA C;  3LEL A;  5B0Y D;  3AZL B;  3KXB B;  3LZ1 D;  3B0D C;  3AZN C;  4DQY B;  3P5J B;  3WKJ C;  1T3U A;  3B6F B;  3WA9 D;  5GT3 A;  3IP4 C;  3AV2 A;  1P3A A;  3NQU A;  3LEL B;  3REI A;  2IO5 C;  5GSU A;  3O62 D;  4X23 D;  4HGA C;  5F99 C;  5JRG A;  5E5A D;  3H0L C;  5GT3 B;  3LZ1 A;  3MNN B;  5AVB C;  1P3A B;  5B0Z B;  3NQU B;  5B1M B;  3WA9 A;  2FJ7 A;  5B33 D;  3B0C W;  3KWQ A;  3W99 D;  1P34 D;  5B40 B;  4EO5 B;  5CPK A;  3REL B;  1PZR A;  3LZ0 C;  5B0Y B;  3VH6 T;  1F1E A;  3O62 A;  3LZ1 B;  3AFA C;  3AL0 C;  2W8S A;  2Y2L A;  2JSS A;  5FUG B;  2NZD A;  3WA9 B;  5B2J D;  4J8W C;  1H3O B;  1P3K D;  3REJ C;  3AYW D;  4H9S A;  1B67 A;  4JJN C;  4UUZ A;  5B33 A;  4Z2M H;  2ZY3 A;  3O62 B;  3AZF A;  2CV5 D;  1P3M D;  5BNV B;  2YFW A;  3C1C D;  2F8N H;  4LD9 A;  5E5A B;  3MVD C;  5GXQ D;  3B6G C;  2NZD B;  1P3F D;  2LY8 A;  3EPJ A;  3LJA D;  5B33 B;  5B0Z C;  3W99 B;  3H0R C;  4KGC C;  5B1M C;  2ARO C;  4LD9 B;  3MGP D; 
#chains in the Genus database with same CATH homology
 3AZG C;  3TU4 D;  2CV5 A;  3EPL A;  3REL C;  5KDM B;  3AN2 C;  5B0Y C;  2XD1 A;  5BS7 A;  3VH6 A;  5B2J B;  1P3K B;  3WKJ D;  3AYW B;  1M18 D;  5AV8 D;  4H9R B;  1M19 D;  4QLC A;  4DRA A;  3X1U C;  2CV5 B;  1P3M B;  3W97 C;  5AV6 D;  2Y2K A;  1HQ3 D;  3MGP A;  2XD5 A;  4E45 A;  5F99 D;  4X23 C;  1P3F B;  1P3O A;  5BNX B;  3WAA A;  5E5A C;  5AV5 C;  2VQR A;  2Y2J A;  1EQZ C;  5AVB D;  3LJA B;  1P3G D;  1JFI A;  3AZN A;  3W96 C;  3WKJ A;  3VH5 W;  3MGP B;  1M19 B;  1P34 C;  3AZK A;  2Y2H A;  3TU4 B;  1KX3 A;  1N1J B;  3MGQ D;  2BYM B;  5BT1 C;  3LZ0 D;  4KUD A;  2ZY4 A;  3AFA D;  3B0D B;  5F99 A;  3AZN B;  3W98 C;  3UTA C;  3WKJ B;  1M18 B;  5AV8 B;  2F2A C;  4J8W D;  4Z2M G;  5AVB A;  2PYO C;  5B2J C;  3REJ D;  5B24 A;  3WTP D;  3C1B C;  2F8N G;  1P3K C;  3AYW C;  4YM6 A;  2IO5 B;  5AV6 B;  4JJN D;  4H9O A;  1HQ3 B;  4HGA B;  1KX5 A;  5F99 B;  5JA4 B;  1P3M C;  2Y2O A;  3MVD D;  3C1C C;  3B6G D;  3EG5 B;  5GXQ C;  2HIO C;  2Y2I A;  5BO0 A;  5AVB B;  4ZUX C;  2ZM5 A;  1P3G B;  1P3F C;  5DNN D;  4AWL C;  5B31 C;  3UT9 D;  4J8W A;  4H9O B;  4UPK A;  1BFM A;  2F8N D;  4Z66 D;  3AZG D;  3MGQ B;  3LZ0 B;  4JJN A;  1M19 C;  4NE6 A;  3TU4 C;  3AFA B;  2G5H C;  3AZJ D;  2Y2Q A;  3AN2 D;  3MVD A;  3B6G A;  3A6N D;  4J8W B;  2NQB C;  3REJ B;  4WU8 C;  3AV1 C;  1M18 C;  5AV8 C;  3X1U D;  3MNN A;  4JJN B;  5B0Z A;  4KGC A;  5B1M A;  3W97 D;  5CHL B;  2ARO A;  5AV6 C;  3MVD B;  1Z2C B;  3AZG A;  3B6G B;  1HQ3 C;  3EPH A;  5B40 A;  4J8V C;  4NFT A;  3REL A;  5AV5 D;  1B6W A;  3AN2 A;  1EQZ D;  4WNN B;  5B0Y A;  5DNN B;  5GT0 D;  3UT9 B;  1P3G C;  5AY8 D;  1P3I D;  2FFF B;  3W96 D;  4KGC B;  5FUG A;  2F8N B;  1WWI A;  2DF4 C;  4H9N B;  2ARO B;  4Z66 B;  3AZG B;  3X1U A;  1H3O A;  2ZY2 A;  5BT1 D;  3AZJ B;  3AN2 B;  3MGQ C;  2BG1 A;  3REH D;  4X23 A;  3A6N B;  3W98 D;  5BNV A;  1KX4 D;  3UTA D;  5E5A A;  3R45 B;  5B31 G;  5CPJ D;  2PYO D;  1KU5 A;  2G5I C;  3X1U B;  3C1B D;  3A1I A;  5AVC C;  3WTP C;  3W97 B;  5CPI D;  4M6B A;  4J8X D;  3AZH C;  1P34 A;  3W99 A;  4X23 B;  1Q9C A;  5AV5 B;  1WWS A;  1EQZ B;  2HIO D;  5GT0 B;  4ZUX D;  1P3I B;  3W96 B;  5KDM A;  5B31 D;  4KHA B;  5DNN C;  5B2I D;  4CAY A;  3EPK A;  3UT9 C;  4ZBJ C;  5B32 C;  4Z5T C;  2DQN C;  5B2J A;  4YS3 D;  1S32 D;  5AV9 D;  3C1B A;  1P34 B;  1P3K A;  3AYW A;  4XZQ C;  4H9R A;  2YFV B;  4Z66 C;  4J8U D;  2Y2G A;  5B1L C;  2RIQ A;  2Y2M A;  5CP6 C;  3REH B;  1P3M A;  3W98 B;  2JCH A;  3C1C A;  3VH5 T;  3UTA B;  3AZJ C;  4WU9 C;  1KX4 B;  2RVQ C;  5GXQ A;  4CAY B;  2HIO A;  5CPJ B;  2PYO B;  1P3F A;  2NQB D;  3A6N C;  4WU8 D;  2Y2P A;  5BNX A;  3C1B B;  3AV1 D;  3A1K A;  3LJA A;  1TAF B;  5CPI B;  3KFU G;  4J8X B;  3C1C B;  5DNM D;  3X1T C;  1M19 A;  5GXQ B;  2HIO B;  3MGR D;  3TU4 A;  4J8V D;  4ZUX B;  1N1J A;  5GSU C;  2BYM A;  4AWL B;  5B31 B;  4G92 C;  5GT0 C;  5JRG C;  4XUJ D;  5AY8 C;  1P3I C;  5AV9 B;  1M18 A;  5AV8 A;  4J8U B;  1TZY D;  1F66 C;  4H9Q A;  4H9P B;  5AV6 A;  3KWQ C;  1HQ3 A;  5JA4 A;  3REH C;  4J8V A;  2NQB B;  1U35 C;  4WU8 B;  1KX4 C;  1P3B D;  3AZI D;  3AV1 B;  5CPJ C;  5B32 G;  1P3G A;  5AVC D;  4H9Q B;  3REK D;  3UTB D;  5CPI C;  3AZH D;  5DNM B;  4J8X C;  1W2E A;  3MGR B;  4J8V B;  3MGQ A;  3LZ0 A;  1ID3 C;  1BH9 A;  1AOI C;  3X1S D;  3AFA A;  4XUJ B;  3AZE D;  3X1V D;  5B2I C;  5B32 D;  4Z5T D;  2BYK B;  3REJ A;  4XZQ D;  5AVC A;  1TZY B;  5AV9 C;  4YS3 C;  3WTP A;  1S32 C;  1BH8 A;  1P3L C;  5B1L D;  5CP6 D;  4J8U C;  1BH9 B;  3B6F D;  4WU9 D;  2JE5 A;  1ULY A;  2RVQ D;  1P3B B;  3B0C T;  3LEL D;  3MGS C;  5AVC B;  3WTP B;  4WNN A;  5DNN A;  3REK B;  1BH8 B;  4CSR B;  3UT9 A;  3UTB B;  5B32 A;  3AZH B;  2HUE C;  3AV2 D;  2F8N A;  5C3I C;  4H9N A;  4QLC C;  3X1T D;  4Z66 A;  5B1L A;  5DNM C;  2UWX A;  5CP6 A;  3X1S B;  3MGR C;  5GSU D;  4NE5 A;  3REI D;  3AZJ A;  4WU9 A;  1A7W A;  3AZE B;  3X1V B;  3AZM C;  5JRG D;  4ZBJ B;  4R8P C;  4Z5T B;  5B32 B;  3A6N A;  4XUJ C;  1M1A C;  3FDD A;  3R45 A;  4XZQ B;  5B1L B;  1F66 D;  5CP6 B;  1TZY C;  2FJ7 D;  3W97 A;  3KWQ D;  4WU9 B;  3X1T A;  3AZK C;  5CPK D;  1KX3 C;  3KUY C;  1U35 D;  4KUD C;  5AV5 A;  1P3B C;  1EQZ A;  5GT0 A;  3AZI C;  5G49 A;  3V9R A;  1ZLA C;  5AY8 A;  3W96 A;  1P3I A;  2NZD D;  4KHA A;  3AV2 B;  3REK C;  3UTB C;  3X1T B;  5B24 C;  1F66 A;  4YM6 C;  3REI B;  5GSU B;  2YFV A;  1ID3 D;  3AZF D;  1P3P C;  1AOI D;  4G92 B;  2L5A A;  1KX5 C;  5G49 B;  5JRG B;  3REH A;  3X1S C;  3V9R B;  4LD9 D;  5AY8 B;  4G91 C;  1U35 A;  3W98 A;  1KX4 A;  3UTA A;  3AZE C;  3X1V C;  5CPJ A;  2PYO A;  2F8N K;  2CWE A;  3AZL C;  1F66 B;  3KXB C;  2FJ7 B;  1P3L D;  3KWQ B;  1TAF A;  5CPI A;  4DRB A;  4J8X A;  5CPK B;  3B6F C;  1HTA A;  1U35 B;  1ID3 A;  1AOI A;  3MGS D;  4ZUX A;  3LEL C;  5B31 A;  5B2I A;  3KSY A;  4YS3 A;  1S32 A;  5AV9 A;  4QLC D;  5GT3 C;  3VH6 W;  3MNN C;  3AV2 C;  1P3L A;  4UUZ B;  1P3A C;  1ID3 B;  3AZF B;  4J8U A;  1AOI B;  2YFW B;  4H9P A;  3REI C;  3AZM D;  1P3O D;  5B2I B;  5B40 C;  4R8P D;  4EO5 C;  3MGS A;  3WAA D;  3B0B A;  1M1A D;  2NQB A;  4WU8 A;  4YS3 B;  1S32 B;  3AV1 A;  3LZ1 C;  3AZN D;  1P3L B;  1R4V A;  3WA9 C;  4WJ3 C;  2FJ7 C;  3AZK D;  5DNM A;  1KX3 D;  3KUY D;  4KUD D;  3MGS B;  3MGR A;  5CPK C;  4NE3 A;  3AZM A;  3O62 C;  3VH5 A;  1ZLA D;  4R8P A;  4XUJ A;  1M1A A;  2HUE B;  2NZD C;  5C3I B;  4QLC B;  5B24 D;  3F6T A;  2BYK A;  4H9S C;  1TZY A;  4YM6 D;  2Y2N A;  4E44 A;  1P3P D;  1KX5 D;  5B33 C;  3AZM B;  3W99 C;  3AZF C;  1P3O B;  4R8P B;  3KUY A;  3WAA B;  4LD9 C;  1M1A B;  4WZS B;  1P3B A;  3AZI A;  1JFI B;  3H0M C;  2ZY5 A;  1ZLA A;  3AZL D;  3KXB D;  3REK A;  4CSR A;  3UTB A;  3AZK B;  3AZH A;  2J8P A;  1KX3 B;  3KUY B;  4KUD B;  1P3P A;  3AZI B;  2CV5 C;  3X1S A;  1ZLA B;  3AZE A;  3X1V A;  5BS7 C;  3NQJ A;  5B24 B;  4Z5T A;  3AZL A;  3WTP E;  5GT3 D;  3KXB A;  4XZQ A;  4YM6 B;  3MNN D;  3LJA C;  1P3A D;  5B0Z D;  1P3P B;  4KGC D;  5B1M D;  1KX5 B;  2ARO D;  3B6F A;  4G91 B;  3MGP C;  5BO0 B;  5B40 D;  4WV4 B;  3NQJ B;  1P3O C;  3REL D;  3WAA C;  3LEL A;  5B0Y D;  3AZL B;  3KXB B;  3LZ1 D;  3B0D C;  3AZN C;  4DQY B;  3P5J B;  3WKJ C;  1T3U A;  3B6F B;  3WA9 D;  5GT3 A;  3IP4 C;  3AV2 A;  1P3A A;  3NQU A;  3LEL B;  3REI A;  2IO5 C;  5GSU A;  3O62 D;  4X23 D;  4HGA C;  5F99 C;  5JRG A;  5E5A D;  3H0L C;  5GT3 B;  3LZ1 A;  3MNN B;  5AVB C;  1P3A B;  5B0Z B;  3NQU B;  5B1M B;  3WA9 A;  2FJ7 A;  5B33 D;  3B0C W;  3KWQ A;  3W99 D;  1P34 D;  5B40 B;  4EO5 B;  5CPK A;  3REL B;  1PZR A;  3LZ0 C;  5B0Y B;  3VH6 T;  1F1E A;  3O62 A;  3LZ1 B;  3AFA C;  3AL0 C;  2W8S A;  2Y2L A;  2JSS A;  5FUG B;  2NZD A;  3WA9 B;  5B2J D;  4J8W C;  1H3O B;  1P3K D;  3REJ C;  3AYW D;  4H9S A;  1B67 A;  4JJN C;  4UUZ A;  5B33 A;  4Z2M H;  2ZY3 A;  3O62 B;  3AZF A;  2CV5 D;  1P3M D;  5BNV B;  2YFW A;  3C1C D;  2F8N H;  4LD9 A;  5E5A B;  3MVD C;  5GXQ D;  3B6G C;  2NZD B;  1P3F D;  2LY8 A;  3EPJ A;  3LJA D;  5B33 B;  5B0Z C;  3W99 B;  3H0R C;  4KGC C;  5B1M C;  2ARO C;  4LD9 B;  3MGP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...