3LJAB

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaB00
3WAAC 4XZQD 1P3FB 4R8PC 1A7WA 3KWQD 1H3OA 3C1BC 4E45A 1JFIB 3AN2A 1WWIA 3LELA 5AV9B 1P3MA 5BO0B 5B33C 2LY8A 4KGCC 3UT9B 3RELC 3WTPD 3REHB 2BYMB 4H9OA 5AVCD 2CV5B 4J8WD 1U35C 4KUDD 3AZEB 4Z66C 3WKJB 4WU8C 1F66A 5GT0B 5AV5A 5DNNA 5B1LD 3LZ1B 4G91C 4H9QA 5CPKD 3AN2C 4X23C 5F99C 1P3MC 3MNND 1R4VA 3AZGD 3MVDA 5B1MA 3AZHA 3UTBB 3LJAA 5CPJB 5GXQB 1ID3D 5B24A 5GSUA 3AZFB 3UTAC 2NQBB 1P3PD 1P3IB 4YM6A 4QLCB 1AOIA 1P34C 4DRAA 3W97A 3B0DC 3AV2D 5B2IA 1EQZD 1M18C 5B31A 4LD9A 4UUZB 3B6GD 2BYKA 3W96A 3KXBB 3AYWA 5GSUC 4Z5TD 3MGPD 3WA9D 3MGSA 3REJA 4XUJB 5AY8D 5BNVB 3A6ND 4JJND 3AFAA 1M1AC 5B31C 3MGQC 3REIA 3W98C 1BH9B 3AV1C 1P3FD 5B40A 1P3OA 3LZ0A 1HQ3C 2RVQD 4H9PB 4ZUXC 3AYWC 1P3KB 2PYOC 3X1TA 5AV9D 2HIOC 5B0YA 3X1VD 3W99B 4EO5B 5GT3C 3UT9D 4KHAA 3REHD 2F8NH 1P3GB 5JRGC 4WV4B 2CV5D 5AV6A 4CSRA 5B32A 3AFAC 3NQJA 4WU9B 3AZED 3REKB 1F1EA 4AWLB 2AROB 5CPIA 3WKJD 3KUYA 5GT0D 3X1UA 5B2JA 4NE3A 1P3OC 3LZ1D 4J8XC 3VH6W 4H9NB 5BS7A 2FJ7B 4J8UB 5C3IB 3X1TC 1KX4B 3AZKA 3VH5T 3UTBD 5AV6C 5B32C 5CPJD 5GXQD 5KDMB 1ZLAA 5CP6A 3AZFD 3KUYC 2F8NA 2NQBD 2L5AA 1S32C 1P3ID 4QLCD 5BT1C 3AZNA 4J8VA 3WAAA 3AZKC 4R8PA 1P3AC 1M19A 3C1CC 1H3OB 3C1BA 5DNMB 5CP6C 3KXBD 3LELB 1KX3C 1P3MB 4XZQC 4KGCA 3KWQC 3B6FB 4WNNA 4XUJD 1U35A 4Z66A 4WU8A 1F66B 3B0CW 5DNNB 5AV5B 3WTPC 1M19C 4G92C 5AVCC 4J8WC 4H9QB 4KUDC 3AZMA 5CHLB 4X23A 3X1VB 3B0DB 5F99A 2JSSA 1P3KD 1P3LA 3MVDB 3MGRA 5B1MB 5B1LC 3AZHB 1B6WA 3W99D 1P3BA 3LJAB 1N1JA 5B24B 1P3GD 2HUEC 4M6BA 3MNNC 3AZGC 3UTAA 4WU9D 3REKD 2AROD 4YM6B 1AOIB 3AZMC 1P34A 1KX5A 1ID3C 1TAFA 3W97B 4H9RA 2FJ7D 4J8UD 1P3LC 3MGRC 1KX4D 1P3PC 1BFMA 5B2IB 4CAYA 1M18A 5B31B 3X1SA 1P3BC 4LD9B 4ZBJC 3A6NA 3W96B 3AYWB 5B0ZA 3O62A 3AV2C 1EQZC 3MGSB 5AV8A 3REJB 3AZLA 3RELD 1TZYA 1KX5C 3TU4B 5JA4A 1JFIA 3AFAB 3MGPC 1M1AA 3MGQA 3X1SC 3REIB 3WTPE 2IO5B 3AV1A 3W98A 5B40B 5AY8C 4Z2MH 1P3OB 3LZ0B 1HQ3A 3A6NC 4ZUXA 5DNMD 4DRBA 5B0ZC 3R45A 5B31G 4JJNC 2PYOA 3O62C 3X1TB 3LELD 2HIOA 5AV8C 5B0YB 1P3MD 1P3FC 5GT3A 3AZLC 3B6FD 4KHAB 1TZYC 2RVQC 5JRGA 5AV6B 4CSRB 5B32B 2NZDB 3NQJB 5AV9C 3AZIA 5CPIB 1F66D 3KUYB 5DNND 5AV5D 3X1UB 3REHC 5B2JB 4J8XA 2CV5C 3AZEC 3WKJC 5E5AA 5GT0C 3MVDD 5B1MD 3AZHD 2YFWB 5AVBB 3LJAD 1ZLAB 5CP6B 5B24D 1Q9CA 3AZIC 5GSUD 2F8NB 3V9RA 3AZJB 5B32G 4NE6A 1S32A 4YM6D 5FUGA 3AZNB 1AOID 5CPJC 4J8VB 4YS3A 3VH5A 3W97D 3AZFC 2NQBC 5E5AC 3WAAB 4R8PB 4NE5A 5B2ID 4QLCC 1P3AA 1P3IC 5B31D 3C1CA 3C1BB 4LD9D 4H9SA 1B67A 3W96D 3AYWD 1KX3A 4XZQA 5B33B 4KGCB 3KWQA 3RELB 3MGSD 3REJD 2F8NG 1U35B 4YS3C 3TU4D 4Z66B 4WU8B 3AFAD 3WTPA 3REID 4XUJC 5AVCA 4G91B 4J8WA 5B40D 4H9SC 5BNXA 1P3OD 3LZ0D 3AZMB 3AN2B 4KUDA 4X23B 5F99B 1P3LB 3X1TD 3MGRB 2AROA 5B1LA 4H9OB 5B0YD 1P3BB 5CPKA 1N1JB 4HGAC 4ZBJB 3MNNA 3AZGA 5AV6D 5B32D 3UTAB 1P3KC 2NZDD 1BH8A 5CPID 3KUYD 3X1UD 5B2JD 2YFVA 1P34B 1KX5B 1ID3A 1P3GC 1TAFB 1WWSA 4H9RB 4WU9C 1P3PA 4AWLC 2AROC 1M18B 3X1SB 5CPKC 3NQUA 5GSUB 5B0ZB 5AVBD 1ZLAD 2FJ7C 3O62B 5CP6D 3AV2A 1EQZA 2F8ND 5AV8B 3AZJD 3AZLB 3B0BA 1TZYB 3B6GA 5JA4B 5DNMA 3AZND 5G49A 4J8VD 4Z5TA 3MGPA 1M1AB 3WA9A 3MGQB 3WAAD 3B6FA 3AV1B 3W98B 4R8PD 5AY8A 1M19D 1HTAA 1HQ3B 2BYKB 4ZUXB 3C1BD 3R45B 4JJNA 2PYOB 2HIOB 5B33D 1P3FA 5GT3B 4NFTA 4KGCD 3B6GC 5DNMC 5JRGB 4Z5TC 1U35D 4Z66D 3LELC 3WA9C 5AV9A 3X1VA 3AZIB 5BO0A 4WU8D 3UT9A 3B6FC 3REHA 2BYMA 4J8XB 2CV5A 3AZEA 3AZMD 3AN2D 3WKJA 4X23D 1F66C 5F99D 5E5AB 5GT0A 5DNNC 5AV5C 3MGRD 1P3LD 3LZ1A 1P3BD 3X1VC 3V9RB 3MVDC 3UTAD 3UT9C 5B1MC 3AZHC 1S32B 5FUGB 3UTBA 1KU5A 3LJAC 5CPJA 5GXQA 2CWEA 1P34D 1KX5D 4YS3B 5B24C 3AZFA 2NQBA 3AZKB 3VH6A 1P3AB 3LZ1C 4YM6C 4QLCA 1P3IA 1M18D 3C1CB 4Z2MG 3X1SD 3VH6T 1AOIC 3TU4A 3KSYA 3W97C 5B0ZD 1KX3B 4XZQB 2F8NK 3O62D 5B2IC 3KWQB 5AV8D 3UTBC 3AZLD 5GXQC 4LD9C 4UUZA 1TZYD 3W96C 3KXBA 4HGAB 1M1AD 3WTPB 3MGSC 3MGQD 1M19B 3REJC 4G92B 4XUJA 5AVCB 4J8WB 3AV1D 3W98D 5BNVA 3TU4C 5BNXB 4KUDB 1HQ3D 4ZUXD 2NZDA 2PYOD 4WNNB 5B1LB 2HIOD 3REIC 2IO5C 1BH9A 5GT3D 5B40C 5CPKB 4WZSB 3LZ0C 3KXBC 4H9PA 5JRGD 2HUEB 3MNNB 3AZGB 1P3KA 1BH8B 5B0YC 3AZID 3W99A 2YFWA 2YFVB 1ULYA 1ID3B 4J8XD 1P3GA 5AVBA 3B0CT 4WU9A 2NZDC 3REKA 1P3PB 5CPIC 3AZJA 5E5AD 3X1UC 4E44A 3VH5W 5B2JC 3NQUB 5BS7C 4H9NA 2FJ7A 4J8UA 1KX4A 3AV2B 1EQZB 3W99C 4EO5C 1S32D 3B6GB 5BT1D 5AVBC 5G49B 1ZLAC 5KDMA 4Z5TB 4YS3D 3REKC 3MGPB 3WA9B 4CAYB 3AZJC 5B33A 3AZKD 3RELA 1P3AD 5AY8B 3C1CD 3AZNC 3A6NB 4J8VC 4J8UC 5C3IC 4JJNB 1KX4C 1KX3D
chains in the Genus database with same CATH superfamily
3WAAC 4XZQD 1P3FB 4R8PC 1A7WA 3KWQD 1H3OA 3C1BC 4E45A 1JFIB 3AN2A 1WWIA 3H0LC 3LELA 5AV9B 1P3MA 5BO0B 5B33C 2LY8A 4KGCC 3UT9B 3RELC 3WTPD 3REHB 2BYMB 4H9OA 4DQYB 5AVCD 3F6TA 4J8WD 2CV5B 1U35C 2Y2KA 2ZM5A 3AZEB 4Z66C 4KUDD 3WKJB 4WU8C 1F66A 2Y2OA 5GT0B 5AV5A 5DNNA 5B1LD 3LZ1B 3A1IA 3P5JB 4G91C 2UWXA 4H9QA 5CPKD 3AN2C 4X23C 5F99C 1P3MC 3MNND 1R4VA 3AZGD 3MVDA 5B1MA 3AZHA 3UTBB 3LJAA 5CPJB 5GXQB 1ID3D 5B24A 5GSUA 2Y2NA 3AZFB 3UTAC 2NQBB 1P3PD 1P3IB 4YM6A 4QLCB 1AOIA 1P34C 2JCHA 4DRAA 3W97A 3B0DC 3AV2D 5B2IA 1EQZD 1M18C 5B31A 4LD9A 4UUZB 3B6GD 2BYKA 3W96A 3KXBB 3AYWA 5GSUC 4Z5TD 3MGPD 3WA9D 3MGSA 3REJA 4XUJB 5AY8D 5BNVB 3A6ND 4JJND 3AFAA 1M1AC 5B31C 3MGQC 2DQNC 3REIA 3W98C 1BH9B 3AV1C 1P3FD 5B40A 1P3OA 3LZ0A 1HQ3C 2RVQD 4H9PB 4ZUXC 2W8SA 3AYWC 3EPJA 1P3KB 2PYOC 3X1TA 5AV9D 2HIOC 5B0YA 3X1VD 2XD1A 3W99B 4EO5B 5GT3C 3UT9D 4KHAA 3REHD 2F8NH 1P3GB 5JRGC 4WV4B 2CV5D 5AV6A 4CSRA 5B32A 3AFAC 3NQJA 4WU9B 3AZED 2Y2QA 3REKB 1F1EA 4AWLB 1W2EA 2AROB 5CPIA 3WKJD 3KUYA 5GT0D 3X1UA 5B2JA 4NE3A 1P3OC 3LZ1D 4J8XC 3VH6W 4H9NB 5BS7A 2FJ7B 4J8UB 5C3IB 3X1TC 1KX4B 3AZKA 3VH5T 3UTBD 1T3UA 5AV6C 5B32C 5CPJD 5GXQD 5KDMB 1ZLAA 5CP6A 3AZFD 3KUYC 2F8NA 2NQBD 2L5AA 1S32C 1P3ID 4QLCD 5BT1C 3AZNA 2ZY2A 4J8VA 3WAAA 3AZKC 4R8PA 1P3AC 1M19A 3C1CC 1H3OB 3C1BA 5DNMB 5CP6C 3KXBD 3LELB 1KX3C 1P3MB 4XZQC 4KGCA 3KWQC 3B6FB 4WNNA 4XUJD 1U35A 3EPLA 4Z66A 4WU8A 3H0RC 3B0CW 1F66B 5DNNB 5AV5B 3WTPC 1M19C 4G92C 5AVCC 4J8WC 4H9QB 4KUDC 3AZMA 5CHLB 4X23A 3X1VB 3B0DB 5F99A 2JSSA 1P3KD 1P3LA 3MVDB 3MGRA 5B1MB 5B1LC 3AZHB 1B6WA 3W99D 1P3BA 3LJAB 1N1JA 2JE5A 3EPHA 5B24B 1P3GD 2HUEC 4M6BA 3MNNC 3AZGC 3UTAA 4WU9D 3REKD 2AROD 4YM6B 2Y2PA 3EPKA 1AOIB 3AZMC 1P34A 1KX5A 1ID3C 1TAFA 3W97B 4H9RA 2FJ7D 4J8UD 1P3LC 3MGRC 1KX4D 1P3PC 1BFMA 5B2IB 4CAYA 1M18A 5B31B 3X1SA 1P3BC 2Y2IA 2RIQA 4LD9B 4ZBJC 2G5IC 3A6NA 3W96B 3AL0C 3AYWB 5B0ZA 3O62A 3AV2C 1EQZC 3MGSB 5AV8A 3REJB 3AZLA 3RELD 1TZYA 1KX5C 3TU4B 5JA4A 2G5HC 1JFIA 3AFAB 3MGPC 1M1AA 3MGQA 3X1SC 3REIB 3WTPE 2IO5B 3AV1A 3W98A 5B40B 5AY8C 4Z2MH 1P3OB 3LZ0B 1HQ3A 3A6NC 4ZUXA 5DNMD 2ZY5A 4DRBA 3R45A 5B31G 5B0ZC 4JJNC 2PYOA 3O62C 3X1TB 3LELD 2HIOA 5AV8C 5B0YB 1P3MD 1P3FC 1PZRA 5GT3A 3AZLC 3B6FD 4KHAB 2ZY4A 1TZYC 2RVQC 5JRGA 5AV6B 4CSRB 5B32B 2NZDB 3NQJB 5AV9C 3AZIA 5CPIB 1F66D 3KUYB 5DNND 5AV5D 3X1UB 3REHC 5B2JB 4J8XA 2CV5C 3AZEC 3WKJC 5E5AA 5GT0C 3MVDD 5B1MD 3AZHD 2YFWB 5AVBB 3LJAD 1ZLAB 3KFUG 5CP6B 5B24D 1Q9CA 1Z2CB 3AZIC 5GSUD 2F8NB 3V9RA 3AZJB 5B32G 2Y2JA 4NE6A 1S32A 4YM6D 5FUGA 3AZNB 1AOID 5CPJC 4J8VB 4YS3A 3VH5A 3W97D 3AZFC 2NQBC 5E5AC 3WAAB 4R8PB 4NE5A 5B2ID 4QLCC 1P3AA 1P3IC 5B31D 3C1CA 3C1BB 4LD9D 4H9SA 1B67A 3W96D 3AYWD 1KX3A 4XZQA 5B33B 4KGCB 3KWQA 3RELB 3FDDA 3MGSD 3REJD 2F8NG 2ZY3A 1U35B 4YS3C 3TU4D 4Z66B 2J8PA 4WU8B 3AFAD 3WTPA 3REID 4XUJC 5AVCA 4G91B 4J8WA 5B40D 4H9SC 5BNXA 1P3OD 3LZ0D 3AZMB 3AN2B 4KUDA 4X23B 5F99B 1P3LB 3X1TD 3MGRB 2AROA 5B1LA 4H9OB 5B0YD 2Y2LA 1P3BB 5CPKA 1N1JB 4HGAC 4ZBJB 3MNNA 3AZGA 5AV6D 5B32D 3UTAB 1P3KC 2NZDD 1BH8A 5CPID 3KUYD 3X1UD 5B2JD 2YFVA 1P34B 1KX5B 1ID3A 1P3GC 1TAFB 1WWSA 4H9RB 4WU9C 1P3PA 4AWLC 2AROC 1M18B 3X1SB 5CPKC 3NQUA 5GSUB 5B0ZB 5AVBD 1ZLAD 2FJ7C 3O62B 5CP6D 3AV2A 1EQZA 2F8ND 5AV8B 3AZJD 3AZLB 3B0BA 1TZYB 3B6GA 5JA4B 5DNMA 3AZND 2FFFB 5G49A 3H0MC 4J8VD 4Z5TA 3MGPA 1M1AB 3WA9A 3MGQB 3WAAD 3B6FA 3AV1B 3W98B 4R8PD 5AY8A 2F2AC 1M19D 1HTAA 1HQ3B 2BYKB 4ZUXB 3C1BD 3R45B 4JJNA 2PYOB 2HIOB 5B33D 1P3FA 5GT3B 4NFTA 4KGCD 3B6GC 5DNMC 5JRGB 4Z5TC 1U35D 4Z66D 3LELC 3WA9C 5AV9A 3X1VA 3AZIB 5BO0A 4WU8D 3UT9A 3B6FC 3REHA 2BYMA 4J8XB 2CV5A 3AZEA 3AZMD 3AN2D 3WKJA 4X23D 1F66C 5F99D 5E5AB 5GT0A 5DNNC 5AV5C 3MGRD 1P3LD 3LZ1A 1P3BD 2BG1A 2Y2HA 3X1VC 3V9RB 3MVDC 3UTAD 3UT9C 5B1MC 3AZHC 1S32B 5FUGB 3UTBA 1KU5A 3LJAC 5CPJA 5GXQA 2CWEA 1P34D 1KX5D 4YS3B 5B24C 3AZFA 2NQBA 3AZKB 3VH6A 1P3AB 3LZ1C 4YM6C 4QLCA 1P3IA 1M18D 3C1CB 4Z2MG 3X1SD 3VH6T 1AOIC 3TU4A 3KSYA 3W97C 5B0ZD 1KX3B 4XZQB 2F8NK 3O62D 5B2IC 2DF4C 3KWQB 5AV8D 3UTBC 3AZLD 5GXQC 4LD9C 4UUZA 1TZYD 3W96C 3KXBA 4HGAB 2Y2GA 1M1AD 3WTPB 3MGSC 3MGQD 1M19B 3REJC 4G92B 4XUJA 5AVCB 4J8WB 3AV1D 2XD5A 5BNVA 3TU4C 5BNXB 3W98D 4KUDB 1HQ3D 4ZUXD 2NZDA 2PYOD 4WNNB 5B1LB 2HIOD 3REIC 2IO5C 1BH9A 5GT3D 5B40C 5CPKB 3A1KA 4WZSB 3LZ0C 2VQRA 3KXBC 4H9PA 2Y2MA 5JRGD 2HUEB 3MNNB 3AZGB 1P3KA 1BH8B 5B0YC 3AZID 3W99A 2YFWA 2YFVB 1ULYA 1ID3B 4J8XD 1P3GA 5AVBA 3B0CT 3EG5B 4WU9A 2NZDC 3REKA 1P3PB 5CPIC 3AZJA 5E5AD 3X1UC 4E44A 3VH5W 5B2JC 3NQUB 5BS7C 4H9NA 2FJ7A 4J8UA 1KX4A 3AV2B 4WJ3C 1EQZB 3W99C 4EO5C 1S32D 3B6GB 5BT1D 5AVBC 5G49B 4UPKA 1ZLAC 5KDMA 4Z5TB 4YS3D 3REKC 3MGPB 3WA9B 3IP4C 4CAYB 3AZJC 5B33A 3AZKD 3RELA 1P3AD 5AY8B 3C1CD 3AZNC 3A6NB 4J8VC 4J8UC 5C3IC 4JJNB 1KX4C 1KX3D
chains in the Genus database with same CATH topology
3WAAC 4XZQD 1P3FB 4R8PC 1A7WA 3KWQD 1H3OA 3C1BC 4E45A 1JFIB 3AN2A 1WWIA 3H0LC 3LELA 5AV9B 1P3MA 5BO0B 5B33C 2LY8A 4KGCC 3UT9B 3RELC 3WTPD 3REHB 2BYMB 4H9OA 4DQYB 5AVCD 3F6TA 4J8WD 2CV5B 1U35C 2Y2KA 2ZM5A 3AZEB 4Z66C 4KUDD 3WKJB 4WU8C 1F66A 2Y2OA 5GT0B 5AV5A 5DNNA 5B1LD 3LZ1B 3A1IA 3P5JB 4G91C 2UWXA 4H9QA 5CPKD 3AN2C 4X23C 5F99C 1P3MC 3MNND 1R4VA 3AZGD 3MVDA 5B1MA 3AZHA 3UTBB 3LJAA 5CPJB 5GXQB 1ID3D 5B24A 5GSUA 2Y2NA 3AZFB 3UTAC 2NQBB 1P3PD 1P3IB 4YM6A 4QLCB 1AOIA 1P34C 2JCHA 4DRAA 3W97A 3B0DC 3AV2D 5B2IA 1EQZD 1M18C 5B31A 4LD9A 4UUZB 3B6GD 2BYKA 3W96A 3KXBB 3AYWA 5GSUC 4Z5TD 3MGPD 3WA9D 3MGSA 3REJA 4XUJB 5AY8D 5BNVB 3A6ND 4JJND 3AFAA 1M1AC 5B31C 3MGQC 2DQNC 3REIA 3W98C 1BH9B 3AV1C 1P3FD 5B40A 1P3OA 3LZ0A 1HQ3C 2RVQD 4H9PB 4ZUXC 2W8SA 3AYWC 3EPJA 1P3KB 2PYOC 3X1TA 5AV9D 2HIOC 5B0YA 3X1VD 2XD1A 3W99B 4EO5B 5GT3C 3UT9D 4KHAA 3REHD 2F8NH 1P3GB 5JRGC 4WV4B 2CV5D 5AV6A 4CSRA 5B32A 3AFAC 3NQJA 4WU9B 3AZED 2Y2QA 3REKB 1F1EA 4AWLB 1W2EA 2AROB 5CPIA 3WKJD 3KUYA 5GT0D 3X1UA 5B2JA 4NE3A 1P3OC 3LZ1D 4J8XC 3VH6W 4H9NB 5BS7A 2FJ7B 4J8UB 5C3IB 3X1TC 1KX4B 3AZKA 3VH5T 3UTBD 1T3UA 5AV6C 5B32C 5CPJD 5GXQD 5KDMB 1ZLAA 5CP6A 3AZFD 3KUYC 2F8NA 2NQBD 2L5AA 1S32C 1P3ID 4QLCD 5BT1C 3AZNA 2ZY2A 4J8VA 3WAAA 3AZKC 4R8PA 1P3AC 1M19A 3C1CC 1H3OB 3C1BA 5DNMB 5CP6C 3KXBD 3LELB 1KX3C 1P3MB 4XZQC 4KGCA 3KWQC 3B6FB 4WNNA 4XUJD 1U35A 3EPLA 4Z66A 4WU8A 3H0RC 3B0CW 1F66B 5DNNB 5AV5B 3WTPC 1M19C 4G92C 5AVCC 4J8WC 4H9QB 4KUDC 3AZMA 5CHLB 4X23A 3X1VB 3B0DB 5F99A 2JSSA 1P3KD 1P3LA 3MVDB 3MGRA 5B1MB 5B1LC 3AZHB 1B6WA 3W99D 1P3BA 3LJAB 1N1JA 2JE5A 3EPHA 5B24B 1P3GD 2HUEC 4M6BA 3MNNC 3AZGC 3UTAA 4WU9D 3REKD 2AROD 4YM6B 2Y2PA 3EPKA 1AOIB 3AZMC 1P34A 1KX5A 1ID3C 1TAFA 3W97B 4H9RA 2FJ7D 4J8UD 1P3LC 3MGRC 1KX4D 1P3PC 1BFMA 5B2IB 4CAYA 1M18A 5B31B 3X1SA 1P3BC 2Y2IA 2RIQA 4LD9B 4ZBJC 2G5IC 3A6NA 3W96B 3AL0C 3AYWB 5B0ZA 3O62A 3AV2C 1EQZC 3MGSB 5AV8A 3REJB 3AZLA 3RELD 1TZYA 1KX5C 3TU4B 5JA4A 2G5HC 1JFIA 3AFAB 3MGPC 1M1AA 3MGQA 3X1SC 3REIB 3WTPE 2IO5B 3AV1A 3W98A 5B40B 5AY8C 4Z2MH 1P3OB 3LZ0B 1HQ3A 3A6NC 4ZUXA 5DNMD 2ZY5A 4DRBA 3R45A 5B31G 5B0ZC 4JJNC 2PYOA 3O62C 3X1TB 3LELD 2HIOA 5AV8C 5B0YB 1P3MD 1P3FC 1PZRA 5GT3A 3AZLC 3B6FD 4KHAB 2ZY4A 1TZYC 2RVQC 5JRGA 5AV6B 4CSRB 5B32B 2NZDB 3NQJB 5AV9C 3AZIA 5CPIB 1F66D 3KUYB 5DNND 5AV5D 3X1UB 3REHC 5B2JB 4J8XA 2CV5C 3AZEC 3WKJC 5E5AA 5GT0C 3MVDD 5B1MD 3AZHD 2YFWB 5AVBB 3LJAD 1ZLAB 3KFUG 5CP6B 5B24D 1Q9CA 1Z2CB 3AZIC 5GSUD 2F8NB 3V9RA 3AZJB 5B32G 2Y2JA 4NE6A 1S32A 4YM6D 5FUGA 3AZNB 1AOID 5CPJC 4J8VB 4YS3A 3VH5A 3W97D 3AZFC 2NQBC 5E5AC 3WAAB 4R8PB 4NE5A 5B2ID 4QLCC 1P3AA 1P3IC 5B31D 3C1CA 3C1BB 4LD9D 4H9SA 1B67A 3W96D 3AYWD 1KX3A 4XZQA 5B33B 4KGCB 3KWQA 3RELB 3FDDA 3MGSD 3REJD 2F8NG 2ZY3A 1U35B 4YS3C 3TU4D 4Z66B 2J8PA 4WU8B 3AFAD 3WTPA 3REID 4XUJC 5AVCA 4G91B 4J8WA 5B40D 4H9SC 5BNXA 1P3OD 3LZ0D 3AZMB 3AN2B 4KUDA 4X23B 5F99B 1P3LB 3X1TD 3MGRB 2AROA 5B1LA 4H9OB 5B0YD 2Y2LA 1P3BB 5CPKA 1N1JB 4HGAC 4ZBJB 3MNNA 3AZGA 5AV6D 5B32D 3UTAB 1P3KC 2NZDD 1BH8A 5CPID 3KUYD 3X1UD 5B2JD 2YFVA 1P34B 1KX5B 1ID3A 1P3GC 1TAFB 1WWSA 4H9RB 4WU9C 1P3PA 4AWLC 2AROC 1M18B 3X1SB 5CPKC 3NQUA 5GSUB 5B0ZB 5AVBD 1ZLAD 2FJ7C 3O62B 5CP6D 3AV2A 1EQZA 2F8ND 5AV8B 3AZJD 3AZLB 3B0BA 1TZYB 3B6GA 5JA4B 5DNMA 3AZND 2FFFB 5G49A 3H0MC 4J8VD 4Z5TA 3MGPA 1M1AB 3WA9A 3MGQB 3WAAD 3B6FA 3AV1B 3W98B 4R8PD 5AY8A 2F2AC 1M19D 1HTAA 1HQ3B 2BYKB 4ZUXB 3C1BD 3R45B 4JJNA 2PYOB 2HIOB 5B33D 1P3FA 5GT3B 4NFTA 4KGCD 3B6GC 5DNMC 5JRGB 4Z5TC 1U35D 4Z66D 3LELC 3WA9C 5AV9A 3X1VA 3AZIB 5BO0A 4WU8D 3UT9A 3B6FC 3REHA 2BYMA 4J8XB 2CV5A 3AZEA 3AZMD 3AN2D 3WKJA 4X23D 1F66C 5F99D 5E5AB 5GT0A 5DNNC 5AV5C 3MGRD 1P3LD 3LZ1A 1P3BD 2BG1A 2Y2HA 3X1VC 3V9RB 3MVDC 3UTAD 3UT9C 5B1MC 3AZHC 1S32B 5FUGB 3UTBA 1KU5A 3LJAC 5CPJA 5GXQA 2CWEA 1P34D 1KX5D 4YS3B 5B24C 3AZFA 2NQBA 3AZKB 3VH6A 1P3AB 3LZ1C 4YM6C 4QLCA 1P3IA 1M18D 3C1CB 4Z2MG 3X1SD 3VH6T 1AOIC 3TU4A 3KSYA 3W97C 5B0ZD 1KX3B 4XZQB 2F8NK 3O62D 5B2IC 2DF4C 3KWQB 5AV8D 3UTBC 3AZLD 5GXQC 4LD9C 4UUZA 1TZYD 3W96C 3KXBA 4HGAB 2Y2GA 1M1AD 3WTPB 3MGSC 3MGQD 1M19B 3REJC 4G92B 4XUJA 5AVCB 4J8WB 3AV1D 2XD5A 5BNVA 3TU4C 5BNXB 3W98D 4KUDB 1HQ3D 4ZUXD 2NZDA 2PYOD 4WNNB 5B1LB 2HIOD 3REIC 2IO5C 1BH9A 5GT3D 5B40C 5CPKB 3A1KA 4WZSB 3LZ0C 2VQRA 3KXBC 4H9PA 2Y2MA 5JRGD 2HUEB 3MNNB 3AZGB 1P3KA 1BH8B 5B0YC 3AZID 3W99A 2YFWA 2YFVB 1ULYA 1ID3B 4J8XD 1P3GA 5AVBA 3B0CT 3EG5B 4WU9A 2NZDC 3REKA 1P3PB 5CPIC 3AZJA 5E5AD 3X1UC 4E44A 3VH5W 5B2JC 3NQUB 5BS7C 4H9NA 2FJ7A 4J8UA 1KX4A 3AV2B 4WJ3C 1EQZB 3W99C 4EO5C 1S32D 3B6GB 5BT1D 5AVBC 5G49B 4UPKA 1ZLAC 5KDMA 4Z5TB 4YS3D 3REKC 3MGPB 3WA9B 3IP4C 4CAYB 3AZJC 5B33A 3AZKD 3RELA 1P3AD 5AY8B 3C1CD 3AZNC 3A6NB 4J8VC 4J8UC 5C3IC 4JJNB 1KX4C 1KX3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAA C;  4XZQ D;  1P3F B;  4R8P C;  1A7W A;  3KWQ D;  1H3O A;  3C1B C;  4E45 A;  1JFI B;  3AN2 A;  1WWI A;  3LEL A;  5AV9 B;  1P3M A;  5BO0 B;  5B33 C;  2LY8 A;  4KGC C;  3UT9 B;  3REL C;  3WTP D;  3REH B;  2BYM B;  4H9O A;  5AVC D;  2CV5 B;  4J8W D;  1U35 C;  4KUD D;  3AZE B;  4Z66 C;  3WKJ B;  4WU8 C;  1F66 A;  5GT0 B;  5AV5 A;  5DNN A;  5B1L D;  3LZ1 B;  4G91 C;  4H9Q A;  5CPK D;  3AN2 C;  4X23 C;  5F99 C;  1P3M C;  3MNN D;  1R4V A;  3AZG D;  3MVD A;  5B1M A;  3AZH A;  3UTB B;  3LJA A;  5CPJ B;  5GXQ B;  1ID3 D;  5B24 A;  5GSU A;  3AZF B;  3UTA C;  2NQB B;  1P3P D;  1P3I B;  4YM6 A;  4QLC B;  1AOI A;  1P34 C;  4DRA A;  3W97 A;  3B0D C;  3AV2 D;  5B2I A;  1EQZ D;  1M18 C;  5B31 A;  4LD9 A;  4UUZ B;  3B6G D;  2BYK A;  3W96 A;  3KXB B;  3AYW A;  5GSU C;  4Z5T D;  3MGP D;  3WA9 D;  3MGS A;  3REJ A;  4XUJ B;  5AY8 D;  5BNV B;  3A6N D;  4JJN D;  3AFA A;  1M1A C;  5B31 C;  3MGQ C;  3REI A;  3W98 C;  1BH9 B;  3AV1 C;  1P3F D;  5B40 A;  1P3O A;  3LZ0 A;  1HQ3 C;  2RVQ D;  4H9P B;  4ZUX C;  3AYW C;  1P3K B;  2PYO C;  3X1T A;  5AV9 D;  2HIO C;  5B0Y A;  3X1V D;  3W99 B;  4EO5 B;  5GT3 C;  3UT9 D;  4KHA A;  3REH D;  2F8N H;  1P3G B;  5JRG C;  4WV4 B;  2CV5 D;  5AV6 A;  4CSR A;  5B32 A;  3AFA C;  3NQJ A;  4WU9 B;  3AZE D;  3REK B;  1F1E A;  4AWL B;  2ARO B;  5CPI A;  3WKJ D;  3KUY A;  5GT0 D;  3X1U A;  5B2J A;  4NE3 A;  1P3O C;  3LZ1 D;  4J8X C;  3VH6 W;  4H9N B;  5BS7 A;  2FJ7 B;  4J8U B;  5C3I B;  3X1T C;  1KX4 B;  3AZK A;  3VH5 T;  3UTB D;  5AV6 C;  5B32 C;  5CPJ D;  5GXQ D;  5KDM B;  1ZLA A;  5CP6 A;  3AZF D;  3KUY C;  2F8N A;  2NQB D;  2L5A A;  1S32 C;  1P3I D;  4QLC D;  5BT1 C;  3AZN A;  4J8V A;  3WAA A;  3AZK C;  4R8P A;  1P3A C;  1M19 A;  3C1C C;  1H3O B;  3C1B A;  5DNM B;  5CP6 C;  3KXB D;  3LEL B;  1KX3 C;  1P3M B;  4XZQ C;  4KGC A;  3KWQ C;  3B6F B;  4WNN A;  4XUJ D;  1U35 A;  4Z66 A;  4WU8 A;  1F66 B;  3B0C W;  5DNN B;  5AV5 B;  3WTP C;  1M19 C;  4G92 C;  5AVC C;  4J8W C;  4H9Q B;  4KUD C;  3AZM A;  5CHL B;  4X23 A;  3X1V B;  3B0D B;  5F99 A;  2JSS A;  1P3K D;  1P3L A;  3MVD B;  3MGR A;  5B1M B;  5B1L C;  3AZH B;  1B6W A;  3W99 D;  1P3B A;  3LJA B;  1N1J A;  5B24 B;  1P3G D;  2HUE C;  4M6B A;  3MNN C;  3AZG C;  3UTA A;  4WU9 D;  3REK D;  2ARO D;  4YM6 B;  1AOI B;  3AZM C;  1P34 A;  1KX5 A;  1ID3 C;  1TAF A;  3W97 B;  4H9R A;  2FJ7 D;  4J8U D;  1P3L C;  3MGR C;  1KX4 D;  1P3P C;  1BFM A;  5B2I B;  4CAY A;  1M18 A;  5B31 B;  3X1S A;  1P3B C;  4LD9 B;  4ZBJ C;  3A6N A;  3W96 B;  3AYW B;  5B0Z A;  3O62 A;  3AV2 C;  1EQZ C;  3MGS B;  5AV8 A;  3REJ B;  3AZL A;  3REL D;  1TZY A;  1KX5 C;  3TU4 B;  5JA4 A;  1JFI A;  3AFA B;  3MGP C;  1M1A A;  3MGQ A;  3X1S C;  3REI B;  3WTP E;  2IO5 B;  3AV1 A;  3W98 A;  5B40 B;  5AY8 C;  4Z2M H;  1P3O B;  3LZ0 B;  1HQ3 A;  3A6N C;  4ZUX A;  5DNM D;  4DRB A;  5B0Z C;  3R45 A;  5B31 G;  4JJN C;  2PYO A;  3O62 C;  3X1T B;  3LEL D;  2HIO A;  5AV8 C;  5B0Y B;  1P3M D;  1P3F C;  5GT3 A;  3AZL C;  3B6F D;  4KHA B;  1TZY C;  2RVQ C;  5JRG A;  5AV6 B;  4CSR B;  5B32 B;  2NZD B;  3NQJ B;  5AV9 C;  3AZI A;  5CPI B;  1F66 D;  3KUY B;  5DNN D;  5AV5 D;  3X1U B;  3REH C;  5B2J B;  4J8X A;  2CV5 C;  3AZE C;  3WKJ C;  5E5A A;  5GT0 C;  3MVD D;  5B1M D;  3AZH D;  2YFW B;  5AVB B;  3LJA D;  1ZLA B;  5CP6 B;  5B24 D;  1Q9C A;  3AZI C;  5GSU D;  2F8N B;  3V9R A;  3AZJ B;  5B32 G;  4NE6 A;  1S32 A;  4YM6 D;  5FUG A;  3AZN B;  1AOI D;  5CPJ C;  4J8V B;  4YS3 A;  3VH5 A;  3W97 D;  3AZF C;  2NQB C;  5E5A C;  3WAA B;  4R8P B;  4NE5 A;  5B2I D;  4QLC C;  1P3A A;  1P3I C;  5B31 D;  3C1C A;  3C1B B;  4LD9 D;  4H9S A;  1B67 A;  3W96 D;  3AYW D;  1KX3 A;  4XZQ A;  5B33 B;  4KGC B;  3KWQ A;  3REL B;  3MGS D;  3REJ D;  2F8N G;  1U35 B;  4YS3 C;  3TU4 D;  4Z66 B;  4WU8 B;  3AFA D;  3WTP A;  3REI D;  4XUJ C;  5AVC A;  4G91 B;  4J8W A;  5B40 D;  4H9S C;  5BNX A;  1P3O D;  3LZ0 D;  3AZM B;  3AN2 B;  4KUD A;  4X23 B;  5F99 B;  1P3L B;  3X1T D;  3MGR B;  2ARO A;  5B1L A;  4H9O B;  5B0Y D;  1P3B B;  5CPK A;  1N1J B;  4HGA C;  4ZBJ B;  3MNN A;  3AZG A;  5AV6 D;  5B32 D;  3UTA B;  1P3K C;  2NZD D;  1BH8 A;  5CPI D;  3KUY D;  3X1U D;  5B2J D;  2YFV A;  1P34 B;  1KX5 B;  1ID3 A;  1P3G C;  1TAF B;  1WWS A;  4H9R B;  4WU9 C;  1P3P A;  4AWL C;  2ARO C;  1M18 B;  3X1S B;  5CPK C;  3NQU A;  5GSU B;  5B0Z B;  5AVB D;  1ZLA D;  2FJ7 C;  3O62 B;  5CP6 D;  3AV2 A;  1EQZ A;  2F8N D;  5AV8 B;  3AZJ D;  3AZL B;  3B0B A;  1TZY B;  3B6G A;  5JA4 B;  5DNM A;  3AZN D;  5G49 A;  4J8V D;  4Z5T A;  3MGP A;  1M1A B;  3WA9 A;  3MGQ B;  3WAA D;  3B6F A;  3AV1 B;  3W98 B;  4R8P D;  5AY8 A;  1M19 D;  1HTA A;  1HQ3 B;  2BYK B;  4ZUX B;  3C1B D;  3R45 B;  4JJN A;  2PYO B;  2HIO B;  5B33 D;  1P3F A;  5GT3 B;  4NFT A;  4KGC D;  3B6G C;  5DNM C;  5JRG B;  4Z5T C;  1U35 D;  4Z66 D;  3LEL C;  3WA9 C;  5AV9 A;  3X1V A;  3AZI B;  5BO0 A;  4WU8 D;  3UT9 A;  3B6F C;  3REH A;  2BYM A;  4J8X B;  2CV5 A;  3AZE A;  3AZM D;  3AN2 D;  3WKJ A;  4X23 D;  1F66 C;  5F99 D;  5E5A B;  5GT0 A;  5DNN C;  5AV5 C;  3MGR D;  1P3L D;  3LZ1 A;  1P3B D;  3X1V C;  3V9R B;  3MVD C;  3UTA D;  3UT9 C;  5B1M C;  3AZH C;  1S32 B;  5FUG B;  3UTB A;  1KU5 A;  3LJA C;  5CPJ A;  5GXQ A;  2CWE A;  1P34 D;  1KX5 D;  4YS3 B;  5B24 C;  3AZF A;  2NQB A;  3AZK B;  3VH6 A;  1P3A B;  3LZ1 C;  4YM6 C;  4QLC A;  1P3I A;  1M18 D;  3C1C B;  4Z2M G;  3X1S D;  3VH6 T;  1AOI C;  3TU4 A;  3KSY A;  3W97 C;  5B0Z D;  1KX3 B;  4XZQ B;  2F8N K;  3O62 D;  5B2I C;  3KWQ B;  5AV8 D;  3UTB C;  3AZL D;  5GXQ C;  4LD9 C;  4UUZ A;  1TZY D;  3W96 C;  3KXB A;  4HGA B;  1M1A D;  3WTP B;  3MGS C;  3MGQ D;  1M19 B;  3REJ C;  4G92 B;  4XUJ A;  5AVC B;  4J8W B;  3AV1 D;  3W98 D;  5BNV A;  3TU4 C;  5BNX B;  4KUD B;  1HQ3 D;  4ZUX D;  2NZD A;  2PYO D;  4WNN B;  5B1L B;  2HIO D;  3REI C;  2IO5 C;  1BH9 A;  5GT3 D;  5B40 C;  5CPK B;  4WZS B;  3LZ0 C;  3KXB C;  4H9P A;  5JRG D;  2HUE B;  3MNN B;  3AZG B;  1P3K A;  1BH8 B;  5B0Y C;  3AZI D;  3W99 A;  2YFW A;  2YFV B;  1ULY A;  1ID3 B;  4J8X D;  1P3G A;  5AVB A;  3B0C T;  4WU9 A;  2NZD C;  3REK A;  1P3P B;  5CPI C;  3AZJ A;  5E5A D;  3X1U C;  4E44 A;  3VH5 W;  5B2J C;  3NQU B;  5BS7 C;  4H9N A;  2FJ7 A;  4J8U A;  1KX4 A;  3AV2 B;  1EQZ B;  3W99 C;  4EO5 C;  1S32 D;  3B6G B;  5BT1 D;  5AVB C;  5G49 B;  1ZLA C;  5KDM A;  4Z5T B;  4YS3 D;  3REK C;  3MGP B;  3WA9 B;  4CAY B;  3AZJ C;  5B33 A;  3AZK D;  3REL A;  1P3A D;  5AY8 B;  3C1C D;  3AZN C;  3A6N B;  4J8V C;  4J8U C;  5C3I C;  4JJN B;  1KX4 C;  1KX3 D; 
#chains in the Genus database with same CATH topology
 3WAA C;  4XZQ D;  1P3F B;  4R8P C;  1A7W A;  3KWQ D;  1H3O A;  3C1B C;  4E45 A;  1JFI B;  3AN2 A;  1WWI A;  3H0L C;  3LEL A;  5AV9 B;  1P3M A;  5BO0 B;  5B33 C;  2LY8 A;  4KGC C;  3UT9 B;  3REL C;  3WTP D;  3REH B;  2BYM B;  4H9O A;  4DQY B;  5AVC D;  3F6T A;  4J8W D;  2CV5 B;  1U35 C;  2Y2K A;  2ZM5 A;  3AZE B;  4Z66 C;  4KUD D;  3WKJ B;  4WU8 C;  1F66 A;  2Y2O A;  5GT0 B;  5AV5 A;  5DNN A;  5B1L D;  3LZ1 B;  3A1I A;  3P5J B;  4G91 C;  2UWX A;  4H9Q A;  5CPK D;  3AN2 C;  4X23 C;  5F99 C;  1P3M C;  3MNN D;  1R4V A;  3AZG D;  3MVD A;  5B1M A;  3AZH A;  3UTB B;  3LJA A;  5CPJ B;  5GXQ B;  1ID3 D;  5B24 A;  5GSU A;  2Y2N A;  3AZF B;  3UTA C;  2NQB B;  1P3P D;  1P3I B;  4YM6 A;  4QLC B;  1AOI A;  1P34 C;  2JCH A;  4DRA A;  3W97 A;  3B0D C;  3AV2 D;  5B2I A;  1EQZ D;  1M18 C;  5B31 A;  4LD9 A;  4UUZ B;  3B6G D;  2BYK A;  3W96 A;  3KXB B;  3AYW A;  5GSU C;  4Z5T D;  3MGP D;  3WA9 D;  3MGS A;  3REJ A;  4XUJ B;  5AY8 D;  5BNV B;  3A6N D;  4JJN D;  3AFA A;  1M1A C;  5B31 C;  3MGQ C;  2DQN C;  3REI A;  3W98 C;  1BH9 B;  3AV1 C;  1P3F D;  5B40 A;  1P3O A;  3LZ0 A;  1HQ3 C;  2RVQ D;  4H9P B;  4ZUX C;  2W8S A;  3AYW C;  3EPJ A;  1P3K B;  2PYO C;  3X1T A;  5AV9 D;  2HIO C;  5B0Y A;  3X1V D;  2XD1 A;  3W99 B;  4EO5 B;  5GT3 C;  3UT9 D;  4KHA A;  3REH D;  2F8N H;  1P3G B;  5JRG C;  4WV4 B;  2CV5 D;  5AV6 A;  4CSR A;  5B32 A;  3AFA C;  3NQJ A;  4WU9 B;  3AZE D;  2Y2Q A;  3REK B;  1F1E A;  4AWL B;  1W2E A;  2ARO B;  5CPI A;  3WKJ D;  3KUY A;  5GT0 D;  3X1U A;  5B2J A;  4NE3 A;  1P3O C;  3LZ1 D;  4J8X C;  3VH6 W;  4H9N B;  5BS7 A;  2FJ7 B;  4J8U B;  5C3I B;  3X1T C;  1KX4 B;  3AZK A;  3VH5 T;  3UTB D;  1T3U A;  5AV6 C;  5B32 C;  5CPJ D;  5GXQ D;  5KDM B;  1ZLA A;  5CP6 A;  3AZF D;  3KUY C;  2F8N A;  2NQB D;  2L5A A;  1S32 C;  1P3I D;  4QLC D;  5BT1 C;  3AZN A;  2ZY2 A;  4J8V A;  3WAA A;  3AZK C;  4R8P A;  1P3A C;  1M19 A;  3C1C C;  1H3O B;  3C1B A;  5DNM B;  5CP6 C;  3KXB D;  3LEL B;  1KX3 C;  1P3M B;  4XZQ C;  4KGC A;  3KWQ C;  3B6F B;  4WNN A;  4XUJ D;  1U35 A;  3EPL A;  4Z66 A;  4WU8 A;  3H0R C;  3B0C W;  1F66 B;  5DNN B;  5AV5 B;  3WTP C;  1M19 C;  4G92 C;  5AVC C;  4J8W C;  4H9Q B;  4KUD C;  3AZM A;  5CHL B;  4X23 A;  3X1V B;  3B0D B;  5F99 A;  2JSS A;  1P3K D;  1P3L A;  3MVD B;  3MGR A;  5B1M B;  5B1L C;  3AZH B;  1B6W A;  3W99 D;  1P3B A;  3LJA B;  1N1J A;  2JE5 A;  3EPH A;  5B24 B;  1P3G D;  2HUE C;  4M6B A;  3MNN C;  3AZG C;  3UTA A;  4WU9 D;  3REK D;  2ARO D;  4YM6 B;  2Y2P A;  3EPK A;  1AOI B;  3AZM C;  1P34 A;  1KX5 A;  1ID3 C;  1TAF A;  3W97 B;  4H9R A;  2FJ7 D;  4J8U D;  1P3L C;  3MGR C;  1KX4 D;  1P3P C;  1BFM A;  5B2I B;  4CAY A;  1M18 A;  5B31 B;  3X1S A;  1P3B C;  2Y2I A;  2RIQ A;  4LD9 B;  4ZBJ C;  2G5I C;  3A6N A;  3W96 B;  3AL0 C;  3AYW B;  5B0Z A;  3O62 A;  3AV2 C;  1EQZ C;  3MGS B;  5AV8 A;  3REJ B;  3AZL A;  3REL D;  1TZY A;  1KX5 C;  3TU4 B;  5JA4 A;  2G5H C;  1JFI A;  3AFA B;  3MGP C;  1M1A A;  3MGQ A;  3X1S C;  3REI B;  3WTP E;  2IO5 B;  3AV1 A;  3W98 A;  5B40 B;  5AY8 C;  4Z2M H;  1P3O B;  3LZ0 B;  1HQ3 A;  3A6N C;  4ZUX A;  5DNM D;  2ZY5 A;  4DRB A;  3R45 A;  5B31 G;  5B0Z C;  4JJN C;  2PYO A;  3O62 C;  3X1T B;  3LEL D;  2HIO A;  5AV8 C;  5B0Y B;  1P3M D;  1P3F C;  1PZR A;  5GT3 A;  3AZL C;  3B6F D;  4KHA B;  2ZY4 A;  1TZY C;  2RVQ C;  5JRG A;  5AV6 B;  4CSR B;  5B32 B;  2NZD B;  3NQJ B;  5AV9 C;  3AZI A;  5CPI B;  1F66 D;  3KUY B;  5DNN D;  5AV5 D;  3X1U B;  3REH C;  5B2J B;  4J8X A;  2CV5 C;  3AZE C;  3WKJ C;  5E5A A;  5GT0 C;  3MVD D;  5B1M D;  3AZH D;  2YFW B;  5AVB B;  3LJA D;  1ZLA B;  3KFU G;  5CP6 B;  5B24 D;  1Q9C A;  1Z2C B;  3AZI C;  5GSU D;  2F8N B;  3V9R A;  3AZJ B;  5B32 G;  2Y2J A;  4NE6 A;  1S32 A;  4YM6 D;  5FUG A;  3AZN B;  1AOI D;  5CPJ C;  4J8V B;  4YS3 A;  3VH5 A;  3W97 D;  3AZF C;  2NQB C;  5E5A C;  3WAA B;  4R8P B;  4NE5 A;  5B2I D;  4QLC C;  1P3A A;  1P3I C;  5B31 D;  3C1C A;  3C1B B;  4LD9 D;  4H9S A;  1B67 A;  3W96 D;  3AYW D;  1KX3 A;  4XZQ A;  5B33 B;  4KGC B;  3KWQ A;  3REL B;  3FDD A;  3MGS D;  3REJ D;  2F8N G;  2ZY3 A;  1U35 B;  4YS3 C;  3TU4 D;  4Z66 B;  2J8P A;  4WU8 B;  3AFA D;  3WTP A;  3REI D;  4XUJ C;  5AVC A;  4G91 B;  4J8W A;  5B40 D;  4H9S C;  5BNX A;  1P3O D;  3LZ0 D;  3AZM B;  3AN2 B;  4KUD A;  4X23 B;  5F99 B;  1P3L B;  3X1T D;  3MGR B;  2ARO A;  5B1L A;  4H9O B;  5B0Y D;  2Y2L A;  1P3B B;  5CPK A;  1N1J B;  4HGA C;  4ZBJ B;  3MNN A;  3AZG A;  5AV6 D;  5B32 D;  3UTA B;  1P3K C;  2NZD D;  1BH8 A;  5CPI D;  3KUY D;  3X1U D;  5B2J D;  2YFV A;  1P34 B;  1KX5 B;  1ID3 A;  1P3G C;  1TAF B;  1WWS A;  4H9R B;  4WU9 C;  1P3P A;  4AWL C;  2ARO C;  1M18 B;  3X1S B;  5CPK C;  3NQU A;  5GSU B;  5B0Z B;  5AVB D;  1ZLA D;  2FJ7 C;  3O62 B;  5CP6 D;  3AV2 A;  1EQZ A;  2F8N D;  5AV8 B;  3AZJ D;  3AZL B;  3B0B A;  1TZY B;  3B6G A;  5JA4 B;  5DNM A;  3AZN D;  2FFF B;  5G49 A;  3H0M C;  4J8V D;  4Z5T A;  3MGP A;  1M1A B;  3WA9 A;  3MGQ B;  3WAA D;  3B6F A;  3AV1 B;  3W98 B;  4R8P D;  5AY8 A;  2F2A C;  1M19 D;  1HTA A;  1HQ3 B;  2BYK B;  4ZUX B;  3C1B D;  3R45 B;  4JJN A;  2PYO B;  2HIO B;  5B33 D;  1P3F A;  5GT3 B;  4NFT A;  4KGC D;  3B6G C;  5DNM C;  5JRG B;  4Z5T C;  1U35 D;  4Z66 D;  3LEL C;  3WA9 C;  5AV9 A;  3X1V A;  3AZI B;  5BO0 A;  4WU8 D;  3UT9 A;  3B6F C;  3REH A;  2BYM A;  4J8X B;  2CV5 A;  3AZE A;  3AZM D;  3AN2 D;  3WKJ A;  4X23 D;  1F66 C;  5F99 D;  5E5A B;  5GT0 A;  5DNN C;  5AV5 C;  3MGR D;  1P3L D;  3LZ1 A;  1P3B D;  2BG1 A;  2Y2H A;  3X1V C;  3V9R B;  3MVD C;  3UTA D;  3UT9 C;  5B1M C;  3AZH C;  1S32 B;  5FUG B;  3UTB A;  1KU5 A;  3LJA C;  5CPJ A;  5GXQ A;  2CWE A;  1P34 D;  1KX5 D;  4YS3 B;  5B24 C;  3AZF A;  2NQB A;  3AZK B;  3VH6 A;  1P3A B;  3LZ1 C;  4YM6 C;  4QLC A;  1P3I A;  1M18 D;  3C1C B;  4Z2M G;  3X1S D;  3VH6 T;  1AOI C;  3TU4 A;  3KSY A;  3W97 C;  5B0Z D;  1KX3 B;  4XZQ B;  2F8N K;  3O62 D;  5B2I C;  2DF4 C;  3KWQ B;  5AV8 D;  3UTB C;  3AZL D;  5GXQ C;  4LD9 C;  4UUZ A;  1TZY D;  3W96 C;  3KXB A;  4HGA B;  2Y2G A;  1M1A D;  3WTP B;  3MGS C;  3MGQ D;  1M19 B;  3REJ C;  4G92 B;  4XUJ A;  5AVC B;  4J8W B;  3AV1 D;  2XD5 A;  5BNV A;  3TU4 C;  5BNX B;  3W98 D;  4KUD B;  1HQ3 D;  4ZUX D;  2NZD A;  2PYO D;  4WNN B;  5B1L B;  2HIO D;  3REI C;  2IO5 C;  1BH9 A;  5GT3 D;  5B40 C;  5CPK B;  3A1K A;  4WZS B;  3LZ0 C;  2VQR A;  3KXB C;  4H9P A;  2Y2M A;  5JRG D;  2HUE B;  3MNN B;  3AZG B;  1P3K A;  1BH8 B;  5B0Y C;  3AZI D;  3W99 A;  2YFW A;  2YFV B;  1ULY A;  1ID3 B;  4J8X D;  1P3G A;  5AVB A;  3B0C T;  3EG5 B;  4WU9 A;  2NZD C;  3REK A;  1P3P B;  5CPI C;  3AZJ A;  5E5A D;  3X1U C;  4E44 A;  3VH5 W;  5B2J C;  3NQU B;  5BS7 C;  4H9N A;  2FJ7 A;  4J8U A;  1KX4 A;  3AV2 B;  4WJ3 C;  1EQZ B;  3W99 C;  4EO5 C;  1S32 D;  3B6G B;  5BT1 D;  5AVB C;  5G49 B;  4UPK A;  1ZLA C;  5KDM A;  4Z5T B;  4YS3 D;  3REK C;  3MGP B;  3WA9 B;  3IP4 C;  4CAY B;  3AZJ C;  5B33 A;  3AZK D;  3REL A;  1P3A D;  5AY8 B;  3C1C D;  3AZN C;  3A6N B;  4J8V C;  4J8U C;  5C3I C;  4JJN B;  1KX4 C;  1KX3 D; 
#chains in the Genus database with same CATH homology
 3WAA C;  4XZQ D;  1P3F B;  4R8P C;  1A7W A;  3KWQ D;  1H3O A;  3C1B C;  4E45 A;  1JFI B;  3AN2 A;  1WWI A;  3H0L C;  3LEL A;  5AV9 B;  1P3M A;  5BO0 B;  5B33 C;  2LY8 A;  4KGC C;  3UT9 B;  3REL C;  3WTP D;  3REH B;  2BYM B;  4H9O A;  4DQY B;  5AVC D;  3F6T A;  4J8W D;  2CV5 B;  1U35 C;  2Y2K A;  2ZM5 A;  3AZE B;  4Z66 C;  4KUD D;  3WKJ B;  4WU8 C;  1F66 A;  2Y2O A;  5GT0 B;  5AV5 A;  5DNN A;  5B1L D;  3LZ1 B;  3A1I A;  3P5J B;  4G91 C;  2UWX A;  4H9Q A;  5CPK D;  3AN2 C;  4X23 C;  5F99 C;  1P3M C;  3MNN D;  1R4V A;  3AZG D;  3MVD A;  5B1M A;  3AZH A;  3UTB B;  3LJA A;  5CPJ B;  5GXQ B;  1ID3 D;  5B24 A;  5GSU A;  2Y2N A;  3AZF B;  3UTA C;  2NQB B;  1P3P D;  1P3I B;  4YM6 A;  4QLC B;  1AOI A;  1P34 C;  2JCH A;  4DRA A;  3W97 A;  3B0D C;  3AV2 D;  5B2I A;  1EQZ D;  1M18 C;  5B31 A;  4LD9 A;  4UUZ B;  3B6G D;  2BYK A;  3W96 A;  3KXB B;  3AYW A;  5GSU C;  4Z5T D;  3MGP D;  3WA9 D;  3MGS A;  3REJ A;  4XUJ B;  5AY8 D;  5BNV B;  3A6N D;  4JJN D;  3AFA A;  1M1A C;  5B31 C;  3MGQ C;  2DQN C;  3REI A;  3W98 C;  1BH9 B;  3AV1 C;  1P3F D;  5B40 A;  1P3O A;  3LZ0 A;  1HQ3 C;  2RVQ D;  4H9P B;  4ZUX C;  2W8S A;  3AYW C;  3EPJ A;  1P3K B;  2PYO C;  3X1T A;  5AV9 D;  2HIO C;  5B0Y A;  3X1V D;  2XD1 A;  3W99 B;  4EO5 B;  5GT3 C;  3UT9 D;  4KHA A;  3REH D;  2F8N H;  1P3G B;  5JRG C;  4WV4 B;  2CV5 D;  5AV6 A;  4CSR A;  5B32 A;  3AFA C;  3NQJ A;  4WU9 B;  3AZE D;  2Y2Q A;  3REK B;  1F1E A;  4AWL B;  1W2E A;  2ARO B;  5CPI A;  3WKJ D;  3KUY A;  5GT0 D;  3X1U A;  5B2J A;  4NE3 A;  1P3O C;  3LZ1 D;  4J8X C;  3VH6 W;  4H9N B;  5BS7 A;  2FJ7 B;  4J8U B;  5C3I B;  3X1T C;  1KX4 B;  3AZK A;  3VH5 T;  3UTB D;  1T3U A;  5AV6 C;  5B32 C;  5CPJ D;  5GXQ D;  5KDM B;  1ZLA A;  5CP6 A;  3AZF D;  3KUY C;  2F8N A;  2NQB D;  2L5A A;  1S32 C;  1P3I D;  4QLC D;  5BT1 C;  3AZN A;  2ZY2 A;  4J8V A;  3WAA A;  3AZK C;  4R8P A;  1P3A C;  1M19 A;  3C1C C;  1H3O B;  3C1B A;  5DNM B;  5CP6 C;  3KXB D;  3LEL B;  1KX3 C;  1P3M B;  4XZQ C;  4KGC A;  3KWQ C;  3B6F B;  4WNN A;  4XUJ D;  1U35 A;  3EPL A;  4Z66 A;  4WU8 A;  3H0R C;  3B0C W;  1F66 B;  5DNN B;  5AV5 B;  3WTP C;  1M19 C;  4G92 C;  5AVC C;  4J8W C;  4H9Q B;  4KUD C;  3AZM A;  5CHL B;  4X23 A;  3X1V B;  3B0D B;  5F99 A;  2JSS A;  1P3K D;  1P3L A;  3MVD B;  3MGR A;  5B1M B;  5B1L C;  3AZH B;  1B6W A;  3W99 D;  1P3B A;  3LJA B;  1N1J A;  2JE5 A;  3EPH A;  5B24 B;  1P3G D;  2HUE C;  4M6B A;  3MNN C;  3AZG C;  3UTA A;  4WU9 D;  3REK D;  2ARO D;  4YM6 B;  2Y2P A;  3EPK A;  1AOI B;  3AZM C;  1P34 A;  1KX5 A;  1ID3 C;  1TAF A;  3W97 B;  4H9R A;  2FJ7 D;  4J8U D;  1P3L C;  3MGR C;  1KX4 D;  1P3P C;  1BFM A;  5B2I B;  4CAY A;  1M18 A;  5B31 B;  3X1S A;  1P3B C;  2Y2I A;  2RIQ A;  4LD9 B;  4ZBJ C;  2G5I C;  3A6N A;  3W96 B;  3AL0 C;  3AYW B;  5B0Z A;  3O62 A;  3AV2 C;  1EQZ C;  3MGS B;  5AV8 A;  3REJ B;  3AZL A;  3REL D;  1TZY A;  1KX5 C;  3TU4 B;  5JA4 A;  2G5H C;  1JFI A;  3AFA B;  3MGP C;  1M1A A;  3MGQ A;  3X1S C;  3REI B;  3WTP E;  2IO5 B;  3AV1 A;  3W98 A;  5B40 B;  5AY8 C;  4Z2M H;  1P3O B;  3LZ0 B;  1HQ3 A;  3A6N C;  4ZUX A;  5DNM D;  2ZY5 A;  4DRB A;  3R45 A;  5B31 G;  5B0Z C;  4JJN C;  2PYO A;  3O62 C;  3X1T B;  3LEL D;  2HIO A;  5AV8 C;  5B0Y B;  1P3M D;  1P3F C;  1PZR A;  5GT3 A;  3AZL C;  3B6F D;  4KHA B;  2ZY4 A;  1TZY C;  2RVQ C;  5JRG A;  5AV6 B;  4CSR B;  5B32 B;  2NZD B;  3NQJ B;  5AV9 C;  3AZI A;  5CPI B;  1F66 D;  3KUY B;  5DNN D;  5AV5 D;  3X1U B;  3REH C;  5B2J B;  4J8X A;  2CV5 C;  3AZE C;  3WKJ C;  5E5A A;  5GT0 C;  3MVD D;  5B1M D;  3AZH D;  2YFW B;  5AVB B;  3LJA D;  1ZLA B;  3KFU G;  5CP6 B;  5B24 D;  1Q9C A;  1Z2C B;  3AZI C;  5GSU D;  2F8N B;  3V9R A;  3AZJ B;  5B32 G;  2Y2J A;  4NE6 A;  1S32 A;  4YM6 D;  5FUG A;  3AZN B;  1AOI D;  5CPJ C;  4J8V B;  4YS3 A;  3VH5 A;  3W97 D;  3AZF C;  2NQB C;  5E5A C;  3WAA B;  4R8P B;  4NE5 A;  5B2I D;  4QLC C;  1P3A A;  1P3I C;  5B31 D;  3C1C A;  3C1B B;  4LD9 D;  4H9S A;  1B67 A;  3W96 D;  3AYW D;  1KX3 A;  4XZQ A;  5B33 B;  4KGC B;  3KWQ A;  3REL B;  3FDD A;  3MGS D;  3REJ D;  2F8N G;  2ZY3 A;  1U35 B;  4YS3 C;  3TU4 D;  4Z66 B;  2J8P A;  4WU8 B;  3AFA D;  3WTP A;  3REI D;  4XUJ C;  5AVC A;  4G91 B;  4J8W A;  5B40 D;  4H9S C;  5BNX A;  1P3O D;  3LZ0 D;  3AZM B;  3AN2 B;  4KUD A;  4X23 B;  5F99 B;  1P3L B;  3X1T D;  3MGR B;  2ARO A;  5B1L A;  4H9O B;  5B0Y D;  2Y2L A;  1P3B B;  5CPK A;  1N1J B;  4HGA C;  4ZBJ B;  3MNN A;  3AZG A;  5AV6 D;  5B32 D;  3UTA B;  1P3K C;  2NZD D;  1BH8 A;  5CPI D;  3KUY D;  3X1U D;  5B2J D;  2YFV A;  1P34 B;  1KX5 B;  1ID3 A;  1P3G C;  1TAF B;  1WWS A;  4H9R B;  4WU9 C;  1P3P A;  4AWL C;  2ARO C;  1M18 B;  3X1S B;  5CPK C;  3NQU A;  5GSU B;  5B0Z B;  5AVB D;  1ZLA D;  2FJ7 C;  3O62 B;  5CP6 D;  3AV2 A;  1EQZ A;  2F8N D;  5AV8 B;  3AZJ D;  3AZL B;  3B0B A;  1TZY B;  3B6G A;  5JA4 B;  5DNM A;  3AZN D;  2FFF B;  5G49 A;  3H0M C;  4J8V D;  4Z5T A;  3MGP A;  1M1A B;  3WA9 A;  3MGQ B;  3WAA D;  3B6F A;  3AV1 B;  3W98 B;  4R8P D;  5AY8 A;  2F2A C;  1M19 D;  1HTA A;  1HQ3 B;  2BYK B;  4ZUX B;  3C1B D;  3R45 B;  4JJN A;  2PYO B;  2HIO B;  5B33 D;  1P3F A;  5GT3 B;  4NFT A;  4KGC D;  3B6G C;  5DNM C;  5JRG B;  4Z5T C;  1U35 D;  4Z66 D;  3LEL C;  3WA9 C;  5AV9 A;  3X1V A;  3AZI B;  5BO0 A;  4WU8 D;  3UT9 A;  3B6F C;  3REH A;  2BYM A;  4J8X B;  2CV5 A;  3AZE A;  3AZM D;  3AN2 D;  3WKJ A;  4X23 D;  1F66 C;  5F99 D;  5E5A B;  5GT0 A;  5DNN C;  5AV5 C;  3MGR D;  1P3L D;  3LZ1 A;  1P3B D;  2BG1 A;  2Y2H A;  3X1V C;  3V9R B;  3MVD C;  3UTA D;  3UT9 C;  5B1M C;  3AZH C;  1S32 B;  5FUG B;  3UTB A;  1KU5 A;  3LJA C;  5CPJ A;  5GXQ A;  2CWE A;  1P34 D;  1KX5 D;  4YS3 B;  5B24 C;  3AZF A;  2NQB A;  3AZK B;  3VH6 A;  1P3A B;  3LZ1 C;  4YM6 C;  4QLC A;  1P3I A;  1M18 D;  3C1C B;  4Z2M G;  3X1S D;  3VH6 T;  1AOI C;  3TU4 A;  3KSY A;  3W97 C;  5B0Z D;  1KX3 B;  4XZQ B;  2F8N K;  3O62 D;  5B2I C;  2DF4 C;  3KWQ B;  5AV8 D;  3UTB C;  3AZL D;  5GXQ C;  4LD9 C;  4UUZ A;  1TZY D;  3W96 C;  3KXB A;  4HGA B;  2Y2G A;  1M1A D;  3WTP B;  3MGS C;  3MGQ D;  1M19 B;  3REJ C;  4G92 B;  4XUJ A;  5AVC B;  4J8W B;  3AV1 D;  2XD5 A;  5BNV A;  3TU4 C;  5BNX B;  3W98 D;  4KUD B;  1HQ3 D;  4ZUX D;  2NZD A;  2PYO D;  4WNN B;  5B1L B;  2HIO D;  3REI C;  2IO5 C;  1BH9 A;  5GT3 D;  5B40 C;  5CPK B;  3A1K A;  4WZS B;  3LZ0 C;  2VQR A;  3KXB C;  4H9P A;  2Y2M A;  5JRG D;  2HUE B;  3MNN B;  3AZG B;  1P3K A;  1BH8 B;  5B0Y C;  3AZI D;  3W99 A;  2YFW A;  2YFV B;  1ULY A;  1ID3 B;  4J8X D;  1P3G A;  5AVB A;  3B0C T;  3EG5 B;  4WU9 A;  2NZD C;  3REK A;  1P3P B;  5CPI C;  3AZJ A;  5E5A D;  3X1U C;  4E44 A;  3VH5 W;  5B2J C;  3NQU B;  5BS7 C;  4H9N A;  2FJ7 A;  4J8U A;  1KX4 A;  3AV2 B;  4WJ3 C;  1EQZ B;  3W99 C;  4EO5 C;  1S32 D;  3B6G B;  5BT1 D;  5AVB C;  5G49 B;  4UPK A;  1ZLA C;  5KDM A;  4Z5T B;  4YS3 D;  3REK C;  3MGP B;  3WA9 B;  3IP4 C;  4CAY B;  3AZJ C;  5B33 A;  3AZK D;  3REL A;  1P3A D;  5AY8 B;  3C1C D;  3AZN C;  3A6N B;  4J8V C;  4J8U C;  5C3I C;  4JJN B;  1KX4 C;  1KX3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...