3MGQA

Binding of nickel ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqA00
1TZYB 3AZJB 4KGCA 1JFIA 3AZKB 1F66A 4Z66D 4KGCB 1JFIB 1F66B 5B1LA 3X1SA 5B2JC 5F99C 5B1LB 3X1SB 5JRGA 3MGPC 3REHB 2BYMA 5JRGB 1M19C 3AZMC 3AZHD 2BYMB 2PYOA 3C1CC 2PYOB 3B6FC 4H9RA 5B2IC 3UT9C 4ZUXA 3X1UD 4H9RB 4ZUXB 5AVBD 2F8NH 4EO5B 3AYWA 3AFAD 3AZLD 3AYWB 1B6WA 3W98A 3AZNC 3W98B 3LELC 5B0ZD 2YFVA 4J8XD 5DNNC 2YFVB 3REKC 5B32G 2NZDD 5BNXA 4R8PB 5BNXB 1P3PA 3WAAA 1KX4C 3A6ND 1P3PB 1KX3D 3WAAB 4NE5A 4CAYA 3UTBC 3AV1D 4CAYB 1P3AC 1P3IC 2HIOD 1EQZA 3RELA 1EQZB 4J8UC 4ZBJB 2CV5C 5B24D 4H9NA 3MNND 1B67A 4HGAB 3AZGA 4H9NB 5AV6C 1TAFA 3AZGB 3WA9C 1TAFB 5GXQC 3MGQA 3MGSC 2AROA 1P3MD 4XZQC 3AZED 1F66C 1P3FA 3X1SC 1HQ3D 5CP6D 3O62C 5CPKD 3AV2A 3AV2B 4LD9D 3KUYA 1TZYD 3AZJD 2F8NG 3AZKD 3W99A 5C3IC 4KGCD 1P3GC 3W99B 4ZUXC 5B1LD 5E5AC 3VH6W 3TU4A 3REHD 1BH8A 1HTAA 5JRGD 4NFTA 1BH8B 3VH5A 1M18D 3LZ0C 2NQBA 2NQBB 1ZLAA 3W98C 2PYOD 4WU9A 3V9RA 1A7WA 5B2JA 4WU9B 3V9RB 3REIA 5B2JB 1H3OA 3MGPA 3REIB 1H3OB 3MGPB 3AZMA 1P3BD 1M19A 5B32C 1M19B 3AZMB 1ID3D 4G92B 1P3PC 4YS3C 5DNMA 4CSRB 5DNMB 5B2IB 2YFWA 3UT9B 2YFWB 4Z5TC 5JA4A 5JA4B 5GT0A 3RELC 4R8PD 5B0YA 3X1VC 3WAAD 4H9PA 3AZNB 3B6GA 3X1TC 3LELA 3WTPA 3LELB 5DNNA 3REKA 3MGQC 5DNNB 3REKB 2AROC 3C1BA 1EQZD 1P3KD 4WU8D 1R4VA 5KDMB 3C1BB 3W96C 4XUJD 3UTBA 1P3FC 3UTBB 1P3AB 4J8WA 3AZGD 4JJND 4DRBA 4KUDD 4J8WB 3KUYC 4NE3A 2CV5A 4QLCD 3VH6T 2CV5B 3W99C 1P34D 2RVQC 3MVDD 3WKJD 3TU4C 5AVCA 5GXQA 5AV9C 3AV2D 3MGSA 5GXQB 5AVCB 4XZQA 3MGSB 4WNNA 1ZLAC 4XZQB 4WNNB 4WU9C 1U35A 3REIC 3O62A 3REJC 4Z2MH 3O62B 1P3OC 4G92C 5B40C 2NQBD 5DNMC 4X23C 1P3GA 4YM6C 5BT1C 5C3IB 1P3GB 5E5AA 5B2JD 5F99D 5E5AB 3MGPD 5GT0C 3LZ0A 4KHAA 1M19D 3AZMD 5B0YC 3LZ0B 4H9SA 4KHAB 5AY8A 3AZFC 3C1CD 5AY8B 3B6GC 2FJ7D 3B6FD 5B2ID 3UT9D 5CHLB 3WTPC 5B32A 3C1BC 5B32B 4YS3A 4YS3B 3VH5W 3AZND 5AV8C 4Z5TA 3LELD 4J8WC 4Z5TB 1WWSA 5DNND 3RELB 3REKD 3X1VA 1KX4D 3X1VB 3X1TA 3AZIC 3X1TB 3UTBD 5B33A 3AN2A 5B33B 1P3ID 1P3AD 5AVCC 3LJAC 2HUEB 4Z2MG 3LZ1A 3MGQB 2AROB 1KX5A 3LZ1B 4J8UD 1N1JA 3W96A 1KX5B 2CV5D 1N1JB 3W96B 1U35C 1P3FB 1M1AA 1M1AB 1S32A 5B1MC 5AV6D 4J8VC 3W97A 5GSUA 1S32B 5AV5D 3W97B 5GXQD 5B31G 3WA9D 5B31A 3MGSD 3KUYB 4XZQD 2F8NA 5BNVA 1F66D 2F8NB 5BNVB 3X1SD 3O62D 5AV9A 3TU4B 5AV9B 3R45A 4H9SC 5AY8C 3R45B 1ZLAB 5CPJC 4H9OA 1KU5A 3REJA 4H9OB 4ZUXD 3REJB 3MGRA 3VH5T 1P3OA 5E5AD 3MGRB 1P3OB 5B40A 5B40B 3AYWD 1BFMA 3W98D 4X23A 4YM6A 4X23B 4YM6B 1F1EA 5CPIC 4E44A 5GT0B 1AOIC 3AZFA 5B0YB 1P3PD 3X1UA 4YS3D 3AZFB 4H9PB 3B6GB 5B33C 3AN2C 3WTPB 1ULYA 2HUEC 4Z5TD 3AZLA 2L5AA 3LZ1C 3RELD 3AZLB 1KX5C 4WV4B 3X1VD 5AV8A 1M1AC 3X1TD 1BH9A 5AV8B 1BH9B 1S32C 3W97C 5GSUC 3A6NA 2BYKA 3UTAC 3MGQD 1KX3A 5B31C 2BYKB 3A6NB 2AROD 1KX3B 3KSYA 3W96D 2HIOA 3AZIA 2LY8A 1P3FD 2HIOB 3KXBC 3AZIB 2CWEA 3LJAA 1P3LC 4DRAA 3LJAB 5B24A 3KUYD 5GT3C 5B24B 3KWQC 3W99D 1U35B 2RVQD 4AWLC 5B1MA 4J8VA 3MGRC 5B1MB 4J8VB 3TU4D 3AZEA 5G49A 4Z66C 3WTPE 5G49B 1ZLAD 1HQ3A 5CP6A 5CP6B 4WU9D 4LD9A 3AZHC 3WA9B 3REID 3REJD 1TZYA 4E45A 1P3OD 3AZKA 5B40D 3X1UC 5CPJA 5DNMD 5CPJB 4X23D 3REHA 4NE6A 5AVBC 4YM6D 5BT1D 1M18A 1Q9CA 1M18B 4H9QA 3AFAC 3AZLC 4H9QB 5GT0D 5B0YD 2IO5B 2FJ7C 3AZFD 5B0ZC 4J8XC 3B6GD 5BS7A 1P3BA 2NZDC 5CPIA 1ID3A 2JSSA 3WTPD 1P3BB 5CPIB 1ID3B 1WWIA 3A6NC 1KX3C 1AOIA 3C1BD 3AV1C 1AOIB 2HIOC 5AV8D 4R8PA 3AN2B 4J8WD 5B24C 3B0DB 3MNNC 3B0BA 4UUZA 3AZID 1P3KA 4UUZB 4WU8A 1P3MC 3AZEC 3UTAA 1P3KB 4G91B 5GSUB 5AVCD 4WU8B 3LJAD 4XUJA 3UTAB 3NQUA 5BO0A 5B31B 4XUJB 3NQUB 5BO0B 4WZSB 1HQ3C 4M6BA 5CP6C 5CPKC 4JJNA 3KXBA 4KUDA 1U35D 4LD9C 4JJNB 3KXBB 5AV5C 4KUDB 1P3LA 1TZYC 5B1MD 4J8VD 4QLCA 3AZJC 1P3LB 3AZKC 4QLCB 4KGCC 5GT3A 1P34A 3KWQA 5GT3B 3MVDA 1P34B 5B1LC 2NQBC 3KWQB 3WKJA 3MVDB 3REHC 2F8NK 1P3GD 3WKJB 5JRGC 3B0CW 1M18C 4AWLB 4Z66A 2PYOC 3LZ0D 2IO5C 4Z66B 5AY8D 5CPJD 3AZHA 5BS7C 1P3BC 1ID3C 3AZHB 4EO5C 3AYWC 5B32D 3X1UB 5F99A 5AVBA 5F99B 5AVBB 4R8PC 3AFAA 5CPID 3AFAB 3C1CA 3B0DC 3WAAC 4CSRA 3C1CB 2FJ7A 1AOID 3B6FA 5B2IA 3UT9A 5B0ZA 2FJ7B 3B6FB 5B0ZB 4J8XA 2NZDA 4J8XB 5B33D 2NZDB 1EQZC 1P3KC 4G91C 3AN2D 4WU8C 4ZBJC 4XUJC 3LZ1D 3AZNA 3AV1A 1KX5D 3NQJA 4HGAC 3AV1B 3NQJB 3AZGC 4JJNC 4KUDC 1M1AD 1S32D 5KDMA 4QLCC 3W97D 5GSUD 1KX4A 3UTAD 3MNNA 1KX4B 3B0CT 5B31D 1P34C 3VH6A 3MNNB 3MVDC 2F8ND 3WKJC 1P3IA 1P3AA 3AV2C 1P3IB 3KXBD 1P3MA 1P3MB 4J8UA 5AV9D 1P3LD 3AZEB 4J8UB 5GT3D 5CPKA 5FUGA 1HQ3B 3KWQD 5AV6A 5CPKB 5FUGB 5AV6B 5AV5A 3WA9A 4LD9B 5AV5B 3AZJA 3MGRD
chains in the Genus database with same CATH superfamily
1TZYB 3AZJB 4KGCA 1JFIA 3AZKB 1F66A 4Z66D 4KGCB 1JFIB 1F66B 5B1LA 3X1SA 5B2JC 5F99C 5B1LB 3X1SB 5JRGA 3MGPC 3REHB 2BYMA 5JRGB 1M19C 3AZMC 3AZHD 2BYMB 2PYOA 3C1CC 2PYOB 2G5HC 3B6FC 4H9RA 5B2IC 3UT9C 3A1IA 4ZUXA 3X1UD 4H9RB 4ZUXB 4WJ3C 5AVBD 2F8NH 4EO5B 3AYWA 2FFFB 3AFAD 3AZLD 3AYWB 1B6WA 3W98A 3AZNC 3W98B 2XD5A 3LELC 5B0ZD 2YFVA 4J8XD 5DNNC 2YFVB 3REKC 5B32G 2NZDD 5BNXA 4R8PB 5BNXB 1P3PA 3WAAA 1KX4C 3A6ND 1P3PB 1KX3D 3WAAB 4NE5A 3IP4C 4CAYA 3UTBC 3AV1D 4CAYB 1P3AC 1P3IC 2HIOD 1EQZA 3RELA 1EQZB 4J8UC 4ZBJB 2CV5C 2Y2HA 5B24D 4H9NA 3MNND 2Y2KA 1B67A 4HGAB 3AZGA 4H9NB 5AV6C 1TAFA 3AZGB 2ZY2A 3WA9C 1TAFB 5GXQC 3MGQA 3MGSC 2AROA 1P3MD 4XZQC 3AZED 1F66C 1P3FA 3X1SC 1HQ3D 5CP6D 3O62C 5CPKD 3AV2A 3AV2B 4LD9D 3KUYA 1TZYD 3AZJD 2F8NG 3AZKD 3W99A 5C3IC 4KGCD 2ZY4A 1P3GC 2ZY5A 3W99B 4ZUXC 5B1LD 5E5AC 3VH6W 3TU4A 3REHD 1BH8A 1HTAA 5JRGD 4NFTA 1BH8B 3VH5A 1M18D 3LZ0C 2NQBA 2NQBB 1ZLAA 3W98C 2PYOD 4WU9A 3V9RA 1A7WA 5B2JA 4WU9B 3V9RB 3REIA 5B2JB 1H3OA 3MGPA 3REIB 1H3OB 3MGPB 3AZMA 1P3BD 1M19A 5B32C 1M19B 3AZMB 1ID3D 4G92B 1P3PC 4YS3C 2DQNC 5DNMA 4CSRB 5DNMB 5B2IB 2YFWA 3UT9B 2YFWB 4Z5TC 5JA4A 3P5JB 5JA4B 5GT0A 3RELC 4R8PD 5B0YA 3X1VC 3WAAD 3FDDA 4H9PA 3AZNB 3X1TC 3B6GA 3LELA 2ZM5A 3WTPA 3LELB 5DNNA 3REKA 3MGQC 5DNNB 3REKB 2AROC 3C1BA 1EQZD 1P3KD 4WU8D 1R4VA 5KDMB 3C1BB 3W96C 4XUJD 3UTBA 1P3FC 3UTBB 1P3AB 4J8WA 3AZGD 3EPHA 4JJND 4DRBA 4KUDD 4J8WB 2VQRA 3KUYC 4NE3A 2CV5A 4QLCD 3VH6T 2CV5B 3W99C 1P34D 2RVQC 2Y2QA 3MVDD 3WKJD 3TU4C 5AVCA 5GXQA 5AV9C 3AV2D 3MGSA 5GXQB 5AVCB 4XZQA 3MGSB 4WNNA 1ZLAC 4XZQB 4WNNB 4WU9C 2Y2OA 3H0LC 1U35A 3REIC 3O62A 3REJC 4Z2MH 4UPKA 3O62B 1P3OC 4G92C 5B40C 2NQBD 5DNMC 4X23C 1P3GA 4YM6C 5BT1C 5C3IB 1P3GB 5E5AA 5B2JD 5F99D 5E5AB 3MGPD 5GT0C 3LZ0A 4KHAA 1M19D 3AZMD 5B0YC 3LZ0B 4H9SA 4KHAB 5AY8A 3AZFC 3C1CD 5AY8B 3B6GC 2FJ7D 3B6FD 5B2ID 3UT9D 5CHLB 3WTPC 2Y2PA 5B32A 3C1BC 5B32B 4YS3A 4YS3B 3VH5W 3AZND 5AV8C 4Z5TA 3LELD 4J8WC 4Z5TB 1WWSA 5DNND 3RELB 3REKD 3X1VA 1KX4D 1Z2CB 3X1VB 3X1TA 2JCHA 3AZIC 3X1TB 3UTBD 5B33A 3AN2A 5B33B 1P3ID 1P3AD 5AVCC 3LJAC 2HUEB 4Z2MG 3LZ1A 3MGQB 2AROB 1KX5A 3LZ1B 4J8UD 1N1JA 3W96A 1KX5B 2CV5D 1N1JB 3W96B 4DQYB 1U35C 1P3FB 1M1AA 1M1AB 1S32A 5B1MC 5AV6D 4J8VC 3W97A 5GSUA 1PZRA 1S32B 5AV5D 3W97B 5GXQD 2BG1A 5B31G 5B31A 3WA9D 3MGSD 3KUYB 4XZQD 2F8NA 5BNVA 1F66D 2F8NB 5BNVB 3X1SD 1T3UA 3O62D 5AV9A 2DF4C 3TU4B 5AV9B 3R45A 4H9SC 5AY8C 3R45B 1ZLAB 2J8PA 5CPJC 4H9OA 1KU5A 3REJA 4H9OB 4ZUXD 3REJB 3MGRA 3VH5T 1P3OA 5E5AD 3MGRB 1P3OB 5B40A 5B40B 3AYWD 1BFMA 3W98D 4X23A 4YM6A 4X23B 4YM6B 1F1EA 5CPIC 4E44A 5GT0B 1W2EA 1AOIC 3AZFA 2Y2JA 5B0YB 1P3PD 3X1UA 4YS3D 3AZFB 4H9PB 3B6GB 5B33C 3AN2C 3WTPB 1ULYA 2HUEC 4Z5TD 3AZLA 2L5AA 3LZ1C 3RELD 3AZLB 2XD1A 1KX5C 4WV4B 3X1VD 5AV8A 1M1AC 3X1TD 1BH9A 5AV8B 3EG5B 1BH9B 1S32C 3W97C 5GSUC 3A6NA 2BYKA 3UTAC 3MGQD 2JE5A 1KX3A 5B31C 2BYKB 3A6NB 2AROD 1KX3B 3KSYA 3W96D 2HIOA 3AZIA 2LY8A 1P3FD 2HIOB 3KXBC 3AZIB 2CWEA 3LJAA 1P3LC 4DRAA 3LJAB 5B24A 3KUYD 5GT3C 5B24B 3KWQC 3AZJA 3W99D 1U35B 3EPJA 2RVQD 4AWLC 5B1MA 4J8VA 3MGRC 5B1MB 4J8VB 3TU4D 3AZEA 3KFUG 5G49A 4Z66C 3WTPE 5G49B 1ZLAD 1HQ3A 5CP6A 5CP6B 4WU9D 2Y2MA 4LD9A 3AZHC 3WA9B 3REID 3REJD 2G5IC 1TZYA 4E45A 3EPKA 1P3OD 3AZKA 5B40D 3X1UC 5CPJA 5DNMD 5CPJB 4X23D 3REHA 4NE6A 5AVBC 4YM6D 5BT1D 1M18A 1Q9CA 1M18B 4H9QA 3AFAC 3AZLC 4H9QB 5GT0D 5B0YD 2IO5B 2FJ7C 3AZFD 5B0ZC 4J8XC 3B6GD 5BS7A 1P3BA 2NZDC 5CPIA 1ID3A 2JSSA 3WTPD 1P3BB 5CPIB 1ID3B 1WWIA 3A6NC 1KX3C 1AOIA 3C1BD 3AV1C 1AOIB 2HIOC 3EPLA 5AV8D 4R8PA 3AN2B 4J8WD 5B24C 3B0DB 3MNNC 3B0BA 4UUZA 3AZID 1P3KA 4UUZB 3F6TA 2ZY3A 4WU8A 1P3MC 3AZEC 3UTAA 1P3KB 4G91B 5GSUB 5AVCD 4WU8B 3LJAD 4XUJA 3UTAB 3NQUA 5BO0A 5B31B 4XUJB 3NQUB 5BO0B 4WZSB 1HQ3C 4M6BA 5CP6C 5CPKC 4JJNA 3KXBA 4KUDA 1U35D 4LD9C 4JJNB 3KXBB 5AV5C 4KUDB 1P3LA 1TZYC 5B1MD 4J8VD 4QLCA 3AZJC 1P3LB 3AZKC 4QLCB 4KGCC 5GT3A 1P34A 3KWQA 5GT3B 3MVDA 1P34B 5B1LC 2NQBC 3KWQB 3WKJA 3MVDB 3REHC 2F8NK 1P3GD 3WKJB 5JRGC 3B0CW 1M18C 4AWLB 4Z66A 2PYOC 3LZ0D 2IO5C 4Z66B 5AY8D 3H0MC 5CPJD 3AZHA 2RIQA 5BS7C 1P3BC 1ID3C 3H0RC 3AZHB 4EO5C 3AYWC 5B32D 3X1UB 5F99A 5AVBA 5F99B 5AVBB 4R8PC 3AFAA 5CPID 3AFAB 3C1CA 3B0DC 3WAAC 4CSRA 3C1CB 2FJ7A 1AOID 3B6FA 5B2IA 3UT9A 5B0ZA 2FJ7B 3B6FB 5B0ZB 4J8XA 2Y2LA 2NZDA 2UWXA 4J8XB 5B33D 2NZDB 1EQZC 1P3KC 4G91C 3AN2D 4WU8C 4ZBJC 4XUJC 3LZ1D 3AZNA 3AV1A 3A1KA 1KX5D 3NQJA 4HGAC 2F2AC 3AV1B 2W8SA 3NQJB 3AZGC 4JJNC 4KUDC 1M1AD 1S32D 5KDMA 2Y2NA 4QLCC 3W97D 5GSUD 1KX4A 3UTAD 3MNNA 1KX4B 3B0CT 5B31D 1P34C 3VH6A 3MNNB 3MVDC 2F8ND 3WKJC 1P3IA 1P3AA 3AV2C 1P3IB 3KXBD 1P3MA 1P3MB 4J8UA 5AV9D 1P3LD 3AZEB 4J8UB 3AL0C 2Y2IA 5GT3D 5CPKA 5FUGA 1HQ3B 3KWQD 5AV6A 5CPKB 5FUGB 5AV6B 5AV5A 3WA9A 4LD9B 5AV5B 2Y2GA 3MGRD
chains in the Genus database with same CATH topology
1TZYB 3AZJB 4KGCA 1JFIA 3AZKB 1F66A 4Z66D 4KGCB 1JFIB 1F66B 5B1LA 3X1SA 5B2JC 5F99C 5B1LB 3X1SB 5JRGA 3MGPC 3REHB 2BYMA 5JRGB 1M19C 3AZMC 3AZHD 2BYMB 2PYOA 3C1CC 2PYOB 2G5HC 3B6FC 4H9RA 5B2IC 3UT9C 3A1IA 4ZUXA 3X1UD 4H9RB 4ZUXB 4WJ3C 5AVBD 2F8NH 4EO5B 3AYWA 2FFFB 3AFAD 3AZLD 3AYWB 1B6WA 3W98A 3AZNC 3W98B 2XD5A 3LELC 5B0ZD 2YFVA 4J8XD 5DNNC 2YFVB 3REKC 5B32G 2NZDD 5BNXA 4R8PB 5BNXB 1P3PA 3WAAA 1KX4C 3A6ND 1P3PB 1KX3D 3WAAB 4NE5A 3IP4C 4CAYA 3UTBC 3AV1D 4CAYB 1P3AC 1P3IC 2HIOD 1EQZA 3RELA 1EQZB 4J8UC 4ZBJB 2CV5C 2Y2HA 5B24D 4H9NA 3MNND 2Y2KA 1B67A 4HGAB 3AZGA 4H9NB 5AV6C 1TAFA 3AZGB 2ZY2A 3WA9C 1TAFB 5GXQC 3MGQA 3MGSC 2AROA 1P3MD 4XZQC 3AZED 1F66C 1P3FA 3X1SC 1HQ3D 5CP6D 3O62C 5CPKD 3AV2A 3AV2B 4LD9D 3KUYA 1TZYD 3AZJD 2F8NG 3AZKD 3W99A 5C3IC 4KGCD 2ZY4A 1P3GC 2ZY5A 3W99B 4ZUXC 5B1LD 5E5AC 3VH6W 3TU4A 3REHD 1BH8A 1HTAA 5JRGD 4NFTA 1BH8B 3VH5A 1M18D 3LZ0C 2NQBA 2NQBB 1ZLAA 3W98C 2PYOD 4WU9A 3V9RA 1A7WA 5B2JA 4WU9B 3V9RB 3REIA 5B2JB 1H3OA 3MGPA 3REIB 1H3OB 3MGPB 3AZMA 1P3BD 1M19A 5B32C 1M19B 3AZMB 1ID3D 4G92B 1P3PC 4YS3C 2DQNC 5DNMA 4CSRB 5DNMB 5B2IB 2YFWA 3UT9B 2YFWB 4Z5TC 5JA4A 3P5JB 5JA4B 5GT0A 3RELC 4R8PD 5B0YA 3X1VC 3WAAD 3FDDA 4H9PA 3AZNB 3X1TC 3B6GA 3LELA 2ZM5A 3WTPA 3LELB 5DNNA 3REKA 3MGQC 5DNNB 3REKB 2AROC 3C1BA 1EQZD 1P3KD 4WU8D 1R4VA 5KDMB 3C1BB 3W96C 4XUJD 3UTBA 1P3FC 3UTBB 1P3AB 4J8WA 3AZGD 3EPHA 4JJND 4DRBA 4KUDD 4J8WB 2VQRA 3KUYC 4NE3A 2CV5A 4QLCD 3VH6T 2CV5B 3W99C 1P34D 2RVQC 2Y2QA 3MVDD 3WKJD 3TU4C 5AVCA 5GXQA 5AV9C 3AV2D 3MGSA 5GXQB 5AVCB 4XZQA 3MGSB 4WNNA 1ZLAC 4XZQB 4WNNB 4WU9C 2Y2OA 3H0LC 1U35A 3REIC 3O62A 3REJC 4Z2MH 4UPKA 3O62B 1P3OC 4G92C 5B40C 2NQBD 5DNMC 4X23C 1P3GA 4YM6C 5BT1C 5C3IB 1P3GB 5E5AA 5B2JD 5F99D 5E5AB 3MGPD 5GT0C 3LZ0A 4KHAA 1M19D 3AZMD 5B0YC 3LZ0B 4H9SA 4KHAB 5AY8A 3AZFC 3C1CD 5AY8B 3B6GC 2FJ7D 3B6FD 5B2ID 3UT9D 5CHLB 3WTPC 2Y2PA 5B32A 3C1BC 5B32B 4YS3A 4YS3B 3VH5W 3AZND 5AV8C 4Z5TA 3LELD 4J8WC 4Z5TB 1WWSA 5DNND 3RELB 3REKD 3X1VA 1KX4D 1Z2CB 3X1VB 3X1TA 2JCHA 3AZIC 3X1TB 3UTBD 5B33A 3AN2A 5B33B 1P3ID 1P3AD 5AVCC 3LJAC 2HUEB 4Z2MG 3LZ1A 3MGQB 2AROB 1KX5A 3LZ1B 4J8UD 1N1JA 3W96A 1KX5B 2CV5D 1N1JB 3W96B 4DQYB 1U35C 1P3FB 1M1AA 1M1AB 1S32A 5B1MC 5AV6D 4J8VC 3W97A 5GSUA 1PZRA 1S32B 5AV5D 3W97B 5GXQD 2BG1A 5B31G 5B31A 3WA9D 3MGSD 3KUYB 4XZQD 2F8NA 5BNVA 1F66D 2F8NB 5BNVB 3X1SD 1T3UA 3O62D 5AV9A 2DF4C 3TU4B 5AV9B 3R45A 4H9SC 5AY8C 3R45B 1ZLAB 2J8PA 5CPJC 4H9OA 1KU5A 3REJA 4H9OB 4ZUXD 3REJB 3MGRA 3VH5T 1P3OA 5E5AD 3MGRB 1P3OB 5B40A 5B40B 3AYWD 1BFMA 3W98D 4X23A 4YM6A 4X23B 4YM6B 1F1EA 5CPIC 4E44A 5GT0B 1W2EA 1AOIC 3AZFA 2Y2JA 5B0YB 1P3PD 3X1UA 4YS3D 3AZFB 4H9PB 3B6GB 5B33C 3AN2C 3WTPB 1ULYA 2HUEC 4Z5TD 3AZLA 2L5AA 3LZ1C 3RELD 3AZLB 2XD1A 1KX5C 4WV4B 3X1VD 5AV8A 1M1AC 3X1TD 1BH9A 5AV8B 3EG5B 1BH9B 1S32C 3W97C 5GSUC 3A6NA 2BYKA 3UTAC 3MGQD 2JE5A 1KX3A 5B31C 2BYKB 3A6NB 2AROD 1KX3B 3KSYA 3W96D 2HIOA 3AZIA 2LY8A 1P3FD 2HIOB 3KXBC 3AZIB 2CWEA 3LJAA 1P3LC 4DRAA 3LJAB 5B24A 3KUYD 5GT3C 5B24B 3KWQC 3AZJA 3W99D 1U35B 3EPJA 2RVQD 4AWLC 5B1MA 4J8VA 3MGRC 5B1MB 4J8VB 3TU4D 3AZEA 3KFUG 5G49A 4Z66C 3WTPE 5G49B 1ZLAD 1HQ3A 5CP6A 5CP6B 4WU9D 2Y2MA 4LD9A 3AZHC 3WA9B 3REID 3REJD 2G5IC 1TZYA 4E45A 3EPKA 1P3OD 3AZKA 5B40D 3X1UC 5CPJA 5DNMD 5CPJB 4X23D 3REHA 4NE6A 5AVBC 4YM6D 5BT1D 1M18A 1Q9CA 1M18B 4H9QA 3AFAC 3AZLC 4H9QB 5GT0D 5B0YD 2IO5B 2FJ7C 3AZFD 5B0ZC 4J8XC 3B6GD 5BS7A 1P3BA 2NZDC 5CPIA 1ID3A 2JSSA 3WTPD 1P3BB 5CPIB 1ID3B 1WWIA 3A6NC 1KX3C 1AOIA 3C1BD 3AV1C 1AOIB 2HIOC 3EPLA 5AV8D 4R8PA 3AN2B 4J8WD 5B24C 3B0DB 3MNNC 3B0BA 4UUZA 3AZID 1P3KA 4UUZB 3F6TA 2ZY3A 4WU8A 1P3MC 3AZEC 3UTAA 1P3KB 4G91B 5GSUB 5AVCD 4WU8B 3LJAD 4XUJA 3UTAB 3NQUA 5BO0A 5B31B 4XUJB 3NQUB 5BO0B 4WZSB 1HQ3C 4M6BA 5CP6C 5CPKC 4JJNA 3KXBA 4KUDA 1U35D 4LD9C 4JJNB 3KXBB 5AV5C 4KUDB 1P3LA 1TZYC 5B1MD 4J8VD 4QLCA 3AZJC 1P3LB 3AZKC 4QLCB 4KGCC 5GT3A 1P34A 3KWQA 5GT3B 3MVDA 1P34B 5B1LC 2NQBC 3KWQB 3WKJA 3MVDB 3REHC 2F8NK 1P3GD 3WKJB 5JRGC 3B0CW 1M18C 4AWLB 4Z66A 2PYOC 3LZ0D 2IO5C 4Z66B 5AY8D 3H0MC 5CPJD 3AZHA 2RIQA 5BS7C 1P3BC 1ID3C 3H0RC 3AZHB 4EO5C 3AYWC 5B32D 3X1UB 5F99A 5AVBA 5F99B 5AVBB 4R8PC 3AFAA 5CPID 3AFAB 3C1CA 3B0DC 3WAAC 4CSRA 3C1CB 2FJ7A 1AOID 3B6FA 5B2IA 3UT9A 5B0ZA 2FJ7B 3B6FB 5B0ZB 4J8XA 2Y2LA 2NZDA 2UWXA 4J8XB 5B33D 2NZDB 1EQZC 1P3KC 4G91C 3AN2D 4WU8C 4ZBJC 4XUJC 3LZ1D 3AZNA 3AV1A 3A1KA 1KX5D 3NQJA 4HGAC 2F2AC 3AV1B 2W8SA 3NQJB 3AZGC 4JJNC 4KUDC 1M1AD 1S32D 5KDMA 2Y2NA 4QLCC 3W97D 5GSUD 1KX4A 3UTAD 3MNNA 1KX4B 3B0CT 5B31D 1P34C 3VH6A 3MNNB 3MVDC 2F8ND 3WKJC 1P3IA 1P3AA 3AV2C 1P3IB 3KXBD 1P3MA 1P3MB 4J8UA 5AV9D 1P3LD 3AZEB 4J8UB 3AL0C 2Y2IA 5GT3D 5CPKA 5FUGA 1HQ3B 3KWQD 5AV6A 5CPKB 5FUGB 5AV6B 5AV5A 3WA9A 4LD9B 5AV5B 2Y2GA 3MGRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY B;  3AZJ B;  4KGC A;  1JFI A;  3AZK B;  1F66 A;  4Z66 D;  4KGC B;  1JFI B;  1F66 B;  5B1L A;  3X1S A;  5B2J C;  5F99 C;  5B1L B;  3X1S B;  5JRG A;  3MGP C;  3REH B;  2BYM A;  5JRG B;  1M19 C;  3AZM C;  3AZH D;  2BYM B;  2PYO A;  3C1C C;  2PYO B;  3B6F C;  4H9R A;  5B2I C;  3UT9 C;  4ZUX A;  3X1U D;  4H9R B;  4ZUX B;  5AVB D;  2F8N H;  4EO5 B;  3AYW A;  3AFA D;  3AZL D;  3AYW B;  1B6W A;  3W98 A;  3AZN C;  3W98 B;  3LEL C;  5B0Z D;  2YFV A;  4J8X D;  5DNN C;  2YFV B;  3REK C;  5B32 G;  2NZD D;  5BNX A;  4R8P B;  5BNX B;  1P3P A;  3WAA A;  1KX4 C;  3A6N D;  1P3P B;  1KX3 D;  3WAA B;  4NE5 A;  4CAY A;  3UTB C;  3AV1 D;  4CAY B;  1P3A C;  1P3I C;  2HIO D;  1EQZ A;  3REL A;  1EQZ B;  4J8U C;  4ZBJ B;  2CV5 C;  5B24 D;  4H9N A;  3MNN D;  1B67 A;  4HGA B;  3AZG A;  4H9N B;  5AV6 C;  1TAF A;  3AZG B;  3WA9 C;  1TAF B;  5GXQ C;  3MGQ A;  3MGS C;  2ARO A;  1P3M D;  4XZQ C;  3AZE D;  1F66 C;  1P3F A;  3X1S C;  1HQ3 D;  5CP6 D;  3O62 C;  5CPK D;  3AV2 A;  3AV2 B;  4LD9 D;  3KUY A;  1TZY D;  3AZJ D;  2F8N G;  3AZK D;  3W99 A;  5C3I C;  4KGC D;  1P3G C;  3W99 B;  4ZUX C;  5B1L D;  5E5A C;  3VH6 W;  3TU4 A;  3REH D;  1BH8 A;  1HTA A;  5JRG D;  4NFT A;  1BH8 B;  3VH5 A;  1M18 D;  3LZ0 C;  2NQB A;  2NQB B;  1ZLA A;  3W98 C;  2PYO D;  4WU9 A;  3V9R A;  1A7W A;  5B2J A;  4WU9 B;  3V9R B;  3REI A;  5B2J B;  1H3O A;  3MGP A;  3REI B;  1H3O B;  3MGP B;  3AZM A;  1P3B D;  1M19 A;  5B32 C;  1M19 B;  3AZM B;  1ID3 D;  4G92 B;  1P3P C;  4YS3 C;  5DNM A;  4CSR B;  5DNM B;  5B2I B;  2YFW A;  3UT9 B;  2YFW B;  4Z5T C;  5JA4 A;  5JA4 B;  5GT0 A;  3REL C;  4R8P D;  5B0Y A;  3X1V C;  3WAA D;  4H9P A;  3AZN B;  3B6G A;  3X1T C;  3LEL A;  3WTP A;  3LEL B;  5DNN A;  3REK A;  3MGQ C;  5DNN B;  3REK B;  2ARO C;  3C1B A;  1EQZ D;  1P3K D;  4WU8 D;  1R4V A;  5KDM B;  3C1B B;  3W96 C;  4XUJ D;  3UTB A;  1P3F C;  3UTB B;  1P3A B;  4J8W A;  3AZG D;  4JJN D;  4DRB A;  4KUD D;  4J8W B;  3KUY C;  4NE3 A;  2CV5 A;  4QLC D;  3VH6 T;  2CV5 B;  3W99 C;  1P34 D;  2RVQ C;  3MVD D;  3WKJ D;  3TU4 C;  5AVC A;  5GXQ A;  5AV9 C;  3AV2 D;  3MGS A;  5GXQ B;  5AVC B;  4XZQ A;  3MGS B;  4WNN A;  1ZLA C;  4XZQ B;  4WNN B;  4WU9 C;  1U35 A;  3REI C;  3O62 A;  3REJ C;  4Z2M H;  3O62 B;  1P3O C;  4G92 C;  5B40 C;  2NQB D;  5DNM C;  4X23 C;  1P3G A;  4YM6 C;  5BT1 C;  5C3I B;  1P3G B;  5E5A A;  5B2J D;  5F99 D;  5E5A B;  3MGP D;  5GT0 C;  3LZ0 A;  4KHA A;  1M19 D;  3AZM D;  5B0Y C;  3LZ0 B;  4H9S A;  4KHA B;  5AY8 A;  3AZF C;  3C1C D;  5AY8 B;  3B6G C;  2FJ7 D;  3B6F D;  5B2I D;  3UT9 D;  5CHL B;  3WTP C;  5B32 A;  3C1B C;  5B32 B;  4YS3 A;  4YS3 B;  3VH5 W;  3AZN D;  5AV8 C;  4Z5T A;  3LEL D;  4J8W C;  4Z5T B;  1WWS A;  5DNN D;  3REL B;  3REK D;  3X1V A;  1KX4 D;  3X1V B;  3X1T A;  3AZI C;  3X1T B;  3UTB D;  5B33 A;  3AN2 A;  5B33 B;  1P3I D;  1P3A D;  5AVC C;  3LJA C;  2HUE B;  4Z2M G;  3LZ1 A;  3MGQ B;  2ARO B;  1KX5 A;  3LZ1 B;  4J8U D;  1N1J A;  3W96 A;  1KX5 B;  2CV5 D;  1N1J B;  3W96 B;  1U35 C;  1P3F B;  1M1A A;  1M1A B;  1S32 A;  5B1M C;  5AV6 D;  4J8V C;  3W97 A;  5GSU A;  1S32 B;  5AV5 D;  3W97 B;  5GXQ D;  5B31 G;  3WA9 D;  5B31 A;  3MGS D;  3KUY B;  4XZQ D;  2F8N A;  5BNV A;  1F66 D;  2F8N B;  5BNV B;  3X1S D;  3O62 D;  5AV9 A;  3TU4 B;  5AV9 B;  3R45 A;  4H9S C;  5AY8 C;  3R45 B;  1ZLA B;  5CPJ C;  4H9O A;  1KU5 A;  3REJ A;  4H9O B;  4ZUX D;  3REJ B;  3MGR A;  3VH5 T;  1P3O A;  5E5A D;  3MGR B;  1P3O B;  5B40 A;  5B40 B;  3AYW D;  1BFM A;  3W98 D;  4X23 A;  4YM6 A;  4X23 B;  4YM6 B;  1F1E A;  5CPI C;  4E44 A;  5GT0 B;  1AOI C;  3AZF A;  5B0Y B;  1P3P D;  3X1U A;  4YS3 D;  3AZF B;  4H9P B;  3B6G B;  5B33 C;  3AN2 C;  3WTP B;  1ULY A;  2HUE C;  4Z5T D;  3AZL A;  2L5A A;  3LZ1 C;  3REL D;  3AZL B;  1KX5 C;  4WV4 B;  3X1V D;  5AV8 A;  1M1A C;  3X1T D;  1BH9 A;  5AV8 B;  1BH9 B;  1S32 C;  3W97 C;  5GSU C;  3A6N A;  2BYK A;  3UTA C;  3MGQ D;  1KX3 A;  5B31 C;  2BYK B;  3A6N B;  2ARO D;  1KX3 B;  3KSY A;  3W96 D;  2HIO A;  3AZI A;  2LY8 A;  1P3F D;  2HIO B;  3KXB C;  3AZI B;  2CWE A;  3LJA A;  1P3L C;  4DRA A;  3LJA B;  5B24 A;  3KUY D;  5GT3 C;  5B24 B;  3KWQ C;  3W99 D;  1U35 B;  2RVQ D;  4AWL C;  5B1M A;  4J8V A;  3MGR C;  5B1M B;  4J8V B;  3TU4 D;  3AZE A;  5G49 A;  4Z66 C;  3WTP E;  5G49 B;  1ZLA D;  1HQ3 A;  5CP6 A;  5CP6 B;  4WU9 D;  4LD9 A;  3AZH C;  3WA9 B;  3REI D;  3REJ D;  1TZY A;  4E45 A;  1P3O D;  3AZK A;  5B40 D;  3X1U C;  5CPJ A;  5DNM D;  5CPJ B;  4X23 D;  3REH A;  4NE6 A;  5AVB C;  4YM6 D;  5BT1 D;  1M18 A;  1Q9C A;  1M18 B;  4H9Q A;  3AFA C;  3AZL C;  4H9Q B;  5GT0 D;  5B0Y D;  2IO5 B;  2FJ7 C;  3AZF D;  5B0Z C;  4J8X C;  3B6G D;  5BS7 A;  1P3B A;  2NZD C;  5CPI A;  1ID3 A;  2JSS A;  3WTP D;  1P3B B;  5CPI B;  1ID3 B;  1WWI A;  3A6N C;  1KX3 C;  1AOI A;  3C1B D;  3AV1 C;  1AOI B;  2HIO C;  5AV8 D;  4R8P A;  3AN2 B;  4J8W D;  5B24 C;  3B0D B;  3MNN C;  3B0B A;  4UUZ A;  3AZI D;  1P3K A;  4UUZ B;  4WU8 A;  1P3M C;  3AZE C;  3UTA A;  1P3K B;  4G91 B;  5GSU B;  5AVC D;  4WU8 B;  3LJA D;  4XUJ A;  3UTA B;  3NQU A;  5BO0 A;  5B31 B;  4XUJ B;  3NQU B;  5BO0 B;  4WZS B;  1HQ3 C;  4M6B A;  5CP6 C;  5CPK C;  4JJN A;  3KXB A;  4KUD A;  1U35 D;  4LD9 C;  4JJN B;  3KXB B;  5AV5 C;  4KUD B;  1P3L A;  1TZY C;  5B1M D;  4J8V D;  4QLC A;  3AZJ C;  1P3L B;  3AZK C;  4QLC B;  4KGC C;  5GT3 A;  1P34 A;  3KWQ A;  5GT3 B;  3MVD A;  1P34 B;  5B1L C;  2NQB C;  3KWQ B;  3WKJ A;  3MVD B;  3REH C;  2F8N K;  1P3G D;  3WKJ B;  5JRG C;  3B0C W;  1M18 C;  4AWL B;  4Z66 A;  2PYO C;  3LZ0 D;  2IO5 C;  4Z66 B;  5AY8 D;  5CPJ D;  3AZH A;  5BS7 C;  1P3B C;  1ID3 C;  3AZH B;  4EO5 C;  3AYW C;  5B32 D;  3X1U B;  5F99 A;  5AVB A;  5F99 B;  5AVB B;  4R8P C;  3AFA A;  5CPI D;  3AFA B;  3C1C A;  3B0D C;  3WAA C;  4CSR A;  3C1C B;  2FJ7 A;  1AOI D;  3B6F A;  5B2I A;  3UT9 A;  5B0Z A;  2FJ7 B;  3B6F B;  5B0Z B;  4J8X A;  2NZD A;  4J8X B;  5B33 D;  2NZD B;  1EQZ C;  1P3K C;  4G91 C;  3AN2 D;  4WU8 C;  4ZBJ C;  4XUJ C;  3LZ1 D;  3AZN A;  3AV1 A;  1KX5 D;  3NQJ A;  4HGA C;  3AV1 B;  3NQJ B;  3AZG C;  4JJN C;  4KUD C;  1M1A D;  1S32 D;  5KDM A;  4QLC C;  3W97 D;  5GSU D;  1KX4 A;  3UTA D;  3MNN A;  1KX4 B;  3B0C T;  5B31 D;  1P34 C;  3VH6 A;  3MNN B;  3MVD C;  2F8N D;  3WKJ C;  1P3I A;  1P3A A;  3AV2 C;  1P3I B;  3KXB D;  1P3M A;  1P3M B;  4J8U A;  5AV9 D;  1P3L D;  3AZE B;  4J8U B;  5GT3 D;  5CPK A;  5FUG A;  1HQ3 B;  3KWQ D;  5AV6 A;  5CPK B;  5FUG B;  5AV6 B;  5AV5 A;  3WA9 A;  4LD9 B;  5AV5 B;  3AZJ A;  3MGR D; 
#chains in the Genus database with same CATH topology
 1TZY B;  3AZJ B;  4KGC A;  1JFI A;  3AZK B;  1F66 A;  4Z66 D;  4KGC B;  1JFI B;  1F66 B;  5B1L A;  3X1S A;  5B2J C;  5F99 C;  5B1L B;  3X1S B;  5JRG A;  3MGP C;  3REH B;  2BYM A;  5JRG B;  1M19 C;  3AZM C;  3AZH D;  2BYM B;  2PYO A;  3C1C C;  2PYO B;  2G5H C;  3B6F C;  4H9R A;  5B2I C;  3UT9 C;  3A1I A;  4ZUX A;  3X1U D;  4H9R B;  4ZUX B;  4WJ3 C;  5AVB D;  2F8N H;  4EO5 B;  3AYW A;  2FFF B;  3AFA D;  3AZL D;  3AYW B;  1B6W A;  3W98 A;  3AZN C;  3W98 B;  2XD5 A;  3LEL C;  5B0Z D;  2YFV A;  4J8X D;  5DNN C;  2YFV B;  3REK C;  5B32 G;  2NZD D;  5BNX A;  4R8P B;  5BNX B;  1P3P A;  3WAA A;  1KX4 C;  3A6N D;  1P3P B;  1KX3 D;  3WAA B;  4NE5 A;  3IP4 C;  4CAY A;  3UTB C;  3AV1 D;  4CAY B;  1P3A C;  1P3I C;  2HIO D;  1EQZ A;  3REL A;  1EQZ B;  4J8U C;  4ZBJ B;  2CV5 C;  2Y2H A;  5B24 D;  4H9N A;  3MNN D;  2Y2K A;  1B67 A;  4HGA B;  3AZG A;  4H9N B;  5AV6 C;  1TAF A;  3AZG B;  2ZY2 A;  3WA9 C;  1TAF B;  5GXQ C;  3MGQ A;  3MGS C;  2ARO A;  1P3M D;  4XZQ C;  3AZE D;  1F66 C;  1P3F A;  3X1S C;  1HQ3 D;  5CP6 D;  3O62 C;  5CPK D;  3AV2 A;  3AV2 B;  4LD9 D;  3KUY A;  1TZY D;  3AZJ D;  2F8N G;  3AZK D;  3W99 A;  5C3I C;  4KGC D;  2ZY4 A;  1P3G C;  2ZY5 A;  3W99 B;  4ZUX C;  5B1L D;  5E5A C;  3VH6 W;  3TU4 A;  3REH D;  1BH8 A;  1HTA A;  5JRG D;  4NFT A;  1BH8 B;  3VH5 A;  1M18 D;  3LZ0 C;  2NQB A;  2NQB B;  1ZLA A;  3W98 C;  2PYO D;  4WU9 A;  3V9R A;  1A7W A;  5B2J A;  4WU9 B;  3V9R B;  3REI A;  5B2J B;  1H3O A;  3MGP A;  3REI B;  1H3O B;  3MGP B;  3AZM A;  1P3B D;  1M19 A;  5B32 C;  1M19 B;  3AZM B;  1ID3 D;  4G92 B;  1P3P C;  4YS3 C;  2DQN C;  5DNM A;  4CSR B;  5DNM B;  5B2I B;  2YFW A;  3UT9 B;  2YFW B;  4Z5T C;  5JA4 A;  3P5J B;  5JA4 B;  5GT0 A;  3REL C;  4R8P D;  5B0Y A;  3X1V C;  3WAA D;  3FDD A;  4H9P A;  3AZN B;  3X1T C;  3B6G A;  3LEL A;  2ZM5 A;  3WTP A;  3LEL B;  5DNN A;  3REK A;  3MGQ C;  5DNN B;  3REK B;  2ARO C;  3C1B A;  1EQZ D;  1P3K D;  4WU8 D;  1R4V A;  5KDM B;  3C1B B;  3W96 C;  4XUJ D;  3UTB A;  1P3F C;  3UTB B;  1P3A B;  4J8W A;  3AZG D;  3EPH A;  4JJN D;  4DRB A;  4KUD D;  4J8W B;  2VQR A;  3KUY C;  4NE3 A;  2CV5 A;  4QLC D;  3VH6 T;  2CV5 B;  3W99 C;  1P34 D;  2RVQ C;  2Y2Q A;  3MVD D;  3WKJ D;  3TU4 C;  5AVC A;  5GXQ A;  5AV9 C;  3AV2 D;  3MGS A;  5GXQ B;  5AVC B;  4XZQ A;  3MGS B;  4WNN A;  1ZLA C;  4XZQ B;  4WNN B;  4WU9 C;  2Y2O A;  3H0L C;  1U35 A;  3REI C;  3O62 A;  3REJ C;  4Z2M H;  4UPK A;  3O62 B;  1P3O C;  4G92 C;  5B40 C;  2NQB D;  5DNM C;  4X23 C;  1P3G A;  4YM6 C;  5BT1 C;  5C3I B;  1P3G B;  5E5A A;  5B2J D;  5F99 D;  5E5A B;  3MGP D;  5GT0 C;  3LZ0 A;  4KHA A;  1M19 D;  3AZM D;  5B0Y C;  3LZ0 B;  4H9S A;  4KHA B;  5AY8 A;  3AZF C;  3C1C D;  5AY8 B;  3B6G C;  2FJ7 D;  3B6F D;  5B2I D;  3UT9 D;  5CHL B;  3WTP C;  2Y2P A;  5B32 A;  3C1B C;  5B32 B;  4YS3 A;  4YS3 B;  3VH5 W;  3AZN D;  5AV8 C;  4Z5T A;  3LEL D;  4J8W C;  4Z5T B;  1WWS A;  5DNN D;  3REL B;  3REK D;  3X1V A;  1KX4 D;  1Z2C B;  3X1V B;  3X1T A;  2JCH A;  3AZI C;  3X1T B;  3UTB D;  5B33 A;  3AN2 A;  5B33 B;  1P3I D;  1P3A D;  5AVC C;  3LJA C;  2HUE B;  4Z2M G;  3LZ1 A;  3MGQ B;  2ARO B;  1KX5 A;  3LZ1 B;  4J8U D;  1N1J A;  3W96 A;  1KX5 B;  2CV5 D;  1N1J B;  3W96 B;  4DQY B;  1U35 C;  1P3F B;  1M1A A;  1M1A B;  1S32 A;  5B1M C;  5AV6 D;  4J8V C;  3W97 A;  5GSU A;  1PZR A;  1S32 B;  5AV5 D;  3W97 B;  5GXQ D;  2BG1 A;  5B31 G;  5B31 A;  3WA9 D;  3MGS D;  3KUY B;  4XZQ D;  2F8N A;  5BNV A;  1F66 D;  2F8N B;  5BNV B;  3X1S D;  1T3U A;  3O62 D;  5AV9 A;  2DF4 C;  3TU4 B;  5AV9 B;  3R45 A;  4H9S C;  5AY8 C;  3R45 B;  1ZLA B;  2J8P A;  5CPJ C;  4H9O A;  1KU5 A;  3REJ A;  4H9O B;  4ZUX D;  3REJ B;  3MGR A;  3VH5 T;  1P3O A;  5E5A D;  3MGR B;  1P3O B;  5B40 A;  5B40 B;  3AYW D;  1BFM A;  3W98 D;  4X23 A;  4YM6 A;  4X23 B;  4YM6 B;  1F1E A;  5CPI C;  4E44 A;  5GT0 B;  1W2E A;  1AOI C;  3AZF A;  2Y2J A;  5B0Y B;  1P3P D;  3X1U A;  4YS3 D;  3AZF B;  4H9P B;  3B6G B;  5B33 C;  3AN2 C;  3WTP B;  1ULY A;  2HUE C;  4Z5T D;  3AZL A;  2L5A A;  3LZ1 C;  3REL D;  3AZL B;  2XD1 A;  1KX5 C;  4WV4 B;  3X1V D;  5AV8 A;  1M1A C;  3X1T D;  1BH9 A;  5AV8 B;  3EG5 B;  1BH9 B;  1S32 C;  3W97 C;  5GSU C;  3A6N A;  2BYK A;  3UTA C;  3MGQ D;  2JE5 A;  1KX3 A;  5B31 C;  2BYK B;  3A6N B;  2ARO D;  1KX3 B;  3KSY A;  3W96 D;  2HIO A;  3AZI A;  2LY8 A;  1P3F D;  2HIO B;  3KXB C;  3AZI B;  2CWE A;  3LJA A;  1P3L C;  4DRA A;  3LJA B;  5B24 A;  3KUY D;  5GT3 C;  5B24 B;  3KWQ C;  3AZJ A;  3W99 D;  1U35 B;  3EPJ A;  2RVQ D;  4AWL C;  5B1M A;  4J8V A;  3MGR C;  5B1M B;  4J8V B;  3TU4 D;  3AZE A;  3KFU G;  5G49 A;  4Z66 C;  3WTP E;  5G49 B;  1ZLA D;  1HQ3 A;  5CP6 A;  5CP6 B;  4WU9 D;  2Y2M A;  4LD9 A;  3AZH C;  3WA9 B;  3REI D;  3REJ D;  2G5I C;  1TZY A;  4E45 A;  3EPK A;  1P3O D;  3AZK A;  5B40 D;  3X1U C;  5CPJ A;  5DNM D;  5CPJ B;  4X23 D;  3REH A;  4NE6 A;  5AVB C;  4YM6 D;  5BT1 D;  1M18 A;  1Q9C A;  1M18 B;  4H9Q A;  3AFA C;  3AZL C;  4H9Q B;  5GT0 D;  5B0Y D;  2IO5 B;  2FJ7 C;  3AZF D;  5B0Z C;  4J8X C;  3B6G D;  5BS7 A;  1P3B A;  2NZD C;  5CPI A;  1ID3 A;  2JSS A;  3WTP D;  1P3B B;  5CPI B;  1ID3 B;  1WWI A;  3A6N C;  1KX3 C;  1AOI A;  3C1B D;  3AV1 C;  1AOI B;  2HIO C;  3EPL A;  5AV8 D;  4R8P A;  3AN2 B;  4J8W D;  5B24 C;  3B0D B;  3MNN C;  3B0B A;  4UUZ A;  3AZI D;  1P3K A;  4UUZ B;  3F6T A;  2ZY3 A;  4WU8 A;  1P3M C;  3AZE C;  3UTA A;  1P3K B;  4G91 B;  5GSU B;  5AVC D;  4WU8 B;  3LJA D;  4XUJ A;  3UTA B;  3NQU A;  5BO0 A;  5B31 B;  4XUJ B;  3NQU B;  5BO0 B;  4WZS B;  1HQ3 C;  4M6B A;  5CP6 C;  5CPK C;  4JJN A;  3KXB A;  4KUD A;  1U35 D;  4LD9 C;  4JJN B;  3KXB B;  5AV5 C;  4KUD B;  1P3L A;  1TZY C;  5B1M D;  4J8V D;  4QLC A;  3AZJ C;  1P3L B;  3AZK C;  4QLC B;  4KGC C;  5GT3 A;  1P34 A;  3KWQ A;  5GT3 B;  3MVD A;  1P34 B;  5B1L C;  2NQB C;  3KWQ B;  3WKJ A;  3MVD B;  3REH C;  2F8N K;  1P3G D;  3WKJ B;  5JRG C;  3B0C W;  1M18 C;  4AWL B;  4Z66 A;  2PYO C;  3LZ0 D;  2IO5 C;  4Z66 B;  5AY8 D;  3H0M C;  5CPJ D;  3AZH A;  2RIQ A;  5BS7 C;  1P3B C;  1ID3 C;  3H0R C;  3AZH B;  4EO5 C;  3AYW C;  5B32 D;  3X1U B;  5F99 A;  5AVB A;  5F99 B;  5AVB B;  4R8P C;  3AFA A;  5CPI D;  3AFA B;  3C1C A;  3B0D C;  3WAA C;  4CSR A;  3C1C B;  2FJ7 A;  1AOI D;  3B6F A;  5B2I A;  3UT9 A;  5B0Z A;  2FJ7 B;  3B6F B;  5B0Z B;  4J8X A;  2Y2L A;  2NZD A;  2UWX A;  4J8X B;  5B33 D;  2NZD B;  1EQZ C;  1P3K C;  4G91 C;  3AN2 D;  4WU8 C;  4ZBJ C;  4XUJ C;  3LZ1 D;  3AZN A;  3AV1 A;  3A1K A;  1KX5 D;  3NQJ A;  4HGA C;  2F2A C;  3AV1 B;  2W8S A;  3NQJ B;  3AZG C;  4JJN C;  4KUD C;  1M1A D;  1S32 D;  5KDM A;  2Y2N A;  4QLC C;  3W97 D;  5GSU D;  1KX4 A;  3UTA D;  3MNN A;  1KX4 B;  3B0C T;  5B31 D;  1P34 C;  3VH6 A;  3MNN B;  3MVD C;  2F8N D;  3WKJ C;  1P3I A;  1P3A A;  3AV2 C;  1P3I B;  3KXB D;  1P3M A;  1P3M B;  4J8U A;  5AV9 D;  1P3L D;  3AZE B;  4J8U B;  3AL0 C;  2Y2I A;  5GT3 D;  5CPK A;  5FUG A;  1HQ3 B;  3KWQ D;  5AV6 A;  5CPK B;  5FUG B;  5AV6 B;  5AV5 A;  3WA9 A;  4LD9 B;  5AV5 B;  2Y2G A;  3MGR D; 
#chains in the Genus database with same CATH homology
 1TZY B;  3AZJ B;  4KGC A;  1JFI A;  3AZK B;  1F66 A;  4Z66 D;  4KGC B;  1JFI B;  1F66 B;  5B1L A;  3X1S A;  5B2J C;  5F99 C;  5B1L B;  3X1S B;  5JRG A;  3MGP C;  3REH B;  2BYM A;  5JRG B;  1M19 C;  3AZM C;  3AZH D;  2BYM B;  2PYO A;  3C1C C;  2PYO B;  2G5H C;  3B6F C;  4H9R A;  5B2I C;  3UT9 C;  3A1I A;  4ZUX A;  3X1U D;  4H9R B;  4ZUX B;  4WJ3 C;  5AVB D;  2F8N H;  4EO5 B;  3AYW A;  2FFF B;  3AFA D;  3AZL D;  3AYW B;  1B6W A;  3W98 A;  3AZN C;  3W98 B;  2XD5 A;  3LEL C;  5B0Z D;  2YFV A;  4J8X D;  5DNN C;  2YFV B;  3REK C;  5B32 G;  2NZD D;  5BNX A;  4R8P B;  5BNX B;  1P3P A;  3WAA A;  1KX4 C;  3A6N D;  1P3P B;  1KX3 D;  3WAA B;  4NE5 A;  3IP4 C;  4CAY A;  3UTB C;  3AV1 D;  4CAY B;  1P3A C;  1P3I C;  2HIO D;  1EQZ A;  3REL A;  1EQZ B;  4J8U C;  4ZBJ B;  2CV5 C;  2Y2H A;  5B24 D;  4H9N A;  3MNN D;  2Y2K A;  1B67 A;  4HGA B;  3AZG A;  4H9N B;  5AV6 C;  1TAF A;  3AZG B;  2ZY2 A;  3WA9 C;  1TAF B;  5GXQ C;  3MGQ A;  3MGS C;  2ARO A;  1P3M D;  4XZQ C;  3AZE D;  1F66 C;  1P3F A;  3X1S C;  1HQ3 D;  5CP6 D;  3O62 C;  5CPK D;  3AV2 A;  3AV2 B;  4LD9 D;  3KUY A;  1TZY D;  3AZJ D;  2F8N G;  3AZK D;  3W99 A;  5C3I C;  4KGC D;  2ZY4 A;  1P3G C;  2ZY5 A;  3W99 B;  4ZUX C;  5B1L D;  5E5A C;  3VH6 W;  3TU4 A;  3REH D;  1BH8 A;  1HTA A;  5JRG D;  4NFT A;  1BH8 B;  3VH5 A;  1M18 D;  3LZ0 C;  2NQB A;  2NQB B;  1ZLA A;  3W98 C;  2PYO D;  4WU9 A;  3V9R A;  1A7W A;  5B2J A;  4WU9 B;  3V9R B;  3REI A;  5B2J B;  1H3O A;  3MGP A;  3REI B;  1H3O B;  3MGP B;  3AZM A;  1P3B D;  1M19 A;  5B32 C;  1M19 B;  3AZM B;  1ID3 D;  4G92 B;  1P3P C;  4YS3 C;  2DQN C;  5DNM A;  4CSR B;  5DNM B;  5B2I B;  2YFW A;  3UT9 B;  2YFW B;  4Z5T C;  5JA4 A;  3P5J B;  5JA4 B;  5GT0 A;  3REL C;  4R8P D;  5B0Y A;  3X1V C;  3WAA D;  3FDD A;  4H9P A;  3AZN B;  3X1T C;  3B6G A;  3LEL A;  2ZM5 A;  3WTP A;  3LEL B;  5DNN A;  3REK A;  3MGQ C;  5DNN B;  3REK B;  2ARO C;  3C1B A;  1EQZ D;  1P3K D;  4WU8 D;  1R4V A;  5KDM B;  3C1B B;  3W96 C;  4XUJ D;  3UTB A;  1P3F C;  3UTB B;  1P3A B;  4J8W A;  3AZG D;  3EPH A;  4JJN D;  4DRB A;  4KUD D;  4J8W B;  2VQR A;  3KUY C;  4NE3 A;  2CV5 A;  4QLC D;  3VH6 T;  2CV5 B;  3W99 C;  1P34 D;  2RVQ C;  2Y2Q A;  3MVD D;  3WKJ D;  3TU4 C;  5AVC A;  5GXQ A;  5AV9 C;  3AV2 D;  3MGS A;  5GXQ B;  5AVC B;  4XZQ A;  3MGS B;  4WNN A;  1ZLA C;  4XZQ B;  4WNN B;  4WU9 C;  2Y2O A;  3H0L C;  1U35 A;  3REI C;  3O62 A;  3REJ C;  4Z2M H;  4UPK A;  3O62 B;  1P3O C;  4G92 C;  5B40 C;  2NQB D;  5DNM C;  4X23 C;  1P3G A;  4YM6 C;  5BT1 C;  5C3I B;  1P3G B;  5E5A A;  5B2J D;  5F99 D;  5E5A B;  3MGP D;  5GT0 C;  3LZ0 A;  4KHA A;  1M19 D;  3AZM D;  5B0Y C;  3LZ0 B;  4H9S A;  4KHA B;  5AY8 A;  3AZF C;  3C1C D;  5AY8 B;  3B6G C;  2FJ7 D;  3B6F D;  5B2I D;  3UT9 D;  5CHL B;  3WTP C;  2Y2P A;  5B32 A;  3C1B C;  5B32 B;  4YS3 A;  4YS3 B;  3VH5 W;  3AZN D;  5AV8 C;  4Z5T A;  3LEL D;  4J8W C;  4Z5T B;  1WWS A;  5DNN D;  3REL B;  3REK D;  3X1V A;  1KX4 D;  1Z2C B;  3X1V B;  3X1T A;  2JCH A;  3AZI C;  3X1T B;  3UTB D;  5B33 A;  3AN2 A;  5B33 B;  1P3I D;  1P3A D;  5AVC C;  3LJA C;  2HUE B;  4Z2M G;  3LZ1 A;  3MGQ B;  2ARO B;  1KX5 A;  3LZ1 B;  4J8U D;  1N1J A;  3W96 A;  1KX5 B;  2CV5 D;  1N1J B;  3W96 B;  4DQY B;  1U35 C;  1P3F B;  1M1A A;  1M1A B;  1S32 A;  5B1M C;  5AV6 D;  4J8V C;  3W97 A;  5GSU A;  1PZR A;  1S32 B;  5AV5 D;  3W97 B;  5GXQ D;  2BG1 A;  5B31 G;  5B31 A;  3WA9 D;  3MGS D;  3KUY B;  4XZQ D;  2F8N A;  5BNV A;  1F66 D;  2F8N B;  5BNV B;  3X1S D;  1T3U A;  3O62 D;  5AV9 A;  2DF4 C;  3TU4 B;  5AV9 B;  3R45 A;  4H9S C;  5AY8 C;  3R45 B;  1ZLA B;  2J8P A;  5CPJ C;  4H9O A;  1KU5 A;  3REJ A;  4H9O B;  4ZUX D;  3REJ B;  3MGR A;  3VH5 T;  1P3O A;  5E5A D;  3MGR B;  1P3O B;  5B40 A;  5B40 B;  3AYW D;  1BFM A;  3W98 D;  4X23 A;  4YM6 A;  4X23 B;  4YM6 B;  1F1E A;  5CPI C;  4E44 A;  5GT0 B;  1W2E A;  1AOI C;  3AZF A;  2Y2J A;  5B0Y B;  1P3P D;  3X1U A;  4YS3 D;  3AZF B;  4H9P B;  3B6G B;  5B33 C;  3AN2 C;  3WTP B;  1ULY A;  2HUE C;  4Z5T D;  3AZL A;  2L5A A;  3LZ1 C;  3REL D;  3AZL B;  2XD1 A;  1KX5 C;  4WV4 B;  3X1V D;  5AV8 A;  1M1A C;  3X1T D;  1BH9 A;  5AV8 B;  3EG5 B;  1BH9 B;  1S32 C;  3W97 C;  5GSU C;  3A6N A;  2BYK A;  3UTA C;  3MGQ D;  2JE5 A;  1KX3 A;  5B31 C;  2BYK B;  3A6N B;  2ARO D;  1KX3 B;  3KSY A;  3W96 D;  2HIO A;  3AZI A;  2LY8 A;  1P3F D;  2HIO B;  3KXB C;  3AZI B;  2CWE A;  3LJA A;  1P3L C;  4DRA A;  3LJA B;  5B24 A;  3KUY D;  5GT3 C;  5B24 B;  3KWQ C;  3AZJ A;  3W99 D;  1U35 B;  3EPJ A;  2RVQ D;  4AWL C;  5B1M A;  4J8V A;  3MGR C;  5B1M B;  4J8V B;  3TU4 D;  3AZE A;  3KFU G;  5G49 A;  4Z66 C;  3WTP E;  5G49 B;  1ZLA D;  1HQ3 A;  5CP6 A;  5CP6 B;  4WU9 D;  2Y2M A;  4LD9 A;  3AZH C;  3WA9 B;  3REI D;  3REJ D;  2G5I C;  1TZY A;  4E45 A;  3EPK A;  1P3O D;  3AZK A;  5B40 D;  3X1U C;  5CPJ A;  5DNM D;  5CPJ B;  4X23 D;  3REH A;  4NE6 A;  5AVB C;  4YM6 D;  5BT1 D;  1M18 A;  1Q9C A;  1M18 B;  4H9Q A;  3AFA C;  3AZL C;  4H9Q B;  5GT0 D;  5B0Y D;  2IO5 B;  2FJ7 C;  3AZF D;  5B0Z C;  4J8X C;  3B6G D;  5BS7 A;  1P3B A;  2NZD C;  5CPI A;  1ID3 A;  2JSS A;  3WTP D;  1P3B B;  5CPI B;  1ID3 B;  1WWI A;  3A6N C;  1KX3 C;  1AOI A;  3C1B D;  3AV1 C;  1AOI B;  2HIO C;  3EPL A;  5AV8 D;  4R8P A;  3AN2 B;  4J8W D;  5B24 C;  3B0D B;  3MNN C;  3B0B A;  4UUZ A;  3AZI D;  1P3K A;  4UUZ B;  3F6T A;  2ZY3 A;  4WU8 A;  1P3M C;  3AZE C;  3UTA A;  1P3K B;  4G91 B;  5GSU B;  5AVC D;  4WU8 B;  3LJA D;  4XUJ A;  3UTA B;  3NQU A;  5BO0 A;  5B31 B;  4XUJ B;  3NQU B;  5BO0 B;  4WZS B;  1HQ3 C;  4M6B A;  5CP6 C;  5CPK C;  4JJN A;  3KXB A;  4KUD A;  1U35 D;  4LD9 C;  4JJN B;  3KXB B;  5AV5 C;  4KUD B;  1P3L A;  1TZY C;  5B1M D;  4J8V D;  4QLC A;  3AZJ C;  1P3L B;  3AZK C;  4QLC B;  4KGC C;  5GT3 A;  1P34 A;  3KWQ A;  5GT3 B;  3MVD A;  1P34 B;  5B1L C;  2NQB C;  3KWQ B;  3WKJ A;  3MVD B;  3REH C;  2F8N K;  1P3G D;  3WKJ B;  5JRG C;  3B0C W;  1M18 C;  4AWL B;  4Z66 A;  2PYO C;  3LZ0 D;  2IO5 C;  4Z66 B;  5AY8 D;  3H0M C;  5CPJ D;  3AZH A;  2RIQ A;  5BS7 C;  1P3B C;  1ID3 C;  3H0R C;  3AZH B;  4EO5 C;  3AYW C;  5B32 D;  3X1U B;  5F99 A;  5AVB A;  5F99 B;  5AVB B;  4R8P C;  3AFA A;  5CPI D;  3AFA B;  3C1C A;  3B0D C;  3WAA C;  4CSR A;  3C1C B;  2FJ7 A;  1AOI D;  3B6F A;  5B2I A;  3UT9 A;  5B0Z A;  2FJ7 B;  3B6F B;  5B0Z B;  4J8X A;  2Y2L A;  2NZD A;  2UWX A;  4J8X B;  5B33 D;  2NZD B;  1EQZ C;  1P3K C;  4G91 C;  3AN2 D;  4WU8 C;  4ZBJ C;  4XUJ C;  3LZ1 D;  3AZN A;  3AV1 A;  3A1K A;  1KX5 D;  3NQJ A;  4HGA C;  2F2A C;  3AV1 B;  2W8S A;  3NQJ B;  3AZG C;  4JJN C;  4KUD C;  1M1A D;  1S32 D;  5KDM A;  2Y2N A;  4QLC C;  3W97 D;  5GSU D;  1KX4 A;  3UTA D;  3MNN A;  1KX4 B;  3B0C T;  5B31 D;  1P34 C;  3VH6 A;  3MNN B;  3MVD C;  2F8N D;  3WKJ C;  1P3I A;  1P3A A;  3AV2 C;  1P3I B;  3KXB D;  1P3M A;  1P3M B;  4J8U A;  5AV9 D;  1P3L D;  3AZE B;  4J8U B;  3AL0 C;  2Y2I A;  5GT3 D;  5CPK A;  5FUG A;  1HQ3 B;  3KWQ D;  5AV6 A;  5CPK B;  5FUG B;  5AV6 B;  5AV5 A;  3WA9 A;  4LD9 B;  5AV5 B;  2Y2G A;  3MGR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...