3LJAB

Using soft x-rays for a detailed picture of divalent metal binding in the nucleosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Using soft X-rays for a detailed picture of divalent metal binding in the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ljaB00
4X23C 3LZ1B 3LJAA 4H9SC 5B33A 3MGRA 1P3IC 3X1SD 3WKJC 1P3FA 5F99C 3C1BC 3REJA 1P3GB 3REKD 3W99D 2LY8A 5GSUD 5AY8A 1HQ3B 2HUEB 5B1LA 3AZMB 1AOIB 1S32B 4H9QB 3REKC 3W99C 3AZGA 3AZND 1P3PA 4JJND 5AV8D 3MGRB 5GT0A 4Z66D 3LELB 3X1VA 5B32D 3RELB 3WAAD 1EQZB 3AZNC 3W97A 1P3AA 4JJNC 5AV8C 4Z66C 1P3IA 5AY8B 3NQUB 5B32C 3WAAC 5B32G 3A6NA 1ID3D 1M19A 1KX3C 3X1SA 3TU4D 3NQJA 3VH6W 1ID3C 3MGPC 3KWQD 5GSUA 5CP6B 5B0YD 1H3OB 3B0DB 4NE5A 4UUZB 3KWQC 3R45A 3AZKB 5B0YC 5B1MA 4H9OB 3AZNA 1M19B 2HIOA 3AZIA 4Z66A 3NQJB 3O62C 4Z2MG 2PYOA 5AVBA 2AROD 3C1CD 4YM6D 4NE3A 1ID3A 3WTPA 2NZDA 2AROC 5AV5D 4ZBJC 4WZSB 3KXBD 3MVDA 3C1CC 5B24A 3TU4A 4J8WD 2HIOB 1P3BA 3LZ0B 3KXBC 2F8NA 2CWEA 3B6GB 3UTBD 5BNVA 5B0YA 4J8WC 1M18B 1KX4B 3AYWC 1TZYB 3UTBC 3UTAB 5AV9B 3WTPB 4XUJA 2YFWA 3MVDB 5B31A 5CPID 3B0CT 3VH5A 5B2JC 4J8XD 4Z5TA 2AROA 4YM6A 5DNMB 3AZJD 3W96B 3AFAD 3MGQA 3REIB 5AV5A 3KUYD 4J8WA 4XZQD 3AZJC 3C1BD 4XUJB 3UT9C 3AN2B 3KUYC 1P3AC 4XZQC 2YFVA 4ZUXD 3AV2A 2BYMA 1M1AC 1TAFA 5CPJD 1ZLAB 1P3OD 3AZFA 4G92C 1P3KB 1KX5D 3MGQB 1B6WA 5JRGD 4J8VA 3AZLD 5CPJC 3AV1B 5CPIA 1F66B 3W98A 5B2IC 1P3OC 2NQBA 1KX5C 4J8XA 5JRGC 3X1UD 3AZLC 2FJ7D 3AZHD 1WWSA 4WV4B 2BYMB 3LZ1D 3AFAA 3AZHC 3X1TC 1TAFB 3KUYA 4CSRA 5E5AB 4DRBA 4XZQA 4WU9A 5B0ZA 3LZ1C 4J8VB 1F1EA 4KGCB 4H9NB 1HQ3D 4HGAC 3AZMD 5AVCB 3VH5W 4ZUXA 5CHLB 3MGSB 3VH6T 4QLCD 3REHB 1HQ3C 2HUEC 5KDMB 3AZMC 5B40D 1S32C 3B6FB 4KUDA 4X23D 5BS7C 4QLCC 3LELD 5GT3A 5B40C 4CSRB 1U35B 1EQZD 3WA9B 3X1UA 3LELC 2FJ7A 3AZHA 3RELC 1EQZC 4NFTA 2RVQD 5GXQA 1BH9A 5AV6A 4WNNA 4LD9A 4R8PB 5CP6D 2RVQC 5DNNB 3LJAB 5B33B 4QLCA 1P3FB 5CP6C 3REJB 4CAYA 1P34D 1N1JA 4X23A 4H9SA 1KX3D 3AZKC 5B1LB 3WKJA 1P34C 5GXQB 5F99A 3C1BA 4WU8D 3MGPD 4AWLC 4NE6A 3AZGB 1P3PB 4WU8C 3REKA 5GT0B 3W99A 3X1VB 3KSYA 4H9PA 3W97B 1P3AB 1N1JB 1P3IB 5BO0A 3WKJB 3A6NB 3O62D 4JJNA 5AV8A 1P3MD 3X1SB 5B32A 1BH8A 3WAAA 5AV9D 1KX4C 5GSUB 1P3MC 1KX3A 1TZYC 2JSSA 5AV9C 4G91B 4J8UD 4WU8A 3MGPA 3R45B 2CV5D 3MNND 5B1MB 1BFMA 4J8UC 3AZNB 3W96D 3AZIB 2CV5C 4Z66B 3KWQA 3MNNC 3AYWD 1BH8B 3WAAB 5DNMC 3W96C 2PYOB 5AVBB 1JFIA 4KHAA 5B2JD 1ID3B 3O62A 3AN2C 2NZDB 1P3MA 5B24B 3TU4B 3V9RA 1P3KD 1P3BB 3VH5T 3C1CA 3AV1D 2F8NB 5BNVB 5B0YB 4J8UA 1P3KC 3UT9D 3AV1C 4EO5C 3MNNA 3KXBA 1F66C 1HTAA 4KHAB 5CPKD 3B0BA 2F8NH 2YFWB 1M1AD 5B31B 3AYWA 5E5AD 3UTBA 5CPKC 3V9RB 1B67A 3AZED 4Z5TB 4DRAA 2AROB 4ZBJB 4YS3D 4YM6B 4E44A 4Z2MH 5AVCD 5E5AC 5B2ID 5B2JA 3MGSD 3AZEC 5AV5B 4YS3C 1P3LD 5AVCC 4J8WB 3B6FD 3MGSC 3X1TD 3REHC 1P3LC 5G49A 2IO5B 3UTBB 3WA9D 2YFVB 3B6FC 3AZJA 3AV2B 4H9RA 3UT9A 3WA9C 1P3GD 3AZFB 5CPKA 1M1AA 5CPIB 1AOID 3W98B 1S32D 1P3GC 2NQBB 4J8XB 3AZEA 4YS3A 5CPJA 1AOIC 4R8PD 5B2IA 5DNND 1P3OA 3AZJB 1KX5A 3AFAB 5JRGA 3MGRD 3AZLA 3KUYB 1P3FD 4R8PC 3RELD 5DNNC 1WWIA 2L5AA 4XZQB 4WU9B 5B0ZB 3MGRC 3X1TA 5AY8D 1P3FC 5B1LD 5BT1D 4ZUXB 3B0CW 5BNXA 3LZ1A 5AY8C 5CPJB 5B1LC 3VH6A 5BT1C 3AZGD 1P3GA 1P3PD 4KUDB 5GT0D 3AZLB 3X1VD 5GT3B 1HQ3A 3AZMA 3AZGC 1S32A 1P3PC 4H9QA 5GT0C 3X1UB 5BS7A 3X1VC 3AZHB 2FJ7B 3AZKD 5B40A 3A6ND 3B0DC 5C3IB 1M19D 5BNXB 3LELA 4HGAB 3A6NC 3RELA 1EQZA 1A7WA 1M19C 1BH9B 5AV6B 4WNNB 3X1SC 3NQUA 4LD9B 4QLCB 5GSUC 5B40B 5B1MD 4G91C 4M6BA 4CAYB 2HIOD 4X23B 3AZID 3LZ0D 3B6GD 5B1MC 5CP6A 1H3OA 5F99B 3C1BB 2HIOC 2PYOD 5AVBD 3AZIC 1M18D 4UUZA 3LZ0C 1R4VA 1KX4D 3B6GC 3AZKA 1TZYD 3UTAD 1P34A 4H9OA 2PYOC 5AVBC 3WTPD 1M18C 3REKB 2NZDD 3W99B 3MVDD 5B24D 3UTAC 4H9PB 3WTPC 1P3BD 2NZDC 5BO0B 3MVDC 2F8ND 5B24C 3TU4C 5DNMD 1P3BC 4JJNB 5AV8B 3REID 5B32B 2F8NG 1P34B 4XUJD 3AN2D 4AWLB 3REIC 3LZ0A 5B31D 1KU5A 1KX3B 3B6GA 4XUJC 4WU8B 3MGPB 1M18A 4Z5TD 5B31C 1KX4A 5B31G 1TZYA 1ZLAD 3UTAA 5AV9A 3MGQD 4Z5TC 4YM6C 3KWQB 1F66D 1ZLAC 3MGQC 5AV5C 1JFIB 2CV5A 5DNMA 3W96A 3AV2D 3O62B 3REIA 1P3MB 2IO5C 3AZFD 3AV2C 4J8VD 3AN2A 4KGCD 3C1CB 3W98D 3AZFC 2NQBD 3WTPE 4J8UB 4J8VC 4KGCC 2CV5B 3REHD 5CPIC 3MNNB 3KXBB 3W98C 1ZLAA 1Q9CA 2NQBC 4J8XC 1P3KA 5FUGA 3AV1A 3AYWB 1F66A 1U35D 4WU9D 5B0ZD 5JA4A 3AFAC 1U35C 4WU9C 5B0ZC 5B2JB 4E45A 5E5AA 4ZUXC 4KUDD 5FUGB 5GT3D 5G49B 4H9NA 4EO5B 4KGCA 5AVCA 4KUDC 5JA4B 3LJAD 3MGSA 4H9RB 5B33D 3UT9B 5GT3C 3REHA 1P3LA 5KDMA 1ULYA 3REJD 5CPKB 3B6FA 3LJAC 3X1UC 5B33C 2FJ7C 1M1AB 2BYKA 1U35A 3REJC 5GXQD 5C3IC 2F8NK 3WA9A 4G92B 5AV6D 3AZEB 4YS3B 4LD9D 5B2IB 5GXQC 1P3OB 1KX5B 5AV6C 5JRGB 4LD9C 1P3LB 1AOIA 3W97D 1P3AD 1P3ID 3X1TB 2BYKB 3WKJD 4R8PA 5F99D 3W97C 5DNNA
chains in the Genus database with same CATH superfamily
4X23C 3LZ1B 3LJAA 4H9SC 5B33A 3MGRA 1P3IC 3X1SD 3WKJC 1P3FA 2DQNC 5F99C 3C1BC 3REJA 1P3GB 3REKD 3W99D 2G5IC 2LY8A 5GSUD 5AY8A 1HQ3B 2HUEB 5B1LA 3AZMB 1AOIB 1S32B 1PZRA 4H9QB 2Y2HA 3REKC 3W99C 3AZGA 2F2AC 3AZND 1P3PA 4JJND 5AV8D 3MGRB 5GT0A 4Z66D 3LELB 3X1VA 5B32D 3RELB 3WAAD 1EQZB 3AZNC 3W97A 1P3AA 4JJNC 5AV8C 4Z66C 1P3IA 5AY8B 3NQUB 5B32C 3WAAC 5B32G 3A6NA 1ID3D 1M19A 1KX3C 2JCHA 3X1SA 3TU4D 3NQJA 3VH6W 2Y2MA 2Y2KA 1ID3C 3MGPC 3KWQD 5GSUA 5CP6B 5B0YD 1H3OB 3B0DB 4NE5A 3H0LC 4UUZB 3KWQC 3R45A 3AZKB 5B0YC 5B1MA 4H9OB 3AZNA 1M19B 2HIOA 3AZIA 4Z66A 3NQJB 3O62C 4Z2MG 2PYOA 5AVBA 2AROD 3C1CD 4YM6D 4NE3A 1ID3A 3WTPA 2NZDA 2AROC 5AV5D 4ZBJC 4WZSB 3KXBD 3MVDA 3C1CC 5B24A 3TU4A 4J8WD 2HIOB 1P3BA 2ZY5A 3LZ0B 3KXBC 2F8NA 2CWEA 3B6GB 3UTBD 5BNVA 5B0YA 4J8WC 1M18B 1KX4B 3F6TA 3AYWC 2Y2NA 1TZYB 3UTBC 3UTAB 5AV9B 3WTPB 2Y2PA 4XUJA 2YFWA 3MVDB 5B31A 2ZY3A 5CPID 3A1KA 3B0CT 3KFUG 3VH5A 5B2JC 4J8XD 4Z5TA 2AROA 4YM6A 5DNMB 3A1IA 3AZJD 3W96B 3AFAD 3MGQA 3REIB 5AV5A 3KUYD 4J8WA 4XZQD 3AZJC 3C1BD 4XUJB 3UT9C 3AN2B 3KUYC 1P3AC 4XZQC 2YFVA 4ZUXD 2ZY4A 3AV2A 2BYMA 1M1AC 1TAFA 5CPJD 1ZLAB 1P3OD 3AZFA 4G92C 1P3KB 1KX5D 3MGQB 1B6WA 5JRGD 4J8VA 3AZLD 5CPJC 3AV1B 5CPIA 3EG5B 1F66B 5B2IC 3W98A 1P3OC 2NQBA 1KX5C 4J8XA 5JRGC 3X1UD 3AZLC 2FJ7D 3AZHD 1WWSA 2DF4C 4WV4B 2BYMB 3LZ1D 3AFAA 3AZHC 3X1TC 1TAFB 3KUYA 4CSRA 5E5AB 4DRBA 4XZQA 4WU9A 5B0ZA 3LZ1C 4J8VB 1F1EA 4KGCB 4H9NB 1HQ3D 4HGAC 3AZMD 5AVCB 3VH5W 1Z2CB 4ZUXA 5CHLB 3MGSB 3VH6T 4QLCD 3REHB 1HQ3C 2HUEC 5KDMB 3AZMC 5B40D 2ZM5A 1S32C 3B6FB 4KUDA 4X23D 5BS7C 4QLCC 3LELD 5GT3A 5B40C 4CSRB 1U35B 1EQZD 3WA9B 3X1UA 3LELC 2FJ7A 3AZHA 4UPKA 3RELC 1EQZC 4NFTA 2RVQD 5GXQA 1BH9A 5AV6A 4WNNA 4LD9A 3EPHA 4R8PB 5CP6D 2RVQC 5DNNB 3LJAB 5B33B 4QLCA 1P3FB 5CP6C 3REJB 4CAYA 1P34D 1N1JA 4X23A 4H9SA 1KX3D 3AZKC 5B1LB 3WKJA 1P34C 5GXQB 5F99A 3C1BA 4WU8D 3MGPD 4AWLC 3P5JB 2FFFB 2G5HC 4NE6A 3AZGB 2Y2LA 1P3PB 4WU8C 3REKA 5GT0B 3W99A 3X1VB 3KSYA 4H9PA 3W97B 1P3AB 1N1JB 1P3IB 5BO0A 3WKJB 3A6NB 3O62D 4JJNA 5AV8A 1P3MD 3X1SB 5B32A 1BH8A 3WAAA 5AV9D 1KX4C 5GSUB 1P3MC 1KX3A 1TZYC 2JSSA 5AV9C 4G91B 4J8UD 4WU8A 3MGPA 3R45B 2CV5D 3MNND 5B1MB 1BFMA 4J8UC 3AZNB 3W96D 3AZIB 2CV5C 4Z66B 3KWQA 3MNNC 3AYWD 1BH8B 3WAAB 5DNMC 3W96C 2PYOB 5AVBB 1JFIA 4KHAA 5B2JD 1ID3B 3O62A 3AN2C 2NZDB 1P3MA 5B24B 3TU4B 3V9RA 1P3KD 1P3BB 3VH5T 3C1CA 3AV1D 2F8NB 5BNVB 5B0YB 4J8UA 1P3KC 3UT9D 3AV1C 4EO5C 3MNNA 3KXBA 1F66C 1HTAA 4KHAB 5CPKD 3B0BA 2F8NH 2YFWB 1M1AD 5B31B 3AYWA 5E5AD 3UTBA 5CPKC 3V9RB 1B67A 4DQYB 3AZED 4WJ3C 4Z5TB 4DRAA 2AROB 4ZBJB 4YM6B 4YS3D 4E44A 4Z2MH 5AVCD 5E5AC 2Y2QA 5B2ID 5B2JA 3MGSD 3AZEC 5AV5B 4YS3C 1P3LD 5AVCC 4J8WB 3B6FD 2Y2IA 3MGSC 3X1TD 3REHC 3IP4C 1P3LC 5G49A 2IO5B 3UTBB 3WA9D 2YFVB 3B6FC 3AZJA 3AV2B 4H9RA 3UT9A 2ZY2A 3FDDA 3WA9C 1P3GD 3AZFB 5CPKA 1M1AA 5CPIB 2VQRA 1AOID 3W98B 1S32D 1P3GC 2NQBB 4J8XB 3AZEA 4YS3A 5CPJA 1AOIC 4R8PD 5B2IA 5DNND 1P3OA 3AZJB 1KX5A 3AFAB 5JRGA 3MGRD 3AZLA 3KUYB 1P3FD 4R8PC 3RELD 5DNNC 1WWIA 2L5AA 4XZQB 4WU9B 5B0ZB 3MGRC 3X1TA 5AY8D 1P3FC 5B1LD 5BT1D 4ZUXB 3B0CW 5BNXA 3LZ1A 5AY8C 5CPJB 5B1LC 3EPKA 3VH6A 5BT1C 3AZGD 1P3GA 1P3PD 4KUDB 5GT0D 3AZLB 3X1VD 5GT3B 1HQ3A 3AZMA 3AZGC 1S32A 1P3PC 4H9QA 5GT0C 3X1UB 5BS7A 3X1VC 3AZHB 2FJ7B 3AZKD 5B40A 3A6ND 3B0DC 1W2EA 5C3IB 1M19D 5BNXB 3LELA 4HGAB 3A6NC 3RELA 1EQZA 1A7WA 1M19C 1BH9B 5AV6B 4WNNB 3X1SC 3NQUA 4LD9B 4QLCB 5GSUC 3EPJA 5B40B 5B1MD 4G91C 4M6BA 4CAYB 2HIOD 4X23B 3AZID 3LZ0D 1T3UA 3B6GD 5B1MC 3H0RC 5CP6A 1H3OA 5F99B 3C1BB 2HIOC 2PYOD 5AVBD 3AZIC 1M18D 4UUZA 3LZ0C 1R4VA 1KX4D 3B6GC 3AZKA 1TZYD 3UTAD 1P34A 4H9OA 2PYOC 5AVBC 3WTPD 1M18C 3REKB 2NZDD 3W99B 3MVDD 2Y2JA 5B24D 3UTAC 4H9PB 3WTPC 1P3BD 2NZDC 5BO0B 3MVDC 2F8ND 5B24C 3TU4C 5DNMD 3EPLA 1P3BC 4JJNB 5AV8B 3REID 2Y2GA 2Y2OA 5B32B 2F8NG 1P34B 4XUJD 3AN2D 4AWLB 3REIC 3LZ0A 5B31D 1KU5A 1KX3B 3B6GA 4XUJC 4WU8B 3MGPB 1M18A 4Z5TD 5B31C 1KX4A 5B31G 1TZYA 1ZLAD 3UTAA 5AV9A 3MGQD 4Z5TC 4YM6C 3KWQB 1F66D 1ZLAC 3MGQC 5AV5C 1JFIB 2CV5A 5DNMA 3W96A 3AV2D 3O62B 3REIA 1P3MB 2IO5C 3AZFD 2W8SA 3AV2C 4J8VD 2BG1A 3AN2A 4KGCD 3C1CB 3W98D 3AZFC 2NQBD 3WTPE 4J8UB 4J8VC 4KGCC 2CV5B 3REHD 5CPIC 3MNNB 3KXBB 3W98C 1ZLAA 1Q9CA 2NQBC 4J8XC 1P3KA 5FUGA 3AV1A 3AYWB 2UWXA 1F66A 1U35D 4WU9D 5B0ZD 5JA4A 3AFAC 2XD1A 3H0MC 1U35C 4WU9C 5B0ZC 5B2JB 4E45A 5E5AA 4ZUXC 4KUDD 5FUGB 5GT3D 5G49B 4H9NA 4EO5B 4KGCA 5AVCA 4KUDC 5JA4B 3LJAD 3MGSA 4H9RB 5B33D 3UT9B 5GT3C 3REHA 1P3LA 5KDMA 1ULYA 3REJD 5CPKB 3B6FA 3LJAC 3X1UC 2XD5A 5B33C 2FJ7C 1M1AB 2BYKA 1U35A 3REJC 5GXQD 5C3IC 2F8NK 3WA9A 4G92B 5AV6D 3AZEB 2J8PA 3AL0C 4YS3B 4LD9D 5B2IB 5GXQC 1P3OB 1KX5B 5AV6C 5JRGB 2JE5A 4LD9C 1P3LB 1AOIA 3W97D 1P3AD 1P3ID 3X1TB 2BYKB 3WKJD 4R8PA 2RIQA 5F99D 3W97C 5DNNA
chains in the Genus database with same CATH topology
4X23C 3LZ1B 3LJAA 4H9SC 5B33A 3MGRA 1P3IC 3X1SD 3WKJC 1P3FA 2DQNC 5F99C 3C1BC 3REJA 1P3GB 3REKD 3W99D 2G5IC 2LY8A 5GSUD 5AY8A 1HQ3B 2HUEB 5B1LA 3AZMB 1AOIB 1S32B 1PZRA 4H9QB 2Y2HA 3REKC 3W99C 3AZGA 2F2AC 3AZND 1P3PA 4JJND 5AV8D 3MGRB 5GT0A 4Z66D 3LELB 3X1VA 5B32D 3RELB 3WAAD 1EQZB 3AZNC 3W97A 1P3AA 4JJNC 5AV8C 4Z66C 1P3IA 5AY8B 3NQUB 5B32C 3WAAC 5B32G 3A6NA 1ID3D 1M19A 1KX3C 2JCHA 3X1SA 3TU4D 3NQJA 3VH6W 2Y2MA 2Y2KA 1ID3C 3MGPC 3KWQD 5GSUA 5CP6B 5B0YD 1H3OB 3B0DB 4NE5A 3H0LC 4UUZB 3KWQC 3R45A 3AZKB 5B0YC 5B1MA 4H9OB 3AZNA 1M19B 2HIOA 3AZIA 4Z66A 3NQJB 3O62C 4Z2MG 2PYOA 5AVBA 2AROD 3C1CD 4YM6D 4NE3A 1ID3A 3WTPA 2NZDA 2AROC 5AV5D 4ZBJC 4WZSB 3KXBD 3MVDA 3C1CC 5B24A 3TU4A 4J8WD 2HIOB 1P3BA 2ZY5A 3LZ0B 3KXBC 2F8NA 2CWEA 3B6GB 3UTBD 5BNVA 5B0YA 4J8WC 1M18B 1KX4B 3F6TA 3AYWC 2Y2NA 1TZYB 3UTBC 3UTAB 5AV9B 3WTPB 2Y2PA 4XUJA 2YFWA 3MVDB 5B31A 2ZY3A 5CPID 3A1KA 3B0CT 3KFUG 3VH5A 5B2JC 4J8XD 4Z5TA 2AROA 4YM6A 5DNMB 3A1IA 3AZJD 3W96B 3AFAD 3MGQA 3REIB 5AV5A 3KUYD 4J8WA 4XZQD 3AZJC 3C1BD 4XUJB 3UT9C 3AN2B 3KUYC 1P3AC 4XZQC 2YFVA 4ZUXD 2ZY4A 3AV2A 2BYMA 1M1AC 1TAFA 5CPJD 1ZLAB 1P3OD 3AZFA 4G92C 1P3KB 1KX5D 3MGQB 1B6WA 5JRGD 4J8VA 3AZLD 5CPJC 3AV1B 5CPIA 3EG5B 1F66B 5B2IC 3W98A 1P3OC 2NQBA 1KX5C 4J8XA 5JRGC 3X1UD 3AZLC 2FJ7D 3AZHD 1WWSA 2DF4C 4WV4B 2BYMB 3LZ1D 3AFAA 3AZHC 3X1TC 1TAFB 3KUYA 4CSRA 5E5AB 4DRBA 4XZQA 4WU9A 5B0ZA 3LZ1C 4J8VB 1F1EA 4KGCB 4H9NB 1HQ3D 4HGAC 3AZMD 5AVCB 3VH5W 1Z2CB 4ZUXA 5CHLB 3MGSB 3VH6T 4QLCD 3REHB 1HQ3C 2HUEC 5KDMB 3AZMC 5B40D 2ZM5A 1S32C 3B6FB 4KUDA 4X23D 5BS7C 4QLCC 3LELD 5GT3A 5B40C 4CSRB 1U35B 1EQZD 3WA9B 3X1UA 3LELC 2FJ7A 3AZHA 4UPKA 3RELC 1EQZC 4NFTA 2RVQD 5GXQA 1BH9A 5AV6A 4WNNA 4LD9A 3EPHA 4R8PB 5CP6D 2RVQC 5DNNB 3LJAB 5B33B 4QLCA 1P3FB 5CP6C 3REJB 4CAYA 1P34D 1N1JA 4X23A 4H9SA 1KX3D 3AZKC 5B1LB 3WKJA 1P34C 5GXQB 5F99A 3C1BA 4WU8D 3MGPD 4AWLC 3P5JB 2FFFB 2G5HC 4NE6A 3AZGB 2Y2LA 1P3PB 4WU8C 3REKA 5GT0B 3W99A 3X1VB 3KSYA 4H9PA 3W97B 1P3AB 1N1JB 1P3IB 5BO0A 3WKJB 3A6NB 3O62D 4JJNA 5AV8A 1P3MD 3X1SB 5B32A 1BH8A 3WAAA 5AV9D 1KX4C 5GSUB 1P3MC 1KX3A 1TZYC 2JSSA 5AV9C 4G91B 4J8UD 4WU8A 3MGPA 3R45B 2CV5D 3MNND 5B1MB 1BFMA 4J8UC 3AZNB 3W96D 3AZIB 2CV5C 4Z66B 3KWQA 3MNNC 3AYWD 1BH8B 3WAAB 5DNMC 3W96C 2PYOB 5AVBB 1JFIA 4KHAA 5B2JD 1ID3B 3O62A 3AN2C 2NZDB 1P3MA 5B24B 3TU4B 3V9RA 1P3KD 1P3BB 3VH5T 3C1CA 3AV1D 2F8NB 5BNVB 5B0YB 4J8UA 1P3KC 3UT9D 3AV1C 4EO5C 3MNNA 3KXBA 1F66C 1HTAA 4KHAB 5CPKD 3B0BA 2F8NH 2YFWB 1M1AD 5B31B 3AYWA 5E5AD 3UTBA 5CPKC 3V9RB 1B67A 4DQYB 3AZED 4WJ3C 4Z5TB 4DRAA 2AROB 4ZBJB 4YM6B 4YS3D 4E44A 4Z2MH 5AVCD 5E5AC 2Y2QA 5B2ID 5B2JA 3MGSD 3AZEC 5AV5B 4YS3C 1P3LD 5AVCC 4J8WB 3B6FD 2Y2IA 3MGSC 3X1TD 3REHC 3IP4C 1P3LC 5G49A 2IO5B 3UTBB 3WA9D 2YFVB 3B6FC 3AZJA 3AV2B 4H9RA 3UT9A 2ZY2A 3FDDA 3WA9C 1P3GD 3AZFB 5CPKA 1M1AA 5CPIB 2VQRA 1AOID 3W98B 1S32D 1P3GC 2NQBB 4J8XB 3AZEA 4YS3A 5CPJA 1AOIC 4R8PD 5B2IA 5DNND 1P3OA 3AZJB 1KX5A 3AFAB 5JRGA 3MGRD 3AZLA 3KUYB 1P3FD 4R8PC 3RELD 5DNNC 1WWIA 2L5AA 4XZQB 4WU9B 5B0ZB 3MGRC 3X1TA 5AY8D 1P3FC 5B1LD 5BT1D 4ZUXB 3B0CW 5BNXA 3LZ1A 5AY8C 5CPJB 5B1LC 3EPKA 3VH6A 5BT1C 3AZGD 1P3GA 1P3PD 4KUDB 5GT0D 3AZLB 3X1VD 5GT3B 1HQ3A 3AZMA 3AZGC 1S32A 1P3PC 4H9QA 5GT0C 3X1UB 5BS7A 3X1VC 3AZHB 2FJ7B 3AZKD 5B40A 3A6ND 3B0DC 1W2EA 5C3IB 1M19D 5BNXB 3LELA 4HGAB 3A6NC 3RELA 1EQZA 1A7WA 1M19C 1BH9B 5AV6B 4WNNB 3X1SC 3NQUA 4LD9B 4QLCB 5GSUC 3EPJA 5B40B 5B1MD 4G91C 4M6BA 4CAYB 2HIOD 4X23B 3AZID 3LZ0D 1T3UA 3B6GD 5B1MC 3H0RC 5CP6A 1H3OA 5F99B 3C1BB 2HIOC 2PYOD 5AVBD 3AZIC 1M18D 4UUZA 3LZ0C 1R4VA 1KX4D 3B6GC 3AZKA 1TZYD 3UTAD 1P34A 4H9OA 2PYOC 5AVBC 3WTPD 1M18C 3REKB 2NZDD 3W99B 3MVDD 2Y2JA 5B24D 3UTAC 4H9PB 3WTPC 1P3BD 2NZDC 5BO0B 3MVDC 2F8ND 5B24C 3TU4C 5DNMD 3EPLA 1P3BC 4JJNB 5AV8B 3REID 2Y2GA 2Y2OA 5B32B 2F8NG 1P34B 4XUJD 3AN2D 4AWLB 3REIC 3LZ0A 5B31D 1KU5A 1KX3B 3B6GA 4XUJC 4WU8B 3MGPB 1M18A 4Z5TD 5B31C 1KX4A 5B31G 1TZYA 1ZLAD 3UTAA 5AV9A 3MGQD 4Z5TC 4YM6C 3KWQB 1F66D 1ZLAC 3MGQC 5AV5C 1JFIB 2CV5A 5DNMA 3W96A 3AV2D 3O62B 3REIA 1P3MB 2IO5C 3AZFD 2W8SA 3AV2C 4J8VD 2BG1A 3AN2A 4KGCD 3C1CB 3W98D 3AZFC 2NQBD 3WTPE 4J8UB 4J8VC 4KGCC 2CV5B 3REHD 5CPIC 3MNNB 3KXBB 3W98C 1ZLAA 1Q9CA 2NQBC 4J8XC 1P3KA 5FUGA 3AV1A 3AYWB 2UWXA 1F66A 1U35D 4WU9D 5B0ZD 5JA4A 3AFAC 2XD1A 3H0MC 1U35C 4WU9C 5B0ZC 5B2JB 4E45A 5E5AA 4ZUXC 4KUDD 5FUGB 5GT3D 5G49B 4H9NA 4EO5B 4KGCA 5AVCA 4KUDC 5JA4B 3LJAD 3MGSA 4H9RB 5B33D 3UT9B 5GT3C 3REHA 1P3LA 5KDMA 1ULYA 3REJD 5CPKB 3B6FA 3LJAC 3X1UC 2XD5A 5B33C 2FJ7C 1M1AB 2BYKA 1U35A 3REJC 5GXQD 5C3IC 2F8NK 3WA9A 4G92B 5AV6D 3AZEB 2J8PA 3AL0C 4YS3B 4LD9D 5B2IB 5GXQC 1P3OB 1KX5B 5AV6C 5JRGB 2JE5A 4LD9C 1P3LB 1AOIA 3W97D 1P3AD 1P3ID 3X1TB 2BYKB 3WKJD 4R8PA 2RIQA 5F99D 3W97C 5DNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  3LZ1 B;  3LJA A;  4H9S C;  5B33 A;  3MGR A;  1P3I C;  3X1S D;  3WKJ C;  1P3F A;  5F99 C;  3C1B C;  3REJ A;  1P3G B;  3REK D;  3W99 D;  2LY8 A;  5GSU D;  5AY8 A;  1HQ3 B;  2HUE B;  5B1L A;  3AZM B;  1AOI B;  1S32 B;  4H9Q B;  3REK C;  3W99 C;  3AZG A;  3AZN D;  1P3P A;  4JJN D;  5AV8 D;  3MGR B;  5GT0 A;  4Z66 D;  3LEL B;  3X1V A;  5B32 D;  3REL B;  3WAA D;  1EQZ B;  3AZN C;  3W97 A;  1P3A A;  4JJN C;  5AV8 C;  4Z66 C;  1P3I A;  5AY8 B;  3NQU B;  5B32 C;  3WAA C;  5B32 G;  3A6N A;  1ID3 D;  1M19 A;  1KX3 C;  3X1S A;  3TU4 D;  3NQJ A;  3VH6 W;  1ID3 C;  3MGP C;  3KWQ D;  5GSU A;  5CP6 B;  5B0Y D;  1H3O B;  3B0D B;  4NE5 A;  4UUZ B;  3KWQ C;  3R45 A;  3AZK B;  5B0Y C;  5B1M A;  4H9O B;  3AZN A;  1M19 B;  2HIO A;  3AZI A;  4Z66 A;  3NQJ B;  3O62 C;  4Z2M G;  2PYO A;  5AVB A;  2ARO D;  3C1C D;  4YM6 D;  4NE3 A;  1ID3 A;  3WTP A;  2NZD A;  2ARO C;  5AV5 D;  4ZBJ C;  4WZS B;  3KXB D;  3MVD A;  3C1C C;  5B24 A;  3TU4 A;  4J8W D;  2HIO B;  1P3B A;  3LZ0 B;  3KXB C;  2F8N A;  2CWE A;  3B6G B;  3UTB D;  5BNV A;  5B0Y A;  4J8W C;  1M18 B;  1KX4 B;  3AYW C;  1TZY B;  3UTB C;  3UTA B;  5AV9 B;  3WTP B;  4XUJ A;  2YFW A;  3MVD B;  5B31 A;  5CPI D;  3B0C T;  3VH5 A;  5B2J C;  4J8X D;  4Z5T A;  2ARO A;  4YM6 A;  5DNM B;  3AZJ D;  3W96 B;  3AFA D;  3MGQ A;  3REI B;  5AV5 A;  3KUY D;  4J8W A;  4XZQ D;  3AZJ C;  3C1B D;  4XUJ B;  3UT9 C;  3AN2 B;  3KUY C;  1P3A C;  4XZQ C;  2YFV A;  4ZUX D;  3AV2 A;  2BYM A;  1M1A C;  1TAF A;  5CPJ D;  1ZLA B;  1P3O D;  3AZF A;  4G92 C;  1P3K B;  1KX5 D;  3MGQ B;  1B6W A;  5JRG D;  4J8V A;  3AZL D;  5CPJ C;  3AV1 B;  5CPI A;  1F66 B;  3W98 A;  5B2I C;  1P3O C;  2NQB A;  1KX5 C;  4J8X A;  5JRG C;  3X1U D;  3AZL C;  2FJ7 D;  3AZH D;  1WWS A;  4WV4 B;  2BYM B;  3LZ1 D;  3AFA A;  3AZH C;  3X1T C;  1TAF B;  3KUY A;  4CSR A;  5E5A B;  4DRB A;  4XZQ A;  4WU9 A;  5B0Z A;  3LZ1 C;  4J8V B;  1F1E A;  4KGC B;  4H9N B;  1HQ3 D;  4HGA C;  3AZM D;  5AVC B;  3VH5 W;  4ZUX A;  5CHL B;  3MGS B;  3VH6 T;  4QLC D;  3REH B;  1HQ3 C;  2HUE C;  5KDM B;  3AZM C;  5B40 D;  1S32 C;  3B6F B;  4KUD A;  4X23 D;  5BS7 C;  4QLC C;  3LEL D;  5GT3 A;  5B40 C;  4CSR B;  1U35 B;  1EQZ D;  3WA9 B;  3X1U A;  3LEL C;  2FJ7 A;  3AZH A;  3REL C;  1EQZ C;  4NFT A;  2RVQ D;  5GXQ A;  1BH9 A;  5AV6 A;  4WNN A;  4LD9 A;  4R8P B;  5CP6 D;  2RVQ C;  5DNN B;  3LJA B;  5B33 B;  4QLC A;  1P3F B;  5CP6 C;  3REJ B;  4CAY A;  1P34 D;  1N1J A;  4X23 A;  4H9S A;  1KX3 D;  3AZK C;  5B1L B;  3WKJ A;  1P34 C;  5GXQ B;  5F99 A;  3C1B A;  4WU8 D;  3MGP D;  4AWL C;  4NE6 A;  3AZG B;  1P3P B;  4WU8 C;  3REK A;  5GT0 B;  3W99 A;  3X1V B;  3KSY A;  4H9P A;  3W97 B;  1P3A B;  1N1J B;  1P3I B;  5BO0 A;  3WKJ B;  3A6N B;  3O62 D;  4JJN A;  5AV8 A;  1P3M D;  3X1S B;  5B32 A;  1BH8 A;  3WAA A;  5AV9 D;  1KX4 C;  5GSU B;  1P3M C;  1KX3 A;  1TZY C;  2JSS A;  5AV9 C;  4G91 B;  4J8U D;  4WU8 A;  3MGP A;  3R45 B;  2CV5 D;  3MNN D;  5B1M B;  1BFM A;  4J8U C;  3AZN B;  3W96 D;  3AZI B;  2CV5 C;  4Z66 B;  3KWQ A;  3MNN C;  3AYW D;  1BH8 B;  3WAA B;  5DNM C;  3W96 C;  2PYO B;  5AVB B;  1JFI A;  4KHA A;  5B2J D;  1ID3 B;  3O62 A;  3AN2 C;  2NZD B;  1P3M A;  5B24 B;  3TU4 B;  3V9R A;  1P3K D;  1P3B B;  3VH5 T;  3C1C A;  3AV1 D;  2F8N B;  5BNV B;  5B0Y B;  4J8U A;  1P3K C;  3UT9 D;  3AV1 C;  4EO5 C;  3MNN A;  3KXB A;  1F66 C;  1HTA A;  4KHA B;  5CPK D;  3B0B A;  2F8N H;  2YFW B;  1M1A D;  5B31 B;  3AYW A;  5E5A D;  3UTB A;  5CPK C;  3V9R B;  1B67 A;  3AZE D;  4Z5T B;  4DRA A;  2ARO B;  4ZBJ B;  4YS3 D;  4YM6 B;  4E44 A;  4Z2M H;  5AVC D;  5E5A C;  5B2I D;  5B2J A;  3MGS D;  3AZE C;  5AV5 B;  4YS3 C;  1P3L D;  5AVC C;  4J8W B;  3B6F D;  3MGS C;  3X1T D;  3REH C;  1P3L C;  5G49 A;  2IO5 B;  3UTB B;  3WA9 D;  2YFV B;  3B6F C;  3AZJ A;  3AV2 B;  4H9R A;  3UT9 A;  3WA9 C;  1P3G D;  3AZF B;  5CPK A;  1M1A A;  5CPI B;  1AOI D;  3W98 B;  1S32 D;  1P3G C;  2NQB B;  4J8X B;  3AZE A;  4YS3 A;  5CPJ A;  1AOI C;  4R8P D;  5B2I A;  5DNN D;  1P3O A;  3AZJ B;  1KX5 A;  3AFA B;  5JRG A;  3MGR D;  3AZL A;  3KUY B;  1P3F D;  4R8P C;  3REL D;  5DNN C;  1WWI A;  2L5A A;  4XZQ B;  4WU9 B;  5B0Z B;  3MGR C;  3X1T A;  5AY8 D;  1P3F C;  5B1L D;  5BT1 D;  4ZUX B;  3B0C W;  5BNX A;  3LZ1 A;  5AY8 C;  5CPJ B;  5B1L C;  3VH6 A;  5BT1 C;  3AZG D;  1P3G A;  1P3P D;  4KUD B;  5GT0 D;  3AZL B;  3X1V D;  5GT3 B;  1HQ3 A;  3AZM A;  3AZG C;  1S32 A;  1P3P C;  4H9Q A;  5GT0 C;  3X1U B;  5BS7 A;  3X1V C;  3AZH B;  2FJ7 B;  3AZK D;  5B40 A;  3A6N D;  3B0D C;  5C3I B;  1M19 D;  5BNX B;  3LEL A;  4HGA B;  3A6N C;  3REL A;  1EQZ A;  1A7W A;  1M19 C;  1BH9 B;  5AV6 B;  4WNN B;  3X1S C;  3NQU A;  4LD9 B;  4QLC B;  5GSU C;  5B40 B;  5B1M D;  4G91 C;  4M6B A;  4CAY B;  2HIO D;  4X23 B;  3AZI D;  3LZ0 D;  3B6G D;  5B1M C;  5CP6 A;  1H3O A;  5F99 B;  3C1B B;  2HIO C;  2PYO D;  5AVB D;  3AZI C;  1M18 D;  4UUZ A;  3LZ0 C;  1R4V A;  1KX4 D;  3B6G C;  3AZK A;  1TZY D;  3UTA D;  1P34 A;  4H9O A;  2PYO C;  5AVB C;  3WTP D;  1M18 C;  3REK B;  2NZD D;  3W99 B;  3MVD D;  5B24 D;  3UTA C;  4H9P B;  3WTP C;  1P3B D;  2NZD C;  5BO0 B;  3MVD C;  2F8N D;  5B24 C;  3TU4 C;  5DNM D;  1P3B C;  4JJN B;  5AV8 B;  3REI D;  5B32 B;  2F8N G;  1P34 B;  4XUJ D;  3AN2 D;  4AWL B;  3REI C;  3LZ0 A;  5B31 D;  1KU5 A;  1KX3 B;  3B6G A;  4XUJ C;  4WU8 B;  3MGP B;  1M18 A;  4Z5T D;  5B31 C;  1KX4 A;  5B31 G;  1TZY A;  1ZLA D;  3UTA A;  5AV9 A;  3MGQ D;  4Z5T C;  4YM6 C;  3KWQ B;  1F66 D;  1ZLA C;  3MGQ C;  5AV5 C;  1JFI B;  2CV5 A;  5DNM A;  3W96 A;  3AV2 D;  3O62 B;  3REI A;  1P3M B;  2IO5 C;  3AZF D;  3AV2 C;  4J8V D;  3AN2 A;  4KGC D;  3C1C B;  3W98 D;  3AZF C;  2NQB D;  3WTP E;  4J8U B;  4J8V C;  4KGC C;  2CV5 B;  3REH D;  5CPI C;  3MNN B;  3KXB B;  3W98 C;  1ZLA A;  1Q9C A;  2NQB C;  4J8X C;  1P3K A;  5FUG A;  3AV1 A;  3AYW B;  1F66 A;  1U35 D;  4WU9 D;  5B0Z D;  5JA4 A;  3AFA C;  1U35 C;  4WU9 C;  5B0Z C;  5B2J B;  4E45 A;  5E5A A;  4ZUX C;  4KUD D;  5FUG B;  5GT3 D;  5G49 B;  4H9N A;  4EO5 B;  4KGC A;  5AVC A;  4KUD C;  5JA4 B;  3LJA D;  3MGS A;  4H9R B;  5B33 D;  3UT9 B;  5GT3 C;  3REH A;  1P3L A;  5KDM A;  1ULY A;  3REJ D;  5CPK B;  3B6F A;  3LJA C;  3X1U C;  5B33 C;  2FJ7 C;  1M1A B;  2BYK A;  1U35 A;  3REJ C;  5GXQ D;  5C3I C;  2F8N K;  3WA9 A;  4G92 B;  5AV6 D;  3AZE B;  4YS3 B;  4LD9 D;  5B2I B;  5GXQ C;  1P3O B;  1KX5 B;  5AV6 C;  5JRG B;  4LD9 C;  1P3L B;  1AOI A;  3W97 D;  1P3A D;  1P3I D;  3X1T B;  2BYK B;  3WKJ D;  4R8P A;  5F99 D;  3W97 C;  5DNN A; 
#chains in the Genus database with same CATH topology
 4X23 C;  3LZ1 B;  3LJA A;  4H9S C;  5B33 A;  3MGR A;  1P3I C;  3X1S D;  3WKJ C;  1P3F A;  2DQN C;  5F99 C;  3C1B C;  3REJ A;  1P3G B;  3REK D;  3W99 D;  2G5I C;  2LY8 A;  5GSU D;  5AY8 A;  1HQ3 B;  2HUE B;  5B1L A;  3AZM B;  1AOI B;  1S32 B;  1PZR A;  4H9Q B;  2Y2H A;  3REK C;  3W99 C;  3AZG A;  2F2A C;  3AZN D;  1P3P A;  4JJN D;  5AV8 D;  3MGR B;  5GT0 A;  4Z66 D;  3LEL B;  3X1V A;  5B32 D;  3REL B;  3WAA D;  1EQZ B;  3AZN C;  3W97 A;  1P3A A;  4JJN C;  5AV8 C;  4Z66 C;  1P3I A;  5AY8 B;  3NQU B;  5B32 C;  3WAA C;  5B32 G;  3A6N A;  1ID3 D;  1M19 A;  1KX3 C;  2JCH A;  3X1S A;  3TU4 D;  3NQJ A;  3VH6 W;  2Y2M A;  2Y2K A;  1ID3 C;  3MGP C;  3KWQ D;  5GSU A;  5CP6 B;  5B0Y D;  1H3O B;  3B0D B;  4NE5 A;  3H0L C;  4UUZ B;  3KWQ C;  3R45 A;  3AZK B;  5B0Y C;  5B1M A;  4H9O B;  3AZN A;  1M19 B;  2HIO A;  3AZI A;  4Z66 A;  3NQJ B;  3O62 C;  4Z2M G;  2PYO A;  5AVB A;  2ARO D;  3C1C D;  4YM6 D;  4NE3 A;  1ID3 A;  3WTP A;  2NZD A;  2ARO C;  5AV5 D;  4ZBJ C;  4WZS B;  3KXB D;  3MVD A;  3C1C C;  5B24 A;  3TU4 A;  4J8W D;  2HIO B;  1P3B A;  2ZY5 A;  3LZ0 B;  3KXB C;  2F8N A;  2CWE A;  3B6G B;  3UTB D;  5BNV A;  5B0Y A;  4J8W C;  1M18 B;  1KX4 B;  3F6T A;  3AYW C;  2Y2N A;  1TZY B;  3UTB C;  3UTA B;  5AV9 B;  3WTP B;  2Y2P A;  4XUJ A;  2YFW A;  3MVD B;  5B31 A;  2ZY3 A;  5CPI D;  3A1K A;  3B0C T;  3KFU G;  3VH5 A;  5B2J C;  4J8X D;  4Z5T A;  2ARO A;  4YM6 A;  5DNM B;  3A1I A;  3AZJ D;  3W96 B;  3AFA D;  3MGQ A;  3REI B;  5AV5 A;  3KUY D;  4J8W A;  4XZQ D;  3AZJ C;  3C1B D;  4XUJ B;  3UT9 C;  3AN2 B;  3KUY C;  1P3A C;  4XZQ C;  2YFV A;  4ZUX D;  2ZY4 A;  3AV2 A;  2BYM A;  1M1A C;  1TAF A;  5CPJ D;  1ZLA B;  1P3O D;  3AZF A;  4G92 C;  1P3K B;  1KX5 D;  3MGQ B;  1B6W A;  5JRG D;  4J8V A;  3AZL D;  5CPJ C;  3AV1 B;  5CPI A;  3EG5 B;  1F66 B;  5B2I C;  3W98 A;  1P3O C;  2NQB A;  1KX5 C;  4J8X A;  5JRG C;  3X1U D;  3AZL C;  2FJ7 D;  3AZH D;  1WWS A;  2DF4 C;  4WV4 B;  2BYM B;  3LZ1 D;  3AFA A;  3AZH C;  3X1T C;  1TAF B;  3KUY A;  4CSR A;  5E5A B;  4DRB A;  4XZQ A;  4WU9 A;  5B0Z A;  3LZ1 C;  4J8V B;  1F1E A;  4KGC B;  4H9N B;  1HQ3 D;  4HGA C;  3AZM D;  5AVC B;  3VH5 W;  1Z2C B;  4ZUX A;  5CHL B;  3MGS B;  3VH6 T;  4QLC D;  3REH B;  1HQ3 C;  2HUE C;  5KDM B;  3AZM C;  5B40 D;  2ZM5 A;  1S32 C;  3B6F B;  4KUD A;  4X23 D;  5BS7 C;  4QLC C;  3LEL D;  5GT3 A;  5B40 C;  4CSR B;  1U35 B;  1EQZ D;  3WA9 B;  3X1U A;  3LEL C;  2FJ7 A;  3AZH A;  4UPK A;  3REL C;  1EQZ C;  4NFT A;  2RVQ D;  5GXQ A;  1BH9 A;  5AV6 A;  4WNN A;  4LD9 A;  3EPH A;  4R8P B;  5CP6 D;  2RVQ C;  5DNN B;  3LJA B;  5B33 B;  4QLC A;  1P3F B;  5CP6 C;  3REJ B;  4CAY A;  1P34 D;  1N1J A;  4X23 A;  4H9S A;  1KX3 D;  3AZK C;  5B1L B;  3WKJ A;  1P34 C;  5GXQ B;  5F99 A;  3C1B A;  4WU8 D;  3MGP D;  4AWL C;  3P5J B;  2FFF B;  2G5H C;  4NE6 A;  3AZG B;  2Y2L A;  1P3P B;  4WU8 C;  3REK A;  5GT0 B;  3W99 A;  3X1V B;  3KSY A;  4H9P A;  3W97 B;  1P3A B;  1N1J B;  1P3I B;  5BO0 A;  3WKJ B;  3A6N B;  3O62 D;  4JJN A;  5AV8 A;  1P3M D;  3X1S B;  5B32 A;  1BH8 A;  3WAA A;  5AV9 D;  1KX4 C;  5GSU B;  1P3M C;  1KX3 A;  1TZY C;  2JSS A;  5AV9 C;  4G91 B;  4J8U D;  4WU8 A;  3MGP A;  3R45 B;  2CV5 D;  3MNN D;  5B1M B;  1BFM A;  4J8U C;  3AZN B;  3W96 D;  3AZI B;  2CV5 C;  4Z66 B;  3KWQ A;  3MNN C;  3AYW D;  1BH8 B;  3WAA B;  5DNM C;  3W96 C;  2PYO B;  5AVB B;  1JFI A;  4KHA A;  5B2J D;  1ID3 B;  3O62 A;  3AN2 C;  2NZD B;  1P3M A;  5B24 B;  3TU4 B;  3V9R A;  1P3K D;  1P3B B;  3VH5 T;  3C1C A;  3AV1 D;  2F8N B;  5BNV B;  5B0Y B;  4J8U A;  1P3K C;  3UT9 D;  3AV1 C;  4EO5 C;  3MNN A;  3KXB A;  1F66 C;  1HTA A;  4KHA B;  5CPK D;  3B0B A;  2F8N H;  2YFW B;  1M1A D;  5B31 B;  3AYW A;  5E5A D;  3UTB A;  5CPK C;  3V9R B;  1B67 A;  4DQY B;  3AZE D;  4WJ3 C;  4Z5T B;  4DRA A;  2ARO B;  4ZBJ B;  4YM6 B;  4YS3 D;  4E44 A;  4Z2M H;  5AVC D;  5E5A C;  2Y2Q A;  5B2I D;  5B2J A;  3MGS D;  3AZE C;  5AV5 B;  4YS3 C;  1P3L D;  5AVC C;  4J8W B;  3B6F D;  2Y2I A;  3MGS C;  3X1T D;  3REH C;  3IP4 C;  1P3L C;  5G49 A;  2IO5 B;  3UTB B;  3WA9 D;  2YFV B;  3B6F C;  3AZJ A;  3AV2 B;  4H9R A;  3UT9 A;  2ZY2 A;  3FDD A;  3WA9 C;  1P3G D;  3AZF B;  5CPK A;  1M1A A;  5CPI B;  2VQR A;  1AOI D;  3W98 B;  1S32 D;  1P3G C;  2NQB B;  4J8X B;  3AZE A;  4YS3 A;  5CPJ A;  1AOI C;  4R8P D;  5B2I A;  5DNN D;  1P3O A;  3AZJ B;  1KX5 A;  3AFA B;  5JRG A;  3MGR D;  3AZL A;  3KUY B;  1P3F D;  4R8P C;  3REL D;  5DNN C;  1WWI A;  2L5A A;  4XZQ B;  4WU9 B;  5B0Z B;  3MGR C;  3X1T A;  5AY8 D;  1P3F C;  5B1L D;  5BT1 D;  4ZUX B;  3B0C W;  5BNX A;  3LZ1 A;  5AY8 C;  5CPJ B;  5B1L C;  3EPK A;  3VH6 A;  5BT1 C;  3AZG D;  1P3G A;  1P3P D;  4KUD B;  5GT0 D;  3AZL B;  3X1V D;  5GT3 B;  1HQ3 A;  3AZM A;  3AZG C;  1S32 A;  1P3P C;  4H9Q A;  5GT0 C;  3X1U B;  5BS7 A;  3X1V C;  3AZH B;  2FJ7 B;  3AZK D;  5B40 A;  3A6N D;  3B0D C;  1W2E A;  5C3I B;  1M19 D;  5BNX B;  3LEL A;  4HGA B;  3A6N C;  3REL A;  1EQZ A;  1A7W A;  1M19 C;  1BH9 B;  5AV6 B;  4WNN B;  3X1S C;  3NQU A;  4LD9 B;  4QLC B;  5GSU C;  3EPJ A;  5B40 B;  5B1M D;  4G91 C;  4M6B A;  4CAY B;  2HIO D;  4X23 B;  3AZI D;  3LZ0 D;  1T3U A;  3B6G D;  5B1M C;  3H0R C;  5CP6 A;  1H3O A;  5F99 B;  3C1B B;  2HIO C;  2PYO D;  5AVB D;  3AZI C;  1M18 D;  4UUZ A;  3LZ0 C;  1R4V A;  1KX4 D;  3B6G C;  3AZK A;  1TZY D;  3UTA D;  1P34 A;  4H9O A;  2PYO C;  5AVB C;  3WTP D;  1M18 C;  3REK B;  2NZD D;  3W99 B;  3MVD D;  2Y2J A;  5B24 D;  3UTA C;  4H9P B;  3WTP C;  1P3B D;  2NZD C;  5BO0 B;  3MVD C;  2F8N D;  5B24 C;  3TU4 C;  5DNM D;  3EPL A;  1P3B C;  4JJN B;  5AV8 B;  3REI D;  2Y2G A;  2Y2O A;  5B32 B;  2F8N G;  1P34 B;  4XUJ D;  3AN2 D;  4AWL B;  3REI C;  3LZ0 A;  5B31 D;  1KU5 A;  1KX3 B;  3B6G A;  4XUJ C;  4WU8 B;  3MGP B;  1M18 A;  4Z5T D;  5B31 C;  1KX4 A;  5B31 G;  1TZY A;  1ZLA D;  3UTA A;  5AV9 A;  3MGQ D;  4Z5T C;  4YM6 C;  3KWQ B;  1F66 D;  1ZLA C;  3MGQ C;  5AV5 C;  1JFI B;  2CV5 A;  5DNM A;  3W96 A;  3AV2 D;  3O62 B;  3REI A;  1P3M B;  2IO5 C;  3AZF D;  2W8S A;  3AV2 C;  4J8V D;  2BG1 A;  3AN2 A;  4KGC D;  3C1C B;  3W98 D;  3AZF C;  2NQB D;  3WTP E;  4J8U B;  4J8V C;  4KGC C;  2CV5 B;  3REH D;  5CPI C;  3MNN B;  3KXB B;  3W98 C;  1ZLA A;  1Q9C A;  2NQB C;  4J8X C;  1P3K A;  5FUG A;  3AV1 A;  3AYW B;  2UWX A;  1F66 A;  1U35 D;  4WU9 D;  5B0Z D;  5JA4 A;  3AFA C;  2XD1 A;  3H0M C;  1U35 C;  4WU9 C;  5B0Z C;  5B2J B;  4E45 A;  5E5A A;  4ZUX C;  4KUD D;  5FUG B;  5GT3 D;  5G49 B;  4H9N A;  4EO5 B;  4KGC A;  5AVC A;  4KUD C;  5JA4 B;  3LJA D;  3MGS A;  4H9R B;  5B33 D;  3UT9 B;  5GT3 C;  3REH A;  1P3L A;  5KDM A;  1ULY A;  3REJ D;  5CPK B;  3B6F A;  3LJA C;  3X1U C;  2XD5 A;  5B33 C;  2FJ7 C;  1M1A B;  2BYK A;  1U35 A;  3REJ C;  5GXQ D;  5C3I C;  2F8N K;  3WA9 A;  4G92 B;  5AV6 D;  3AZE B;  2J8P A;  3AL0 C;  4YS3 B;  4LD9 D;  5B2I B;  5GXQ C;  1P3O B;  1KX5 B;  5AV6 C;  5JRG B;  2JE5 A;  4LD9 C;  1P3L B;  1AOI A;  3W97 D;  1P3A D;  1P3I D;  3X1T B;  2BYK B;  3WKJ D;  4R8P A;  2RIQ A;  5F99 D;  3W97 C;  5DNN A; 
#chains in the Genus database with same CATH homology
 4X23 C;  3LZ1 B;  3LJA A;  4H9S C;  5B33 A;  3MGR A;  1P3I C;  3X1S D;  3WKJ C;  1P3F A;  2DQN C;  5F99 C;  3C1B C;  3REJ A;  1P3G B;  3REK D;  3W99 D;  2G5I C;  2LY8 A;  5GSU D;  5AY8 A;  1HQ3 B;  2HUE B;  5B1L A;  3AZM B;  1AOI B;  1S32 B;  1PZR A;  4H9Q B;  2Y2H A;  3REK C;  3W99 C;  3AZG A;  2F2A C;  3AZN D;  1P3P A;  4JJN D;  5AV8 D;  3MGR B;  5GT0 A;  4Z66 D;  3LEL B;  3X1V A;  5B32 D;  3REL B;  3WAA D;  1EQZ B;  3AZN C;  3W97 A;  1P3A A;  4JJN C;  5AV8 C;  4Z66 C;  1P3I A;  5AY8 B;  3NQU B;  5B32 C;  3WAA C;  5B32 G;  3A6N A;  1ID3 D;  1M19 A;  1KX3 C;  2JCH A;  3X1S A;  3TU4 D;  3NQJ A;  3VH6 W;  2Y2M A;  2Y2K A;  1ID3 C;  3MGP C;  3KWQ D;  5GSU A;  5CP6 B;  5B0Y D;  1H3O B;  3B0D B;  4NE5 A;  3H0L C;  4UUZ B;  3KWQ C;  3R45 A;  3AZK B;  5B0Y C;  5B1M A;  4H9O B;  3AZN A;  1M19 B;  2HIO A;  3AZI A;  4Z66 A;  3NQJ B;  3O62 C;  4Z2M G;  2PYO A;  5AVB A;  2ARO D;  3C1C D;  4YM6 D;  4NE3 A;  1ID3 A;  3WTP A;  2NZD A;  2ARO C;  5AV5 D;  4ZBJ C;  4WZS B;  3KXB D;  3MVD A;  3C1C C;  5B24 A;  3TU4 A;  4J8W D;  2HIO B;  1P3B A;  2ZY5 A;  3LZ0 B;  3KXB C;  2F8N A;  2CWE A;  3B6G B;  3UTB D;  5BNV A;  5B0Y A;  4J8W C;  1M18 B;  1KX4 B;  3F6T A;  3AYW C;  2Y2N A;  1TZY B;  3UTB C;  3UTA B;  5AV9 B;  3WTP B;  2Y2P A;  4XUJ A;  2YFW A;  3MVD B;  5B31 A;  2ZY3 A;  5CPI D;  3A1K A;  3B0C T;  3KFU G;  3VH5 A;  5B2J C;  4J8X D;  4Z5T A;  2ARO A;  4YM6 A;  5DNM B;  3A1I A;  3AZJ D;  3W96 B;  3AFA D;  3MGQ A;  3REI B;  5AV5 A;  3KUY D;  4J8W A;  4XZQ D;  3AZJ C;  3C1B D;  4XUJ B;  3UT9 C;  3AN2 B;  3KUY C;  1P3A C;  4XZQ C;  2YFV A;  4ZUX D;  2ZY4 A;  3AV2 A;  2BYM A;  1M1A C;  1TAF A;  5CPJ D;  1ZLA B;  1P3O D;  3AZF A;  4G92 C;  1P3K B;  1KX5 D;  3MGQ B;  1B6W A;  5JRG D;  4J8V A;  3AZL D;  5CPJ C;  3AV1 B;  5CPI A;  3EG5 B;  1F66 B;  5B2I C;  3W98 A;  1P3O C;  2NQB A;  1KX5 C;  4J8X A;  5JRG C;  3X1U D;  3AZL C;  2FJ7 D;  3AZH D;  1WWS A;  2DF4 C;  4WV4 B;  2BYM B;  3LZ1 D;  3AFA A;  3AZH C;  3X1T C;  1TAF B;  3KUY A;  4CSR A;  5E5A B;  4DRB A;  4XZQ A;  4WU9 A;  5B0Z A;  3LZ1 C;  4J8V B;  1F1E A;  4KGC B;  4H9N B;  1HQ3 D;  4HGA C;  3AZM D;  5AVC B;  3VH5 W;  1Z2C B;  4ZUX A;  5CHL B;  3MGS B;  3VH6 T;  4QLC D;  3REH B;  1HQ3 C;  2HUE C;  5KDM B;  3AZM C;  5B40 D;  2ZM5 A;  1S32 C;  3B6F B;  4KUD A;  4X23 D;  5BS7 C;  4QLC C;  3LEL D;  5GT3 A;  5B40 C;  4CSR B;  1U35 B;  1EQZ D;  3WA9 B;  3X1U A;  3LEL C;  2FJ7 A;  3AZH A;  4UPK A;  3REL C;  1EQZ C;  4NFT A;  2RVQ D;  5GXQ A;  1BH9 A;  5AV6 A;  4WNN A;  4LD9 A;  3EPH A;  4R8P B;  5CP6 D;  2RVQ C;  5DNN B;  3LJA B;  5B33 B;  4QLC A;  1P3F B;  5CP6 C;  3REJ B;  4CAY A;  1P34 D;  1N1J A;  4X23 A;  4H9S A;  1KX3 D;  3AZK C;  5B1L B;  3WKJ A;  1P34 C;  5GXQ B;  5F99 A;  3C1B A;  4WU8 D;  3MGP D;  4AWL C;  3P5J B;  2FFF B;  2G5H C;  4NE6 A;  3AZG B;  2Y2L A;  1P3P B;  4WU8 C;  3REK A;  5GT0 B;  3W99 A;  3X1V B;  3KSY A;  4H9P A;  3W97 B;  1P3A B;  1N1J B;  1P3I B;  5BO0 A;  3WKJ B;  3A6N B;  3O62 D;  4JJN A;  5AV8 A;  1P3M D;  3X1S B;  5B32 A;  1BH8 A;  3WAA A;  5AV9 D;  1KX4 C;  5GSU B;  1P3M C;  1KX3 A;  1TZY C;  2JSS A;  5AV9 C;  4G91 B;  4J8U D;  4WU8 A;  3MGP A;  3R45 B;  2CV5 D;  3MNN D;  5B1M B;  1BFM A;  4J8U C;  3AZN B;  3W96 D;  3AZI B;  2CV5 C;  4Z66 B;  3KWQ A;  3MNN C;  3AYW D;  1BH8 B;  3WAA B;  5DNM C;  3W96 C;  2PYO B;  5AVB B;  1JFI A;  4KHA A;  5B2J D;  1ID3 B;  3O62 A;  3AN2 C;  2NZD B;  1P3M A;  5B24 B;  3TU4 B;  3V9R A;  1P3K D;  1P3B B;  3VH5 T;  3C1C A;  3AV1 D;  2F8N B;  5BNV B;  5B0Y B;  4J8U A;  1P3K C;  3UT9 D;  3AV1 C;  4EO5 C;  3MNN A;  3KXB A;  1F66 C;  1HTA A;  4KHA B;  5CPK D;  3B0B A;  2F8N H;  2YFW B;  1M1A D;  5B31 B;  3AYW A;  5E5A D;  3UTB A;  5CPK C;  3V9R B;  1B67 A;  4DQY B;  3AZE D;  4WJ3 C;  4Z5T B;  4DRA A;  2ARO B;  4ZBJ B;  4YM6 B;  4YS3 D;  4E44 A;  4Z2M H;  5AVC D;  5E5A C;  2Y2Q A;  5B2I D;  5B2J A;  3MGS D;  3AZE C;  5AV5 B;  4YS3 C;  1P3L D;  5AVC C;  4J8W B;  3B6F D;  2Y2I A;  3MGS C;  3X1T D;  3REH C;  3IP4 C;  1P3L C;  5G49 A;  2IO5 B;  3UTB B;  3WA9 D;  2YFV B;  3B6F C;  3AZJ A;  3AV2 B;  4H9R A;  3UT9 A;  2ZY2 A;  3FDD A;  3WA9 C;  1P3G D;  3AZF B;  5CPK A;  1M1A A;  5CPI B;  2VQR A;  1AOI D;  3W98 B;  1S32 D;  1P3G C;  2NQB B;  4J8X B;  3AZE A;  4YS3 A;  5CPJ A;  1AOI C;  4R8P D;  5B2I A;  5DNN D;  1P3O A;  3AZJ B;  1KX5 A;  3AFA B;  5JRG A;  3MGR D;  3AZL A;  3KUY B;  1P3F D;  4R8P C;  3REL D;  5DNN C;  1WWI A;  2L5A A;  4XZQ B;  4WU9 B;  5B0Z B;  3MGR C;  3X1T A;  5AY8 D;  1P3F C;  5B1L D;  5BT1 D;  4ZUX B;  3B0C W;  5BNX A;  3LZ1 A;  5AY8 C;  5CPJ B;  5B1L C;  3EPK A;  3VH6 A;  5BT1 C;  3AZG D;  1P3G A;  1P3P D;  4KUD B;  5GT0 D;  3AZL B;  3X1V D;  5GT3 B;  1HQ3 A;  3AZM A;  3AZG C;  1S32 A;  1P3P C;  4H9Q A;  5GT0 C;  3X1U B;  5BS7 A;  3X1V C;  3AZH B;  2FJ7 B;  3AZK D;  5B40 A;  3A6N D;  3B0D C;  1W2E A;  5C3I B;  1M19 D;  5BNX B;  3LEL A;  4HGA B;  3A6N C;  3REL A;  1EQZ A;  1A7W A;  1M19 C;  1BH9 B;  5AV6 B;  4WNN B;  3X1S C;  3NQU A;  4LD9 B;  4QLC B;  5GSU C;  3EPJ A;  5B40 B;  5B1M D;  4G91 C;  4M6B A;  4CAY B;  2HIO D;  4X23 B;  3AZI D;  3LZ0 D;  1T3U A;  3B6G D;  5B1M C;  3H0R C;  5CP6 A;  1H3O A;  5F99 B;  3C1B B;  2HIO C;  2PYO D;  5AVB D;  3AZI C;  1M18 D;  4UUZ A;  3LZ0 C;  1R4V A;  1KX4 D;  3B6G C;  3AZK A;  1TZY D;  3UTA D;  1P34 A;  4H9O A;  2PYO C;  5AVB C;  3WTP D;  1M18 C;  3REK B;  2NZD D;  3W99 B;  3MVD D;  2Y2J A;  5B24 D;  3UTA C;  4H9P B;  3WTP C;  1P3B D;  2NZD C;  5BO0 B;  3MVD C;  2F8N D;  5B24 C;  3TU4 C;  5DNM D;  3EPL A;  1P3B C;  4JJN B;  5AV8 B;  3REI D;  2Y2G A;  2Y2O A;  5B32 B;  2F8N G;  1P34 B;  4XUJ D;  3AN2 D;  4AWL B;  3REI C;  3LZ0 A;  5B31 D;  1KU5 A;  1KX3 B;  3B6G A;  4XUJ C;  4WU8 B;  3MGP B;  1M18 A;  4Z5T D;  5B31 C;  1KX4 A;  5B31 G;  1TZY A;  1ZLA D;  3UTA A;  5AV9 A;  3MGQ D;  4Z5T C;  4YM6 C;  3KWQ B;  1F66 D;  1ZLA C;  3MGQ C;  5AV5 C;  1JFI B;  2CV5 A;  5DNM A;  3W96 A;  3AV2 D;  3O62 B;  3REI A;  1P3M B;  2IO5 C;  3AZF D;  2W8S A;  3AV2 C;  4J8V D;  2BG1 A;  3AN2 A;  4KGC D;  3C1C B;  3W98 D;  3AZF C;  2NQB D;  3WTP E;  4J8U B;  4J8V C;  4KGC C;  2CV5 B;  3REH D;  5CPI C;  3MNN B;  3KXB B;  3W98 C;  1ZLA A;  1Q9C A;  2NQB C;  4J8X C;  1P3K A;  5FUG A;  3AV1 A;  3AYW B;  2UWX A;  1F66 A;  1U35 D;  4WU9 D;  5B0Z D;  5JA4 A;  3AFA C;  2XD1 A;  3H0M C;  1U35 C;  4WU9 C;  5B0Z C;  5B2J B;  4E45 A;  5E5A A;  4ZUX C;  4KUD D;  5FUG B;  5GT3 D;  5G49 B;  4H9N A;  4EO5 B;  4KGC A;  5AVC A;  4KUD C;  5JA4 B;  3LJA D;  3MGS A;  4H9R B;  5B33 D;  3UT9 B;  5GT3 C;  3REH A;  1P3L A;  5KDM A;  1ULY A;  3REJ D;  5CPK B;  3B6F A;  3LJA C;  3X1U C;  2XD5 A;  5B33 C;  2FJ7 C;  1M1A B;  2BYK A;  1U35 A;  3REJ C;  5GXQ D;  5C3I C;  2F8N K;  3WA9 A;  4G92 B;  5AV6 D;  3AZE B;  2J8P A;  3AL0 C;  4YS3 B;  4LD9 D;  5B2I B;  5GXQ C;  1P3O B;  1KX5 B;  5AV6 C;  5JRG B;  2JE5 A;  4LD9 C;  1P3L B;  1AOI A;  3W97 D;  1P3A D;  1P3I D;  3X1T B;  2BYK B;  3WKJ D;  4R8P A;  2RIQ A;  5F99 D;  3W97 C;  5DNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...