3MGQA

Binding of nickel ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqA00
3B6GB 1TAFB 4J8WA 5AV8D 3B0CT 5GXQA 3B6GC 3X1SC 4J8UB 1P3MA 1JFIA 4Z5TD 3UTBB 1KX4C 5AV8A 4J8UC 3VH6A 1TZYD 1HTAA 1F66A 5DNMD 5GXQB 4LD9D 4Z5TA 3WKJB 3AZIC 3AFAD 1TZYA 3AZHD 5DNMA 1BH8A 3WKJC 3X1TC 4H9QA 4WV4B 1F66B 4J8VB 3AFAA 1HQ3B 5G49B 3AZHA 3RELD 5CPKB 4J8VC 1BH9B 3MGPC 3WTPD 1HQ3C 2HIOD 3MVDD 3LZ0D 5AV9B 4J8XB 3RELA 3NQJA 5KDMA 2HIOA 2F8NK 3MVDA 5AV9C 4J8XC 4HGAB 3AZGB 3KWQA 4JJNC 1F1EA 5E5AB 3AZND 2RVQD 4R8PD 4HGAC 4NE6A 1P3LB 5E5AC 3AZNA 3AZKA 1B67A 4R8PA 5B1LD 3KWQB 1P3LC 5B1MD 4WU8D 4WNNB 1P34C 5FUGB 5B1MA 4E44A 4WU8A 1EQZB 3AZKB 4XUJC 5CP6B 1EQZC 1P3KD 5CP6C 5B32G 4G91B 3O62D 3AZJB 3AZFD 4G91C 1P3FD 4H9SC 4WU9B 3MGRB 1ZLAB 3AN2D 4H9OA 3AZJC 2F8NA 3B6FB 4WU9C 5AV5B 3MGRC 1ZLAC 5B2IC 3AZFA 3W98D 5B31D 3UT9B 2LY8A 3TU4B 3AN2A 3B6FC 5AV5C 5B24B 3UT9C 2L5AA 3TU4C 3AYWB 1ID3B 3W98A 5B31A 5B0ZB 2AROA 2F8NB 2NQBD 5B24C 3AYWC 1ID3C 5B0ZC 4Z66B 4ZUXD 5B40B 3C1BB 5DNNB 3V9RB 2AROB 5B40C 1N1JA 3C1BC 5AVBD 5JRGB 4YM6D 5DNNC 4ZUXA 2PYOB 3VH6T 3LJAB 5BO0B 5JRGC 2BYMB 5AY8D 2PYOC 4X23B 4YM6A 3LJAC 4KHAB 4AWLC 3W99D 2NZDB 4X23C 5AY8A 1M1AB 2NZDC 4NFTA 3W99A 1KX3C 1U35B 1M1AC 3R45B 1U35C 3B6GD 3KXBB 5JA4A 3MNNC 3W97B 1AOIB 2YFWA 2IO5B 3KXBC 3B6GA 1TAFA 3X1SA 3UTBD 5CPJB 3W97C 3AZMB 2IO5C 5F99B 5BT1C 1KX4A 4J8UA 3X1VB 5GXQD 3AZMC 5CPJC 1P3PC 5F99C 3WKJD 3X1SB 3X1VC 1KX5B 2CWEA 5B2JB 1S32B 1KX4B 1F66D 3WKJA 4J8VD 3X1TA 5B2JC 1KX5C 1S32C 1HQ3D 1P3AC 4Z2MG 5B0YB 4H9PB 5CPKD 5BS7C 3AZIB 5B0YC 4J8VA 3MGPA 3X1UB 1HQ3A 5G49A 1B6WA 3X1TB 4J8XD 5CPKA 1BH9A 3X1UC 3AZGD 5AV9A 3MGPB 4J8XA 3REJB 5E5AD 4YS3B 3B0BA 3REJC 1P3LD 3AZGA 4YS3C 5E5AA 3WTPE 3NQUB 3KWQD 3W96B 5AVCB 1P3LA 4JJNB 3REHB 3W96C 5AVCC 3REHC 1EQZD 3AZEB 3AZKD 4WNNA 1P34A 5CP6D 4KGCB 3AZEC 5FUGA 1EQZA 4KGCC 3WA9B 5CP6A 2BYKB 3LZ1B 1P34B 1ULYA 1TZYC 4XUJB 3WA9C 3LZ1C 3AZJD 4LD9C 3AV1B 4WU9D 1ZLAD 3MGRD 2F8NG 4H9SA 3AV1C 3MGSB 3B6FD 5AV5D 3MGQB 3AZJA 3UT9D 1KU5A 4WU9A 1ZLAA 3MGRA 3TU4D 5B2IA 3MGSC 1P3IB 3MGQC 5B31G 5B24D 3B6FA 5AV5A 3AYWD 1ID3D 5B0ZD 3UT9A 1BFMA 1P3IC 2F8ND 3WTPC 2HUEB 3TU4A 3LZ0C 4UUZB 5B24A 4Z66D 5B2IB 3AYWA 1ID3A 2HUEC 3REIB 5BNXB 4CSRB 5B0ZA 5B40D 4CAYB 3C1BD 5DNND 1AOIC 3WAAB 3REIC 2AROD 4Z66A 5JRGD 4G92B 2PYOD 5B40A 3WAAC 3C1BA 5DNNA 3V9RA 3LJAD 4G92C 4X23D 5JRGA 3A6NB 4NE5A 2PYOA 5GT3B 3LJAA 3REKB 2NZDD 5BO0A 5B1LC 3A6NC 2BYMA 4M6BA 4X23A 1M1AD 5GT3C 3REKC 4KHAA 2YFVB 2NZDA 1U35D 1KX3A 1M1AA 4AWLB 4ZBJC 4QLCB 1U35A 4XZQB 1P3KC 3KXBD 3O62B 3R45A 4QLCC 5GSUB 4XZQC 1KX3B 3W97D 3LELB 3O62C 3MNNA 4H9RB 2FJ7B 5GSUC 3KXBA 1H3OB 5CPJD 3AZMD 3LELC 1P3FC 2FJ7C 3W97A 5F99D 5B32B 3X1VD 3VH5W 1WWSA 3MNNB 3AZMA 3AV2B 3B0DB 5CPJA 1P3PA 3X1SD 5F99A 5CHLB 5B32C 5GT0B 4KUDB 1KX5D 5B2JD 1S32D 3AV2C 3X1VA 3B0DC 1KX4D 5GT0C 4J8UD 4KUDC 1A7WA 3KUYB 2NQBC 3B0CW 5B0YD 1KX5A 5B2JA 1S32A 1P3AA 3KUYC 1P3PB 3AZID 5C3IC 5BS7A 3X1UD 5B0YA 4H9PA 3X1TD 3AZIA 5AVBC 1P3OB 5BNVB 1P3AB 3X1UA 5B33B 1P3OC 3MGPD 3REJD 5B33C 4YS3D 3REJA 1M19B 1M18B 3AZLB 4YS3A 5AV9D 3UTAB 1M19C 5AVCD 4JJND 1P3BB 1M18C 3REHD 3AZLC 3C1CB 3UTAC 3NQUA 1P3BC 1P3GB 5CPIB 3W96A 5AV6B 5AVCA 4JJNA 3C1CC 3AZED 2CV5B 3REHA 1P3GC 5CPIC 5AV6C 4KGCD 2CV5C 3AZEA 3WA9D 4NE3A 4J8WB 4WZSB 3LZ1D 3UTBC 1P34D 4KGCA 4Z2MH 4XUJD 1P3MB 1JFIB 4J8WC 5GXQC 3AV1D 3WA9A 3LZ1A 2BYKA 5AV8B 1P3MC 4LD9A 1Q9CA 4XUJA 3MGSD 5AV8C 3MGQD 4Z5TB 3AV1A 1F66C 1TZYB 1P3ID 4Z5TC 5DNMB 1BH8B 3MGSA 4LD9B 3MGQA 5CPKC 4H9QB 3AFAB 5DNMC 1P3IA 3WTPA 3AZHB 1AOID 5B2ID 3REID 3AFAC 3LZ0A 3AZHC 3WAAD 4UUZA 3VH5A 1AOIA 3RELB 3AZGC 3REIA 3NQJB 5BNXA 3WTPB 4CSRA 2HIOB 4CAYA 5KDMB 3MVDB 3WAAA 3RELC 3LZ0B 2HIOC 4DRAA 3A6ND 3MVDC 5GT3D 4EO5B 3REKD 3KWQC 5B1LA 3A6NA 4EO5C 3AZNB 5GT3A 4R8PB 3REKA 3AZNC 2JSSA 2RVQC 4R8PC 3AZKC 2YFVA 2F8NH 5B1LB 4QLCD 3VH6W 4XZQD 5B1MB 4WU8B 1P3KA 5GSUD 1KX3D 5B1MC 4WU8C 4QLCA 3LELD 4E45A 4XZQA 2FJ7D 3KSYA 3O62A 4ZBJB 5GSUA 3LELA 1P3KB 1P3FA 4H9RA 2FJ7A 5B32D 1H3OA 3AV2D 3MNND 5GT0D 4KUDD 4H9OB 5B32A 3AZFB 1P3FB 3AV2A 3KUYD 5BT1D 5GT0A 4KUDA 3AN2B 2NQBA 3AZFC 1P3PD 4Z66C 3W98B 5B31B 3AN2C 3KUYA 3W98C 5B31C 2AROC 1P3OD 2NQBB 1P3AD 5AVBA 5B33D 1N1JB 5C3IB 4ZUXB 1P3OA 4DRBA 5BNVA 4H9NA 5B33A 1WWIA 4ZUXC 1M19D 5AVBB 4YM6B 1M18D 3AZLD 3UTAD 4YM6C 1P3BD 5AY8B 4H9NB 1M19A 1M18A 3C1CD 1R4VA 3AZLA 3UTAA 5AY8C 5CPID 1P3GD 3W99B 5AV6D 1P3BA 2CV5D 3C1CA 3W99C 1P3GA 5CPIA 5AV6A 2CV5A 3VH5T 3W96D 5JA4B 4J8WD 2YFWB 3UTBA 1P3MD
chains in the Genus database with same CATH superfamily
3B6GB 1TAFB 4J8WA 5AV8D 3B0CT 5GXQA 3B6GC 3X1SC 4J8UB 1P3MA 1JFIA 4Z5TD 3UTBB 1KX4C 5AV8A 4J8UC 3VH6A 1TZYD 1HTAA 1F66A 5DNMD 5GXQB 4LD9D 4Z5TA 3WKJB 3AZIC 3AFAD 1TZYA 4DQYB 3AZHD 5DNMA 1BH8A 3WKJC 3X1TC 3KFUG 4H9QA 4WV4B 1F66B 4J8VB 3AFAA 1HQ3B 5G49B 3AZHA 3RELD 5CPKB 4J8VC 1BH9B 3MGPC 3WTPD 1HQ3C 2HIOD 1PZRA 3MVDD 3LZ0D 2ZY2A 5AV9B 4J8XB 3RELA 3NQJA 5KDMA 2HIOA 4UPKA 2F8NK 3MVDA 5AV9C 4J8XC 4HGAB 3AZGB 3KWQA 4JJNC 1F1EA 5E5AB 3AZND 2RVQD 4R8PD 4HGAC 2FFFB 4NE6A 1P3LB 5E5AC 3AZNA 3AZKA 1B67A 4R8PA 5B1LD 3KWQB 1P3LC 5B1MD 4WU8D 4WNNB 1P34C 2Y2IA 5FUGB 5B1MA 4E44A 4WU8A 1EQZB 3AZKB 4XUJC 5CP6B 1EQZC 1P3KD 5CP6C 1W2EA 5B32G 4G91B 3O62D 2Y2OA 3AZJB 3AZFD 4G91C 1P3FD 4H9SC 4WU9B 3MGRB 1ZLAB 3AN2D 4H9OA 3AZJC 2Y2PA 2F8NA 3B6FB 4WU9C 5AV5B 3MGRC 1ZLAC 2G5HC 5B2IC 3AZFA 5B31D 3UT9B 3W98D 2LY8A 3TU4B 1Z2CB 3AN2A 3B6FC 5AV5C 5B24B 3UT9C 2L5AA 3TU4C 3AYWB 1ID3B 3W98A 5B31A 5B0ZB 2AROA 2F8NB 2NQBD 3EG5B 5B24C 3AYWC 1ID3C 5B0ZC 4Z66B 4ZUXD 5B40B 3C1BB 2W8SA 5DNNB 3V9RB 2AROB 5B40C 1N1JA 3C1BC 5AVBD 5JRGB 4YM6D 5DNNC 4ZUXA 2PYOB 3VH6T 2ZY5A 3LJAB 5BO0B 5JRGC 2BYMB 5AY8D 2PYOC 4X23B 4YM6A 3LJAC 4KHAB 4AWLC 2RIQA 3W99D 2NZDB 4X23C 3H0RC 5AY8A 1M1AB 2NZDC 4NFTA 3W99A 1KX3C 1U35B 1M1AC 3R45B 1U35C 3B6GD 3KXBB 5JA4A 3MNNC 3W97B 1AOIB 2YFWA 2IO5B 3KXBC 3EPLA 3B6GA 1TAFA 3X1SA 3UTBD 5CPJB 3W97C 3AZMB 2IO5C 5F99B 5BT1C 1KX4A 4J8UA 3X1VB 5GXQD 3AZMC 5CPJC 1P3PC 2ZY3A 5F99C 3WKJD 3X1SB 3X1VC 1KX5B 2CWEA 5B2JB 1S32B 2G5IC 1KX4B 1F66D 3WKJA 4J8VD 3X1TA 5B2JC 1KX5C 1S32C 1HQ3D 1P3AC 4Z2MG 5B0YB 4H9PB 5CPKD 5BS7C 3AZIB 5B0YC 4J8VA 3MGPA 3X1UB 1HQ3A 5G49A 1B6WA 3X1TB 4J8XD 5CPKA 1BH9A 3X1UC 2Y2KA 3AZGD 5AV9A 3MGPB 4J8XA 3REJB 5E5AD 2JCHA 4YS3B 3B0BA 3REJC 1P3LD 3AZGA 4YS3C 5E5AA 3WTPE 3NQUB 3KWQD 3W96B 5AVCB 1P3LA 4JJNB 3REHB 2Y2MA 3W96C 5AVCC 3REHC 1EQZD 3AZEB 3AZKD 4WNNA 3A1IA 1P34A 2Y2LA 5CP6D 4KGCB 3AZEC 5FUGA 1EQZA 4KGCC 3WA9B 5CP6A 2BYKB 3LZ1B 1P34B 1ULYA 1TZYC 4XUJB 2Y2NA 2Y2QA 3WA9C 3LZ1C 3AZJD 4LD9C 3AV1B 4WU9D 1ZLAD 3MGRD 2F8NG 2Y2HA 2ZY4A 4H9SA 3AV1C 3MGSB 3A1KA 3B6FD 5AV5D 3MGQB 3AZJA 3UT9D 1KU5A 4WU9A 1ZLAA 3MGRA 3TU4D 5B2IA 3MGSC 1P3IB 3MGQC 5B31G 5B24D 3B6FA 5AV5A 3AYWD 3EPJA 3EPKA 1ID3D 5B0ZD 3UT9A 1BFMA 1P3IC 2F8ND 3WTPC 2HUEB 3TU4A 3LZ0C 4UUZB 5B24A 5B2IB 4Z66D 3AYWA 1ID3A 2HUEC 3REIB 5BNXB 4CSRB 5B0ZA 5B40D 4CAYB 3C1BD 5DNND 1AOIC 2VQRA 3WAAB 3REIC 2AROD 4Z66A 5JRGD 4G92B 2PYOD 5B40A 3WAAC 3C1BA 5DNNA 3V9RA 3LJAD 4G92C 4X23D 5JRGA 3A6NB 4NE5A 2PYOA 5GT3B 3LJAA 3REKB 2NZDD 5BO0A 5B1LC 3A6NC 2BYMA 2J8PA 4M6BA 4X23A 1M1AD 5GT3C 3REKC 4KHAA 2YFVB 2NZDA 1U35D 1KX3A 1M1AA 4AWLB 4ZBJC 4QLCB 1U35A 4XZQB 1P3KC 3KXBD 3O62B 3R45A 4QLCC 5GSUB 4XZQC 1KX3B 3W97D 3LELB 3O62C 3MNNA 4H9RB 2FJ7B 5GSUC 3KXBA 1H3OB 5CPJD 3AZMD 3LELC 1P3FC 2FJ7C 3W97A 5F99D 5B32B 3X1VD 3VH5W 1WWSA 3MNNB 3AZMA 3AV2B 3B0DB 5CPJA 1P3PA 5GT0B 5B32C 5CHLB 5F99A 3X1SD 4KUDB 1KX5D 5B2JD 1S32D 3AV2C 3X1VA 3B0DC 1KX4D 5GT0C 4J8UD 4KUDC 1A7WA 3KUYB 2NQBC 3B0CW 5B0YD 1KX5A 5B2JA 1S32A 1P3AA 3KUYC 1P3PB 3AZID 5C3IC 5BS7A 3X1UD 5B0YA 4H9PA 3X1TD 3AZIA 5AVBC 1P3OB 5BNVB 1P3AB 3X1UA 2DF4C 5B33B 1P3OC 3MGPD 3REJD 3AL0C 5B33C 4YS3D 3FDDA 3REJA 1M19B 1M18B 3AZLB 4YS3A 5AV9D 3UTAB 1M19C 5AVCD 4JJND 1P3BB 1M18C 3REHD 3EPHA 3AZLC 3C1CB 3UTAC 3NQUA 1P3BC 1P3GB 5CPIB 3W96A 5AV6B 5AVCA 4JJNA 3C1CC 3AZED 2CV5B 3REHA 1P3GC 5CPIC 5AV6C 4KGCD 2CV5C 3F6TA 3AZEA 3WA9D 4NE3A 4J8WB 4WZSB 3LZ1D 3UTBC 1P34D 4KGCA 4Z2MH 4XUJD 1P3MB 1JFIB 4J8WC 5GXQC 3AV1D 3WA9A 3LZ1A 2BYKA 5AV8B 2Y2GA 1P3MC 4LD9A 1Q9CA 4XUJA 3MGSD 3H0MC 5AV8C 3MGQD 4Z5TB 3AV1A 1F66C 3P5JB 1TZYB 1P3ID 4Z5TC 5DNMB 1BH8B 3MGSA 4LD9B 3MGQA 5CPKC 4H9QB 3AFAB 5DNMC 2JE5A 1P3IA 3WTPA 3H0LC 3AZHB 1AOID 5B2ID 3REID 3AFAC 3LZ0A 3AZHC 3WAAD 4UUZA 3VH5A 1AOIA 3RELB 3AZGC 3REIA 3NQJB 5BNXA 3WTPB 4CSRA 2HIOB 4CAYA 5KDMB 3MVDB 3WAAA 3RELC 3LZ0B 3IP4C 4WJ3C 2HIOC 4DRAA 3A6ND 3MVDC 5GT3D 4EO5B 3REKD 3KWQC 5B1LA 3A6NA 4EO5C 3AZNB 5GT3A 4R8PB 3REKA 3AZNC 2JSSA 2ZM5A 2RVQC 4R8PC 2F2AC 3AZKC 2YFVA 2DQNC 2F8NH 2BG1A 5B1LB 3VH6W 4QLCD 4XZQD 5B1MB 4WU8B 1P3KA 5GSUD 1KX3D 5B1MC 4WU8C 4QLCA 3LELD 4E45A 4XZQA 2FJ7D 3KSYA 2XD5A 3O62A 4ZBJB 5GSUA 3LELA 1P3KB 1P3FA 4H9RA 2FJ7A 5B32D 1H3OA 3AV2D 3MNND 1T3UA 5GT0D 4KUDD 4H9OB 5B32A 3AZFB 1P3FB 3AV2A 3KUYD 5BT1D 5GT0A 4KUDA 3AN2B 2NQBA 3AZFC 1P3PD 4Z66C 3W98B 5B31B 3AN2C 3KUYA 3W98C 5B31C 2AROC 1P3OD 2NQBB 1P3AD 5AVBA 5B33D 1N1JB 5C3IB 4ZUXB 1P3OA 4DRBA 5BNVA 4H9NA 5B33A 1WWIA 4ZUXC 1M19D 5AVBB 4YM6B 1M18D 3AZLD 2UWXA 3UTAD 4YM6C 1P3BD 5AY8B 4H9NB 1M19A 1M18A 3C1CD 1R4VA 3AZLA 3UTAA 2Y2JA 5AY8C 5CPID 1P3GD 5AV6D 3W99B 1P3BA 2CV5D 3C1CA 3W99C 1P3GA 5CPIA 5AV6A 2CV5A 3VH5T 3W96D 2XD1A 5JA4B 4J8WD 2YFWB 3UTBA 1P3MD
chains in the Genus database with same CATH topology
3B6GB 1TAFB 4J8WA 5AV8D 3B0CT 5GXQA 3B6GC 3X1SC 4J8UB 1P3MA 1JFIA 4Z5TD 3UTBB 1KX4C 5AV8A 4J8UC 3VH6A 1TZYD 1HTAA 1F66A 5DNMD 5GXQB 4LD9D 4Z5TA 3WKJB 3AZIC 3AFAD 1TZYA 4DQYB 3AZHD 5DNMA 1BH8A 3WKJC 3X1TC 3KFUG 4H9QA 4WV4B 1F66B 4J8VB 3AFAA 1HQ3B 5G49B 3AZHA 3RELD 5CPKB 4J8VC 1BH9B 3MGPC 3WTPD 1HQ3C 2HIOD 1PZRA 3MVDD 3LZ0D 2ZY2A 5AV9B 4J8XB 3RELA 3NQJA 5KDMA 2HIOA 4UPKA 2F8NK 3MVDA 5AV9C 4J8XC 4HGAB 3AZGB 3KWQA 4JJNC 1F1EA 5E5AB 3AZND 2RVQD 4R8PD 4HGAC 2FFFB 4NE6A 1P3LB 5E5AC 3AZNA 3AZKA 1B67A 4R8PA 5B1LD 3KWQB 1P3LC 5B1MD 4WU8D 4WNNB 1P34C 2Y2IA 5FUGB 5B1MA 4E44A 4WU8A 1EQZB 3AZKB 4XUJC 5CP6B 1EQZC 1P3KD 5CP6C 1W2EA 5B32G 4G91B 3O62D 2Y2OA 3AZJB 3AZFD 4G91C 1P3FD 4H9SC 4WU9B 3MGRB 1ZLAB 3AN2D 4H9OA 3AZJC 2Y2PA 2F8NA 3B6FB 4WU9C 5AV5B 3MGRC 1ZLAC 2G5HC 5B2IC 3AZFA 5B31D 3UT9B 3W98D 2LY8A 3TU4B 1Z2CB 3AN2A 3B6FC 5AV5C 5B24B 3UT9C 2L5AA 3TU4C 3AYWB 1ID3B 3W98A 5B31A 5B0ZB 2AROA 2F8NB 2NQBD 3EG5B 5B24C 3AYWC 1ID3C 5B0ZC 4Z66B 4ZUXD 5B40B 3C1BB 2W8SA 5DNNB 3V9RB 2AROB 5B40C 1N1JA 3C1BC 5AVBD 5JRGB 4YM6D 5DNNC 4ZUXA 2PYOB 3VH6T 2ZY5A 3LJAB 5BO0B 5JRGC 2BYMB 5AY8D 2PYOC 4X23B 4YM6A 3LJAC 4KHAB 4AWLC 2RIQA 3W99D 2NZDB 4X23C 3H0RC 5AY8A 1M1AB 2NZDC 4NFTA 3W99A 1KX3C 1U35B 1M1AC 3R45B 1U35C 3B6GD 3KXBB 5JA4A 3MNNC 3W97B 1AOIB 2YFWA 2IO5B 3KXBC 3EPLA 3B6GA 1TAFA 3X1SA 3UTBD 5CPJB 3W97C 3AZMB 2IO5C 5F99B 5BT1C 1KX4A 4J8UA 3X1VB 5GXQD 3AZMC 5CPJC 1P3PC 2ZY3A 5F99C 3WKJD 3X1SB 3X1VC 1KX5B 2CWEA 5B2JB 1S32B 2G5IC 1KX4B 1F66D 3WKJA 4J8VD 3X1TA 5B2JC 1KX5C 1S32C 1HQ3D 1P3AC 4Z2MG 5B0YB 4H9PB 5CPKD 5BS7C 3AZIB 5B0YC 4J8VA 3MGPA 3X1UB 1HQ3A 5G49A 1B6WA 3X1TB 4J8XD 5CPKA 1BH9A 3X1UC 2Y2KA 3AZGD 5AV9A 3MGPB 4J8XA 3REJB 5E5AD 2JCHA 4YS3B 3B0BA 3REJC 1P3LD 3AZGA 4YS3C 5E5AA 3WTPE 3NQUB 3KWQD 3W96B 5AVCB 1P3LA 4JJNB 3REHB 2Y2MA 3W96C 5AVCC 3REHC 1EQZD 3AZEB 3AZKD 4WNNA 3A1IA 1P34A 2Y2LA 5CP6D 4KGCB 3AZEC 5FUGA 1EQZA 4KGCC 3WA9B 5CP6A 2BYKB 3LZ1B 1P34B 1ULYA 1TZYC 4XUJB 2Y2NA 2Y2QA 3WA9C 3LZ1C 3AZJD 4LD9C 3AV1B 4WU9D 1ZLAD 3MGRD 2F8NG 2Y2HA 2ZY4A 4H9SA 3AV1C 3MGSB 3A1KA 3B6FD 5AV5D 3MGQB 3AZJA 3UT9D 1KU5A 4WU9A 1ZLAA 3MGRA 3TU4D 5B2IA 3MGSC 1P3IB 3MGQC 5B31G 5B24D 3B6FA 5AV5A 3AYWD 3EPJA 3EPKA 1ID3D 5B0ZD 3UT9A 1BFMA 1P3IC 2F8ND 3WTPC 2HUEB 3TU4A 3LZ0C 4UUZB 5B24A 5B2IB 4Z66D 3AYWA 1ID3A 2HUEC 3REIB 5BNXB 4CSRB 5B0ZA 5B40D 4CAYB 3C1BD 5DNND 1AOIC 2VQRA 3WAAB 3REIC 2AROD 4Z66A 5JRGD 4G92B 2PYOD 5B40A 3WAAC 3C1BA 5DNNA 3V9RA 3LJAD 4G92C 4X23D 5JRGA 3A6NB 4NE5A 2PYOA 5GT3B 3LJAA 3REKB 2NZDD 5BO0A 5B1LC 3A6NC 2BYMA 2J8PA 4M6BA 4X23A 1M1AD 5GT3C 3REKC 4KHAA 2YFVB 2NZDA 1U35D 1KX3A 1M1AA 4AWLB 4ZBJC 4QLCB 1U35A 4XZQB 1P3KC 3KXBD 3O62B 3R45A 4QLCC 5GSUB 4XZQC 1KX3B 3W97D 3LELB 3O62C 3MNNA 4H9RB 2FJ7B 5GSUC 3KXBA 1H3OB 5CPJD 3AZMD 3LELC 1P3FC 2FJ7C 3W97A 5F99D 5B32B 3X1VD 3VH5W 1WWSA 3MNNB 3AZMA 3AV2B 3B0DB 5CPJA 1P3PA 5GT0B 5B32C 5CHLB 5F99A 3X1SD 4KUDB 1KX5D 5B2JD 1S32D 3AV2C 3X1VA 3B0DC 1KX4D 5GT0C 4J8UD 4KUDC 1A7WA 3KUYB 2NQBC 3B0CW 5B0YD 1KX5A 5B2JA 1S32A 1P3AA 3KUYC 1P3PB 3AZID 5C3IC 5BS7A 3X1UD 5B0YA 4H9PA 3X1TD 3AZIA 5AVBC 1P3OB 5BNVB 1P3AB 3X1UA 2DF4C 5B33B 1P3OC 3MGPD 3REJD 3AL0C 5B33C 4YS3D 3FDDA 3REJA 1M19B 1M18B 3AZLB 4YS3A 5AV9D 3UTAB 1M19C 5AVCD 4JJND 1P3BB 1M18C 3REHD 3EPHA 3AZLC 3C1CB 3UTAC 3NQUA 1P3BC 1P3GB 5CPIB 3W96A 5AV6B 5AVCA 4JJNA 3C1CC 3AZED 2CV5B 3REHA 1P3GC 5CPIC 5AV6C 4KGCD 2CV5C 3F6TA 3AZEA 3WA9D 4NE3A 4J8WB 4WZSB 3LZ1D 3UTBC 1P34D 4KGCA 4Z2MH 4XUJD 1P3MB 1JFIB 4J8WC 5GXQC 3AV1D 3WA9A 3LZ1A 2BYKA 5AV8B 2Y2GA 1P3MC 4LD9A 1Q9CA 4XUJA 3MGSD 3H0MC 5AV8C 3MGQD 4Z5TB 3AV1A 1F66C 3P5JB 1TZYB 1P3ID 4Z5TC 5DNMB 1BH8B 3MGSA 4LD9B 3MGQA 5CPKC 4H9QB 3AFAB 5DNMC 2JE5A 1P3IA 3WTPA 3H0LC 3AZHB 1AOID 5B2ID 3REID 3AFAC 3LZ0A 3AZHC 3WAAD 4UUZA 3VH5A 1AOIA 3RELB 3AZGC 3REIA 3NQJB 5BNXA 3WTPB 4CSRA 2HIOB 4CAYA 5KDMB 3MVDB 3WAAA 3RELC 3LZ0B 3IP4C 4WJ3C 2HIOC 4DRAA 3A6ND 3MVDC 5GT3D 4EO5B 3REKD 3KWQC 5B1LA 3A6NA 4EO5C 3AZNB 5GT3A 4R8PB 3REKA 3AZNC 2JSSA 2ZM5A 2RVQC 4R8PC 2F2AC 3AZKC 2YFVA 2DQNC 2F8NH 2BG1A 5B1LB 3VH6W 4QLCD 4XZQD 5B1MB 4WU8B 1P3KA 5GSUD 1KX3D 5B1MC 4WU8C 4QLCA 3LELD 4E45A 4XZQA 2FJ7D 3KSYA 2XD5A 3O62A 4ZBJB 5GSUA 3LELA 1P3KB 1P3FA 4H9RA 2FJ7A 5B32D 1H3OA 3AV2D 3MNND 1T3UA 5GT0D 4KUDD 4H9OB 5B32A 3AZFB 1P3FB 3AV2A 3KUYD 5BT1D 5GT0A 4KUDA 3AN2B 2NQBA 3AZFC 1P3PD 4Z66C 3W98B 5B31B 3AN2C 3KUYA 3W98C 5B31C 2AROC 1P3OD 2NQBB 1P3AD 5AVBA 5B33D 1N1JB 5C3IB 4ZUXB 1P3OA 4DRBA 5BNVA 4H9NA 5B33A 1WWIA 4ZUXC 1M19D 5AVBB 4YM6B 1M18D 3AZLD 2UWXA 3UTAD 4YM6C 1P3BD 5AY8B 4H9NB 1M19A 1M18A 3C1CD 1R4VA 3AZLA 3UTAA 2Y2JA 5AY8C 5CPID 1P3GD 5AV6D 3W99B 1P3BA 2CV5D 3C1CA 3W99C 1P3GA 5CPIA 5AV6A 2CV5A 3VH5T 3W96D 2XD1A 5JA4B 4J8WD 2YFWB 3UTBA 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G B;  1TAF B;  4J8W A;  5AV8 D;  3B0C T;  5GXQ A;  3B6G C;  3X1S C;  4J8U B;  1P3M A;  1JFI A;  4Z5T D;  3UTB B;  1KX4 C;  5AV8 A;  4J8U C;  3VH6 A;  1TZY D;  1HTA A;  1F66 A;  5DNM D;  5GXQ B;  4LD9 D;  4Z5T A;  3WKJ B;  3AZI C;  3AFA D;  1TZY A;  3AZH D;  5DNM A;  1BH8 A;  3WKJ C;  3X1T C;  4H9Q A;  4WV4 B;  1F66 B;  4J8V B;  3AFA A;  1HQ3 B;  5G49 B;  3AZH A;  3REL D;  5CPK B;  4J8V C;  1BH9 B;  3MGP C;  3WTP D;  1HQ3 C;  2HIO D;  3MVD D;  3LZ0 D;  5AV9 B;  4J8X B;  3REL A;  3NQJ A;  5KDM A;  2HIO A;  2F8N K;  3MVD A;  5AV9 C;  4J8X C;  4HGA B;  3AZG B;  3KWQ A;  4JJN C;  1F1E A;  5E5A B;  3AZN D;  2RVQ D;  4R8P D;  4HGA C;  4NE6 A;  1P3L B;  5E5A C;  3AZN A;  3AZK A;  1B67 A;  4R8P A;  5B1L D;  3KWQ B;  1P3L C;  5B1M D;  4WU8 D;  4WNN B;  1P34 C;  5FUG B;  5B1M A;  4E44 A;  4WU8 A;  1EQZ B;  3AZK B;  4XUJ C;  5CP6 B;  1EQZ C;  1P3K D;  5CP6 C;  5B32 G;  4G91 B;  3O62 D;  3AZJ B;  3AZF D;  4G91 C;  1P3F D;  4H9S C;  4WU9 B;  3MGR B;  1ZLA B;  3AN2 D;  4H9O A;  3AZJ C;  2F8N A;  3B6F B;  4WU9 C;  5AV5 B;  3MGR C;  1ZLA C;  5B2I C;  3AZF A;  3W98 D;  5B31 D;  3UT9 B;  2LY8 A;  3TU4 B;  3AN2 A;  3B6F C;  5AV5 C;  5B24 B;  3UT9 C;  2L5A A;  3TU4 C;  3AYW B;  1ID3 B;  3W98 A;  5B31 A;  5B0Z B;  2ARO A;  2F8N B;  2NQB D;  5B24 C;  3AYW C;  1ID3 C;  5B0Z C;  4Z66 B;  4ZUX D;  5B40 B;  3C1B B;  5DNN B;  3V9R B;  2ARO B;  5B40 C;  1N1J A;  3C1B C;  5AVB D;  5JRG B;  4YM6 D;  5DNN C;  4ZUX A;  2PYO B;  3VH6 T;  3LJA B;  5BO0 B;  5JRG C;  2BYM B;  5AY8 D;  2PYO C;  4X23 B;  4YM6 A;  3LJA C;  4KHA B;  4AWL C;  3W99 D;  2NZD B;  4X23 C;  5AY8 A;  1M1A B;  2NZD C;  4NFT A;  3W99 A;  1KX3 C;  1U35 B;  1M1A C;  3R45 B;  1U35 C;  3B6G D;  3KXB B;  5JA4 A;  3MNN C;  3W97 B;  1AOI B;  2YFW A;  2IO5 B;  3KXB C;  3B6G A;  1TAF A;  3X1S A;  3UTB D;  5CPJ B;  3W97 C;  3AZM B;  2IO5 C;  5F99 B;  5BT1 C;  1KX4 A;  4J8U A;  3X1V B;  5GXQ D;  3AZM C;  5CPJ C;  1P3P C;  5F99 C;  3WKJ D;  3X1S B;  3X1V C;  1KX5 B;  2CWE A;  5B2J B;  1S32 B;  1KX4 B;  1F66 D;  3WKJ A;  4J8V D;  3X1T A;  5B2J C;  1KX5 C;  1S32 C;  1HQ3 D;  1P3A C;  4Z2M G;  5B0Y B;  4H9P B;  5CPK D;  5BS7 C;  3AZI B;  5B0Y C;  4J8V A;  3MGP A;  3X1U B;  1HQ3 A;  5G49 A;  1B6W A;  3X1T B;  4J8X D;  5CPK A;  1BH9 A;  3X1U C;  3AZG D;  5AV9 A;  3MGP B;  4J8X A;  3REJ B;  5E5A D;  4YS3 B;  3B0B A;  3REJ C;  1P3L D;  3AZG A;  4YS3 C;  5E5A A;  3WTP E;  3NQU B;  3KWQ D;  3W96 B;  5AVC B;  1P3L A;  4JJN B;  3REH B;  3W96 C;  5AVC C;  3REH C;  1EQZ D;  3AZE B;  3AZK D;  4WNN A;  1P34 A;  5CP6 D;  4KGC B;  3AZE C;  5FUG A;  1EQZ A;  4KGC C;  3WA9 B;  5CP6 A;  2BYK B;  3LZ1 B;  1P34 B;  1ULY A;  1TZY C;  4XUJ B;  3WA9 C;  3LZ1 C;  3AZJ D;  4LD9 C;  3AV1 B;  4WU9 D;  1ZLA D;  3MGR D;  2F8N G;  4H9S A;  3AV1 C;  3MGS B;  3B6F D;  5AV5 D;  3MGQ B;  3AZJ A;  3UT9 D;  1KU5 A;  4WU9 A;  1ZLA A;  3MGR A;  3TU4 D;  5B2I A;  3MGS C;  1P3I B;  3MGQ C;  5B31 G;  5B24 D;  3B6F A;  5AV5 A;  3AYW D;  1ID3 D;  5B0Z D;  3UT9 A;  1BFM A;  1P3I C;  2F8N D;  3WTP C;  2HUE B;  3TU4 A;  3LZ0 C;  4UUZ B;  5B24 A;  4Z66 D;  5B2I B;  3AYW A;  1ID3 A;  2HUE C;  3REI B;  5BNX B;  4CSR B;  5B0Z A;  5B40 D;  4CAY B;  3C1B D;  5DNN D;  1AOI C;  3WAA B;  3REI C;  2ARO D;  4Z66 A;  5JRG D;  4G92 B;  2PYO D;  5B40 A;  3WAA C;  3C1B A;  5DNN A;  3V9R A;  3LJA D;  4G92 C;  4X23 D;  5JRG A;  3A6N B;  4NE5 A;  2PYO A;  5GT3 B;  3LJA A;  3REK B;  2NZD D;  5BO0 A;  5B1L C;  3A6N C;  2BYM A;  4M6B A;  4X23 A;  1M1A D;  5GT3 C;  3REK C;  4KHA A;  2YFV B;  2NZD A;  1U35 D;  1KX3 A;  1M1A A;  4AWL B;  4ZBJ C;  4QLC B;  1U35 A;  4XZQ B;  1P3K C;  3KXB D;  3O62 B;  3R45 A;  4QLC C;  5GSU B;  4XZQ C;  1KX3 B;  3W97 D;  3LEL B;  3O62 C;  3MNN A;  4H9R B;  2FJ7 B;  5GSU C;  3KXB A;  1H3O B;  5CPJ D;  3AZM D;  3LEL C;  1P3F C;  2FJ7 C;  3W97 A;  5F99 D;  5B32 B;  3X1V D;  3VH5 W;  1WWS A;  3MNN B;  3AZM A;  3AV2 B;  3B0D B;  5CPJ A;  1P3P A;  3X1S D;  5F99 A;  5CHL B;  5B32 C;  5GT0 B;  4KUD B;  1KX5 D;  5B2J D;  1S32 D;  3AV2 C;  3X1V A;  3B0D C;  1KX4 D;  5GT0 C;  4J8U D;  4KUD C;  1A7W A;  3KUY B;  2NQB C;  3B0C W;  5B0Y D;  1KX5 A;  5B2J A;  1S32 A;  1P3A A;  3KUY C;  1P3P B;  3AZI D;  5C3I C;  5BS7 A;  3X1U D;  5B0Y A;  4H9P A;  3X1T D;  3AZI A;  5AVB C;  1P3O B;  5BNV B;  1P3A B;  3X1U A;  5B33 B;  1P3O C;  3MGP D;  3REJ D;  5B33 C;  4YS3 D;  3REJ A;  1M19 B;  1M18 B;  3AZL B;  4YS3 A;  5AV9 D;  3UTA B;  1M19 C;  5AVC D;  4JJN D;  1P3B B;  1M18 C;  3REH D;  3AZL C;  3C1C B;  3UTA C;  3NQU A;  1P3B C;  1P3G B;  5CPI B;  3W96 A;  5AV6 B;  5AVC A;  4JJN A;  3C1C C;  3AZE D;  2CV5 B;  3REH A;  1P3G C;  5CPI C;  5AV6 C;  4KGC D;  2CV5 C;  3AZE A;  3WA9 D;  4NE3 A;  4J8W B;  4WZS B;  3LZ1 D;  3UTB C;  1P34 D;  4KGC A;  4Z2M H;  4XUJ D;  1P3M B;  1JFI B;  4J8W C;  5GXQ C;  3AV1 D;  3WA9 A;  3LZ1 A;  2BYK A;  5AV8 B;  1P3M C;  4LD9 A;  1Q9C A;  4XUJ A;  3MGS D;  5AV8 C;  3MGQ D;  4Z5T B;  3AV1 A;  1F66 C;  1TZY B;  1P3I D;  4Z5T C;  5DNM B;  1BH8 B;  3MGS A;  4LD9 B;  3MGQ A;  5CPK C;  4H9Q B;  3AFA B;  5DNM C;  1P3I A;  3WTP A;  3AZH B;  1AOI D;  5B2I D;  3REI D;  3AFA C;  3LZ0 A;  3AZH C;  3WAA D;  4UUZ A;  3VH5 A;  1AOI A;  3REL B;  3AZG C;  3REI A;  3NQJ B;  5BNX A;  3WTP B;  4CSR A;  2HIO B;  4CAY A;  5KDM B;  3MVD B;  3WAA A;  3REL C;  3LZ0 B;  2HIO C;  4DRA A;  3A6N D;  3MVD C;  5GT3 D;  4EO5 B;  3REK D;  3KWQ C;  5B1L A;  3A6N A;  4EO5 C;  3AZN B;  5GT3 A;  4R8P B;  3REK A;  3AZN C;  2JSS A;  2RVQ C;  4R8P C;  3AZK C;  2YFV A;  2F8N H;  5B1L B;  4QLC D;  3VH6 W;  4XZQ D;  5B1M B;  4WU8 B;  1P3K A;  5GSU D;  1KX3 D;  5B1M C;  4WU8 C;  4QLC A;  3LEL D;  4E45 A;  4XZQ A;  2FJ7 D;  3KSY A;  3O62 A;  4ZBJ B;  5GSU A;  3LEL A;  1P3K B;  1P3F A;  4H9R A;  2FJ7 A;  5B32 D;  1H3O A;  3AV2 D;  3MNN D;  5GT0 D;  4KUD D;  4H9O B;  5B32 A;  3AZF B;  1P3F B;  3AV2 A;  3KUY D;  5BT1 D;  5GT0 A;  4KUD A;  3AN2 B;  2NQB A;  3AZF C;  1P3P D;  4Z66 C;  3W98 B;  5B31 B;  3AN2 C;  3KUY A;  3W98 C;  5B31 C;  2ARO C;  1P3O D;  2NQB B;  1P3A D;  5AVB A;  5B33 D;  1N1J B;  5C3I B;  4ZUX B;  1P3O A;  4DRB A;  5BNV A;  4H9N A;  5B33 A;  1WWI A;  4ZUX C;  1M19 D;  5AVB B;  4YM6 B;  1M18 D;  3AZL D;  3UTA D;  4YM6 C;  1P3B D;  5AY8 B;  4H9N B;  1M19 A;  1M18 A;  3C1C D;  1R4V A;  3AZL A;  3UTA A;  5AY8 C;  5CPI D;  1P3G D;  3W99 B;  5AV6 D;  1P3B A;  2CV5 D;  3C1C A;  3W99 C;  1P3G A;  5CPI A;  5AV6 A;  2CV5 A;  3VH5 T;  3W96 D;  5JA4 B;  4J8W D;  2YFW B;  3UTB A;  1P3M D; 
#chains in the Genus database with same CATH topology
 3B6G B;  1TAF B;  4J8W A;  5AV8 D;  3B0C T;  5GXQ A;  3B6G C;  3X1S C;  4J8U B;  1P3M A;  1JFI A;  4Z5T D;  3UTB B;  1KX4 C;  5AV8 A;  4J8U C;  3VH6 A;  1TZY D;  1HTA A;  1F66 A;  5DNM D;  5GXQ B;  4LD9 D;  4Z5T A;  3WKJ B;  3AZI C;  3AFA D;  1TZY A;  4DQY B;  3AZH D;  5DNM A;  1BH8 A;  3WKJ C;  3X1T C;  3KFU G;  4H9Q A;  4WV4 B;  1F66 B;  4J8V B;  3AFA A;  1HQ3 B;  5G49 B;  3AZH A;  3REL D;  5CPK B;  4J8V C;  1BH9 B;  3MGP C;  3WTP D;  1HQ3 C;  2HIO D;  1PZR A;  3MVD D;  3LZ0 D;  2ZY2 A;  5AV9 B;  4J8X B;  3REL A;  3NQJ A;  5KDM A;  2HIO A;  4UPK A;  2F8N K;  3MVD A;  5AV9 C;  4J8X C;  4HGA B;  3AZG B;  3KWQ A;  4JJN C;  1F1E A;  5E5A B;  3AZN D;  2RVQ D;  4R8P D;  4HGA C;  2FFF B;  4NE6 A;  1P3L B;  5E5A C;  3AZN A;  3AZK A;  1B67 A;  4R8P A;  5B1L D;  3KWQ B;  1P3L C;  5B1M D;  4WU8 D;  4WNN B;  1P34 C;  2Y2I A;  5FUG B;  5B1M A;  4E44 A;  4WU8 A;  1EQZ B;  3AZK B;  4XUJ C;  5CP6 B;  1EQZ C;  1P3K D;  5CP6 C;  1W2E A;  5B32 G;  4G91 B;  3O62 D;  2Y2O A;  3AZJ B;  3AZF D;  4G91 C;  1P3F D;  4H9S C;  4WU9 B;  3MGR B;  1ZLA B;  3AN2 D;  4H9O A;  3AZJ C;  2Y2P A;  2F8N A;  3B6F B;  4WU9 C;  5AV5 B;  3MGR C;  1ZLA C;  2G5H C;  5B2I C;  3AZF A;  5B31 D;  3UT9 B;  3W98 D;  2LY8 A;  3TU4 B;  1Z2C B;  3AN2 A;  3B6F C;  5AV5 C;  5B24 B;  3UT9 C;  2L5A A;  3TU4 C;  3AYW B;  1ID3 B;  3W98 A;  5B31 A;  5B0Z B;  2ARO A;  2F8N B;  2NQB D;  3EG5 B;  5B24 C;  3AYW C;  1ID3 C;  5B0Z C;  4Z66 B;  4ZUX D;  5B40 B;  3C1B B;  2W8S A;  5DNN B;  3V9R B;  2ARO B;  5B40 C;  1N1J A;  3C1B C;  5AVB D;  5JRG B;  4YM6 D;  5DNN C;  4ZUX A;  2PYO B;  3VH6 T;  2ZY5 A;  3LJA B;  5BO0 B;  5JRG C;  2BYM B;  5AY8 D;  2PYO C;  4X23 B;  4YM6 A;  3LJA C;  4KHA B;  4AWL C;  2RIQ A;  3W99 D;  2NZD B;  4X23 C;  3H0R C;  5AY8 A;  1M1A B;  2NZD C;  4NFT A;  3W99 A;  1KX3 C;  1U35 B;  1M1A C;  3R45 B;  1U35 C;  3B6G D;  3KXB B;  5JA4 A;  3MNN C;  3W97 B;  1AOI B;  2YFW A;  2IO5 B;  3KXB C;  3EPL A;  3B6G A;  1TAF A;  3X1S A;  3UTB D;  5CPJ B;  3W97 C;  3AZM B;  2IO5 C;  5F99 B;  5BT1 C;  1KX4 A;  4J8U A;  3X1V B;  5GXQ D;  3AZM C;  5CPJ C;  1P3P C;  2ZY3 A;  5F99 C;  3WKJ D;  3X1S B;  3X1V C;  1KX5 B;  2CWE A;  5B2J B;  1S32 B;  2G5I C;  1KX4 B;  1F66 D;  3WKJ A;  4J8V D;  3X1T A;  5B2J C;  1KX5 C;  1S32 C;  1HQ3 D;  1P3A C;  4Z2M G;  5B0Y B;  4H9P B;  5CPK D;  5BS7 C;  3AZI B;  5B0Y C;  4J8V A;  3MGP A;  3X1U B;  1HQ3 A;  5G49 A;  1B6W A;  3X1T B;  4J8X D;  5CPK A;  1BH9 A;  3X1U C;  2Y2K A;  3AZG D;  5AV9 A;  3MGP B;  4J8X A;  3REJ B;  5E5A D;  2JCH A;  4YS3 B;  3B0B A;  3REJ C;  1P3L D;  3AZG A;  4YS3 C;  5E5A A;  3WTP E;  3NQU B;  3KWQ D;  3W96 B;  5AVC B;  1P3L A;  4JJN B;  3REH B;  2Y2M A;  3W96 C;  5AVC C;  3REH C;  1EQZ D;  3AZE B;  3AZK D;  4WNN A;  3A1I A;  1P34 A;  2Y2L A;  5CP6 D;  4KGC B;  3AZE C;  5FUG A;  1EQZ A;  4KGC C;  3WA9 B;  5CP6 A;  2BYK B;  3LZ1 B;  1P34 B;  1ULY A;  1TZY C;  4XUJ B;  2Y2N A;  2Y2Q A;  3WA9 C;  3LZ1 C;  3AZJ D;  4LD9 C;  3AV1 B;  4WU9 D;  1ZLA D;  3MGR D;  2F8N G;  2Y2H A;  2ZY4 A;  4H9S A;  3AV1 C;  3MGS B;  3A1K A;  3B6F D;  5AV5 D;  3MGQ B;  3AZJ A;  3UT9 D;  1KU5 A;  4WU9 A;  1ZLA A;  3MGR A;  3TU4 D;  5B2I A;  3MGS C;  1P3I B;  3MGQ C;  5B31 G;  5B24 D;  3B6F A;  5AV5 A;  3AYW D;  3EPJ A;  3EPK A;  1ID3 D;  5B0Z D;  3UT9 A;  1BFM A;  1P3I C;  2F8N D;  3WTP C;  2HUE B;  3TU4 A;  3LZ0 C;  4UUZ B;  5B24 A;  5B2I B;  4Z66 D;  3AYW A;  1ID3 A;  2HUE C;  3REI B;  5BNX B;  4CSR B;  5B0Z A;  5B40 D;  4CAY B;  3C1B D;  5DNN D;  1AOI C;  2VQR A;  3WAA B;  3REI C;  2ARO D;  4Z66 A;  5JRG D;  4G92 B;  2PYO D;  5B40 A;  3WAA C;  3C1B A;  5DNN A;  3V9R A;  3LJA D;  4G92 C;  4X23 D;  5JRG A;  3A6N B;  4NE5 A;  2PYO A;  5GT3 B;  3LJA A;  3REK B;  2NZD D;  5BO0 A;  5B1L C;  3A6N C;  2BYM A;  2J8P A;  4M6B A;  4X23 A;  1M1A D;  5GT3 C;  3REK C;  4KHA A;  2YFV B;  2NZD A;  1U35 D;  1KX3 A;  1M1A A;  4AWL B;  4ZBJ C;  4QLC B;  1U35 A;  4XZQ B;  1P3K C;  3KXB D;  3O62 B;  3R45 A;  4QLC C;  5GSU B;  4XZQ C;  1KX3 B;  3W97 D;  3LEL B;  3O62 C;  3MNN A;  4H9R B;  2FJ7 B;  5GSU C;  3KXB A;  1H3O B;  5CPJ D;  3AZM D;  3LEL C;  1P3F C;  2FJ7 C;  3W97 A;  5F99 D;  5B32 B;  3X1V D;  3VH5 W;  1WWS A;  3MNN B;  3AZM A;  3AV2 B;  3B0D B;  5CPJ A;  1P3P A;  5GT0 B;  5B32 C;  5CHL B;  5F99 A;  3X1S D;  4KUD B;  1KX5 D;  5B2J D;  1S32 D;  3AV2 C;  3X1V A;  3B0D C;  1KX4 D;  5GT0 C;  4J8U D;  4KUD C;  1A7W A;  3KUY B;  2NQB C;  3B0C W;  5B0Y D;  1KX5 A;  5B2J A;  1S32 A;  1P3A A;  3KUY C;  1P3P B;  3AZI D;  5C3I C;  5BS7 A;  3X1U D;  5B0Y A;  4H9P A;  3X1T D;  3AZI A;  5AVB C;  1P3O B;  5BNV B;  1P3A B;  3X1U A;  2DF4 C;  5B33 B;  1P3O C;  3MGP D;  3REJ D;  3AL0 C;  5B33 C;  4YS3 D;  3FDD A;  3REJ A;  1M19 B;  1M18 B;  3AZL B;  4YS3 A;  5AV9 D;  3UTA B;  1M19 C;  5AVC D;  4JJN D;  1P3B B;  1M18 C;  3REH D;  3EPH A;  3AZL C;  3C1C B;  3UTA C;  3NQU A;  1P3B C;  1P3G B;  5CPI B;  3W96 A;  5AV6 B;  5AVC A;  4JJN A;  3C1C C;  3AZE D;  2CV5 B;  3REH A;  1P3G C;  5CPI C;  5AV6 C;  4KGC D;  2CV5 C;  3F6T A;  3AZE A;  3WA9 D;  4NE3 A;  4J8W B;  4WZS B;  3LZ1 D;  3UTB C;  1P34 D;  4KGC A;  4Z2M H;  4XUJ D;  1P3M B;  1JFI B;  4J8W C;  5GXQ C;  3AV1 D;  3WA9 A;  3LZ1 A;  2BYK A;  5AV8 B;  2Y2G A;  1P3M C;  4LD9 A;  1Q9C A;  4XUJ A;  3MGS D;  3H0M C;  5AV8 C;  3MGQ D;  4Z5T B;  3AV1 A;  1F66 C;  3P5J B;  1TZY B;  1P3I D;  4Z5T C;  5DNM B;  1BH8 B;  3MGS A;  4LD9 B;  3MGQ A;  5CPK C;  4H9Q B;  3AFA B;  5DNM C;  2JE5 A;  1P3I A;  3WTP A;  3H0L C;  3AZH B;  1AOI D;  5B2I D;  3REI D;  3AFA C;  3LZ0 A;  3AZH C;  3WAA D;  4UUZ A;  3VH5 A;  1AOI A;  3REL B;  3AZG C;  3REI A;  3NQJ B;  5BNX A;  3WTP B;  4CSR A;  2HIO B;  4CAY A;  5KDM B;  3MVD B;  3WAA A;  3REL C;  3LZ0 B;  3IP4 C;  4WJ3 C;  2HIO C;  4DRA A;  3A6N D;  3MVD C;  5GT3 D;  4EO5 B;  3REK D;  3KWQ C;  5B1L A;  3A6N A;  4EO5 C;  3AZN B;  5GT3 A;  4R8P B;  3REK A;  3AZN C;  2JSS A;  2ZM5 A;  2RVQ C;  4R8P C;  2F2A C;  3AZK C;  2YFV A;  2DQN C;  2F8N H;  2BG1 A;  5B1L B;  3VH6 W;  4QLC D;  4XZQ D;  5B1M B;  4WU8 B;  1P3K A;  5GSU D;  1KX3 D;  5B1M C;  4WU8 C;  4QLC A;  3LEL D;  4E45 A;  4XZQ A;  2FJ7 D;  3KSY A;  2XD5 A;  3O62 A;  4ZBJ B;  5GSU A;  3LEL A;  1P3K B;  1P3F A;  4H9R A;  2FJ7 A;  5B32 D;  1H3O A;  3AV2 D;  3MNN D;  1T3U A;  5GT0 D;  4KUD D;  4H9O B;  5B32 A;  3AZF B;  1P3F B;  3AV2 A;  3KUY D;  5BT1 D;  5GT0 A;  4KUD A;  3AN2 B;  2NQB A;  3AZF C;  1P3P D;  4Z66 C;  3W98 B;  5B31 B;  3AN2 C;  3KUY A;  3W98 C;  5B31 C;  2ARO C;  1P3O D;  2NQB B;  1P3A D;  5AVB A;  5B33 D;  1N1J B;  5C3I B;  4ZUX B;  1P3O A;  4DRB A;  5BNV A;  4H9N A;  5B33 A;  1WWI A;  4ZUX C;  1M19 D;  5AVB B;  4YM6 B;  1M18 D;  3AZL D;  2UWX A;  3UTA D;  4YM6 C;  1P3B D;  5AY8 B;  4H9N B;  1M19 A;  1M18 A;  3C1C D;  1R4V A;  3AZL A;  3UTA A;  2Y2J A;  5AY8 C;  5CPI D;  1P3G D;  5AV6 D;  3W99 B;  1P3B A;  2CV5 D;  3C1C A;  3W99 C;  1P3G A;  5CPI A;  5AV6 A;  2CV5 A;  3VH5 T;  3W96 D;  2XD1 A;  5JA4 B;  4J8W D;  2YFW B;  3UTB A;  1P3M D; 
#chains in the Genus database with same CATH homology
 3B6G B;  1TAF B;  4J8W A;  5AV8 D;  3B0C T;  5GXQ A;  3B6G C;  3X1S C;  4J8U B;  1P3M A;  1JFI A;  4Z5T D;  3UTB B;  1KX4 C;  5AV8 A;  4J8U C;  3VH6 A;  1TZY D;  1HTA A;  1F66 A;  5DNM D;  5GXQ B;  4LD9 D;  4Z5T A;  3WKJ B;  3AZI C;  3AFA D;  1TZY A;  4DQY B;  3AZH D;  5DNM A;  1BH8 A;  3WKJ C;  3X1T C;  3KFU G;  4H9Q A;  4WV4 B;  1F66 B;  4J8V B;  3AFA A;  1HQ3 B;  5G49 B;  3AZH A;  3REL D;  5CPK B;  4J8V C;  1BH9 B;  3MGP C;  3WTP D;  1HQ3 C;  2HIO D;  1PZR A;  3MVD D;  3LZ0 D;  2ZY2 A;  5AV9 B;  4J8X B;  3REL A;  3NQJ A;  5KDM A;  2HIO A;  4UPK A;  2F8N K;  3MVD A;  5AV9 C;  4J8X C;  4HGA B;  3AZG B;  3KWQ A;  4JJN C;  1F1E A;  5E5A B;  3AZN D;  2RVQ D;  4R8P D;  4HGA C;  2FFF B;  4NE6 A;  1P3L B;  5E5A C;  3AZN A;  3AZK A;  1B67 A;  4R8P A;  5B1L D;  3KWQ B;  1P3L C;  5B1M D;  4WU8 D;  4WNN B;  1P34 C;  2Y2I A;  5FUG B;  5B1M A;  4E44 A;  4WU8 A;  1EQZ B;  3AZK B;  4XUJ C;  5CP6 B;  1EQZ C;  1P3K D;  5CP6 C;  1W2E A;  5B32 G;  4G91 B;  3O62 D;  2Y2O A;  3AZJ B;  3AZF D;  4G91 C;  1P3F D;  4H9S C;  4WU9 B;  3MGR B;  1ZLA B;  3AN2 D;  4H9O A;  3AZJ C;  2Y2P A;  2F8N A;  3B6F B;  4WU9 C;  5AV5 B;  3MGR C;  1ZLA C;  2G5H C;  5B2I C;  3AZF A;  5B31 D;  3UT9 B;  3W98 D;  2LY8 A;  3TU4 B;  1Z2C B;  3AN2 A;  3B6F C;  5AV5 C;  5B24 B;  3UT9 C;  2L5A A;  3TU4 C;  3AYW B;  1ID3 B;  3W98 A;  5B31 A;  5B0Z B;  2ARO A;  2F8N B;  2NQB D;  3EG5 B;  5B24 C;  3AYW C;  1ID3 C;  5B0Z C;  4Z66 B;  4ZUX D;  5B40 B;  3C1B B;  2W8S A;  5DNN B;  3V9R B;  2ARO B;  5B40 C;  1N1J A;  3C1B C;  5AVB D;  5JRG B;  4YM6 D;  5DNN C;  4ZUX A;  2PYO B;  3VH6 T;  2ZY5 A;  3LJA B;  5BO0 B;  5JRG C;  2BYM B;  5AY8 D;  2PYO C;  4X23 B;  4YM6 A;  3LJA C;  4KHA B;  4AWL C;  2RIQ A;  3W99 D;  2NZD B;  4X23 C;  3H0R C;  5AY8 A;  1M1A B;  2NZD C;  4NFT A;  3W99 A;  1KX3 C;  1U35 B;  1M1A C;  3R45 B;  1U35 C;  3B6G D;  3KXB B;  5JA4 A;  3MNN C;  3W97 B;  1AOI B;  2YFW A;  2IO5 B;  3KXB C;  3EPL A;  3B6G A;  1TAF A;  3X1S A;  3UTB D;  5CPJ B;  3W97 C;  3AZM B;  2IO5 C;  5F99 B;  5BT1 C;  1KX4 A;  4J8U A;  3X1V B;  5GXQ D;  3AZM C;  5CPJ C;  1P3P C;  2ZY3 A;  5F99 C;  3WKJ D;  3X1S B;  3X1V C;  1KX5 B;  2CWE A;  5B2J B;  1S32 B;  2G5I C;  1KX4 B;  1F66 D;  3WKJ A;  4J8V D;  3X1T A;  5B2J C;  1KX5 C;  1S32 C;  1HQ3 D;  1P3A C;  4Z2M G;  5B0Y B;  4H9P B;  5CPK D;  5BS7 C;  3AZI B;  5B0Y C;  4J8V A;  3MGP A;  3X1U B;  1HQ3 A;  5G49 A;  1B6W A;  3X1T B;  4J8X D;  5CPK A;  1BH9 A;  3X1U C;  2Y2K A;  3AZG D;  5AV9 A;  3MGP B;  4J8X A;  3REJ B;  5E5A D;  2JCH A;  4YS3 B;  3B0B A;  3REJ C;  1P3L D;  3AZG A;  4YS3 C;  5E5A A;  3WTP E;  3NQU B;  3KWQ D;  3W96 B;  5AVC B;  1P3L A;  4JJN B;  3REH B;  2Y2M A;  3W96 C;  5AVC C;  3REH C;  1EQZ D;  3AZE B;  3AZK D;  4WNN A;  3A1I A;  1P34 A;  2Y2L A;  5CP6 D;  4KGC B;  3AZE C;  5FUG A;  1EQZ A;  4KGC C;  3WA9 B;  5CP6 A;  2BYK B;  3LZ1 B;  1P34 B;  1ULY A;  1TZY C;  4XUJ B;  2Y2N A;  2Y2Q A;  3WA9 C;  3LZ1 C;  3AZJ D;  4LD9 C;  3AV1 B;  4WU9 D;  1ZLA D;  3MGR D;  2F8N G;  2Y2H A;  2ZY4 A;  4H9S A;  3AV1 C;  3MGS B;  3A1K A;  3B6F D;  5AV5 D;  3MGQ B;  3AZJ A;  3UT9 D;  1KU5 A;  4WU9 A;  1ZLA A;  3MGR A;  3TU4 D;  5B2I A;  3MGS C;  1P3I B;  3MGQ C;  5B31 G;  5B24 D;  3B6F A;  5AV5 A;  3AYW D;  3EPJ A;  3EPK A;  1ID3 D;  5B0Z D;  3UT9 A;  1BFM A;  1P3I C;  2F8N D;  3WTP C;  2HUE B;  3TU4 A;  3LZ0 C;  4UUZ B;  5B24 A;  5B2I B;  4Z66 D;  3AYW A;  1ID3 A;  2HUE C;  3REI B;  5BNX B;  4CSR B;  5B0Z A;  5B40 D;  4CAY B;  3C1B D;  5DNN D;  1AOI C;  2VQR A;  3WAA B;  3REI C;  2ARO D;  4Z66 A;  5JRG D;  4G92 B;  2PYO D;  5B40 A;  3WAA C;  3C1B A;  5DNN A;  3V9R A;  3LJA D;  4G92 C;  4X23 D;  5JRG A;  3A6N B;  4NE5 A;  2PYO A;  5GT3 B;  3LJA A;  3REK B;  2NZD D;  5BO0 A;  5B1L C;  3A6N C;  2BYM A;  2J8P A;  4M6B A;  4X23 A;  1M1A D;  5GT3 C;  3REK C;  4KHA A;  2YFV B;  2NZD A;  1U35 D;  1KX3 A;  1M1A A;  4AWL B;  4ZBJ C;  4QLC B;  1U35 A;  4XZQ B;  1P3K C;  3KXB D;  3O62 B;  3R45 A;  4QLC C;  5GSU B;  4XZQ C;  1KX3 B;  3W97 D;  3LEL B;  3O62 C;  3MNN A;  4H9R B;  2FJ7 B;  5GSU C;  3KXB A;  1H3O B;  5CPJ D;  3AZM D;  3LEL C;  1P3F C;  2FJ7 C;  3W97 A;  5F99 D;  5B32 B;  3X1V D;  3VH5 W;  1WWS A;  3MNN B;  3AZM A;  3AV2 B;  3B0D B;  5CPJ A;  1P3P A;  5GT0 B;  5B32 C;  5CHL B;  5F99 A;  3X1S D;  4KUD B;  1KX5 D;  5B2J D;  1S32 D;  3AV2 C;  3X1V A;  3B0D C;  1KX4 D;  5GT0 C;  4J8U D;  4KUD C;  1A7W A;  3KUY B;  2NQB C;  3B0C W;  5B0Y D;  1KX5 A;  5B2J A;  1S32 A;  1P3A A;  3KUY C;  1P3P B;  3AZI D;  5C3I C;  5BS7 A;  3X1U D;  5B0Y A;  4H9P A;  3X1T D;  3AZI A;  5AVB C;  1P3O B;  5BNV B;  1P3A B;  3X1U A;  2DF4 C;  5B33 B;  1P3O C;  3MGP D;  3REJ D;  3AL0 C;  5B33 C;  4YS3 D;  3FDD A;  3REJ A;  1M19 B;  1M18 B;  3AZL B;  4YS3 A;  5AV9 D;  3UTA B;  1M19 C;  5AVC D;  4JJN D;  1P3B B;  1M18 C;  3REH D;  3EPH A;  3AZL C;  3C1C B;  3UTA C;  3NQU A;  1P3B C;  1P3G B;  5CPI B;  3W96 A;  5AV6 B;  5AVC A;  4JJN A;  3C1C C;  3AZE D;  2CV5 B;  3REH A;  1P3G C;  5CPI C;  5AV6 C;  4KGC D;  2CV5 C;  3F6T A;  3AZE A;  3WA9 D;  4NE3 A;  4J8W B;  4WZS B;  3LZ1 D;  3UTB C;  1P34 D;  4KGC A;  4Z2M H;  4XUJ D;  1P3M B;  1JFI B;  4J8W C;  5GXQ C;  3AV1 D;  3WA9 A;  3LZ1 A;  2BYK A;  5AV8 B;  2Y2G A;  1P3M C;  4LD9 A;  1Q9C A;  4XUJ A;  3MGS D;  3H0M C;  5AV8 C;  3MGQ D;  4Z5T B;  3AV1 A;  1F66 C;  3P5J B;  1TZY B;  1P3I D;  4Z5T C;  5DNM B;  1BH8 B;  3MGS A;  4LD9 B;  3MGQ A;  5CPK C;  4H9Q B;  3AFA B;  5DNM C;  2JE5 A;  1P3I A;  3WTP A;  3H0L C;  3AZH B;  1AOI D;  5B2I D;  3REI D;  3AFA C;  3LZ0 A;  3AZH C;  3WAA D;  4UUZ A;  3VH5 A;  1AOI A;  3REL B;  3AZG C;  3REI A;  3NQJ B;  5BNX A;  3WTP B;  4CSR A;  2HIO B;  4CAY A;  5KDM B;  3MVD B;  3WAA A;  3REL C;  3LZ0 B;  3IP4 C;  4WJ3 C;  2HIO C;  4DRA A;  3A6N D;  3MVD C;  5GT3 D;  4EO5 B;  3REK D;  3KWQ C;  5B1L A;  3A6N A;  4EO5 C;  3AZN B;  5GT3 A;  4R8P B;  3REK A;  3AZN C;  2JSS A;  2ZM5 A;  2RVQ C;  4R8P C;  2F2A C;  3AZK C;  2YFV A;  2DQN C;  2F8N H;  2BG1 A;  5B1L B;  3VH6 W;  4QLC D;  4XZQ D;  5B1M B;  4WU8 B;  1P3K A;  5GSU D;  1KX3 D;  5B1M C;  4WU8 C;  4QLC A;  3LEL D;  4E45 A;  4XZQ A;  2FJ7 D;  3KSY A;  2XD5 A;  3O62 A;  4ZBJ B;  5GSU A;  3LEL A;  1P3K B;  1P3F A;  4H9R A;  2FJ7 A;  5B32 D;  1H3O A;  3AV2 D;  3MNN D;  1T3U A;  5GT0 D;  4KUD D;  4H9O B;  5B32 A;  3AZF B;  1P3F B;  3AV2 A;  3KUY D;  5BT1 D;  5GT0 A;  4KUD A;  3AN2 B;  2NQB A;  3AZF C;  1P3P D;  4Z66 C;  3W98 B;  5B31 B;  3AN2 C;  3KUY A;  3W98 C;  5B31 C;  2ARO C;  1P3O D;  2NQB B;  1P3A D;  5AVB A;  5B33 D;  1N1J B;  5C3I B;  4ZUX B;  1P3O A;  4DRB A;  5BNV A;  4H9N A;  5B33 A;  1WWI A;  4ZUX C;  1M19 D;  5AVB B;  4YM6 B;  1M18 D;  3AZL D;  2UWX A;  3UTA D;  4YM6 C;  1P3B D;  5AY8 B;  4H9N B;  1M19 A;  1M18 A;  3C1C D;  1R4V A;  3AZL A;  3UTA A;  2Y2J A;  5AY8 C;  5CPI D;  1P3G D;  5AV6 D;  3W99 B;  1P3B A;  2CV5 D;  3C1C A;  3W99 C;  1P3G A;  5CPI A;  5AV6 A;  2CV5 A;  3VH5 T;  3W96 D;  2XD1 A;  5JA4 B;  4J8W D;  2YFW B;  3UTB A;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...