4XZQC

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqC00
5AVCA 3AZNB 1S32B 3WTPD 2NZDA 5BNVA 5GXQC 3V9RA 2HIOC 5AVCB 2NZDB 4LD9A 5BNVB 3V9RB 3O62D 3KSYA 5AV8C 4LD9B 3AYWC 1P3AD 3B6GD 1B67A 4ZUXA 1M1AC 3AV2A 3UTBC 4E45A 4Z66D 5KDMA 3AFAD 4ZUXB 3W96D 4J8WD 3AV2B 1KX4C 5B33A 4J8UA 5KDMB 5B2JA 5B33B 4J8UB 3X1SC 1EQZA 1P34C 5B2JB 3WAAD 2PYOA 4J8XD 1U35C 1EQZB 1P3OA 3LZ1D 1F1EA 1KX5A 2PYOB 1A7WA 1ZLAD 3UTAA 1P3OB 1KX3C 3AZJA 1KX5B 5CPJC 5GT0C 3REKA 3UTAB 3B0CT 5GT3D 3AZJB 3REHD 3AZGA 5B1MA 4NE3A 3REKB 3REIC 5AV9A 3AZGB 5B1MB 2AROC 3WKJD 4XUJA 4X23A 5AV9B 1P3PD 4XUJB 4EO5B 4G92B 3W99A 3WA9C 5CP6D 1AOIA 3TU4A 5CPIA 3B6FD 3W99B 3MGPD 1AOIB 2IO5B 3TU4B 5CPIB 3MNNA 5AVBD 3A6NB 5DNMA 5B40C 3NQJA 3MNNB 5JA4A 3W98C 4QLCD 1P3LD 4JJNA 3AZMC 3VH5T 3LZ0D 5DNMB 3NQJB 5JA4B 4JJNB 1N1JA 1M19A 5CHLB 3MGSA 1P3BD 3AZIC 1N1JB 1M19B 5AY8C 2HUEC 4YM6D 3MGSB 3AZFD 3B0DC 3MGRA 1P3GA 3MGRB 5GXQA 3KXBC 3AV1C 1F66C 1R4VA 1P3GB 4R8PD 2NQBA 5B0ZA 3WTPC 5GXQB 3AZHD 2L5AA 5B24D 2NQBB 5B0ZB 5G49A 3AZKD 3AYWA 3O62C 5G49B 3LELD 3AYWB 3AN2A 1P3AC 3B6GC 3REJD 2LY8A 3KWQC 3AN2B 3LJAD 3W96C 4Z66C 3X1UC 4J8WC 4HGAC 4WNNA 2F8NK 3X1SA 4WNNB 2RVQD 3X1SB 4J8VD 4J8XC 1ID3C 1KX3A 2YFVA 5CPJA 5B1LD 1ZLAC 1KX3B 2YFVB 5CPJB 5GT3C 5E5AA 5F99D 2CV5A 5JRGA 5E5AB 5BT1C 3WKJC 2CV5B 1ULYA 5JRGB 1P3FC 3W97D 5GSUD 3MVDA 3MVDB 3B0BA 5CP6C 3B6FC 1HQ3D 1BFMA 5B31D 5AV5D 3W98A 4WU8C 3C1BD 5AVBC 3AZLD 3W98B 4QLCC 1P3LC 3UT9A 3LZ0C 3C1CD 1P3ID 1HTAA 3UT9B 3B0CW 5BS7C 1P3BC 4KUDC 5B2IA 4YM6C 2HUEB 3B0DB 3AZFC 3AZND 1P3MC 1S32D 3KXBA 5B2IB 3AV1A 1F66A 5AVCD 2NZDD 3KXBB 1M18A 3AV1B 1F66B 2FJ7C 4R8PC 3AZED 4LD9D 1M18B 5B24C 1BH8A 3AZKC 1TAFA 1BH8B 4ZUXD 1TAFB 3KWQA 3AV2D 4YS3C 5AV6A 3REJC 3X1UA 3KWQB 3VH5W 1P3KA 5B33D 3LJAC 4Z5TC 4J8UD 5AV6B 5B2JD 3X1UB 1P3KB 1EQZD 2PYOD 3RELA 2RVQC 4ZBJC 1ID3A 4J8VC 1TZYA 3MGQA 1P3OD 1KX5D 4XZQC 3VH6A 3RELB 1ID3B 3UTAD 1TZYB 3MGQB 4G91B 5B31G 3AZJD 2JSSA 4H9QA 3REKD 3AZGD 5B1MD 4H9QB 5AV9D 4WU9C 1BH9A 4H9SC 4XUJD 4X23D 3A6NA 1P3FA 1BH9B 3W97C 1P3FB 5GSUC 3W99D 2BYKA 1AOID 3TU4D 5CPID 2BYKB 5B32A 3X1TC 4H9NA 3MNND 5B31C 4WU8A 5B32B 5DNMD 5DNNC 4H9NB 5AV5C 4KGCA 3KUYA 4WU8B 3C1BC 4JJND 5CPKC 4KUDA 5B0YC 4KGCB 3KUYB 4KUDB 3X1VC 1M19D 3MGSD 2HIOA 2F8NA 3C1CC 1P3IC 2HIOB 2F8NB 1P3MA 5AV8A 3MGRD 1P3GD 1P3MB 5AV8B 3AZNC 4H9OA 4KHAA 5GXQD 1M1AA 2FJ7A 3UTBA 5AVCC 2NQBD 5B0ZD 4H9OB 4KHAB 1M1AB 2FJ7B 1KX4A 3UTBB 3AZEC 5FUGA 3AFAC 3AYWD 1KX4B 5C3IC 5FUGB 1P34A 3AN2D 1U35A 4YS3A 1P34B 3WAAC 1U35B 4YS3B 4Z5TA 1WWSA 3LZ1C 5GT0A 5B33C 4Z5TB 3X1SD 4J8UC 5GT0B 1EQZC 3REIA 3REHC 2PYOC 4XZQA 2AROA 4ZBJB 2YFWA 5BO0A 3REIB 1KX3D 1KX5C 4XZQB 5CPJD 2AROB 2YFWB 5BNXA 4Z2MH 5BO0B 1P3PC 3AZJC 3WA9A 5BNXB 4WU9A 5E5AD 5B1MC 3WA9B 4H9SA 2CV5D 5JRGD 4WU9B 3MGPC 5B32G 4NFTA 4XUJC 4EO5C 4X23C 5B40A 3MVDD 4G92C 4UUZA 3AZMA 5B40B 3W99C 4UUZB 3AZMB 3VH6T 3X1TA 2IO5C 5CPIC 3AZIA 3X1TB 5AY8A 5DNNA 3MNNC 3AZIB 3W98D 5CPKA 5DNNB 5DNMC 5AY8B 5B0YA 4DRAA 3X1VA 5CPKB 4CSRA 3UT9D 5B0YB 1WWIA 4WV4B 3WTPA 3X1VB 4CSRB 3MGSC 3WTPB 3AZHC 4CAYA 5B2ID 3O62A 3MGRC 4CAYB 4Z2MG 3KXBD 3AV1D 1F66D 3O62B 3R45A 1P3GC 1P3AA 3B6GA 3LELC 1M18D 3R45B 1P3AB 3AZEA 2NQBC 3B6GB 3W96A 5B0ZC 4Z66A 3AFAA 4J8WA 3AZEB 1Q9CA 4Z66B 3AFAB 3W96B 4J8WB 4HGAB 5C3IB 3WAAA 3KWQD 4J8XA 3AN2C 3WAAB 5AV6D 3LZ1A 3X1UD 4J8XB 1P3KD 1ZLAA 3LZ1B 1ZLAB 5B1LC 5GT3A 3REHA 3RELD 1ID3D 5GT3B 1TZYD 3MGQD 3REHB 5F99C 3WKJA 1P3PA 4H9RA 3WKJB 1P3PB 4H9RB 4AWLC 5CP6A 3B6FA 5E5AC 5BT1D 3MGPA 5CP6B 3A6ND 2CV5C 5JRGC 1P3FD 3B6FB 1HQ3C 3MGPB 5AVBA 4X23B 3MVDC 4QLCA 5AVBB 3AZLC 1P3LA 3LZ0A 4QLCB 1P3LB 5B32D 3LZ0B 5BS7A 1P3BA 4WU8D 4YM6A 4KGCD 3AZFA 3KUYD 1P3BB 4E44A 4KUDD 4NE5A 4YM6B 3AZFB 1S32C 3UT9C 2HIOD 4R8PA 2F8ND 2NZDC 3AZHA 2CWEA 4R8PB 5B24A 1P3MD 5AV8D 3AZHB 4LD9C 3AZKA 5B2IC 5B24B 3AZKB 1M1AD 3LELA 2FJ7D 3UTBD 4NE6A 2F8NH 4ZUXC 3LELB 3REJA 1M18C 3AV2C 1KX4D 3LJAA 1JFIA 4WZSB 3REJB 3VH6W 3LJAB 1P34D 1JFIB 5B2JC 3NQUA 1U35D 4YS3D 4J8VA 3NQUB 4J8VB 4Z5TD 1P3OC 5AV6C 5GT0D 1P3KC 5B1LA 3UTAC 5B1LB 3REKC 3REID 3VH5A 4XZQD 3AZGC 2AROD 5F99A 3RELC 1TZYC 5AV9C 3MGQC 4G91C 5F99B 3W97A 5GSUA 4M6BA 3WA9D 3W97B 5GSUB 2BYMA 4WU9D 4AWLB 1AOIC 3TU4C 2BYMB 1HQ3A 5B31A 3A6NC 4DRBA 5AV5A 2F8NG 1H3OA 5B40D 1HQ3B 5B31B 3C1BA 1KU5A 3AZMD 5AV5B 4H9PA 3AZLA 1H3OB 3C1BB 4JJNC 3AZLB 4H9PB 3X1TD 3C1CA 1B6WA 3AZID 1P3IA 5B32C 1M19C 5AY8D 5DNND 3C1CB 1P3IB 5CPKD 5B0YD 4KGCC 3KUYC 3AZNA 1S32A 3X1VD 3WTPE
chains in the Genus database with same CATH superfamily
5AVCA 3AZNB 1S32B 3WTPD 2NZDA 5BNVA 2Y2QA 5GXQC 3V9RA 2HIOC 5AVCB 2NZDB 4LD9A 5BNVB 3V9RB 3O62D 3KSYA 5AV8C 4LD9B 3AYWC 2ZY5A 1P3AD 3B6GD 1B67A 4ZUXA 1M1AC 3AV2A 3UTBC 4E45A 4Z66D 5KDMA 3AFAD 4ZUXB 3W96D 4J8WD 3AV2B 1KX4C 5B33A 4J8UA 3H0MC 5KDMB 5B2JA 5B33B 4J8UB 3X1SC 1EQZA 1P34C 5B2JB 3WAAD 2PYOA 4J8XD 1U35C 1EQZB 1P3OA 3LZ1D 1F1EA 1KX5A 3EPKA 2PYOB 1A7WA 1ZLAD 3UTAA 1P3OB 1KX3C 3AZJA 1KX5B 5CPJC 5GT0C 3REKA 3UTAB 3B0CT 5GT3D 2Y2HA 3AZJB 3REHD 3AZGA 5B1MA 4NE3A 3REKB 3REIC 5AV9A 3AZGB 5B1MB 2AROC 3WKJD 4XUJA 4X23A 5AV9B 1P3PD 4XUJB 4EO5B 2DF4C 4G92B 3W99A 3WA9C 5CP6D 1AOIA 3TU4A 5CPIA 3B6FD 3W99B 3MGPD 1AOIB 2IO5B 3TU4B 5CPIB 3MNNA 5AVBD 3A6NB 5DNMA 5B40C 3NQJA 3MNNB 5JA4A 3W98C 4QLCD 1P3LD 4JJNA 3AZMC 3VH5T 3LZ0D 5DNMB 3NQJB 5JA4B 4JJNB 1N1JA 1M19A 5CHLB 2ZY4A 3MGSA 1P3BD 3AZIC 1N1JB 1M19B 5AY8C 2HUEC 4YM6D 3MGSB 3AZFD 3B0DC 3MGRA 1P3GA 3MGRB 5GXQA 3KXBC 3AV1C 1F66C 1R4VA 1P3GB 4R8PD 2NQBA 5B0ZA 3WTPC 5GXQB 3AZHD 3P5JB 2L5AA 5B24D 2NQBB 5B0ZB 5G49A 3AZKD 3AYWA 3O62C 5G49B 3LELD 3AYWB 3AN2A 1P3AC 3B6GC 3REJD 2LY8A 3KWQC 3AN2B 3LJAD 3W96C 4Z66C 3X1UC 4J8WC 4HGAC 4WNNA 2F8NK 3X1SA 2Y2OA 4WNNB 2RVQD 3X1SB 4J8VD 4J8XC 1ID3C 1KX3A 2YFVA 5CPJA 2Y2NA 2Y2LA 5B1LD 1ZLAC 1KX3B 2YFVB 5CPJB 4DQYB 5GT3C 5E5AA 5F99D 2CV5A 2Y2PA 5JRGA 5E5AB 5BT1C 3WKJC 2CV5B 1ULYA 5JRGB 1P3FC 3W97D 5GSUD 3MVDA 3MVDB 3B0BA 5CP6C 3B6FC 1HQ3D 1BFMA 5B31D 5AV5D 3W98A 4WU8C 3C1BD 5AVBC 3AZLD 3W98B 1PZRA 4QLCC 1P3LC 3UT9A 3LZ0C 3C1CD 1P3ID 1HTAA 3UT9B 3B0CW 5BS7C 1P3BC 4KUDC 5B2IA 2HUEB 4YM6C 3B0DB 3AZFC 3AZND 1P3MC 1S32D 3KXBA 5B2IB 3AV1A 1F66A 5AVCD 2NZDD 3KXBB 1M18A 3AV1B 1F66B 2FJ7C 4UPKA 4R8PC 3EPLA 3AZED 4LD9D 1M18B 2JCHA 3EPHA 5B24C 1BH8A 4WJ3C 3AZKC 1TAFA 1BH8B 4ZUXD 1TAFB 3KWQA 3AV2D 4YS3C 1T3UA 5AV6A 3REJC 3X1UA 3KWQB 3VH5W 1P3KA 5B33D 3LJAC 4Z5TC 4J8UD 5AV6B 5B2JD 3X1UB 2RIQA 1P3KB 2JE5A 1EQZD 2PYOD 3RELA 2RVQC 4ZBJC 1ID3A 4J8VC 1TZYA 3MGQA 1P3OD 1KX5D 4XZQC 3VH6A 3RELB 1ID3B 3UTAD 1TZYB 3MGQB 4G91B 5B31G 3AZJD 2JSSA 2XD1A 4H9QA 3REKD 2Y2JA 3AZGD 5B1MD 4H9QB 5AV9D 4WU9C 1BH9A 4H9SC 4XUJD 4X23D 3A6NA 1P3FA 1BH9B 3W97C 1P3FB 5GSUC 3W99D 2BYKA 1AOID 3TU4D 5CPID 2BYKB 5B32A 3X1TC 4H9NA 3MNND 5B31C 4WU8A 5B32B 5DNMD 5DNNC 4H9NB 5AV5C 4KGCA 3KUYA 4WU8B 3C1BC 4JJND 5CPKC 4KUDA 5B0YC 4KGCB 3KUYB 2Y2GA 4KUDB 3X1VC 1M19D 3MGSD 2HIOA 2F8NA 3C1CC 1P3IC 2HIOB 2F8NB 1P3MA 5AV8A 3MGRD 1P3GD 1P3MB 5AV8B 3AZNC 4H9OA 4KHAA 5GXQD 2G5HC 1M1AA 2FJ7A 3UTBA 5AVCC 2NQBD 5B0ZD 4H9OB 4KHAB 1M1AB 2FJ7B 1W2EA 1KX4A 3UTBB 3AZEC 5FUGA 3AFAC 3AYWD 1KX4B 5C3IC 5FUGB 1P34A 3AN2D 1U35A 4YS3A 2UWXA 1P34B 3WAAC 1U35B 2J8PA 4YS3B 2XD5A 4Z5TA 1WWSA 3LZ1C 5GT0A 5B33C 4Z5TB 3X1SD 4J8UC 5GT0B 1EQZC 3REIA 3REHC 2PYOC 4XZQA 2AROA 4ZBJB 2F2AC 2YFWA 5BO0A 3REIB 1KX3D 1KX5C 4XZQB 5CPJD 2AROB 2Y2MA 3FDDA 2YFWB 5BNXA 4Z2MH 5BO0B 3EPJA 1P3PC 3AZJC 3WA9A 5BNXB 4WU9A 5E5AD 5B1MC 3WA9B 4H9SA 2CV5D 5JRGD 4WU9B 3MGPC 5B32G 4NFTA 4XUJC 4EO5C 4X23C 5B40A 3MVDD 4G92C 4UUZA 3AZMA 5B40B 3W99C 4UUZB 3AZMB 3VH6T 3X1TA 2IO5C 5CPIC 3AZIA 3X1TB 5AY8A 5DNNA 3MNNC 3AZIB 3W98D 5CPKA 5DNNB 5DNMC 5AY8B 5B0YA 1Z2CB 4DRAA 3X1VA 5CPKB 4CSRA 3UT9D 5B0YB 1WWIA 4WV4B 3WTPA 3X1VB 4CSRB 3MGSC 3WTPB 3AZHC 4CAYA 5B2ID 3O62A 3EG5B 3MGRC 4CAYB 4Z2MG 3KXBD 3AV1D 2DQNC 3O62B 3R45A 1P3GC 1P3AA 1F66D 3B6GA 3LELC 1M18D 3R45B 1P3AB 3AZEA 2NQBC 3B6GB 3W96A 5B0ZC 4Z66A 3AFAA 4J8WA 3AZEB 1Q9CA 4Z66B 3AFAB 2FFFB 3W96B 4J8WB 4HGAB 5C3IB 3WAAA 3KWQD 4J8XA 3AN2C 3WAAB 2Y2KA 5AV6D 3LZ1A 3X1UD 4J8XB 1P3KD 1ZLAA 3LZ1B 1ZLAB 5B1LC 5GT3A 3REHA 3RELD 3H0LC 5GT3B 1TZYD 3MGQD 1ID3D 3REHB 5F99C 3WKJA 1P3PA 4H9RA 3WKJB 1P3PB 4H9RB 4AWLC 5CP6A 3B6FA 5E5AC 5BT1D 3MGPA 5CP6B 3A6ND 2CV5C 5JRGC 1P3FD 3B6FB 1HQ3C 3MGPB 2ZY2A 5AVBA 4X23B 3MVDC 3F6TA 4QLCA 5AVBB 3AZLC 1P3LA 3KFUG 3LZ0A 4QLCB 1P3LB 5B32D 3LZ0B 5BS7A 1P3BA 4WU8D 4YM6A 4KGCD 3AZFA 3KUYD 1P3BB 4E44A 4KUDD 4NE5A 4YM6B 3AZFB 2ZY3A 1S32C 3UT9C 2HIOD 4R8PA 2F8ND 2BG1A 2NZDC 3AZHA 2VQRA 2CWEA 4R8PB 5B24A 1P3MD 5AV8D 3AZHB 4LD9C 3AZKA 3IP4C 5B2IC 5B24B 3AZKB 1M1AD 3LELA 2FJ7D 2W8SA 3UTBD 4NE6A 2F8NH 4ZUXC 3LELB 3REJA 1M18C 3AV2C 1KX4D 3LJAA 1JFIA 4WZSB 3REJB 3VH6W 3LJAB 1P34D 1JFIB 5B2JC 3NQUA 2G5IC 3AL0C 1U35D 4YS3D 4J8VA 3NQUB 2Y2IA 4J8VB 4Z5TD 1P3OC 5AV6C 5GT0D 1P3KC 5B1LA 3UTAC 5B1LB 3A1KA 3REKC 2ZM5A 3REID 3VH5A 4XZQD 3AZGC 2AROD 5F99A 3RELC 1TZYC 5AV9C 3MGQC 4G91C 5F99B 3W97A 5GSUA 4M6BA 3WA9D 3H0RC 3W97B 5GSUB 2BYMA 4WU9D 4AWLB 1AOIC 3TU4C 2BYMB 1HQ3A 5B31A 3A6NC 4DRBA 5AV5A 2F8NG 1H3OA 5B40D 1HQ3B 5B31B 3C1BA 1KU5A 3AZMD 5AV5B 4H9PA 3AZLA 1H3OB 3C1BB 4JJNC 3AZLB 4H9PB 3X1TD 3C1CA 1B6WA 3AZID 3A1IA 1P3IA 5B32C 1M19C 5AY8D 5DNND 3C1CB 1P3IB 5CPKD 5B0YD 4KGCC 3KUYC 3AZNA 1S32A 3X1VD 3WTPE
chains in the Genus database with same CATH topology
5AVCA 3AZNB 1S32B 3WTPD 2NZDA 5BNVA 2Y2QA 5GXQC 3V9RA 2HIOC 5AVCB 2NZDB 4LD9A 5BNVB 3V9RB 3O62D 3KSYA 5AV8C 4LD9B 3AYWC 2ZY5A 1P3AD 3B6GD 1B67A 4ZUXA 1M1AC 3AV2A 3UTBC 4E45A 4Z66D 5KDMA 3AFAD 4ZUXB 3W96D 4J8WD 3AV2B 1KX4C 5B33A 4J8UA 3H0MC 5KDMB 5B2JA 5B33B 4J8UB 3X1SC 1EQZA 1P34C 5B2JB 3WAAD 2PYOA 4J8XD 1U35C 1EQZB 1P3OA 3LZ1D 1F1EA 1KX5A 3EPKA 2PYOB 1A7WA 1ZLAD 3UTAA 1P3OB 1KX3C 3AZJA 1KX5B 5CPJC 5GT0C 3REKA 3UTAB 3B0CT 5GT3D 2Y2HA 3AZJB 3REHD 3AZGA 5B1MA 4NE3A 3REKB 3REIC 5AV9A 3AZGB 5B1MB 2AROC 3WKJD 4XUJA 4X23A 5AV9B 1P3PD 4XUJB 4EO5B 2DF4C 4G92B 3W99A 3WA9C 5CP6D 1AOIA 3TU4A 5CPIA 3B6FD 3W99B 3MGPD 1AOIB 2IO5B 3TU4B 5CPIB 3MNNA 5AVBD 3A6NB 5DNMA 5B40C 3NQJA 3MNNB 5JA4A 3W98C 4QLCD 1P3LD 4JJNA 3AZMC 3VH5T 3LZ0D 5DNMB 3NQJB 5JA4B 4JJNB 1N1JA 1M19A 5CHLB 2ZY4A 3MGSA 1P3BD 3AZIC 1N1JB 1M19B 5AY8C 2HUEC 4YM6D 3MGSB 3AZFD 3B0DC 3MGRA 1P3GA 3MGRB 5GXQA 3KXBC 3AV1C 1F66C 1R4VA 1P3GB 4R8PD 2NQBA 5B0ZA 3WTPC 5GXQB 3AZHD 3P5JB 2L5AA 5B24D 2NQBB 5B0ZB 5G49A 3AZKD 3AYWA 3O62C 5G49B 3LELD 3AYWB 3AN2A 1P3AC 3B6GC 3REJD 2LY8A 3KWQC 3AN2B 3LJAD 3W96C 4Z66C 3X1UC 4J8WC 4HGAC 4WNNA 2F8NK 3X1SA 2Y2OA 4WNNB 2RVQD 3X1SB 4J8VD 4J8XC 1ID3C 1KX3A 2YFVA 5CPJA 2Y2NA 2Y2LA 5B1LD 1ZLAC 1KX3B 2YFVB 5CPJB 4DQYB 5GT3C 5E5AA 5F99D 2CV5A 2Y2PA 5JRGA 5E5AB 5BT1C 3WKJC 2CV5B 1ULYA 5JRGB 1P3FC 3W97D 5GSUD 3MVDA 3MVDB 3B0BA 5CP6C 3B6FC 1HQ3D 1BFMA 5B31D 5AV5D 3W98A 4WU8C 3C1BD 5AVBC 3AZLD 3W98B 1PZRA 4QLCC 1P3LC 3UT9A 3LZ0C 3C1CD 1P3ID 1HTAA 3UT9B 3B0CW 5BS7C 1P3BC 4KUDC 5B2IA 2HUEB 4YM6C 3B0DB 3AZFC 3AZND 1P3MC 1S32D 3KXBA 5B2IB 3AV1A 1F66A 5AVCD 2NZDD 3KXBB 1M18A 3AV1B 1F66B 2FJ7C 4UPKA 4R8PC 3EPLA 3AZED 4LD9D 1M18B 2JCHA 3EPHA 5B24C 1BH8A 4WJ3C 3AZKC 1TAFA 1BH8B 4ZUXD 1TAFB 3KWQA 3AV2D 4YS3C 1T3UA 5AV6A 3REJC 3X1UA 3KWQB 3VH5W 1P3KA 5B33D 3LJAC 4Z5TC 4J8UD 5AV6B 5B2JD 3X1UB 2RIQA 1P3KB 2JE5A 1EQZD 2PYOD 3RELA 2RVQC 4ZBJC 1ID3A 4J8VC 1TZYA 3MGQA 1P3OD 1KX5D 4XZQC 3VH6A 3RELB 1ID3B 3UTAD 1TZYB 3MGQB 4G91B 5B31G 3AZJD 2JSSA 2XD1A 4H9QA 3REKD 2Y2JA 3AZGD 5B1MD 4H9QB 5AV9D 4WU9C 1BH9A 4H9SC 4XUJD 4X23D 3A6NA 1P3FA 1BH9B 3W97C 1P3FB 5GSUC 3W99D 2BYKA 1AOID 3TU4D 5CPID 2BYKB 5B32A 3X1TC 4H9NA 3MNND 5B31C 4WU8A 5B32B 5DNMD 5DNNC 4H9NB 5AV5C 4KGCA 3KUYA 4WU8B 3C1BC 4JJND 5CPKC 4KUDA 5B0YC 4KGCB 3KUYB 2Y2GA 4KUDB 3X1VC 1M19D 3MGSD 2HIOA 2F8NA 3C1CC 1P3IC 2HIOB 2F8NB 1P3MA 5AV8A 3MGRD 1P3GD 1P3MB 5AV8B 3AZNC 4H9OA 4KHAA 5GXQD 2G5HC 1M1AA 2FJ7A 3UTBA 5AVCC 2NQBD 5B0ZD 4H9OB 4KHAB 1M1AB 2FJ7B 1W2EA 1KX4A 3UTBB 3AZEC 5FUGA 3AFAC 3AYWD 1KX4B 5C3IC 5FUGB 1P34A 3AN2D 1U35A 4YS3A 2UWXA 1P34B 3WAAC 1U35B 2J8PA 4YS3B 2XD5A 4Z5TA 1WWSA 3LZ1C 5GT0A 5B33C 4Z5TB 3X1SD 4J8UC 5GT0B 1EQZC 3REIA 3REHC 2PYOC 4XZQA 2AROA 4ZBJB 2F2AC 2YFWA 5BO0A 3REIB 1KX3D 1KX5C 4XZQB 5CPJD 2AROB 2Y2MA 3FDDA 2YFWB 5BNXA 4Z2MH 5BO0B 3EPJA 1P3PC 3AZJC 3WA9A 5BNXB 4WU9A 5E5AD 5B1MC 3WA9B 4H9SA 2CV5D 5JRGD 4WU9B 3MGPC 5B32G 4NFTA 4XUJC 4EO5C 4X23C 5B40A 3MVDD 4G92C 4UUZA 3AZMA 5B40B 3W99C 4UUZB 3AZMB 3VH6T 3X1TA 2IO5C 5CPIC 3AZIA 3X1TB 5AY8A 5DNNA 3MNNC 3AZIB 3W98D 5CPKA 5DNNB 5DNMC 5AY8B 5B0YA 1Z2CB 4DRAA 3X1VA 5CPKB 4CSRA 3UT9D 5B0YB 1WWIA 4WV4B 3WTPA 3X1VB 4CSRB 3MGSC 3WTPB 3AZHC 4CAYA 5B2ID 3O62A 3EG5B 3MGRC 4CAYB 4Z2MG 3KXBD 3AV1D 2DQNC 3O62B 3R45A 1P3GC 1P3AA 1F66D 3B6GA 3LELC 1M18D 3R45B 1P3AB 3AZEA 2NQBC 3B6GB 3W96A 5B0ZC 4Z66A 3AFAA 4J8WA 3AZEB 1Q9CA 4Z66B 3AFAB 2FFFB 3W96B 4J8WB 4HGAB 5C3IB 3WAAA 3KWQD 4J8XA 3AN2C 3WAAB 2Y2KA 5AV6D 3LZ1A 3X1UD 4J8XB 1P3KD 1ZLAA 3LZ1B 1ZLAB 5B1LC 5GT3A 3REHA 3RELD 3H0LC 5GT3B 1TZYD 3MGQD 1ID3D 3REHB 5F99C 3WKJA 1P3PA 4H9RA 3WKJB 1P3PB 4H9RB 4AWLC 5CP6A 3B6FA 5E5AC 5BT1D 3MGPA 5CP6B 3A6ND 2CV5C 5JRGC 1P3FD 3B6FB 1HQ3C 3MGPB 2ZY2A 5AVBA 4X23B 3MVDC 3F6TA 4QLCA 5AVBB 3AZLC 1P3LA 3KFUG 3LZ0A 4QLCB 1P3LB 5B32D 3LZ0B 5BS7A 1P3BA 4WU8D 4YM6A 4KGCD 3AZFA 3KUYD 1P3BB 4E44A 4KUDD 4NE5A 4YM6B 3AZFB 2ZY3A 1S32C 3UT9C 2HIOD 4R8PA 2F8ND 2BG1A 2NZDC 3AZHA 2VQRA 2CWEA 4R8PB 5B24A 1P3MD 5AV8D 3AZHB 4LD9C 3AZKA 3IP4C 5B2IC 5B24B 3AZKB 1M1AD 3LELA 2FJ7D 2W8SA 3UTBD 4NE6A 2F8NH 4ZUXC 3LELB 3REJA 1M18C 3AV2C 1KX4D 3LJAA 1JFIA 4WZSB 3REJB 3VH6W 3LJAB 1P34D 1JFIB 5B2JC 3NQUA 2G5IC 3AL0C 1U35D 4YS3D 4J8VA 3NQUB 2Y2IA 4J8VB 4Z5TD 1P3OC 5AV6C 5GT0D 1P3KC 5B1LA 3UTAC 5B1LB 3A1KA 3REKC 2ZM5A 3REID 3VH5A 4XZQD 3AZGC 2AROD 5F99A 3RELC 1TZYC 5AV9C 3MGQC 4G91C 5F99B 3W97A 5GSUA 4M6BA 3WA9D 3H0RC 3W97B 5GSUB 2BYMA 4WU9D 4AWLB 1AOIC 3TU4C 2BYMB 1HQ3A 5B31A 3A6NC 4DRBA 5AV5A 2F8NG 1H3OA 5B40D 1HQ3B 5B31B 3C1BA 1KU5A 3AZMD 5AV5B 4H9PA 3AZLA 1H3OB 3C1BB 4JJNC 3AZLB 4H9PB 3X1TD 3C1CA 1B6WA 3AZID 3A1IA 1P3IA 5B32C 1M19C 5AY8D 5DNND 3C1CB 1P3IB 5CPKD 5B0YD 4KGCC 3KUYC 3AZNA 1S32A 3X1VD 3WTPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC A;  3AZN B;  1S32 B;  3WTP D;  2NZD A;  5BNV A;  5GXQ C;  3V9R A;  2HIO C;  5AVC B;  2NZD B;  4LD9 A;  5BNV B;  3V9R B;  3O62 D;  3KSY A;  5AV8 C;  4LD9 B;  3AYW C;  1P3A D;  3B6G D;  1B67 A;  4ZUX A;  1M1A C;  3AV2 A;  3UTB C;  4E45 A;  4Z66 D;  5KDM A;  3AFA D;  4ZUX B;  3W96 D;  4J8W D;  3AV2 B;  1KX4 C;  5B33 A;  4J8U A;  5KDM B;  5B2J A;  5B33 B;  4J8U B;  3X1S C;  1EQZ A;  1P34 C;  5B2J B;  3WAA D;  2PYO A;  4J8X D;  1U35 C;  1EQZ B;  1P3O A;  3LZ1 D;  1F1E A;  1KX5 A;  2PYO B;  1A7W A;  1ZLA D;  3UTA A;  1P3O B;  1KX3 C;  3AZJ A;  1KX5 B;  5CPJ C;  5GT0 C;  3REK A;  3UTA B;  3B0C T;  5GT3 D;  3AZJ B;  3REH D;  3AZG A;  5B1M A;  4NE3 A;  3REK B;  3REI C;  5AV9 A;  3AZG B;  5B1M B;  2ARO C;  3WKJ D;  4XUJ A;  4X23 A;  5AV9 B;  1P3P D;  4XUJ B;  4EO5 B;  4G92 B;  3W99 A;  3WA9 C;  5CP6 D;  1AOI A;  3TU4 A;  5CPI A;  3B6F D;  3W99 B;  3MGP D;  1AOI B;  2IO5 B;  3TU4 B;  5CPI B;  3MNN A;  5AVB D;  3A6N B;  5DNM A;  5B40 C;  3NQJ A;  3MNN B;  5JA4 A;  3W98 C;  4QLC D;  1P3L D;  4JJN A;  3AZM C;  3VH5 T;  3LZ0 D;  5DNM B;  3NQJ B;  5JA4 B;  4JJN B;  1N1J A;  1M19 A;  5CHL B;  3MGS A;  1P3B D;  3AZI C;  1N1J B;  1M19 B;  5AY8 C;  2HUE C;  4YM6 D;  3MGS B;  3AZF D;  3B0D C;  3MGR A;  1P3G A;  3MGR B;  5GXQ A;  3KXB C;  3AV1 C;  1F66 C;  1R4V A;  1P3G B;  4R8P D;  2NQB A;  5B0Z A;  3WTP C;  5GXQ B;  3AZH D;  2L5A A;  5B24 D;  2NQB B;  5B0Z B;  5G49 A;  3AZK D;  3AYW A;  3O62 C;  5G49 B;  3LEL D;  3AYW B;  3AN2 A;  1P3A C;  3B6G C;  3REJ D;  2LY8 A;  3KWQ C;  3AN2 B;  3LJA D;  3W96 C;  4Z66 C;  3X1U C;  4J8W C;  4HGA C;  4WNN A;  2F8N K;  3X1S A;  4WNN B;  2RVQ D;  3X1S B;  4J8V D;  4J8X C;  1ID3 C;  1KX3 A;  2YFV A;  5CPJ A;  5B1L D;  1ZLA C;  1KX3 B;  2YFV B;  5CPJ B;  5GT3 C;  5E5A A;  5F99 D;  2CV5 A;  5JRG A;  5E5A B;  5BT1 C;  3WKJ C;  2CV5 B;  1ULY A;  5JRG B;  1P3F C;  3W97 D;  5GSU D;  3MVD A;  3MVD B;  3B0B A;  5CP6 C;  3B6F C;  1HQ3 D;  1BFM A;  5B31 D;  5AV5 D;  3W98 A;  4WU8 C;  3C1B D;  5AVB C;  3AZL D;  3W98 B;  4QLC C;  1P3L C;  3UT9 A;  3LZ0 C;  3C1C D;  1P3I D;  1HTA A;  3UT9 B;  3B0C W;  5BS7 C;  1P3B C;  4KUD C;  5B2I A;  4YM6 C;  2HUE B;  3B0D B;  3AZF C;  3AZN D;  1P3M C;  1S32 D;  3KXB A;  5B2I B;  3AV1 A;  1F66 A;  5AVC D;  2NZD D;  3KXB B;  1M18 A;  3AV1 B;  1F66 B;  2FJ7 C;  4R8P C;  3AZE D;  4LD9 D;  1M18 B;  5B24 C;  1BH8 A;  3AZK C;  1TAF A;  1BH8 B;  4ZUX D;  1TAF B;  3KWQ A;  3AV2 D;  4YS3 C;  5AV6 A;  3REJ C;  3X1U A;  3KWQ B;  3VH5 W;  1P3K A;  5B33 D;  3LJA C;  4Z5T C;  4J8U D;  5AV6 B;  5B2J D;  3X1U B;  1P3K B;  1EQZ D;  2PYO D;  3REL A;  2RVQ C;  4ZBJ C;  1ID3 A;  4J8V C;  1TZY A;  3MGQ A;  1P3O D;  1KX5 D;  4XZQ C;  3VH6 A;  3REL B;  1ID3 B;  3UTA D;  1TZY B;  3MGQ B;  4G91 B;  5B31 G;  3AZJ D;  2JSS A;  4H9Q A;  3REK D;  3AZG D;  5B1M D;  4H9Q B;  5AV9 D;  4WU9 C;  1BH9 A;  4H9S C;  4XUJ D;  4X23 D;  3A6N A;  1P3F A;  1BH9 B;  3W97 C;  1P3F B;  5GSU C;  3W99 D;  2BYK A;  1AOI D;  3TU4 D;  5CPI D;  2BYK B;  5B32 A;  3X1T C;  4H9N A;  3MNN D;  5B31 C;  4WU8 A;  5B32 B;  5DNM D;  5DNN C;  4H9N B;  5AV5 C;  4KGC A;  3KUY A;  4WU8 B;  3C1B C;  4JJN D;  5CPK C;  4KUD A;  5B0Y C;  4KGC B;  3KUY B;  4KUD B;  3X1V C;  1M19 D;  3MGS D;  2HIO A;  2F8N A;  3C1C C;  1P3I C;  2HIO B;  2F8N B;  1P3M A;  5AV8 A;  3MGR D;  1P3G D;  1P3M B;  5AV8 B;  3AZN C;  4H9O A;  4KHA A;  5GXQ D;  1M1A A;  2FJ7 A;  3UTB A;  5AVC C;  2NQB D;  5B0Z D;  4H9O B;  4KHA B;  1M1A B;  2FJ7 B;  1KX4 A;  3UTB B;  3AZE C;  5FUG A;  3AFA C;  3AYW D;  1KX4 B;  5C3I C;  5FUG B;  1P34 A;  3AN2 D;  1U35 A;  4YS3 A;  1P34 B;  3WAA C;  1U35 B;  4YS3 B;  4Z5T A;  1WWS A;  3LZ1 C;  5GT0 A;  5B33 C;  4Z5T B;  3X1S D;  4J8U C;  5GT0 B;  1EQZ C;  3REI A;  3REH C;  2PYO C;  4XZQ A;  2ARO A;  4ZBJ B;  2YFW A;  5BO0 A;  3REI B;  1KX3 D;  1KX5 C;  4XZQ B;  5CPJ D;  2ARO B;  2YFW B;  5BNX A;  4Z2M H;  5BO0 B;  1P3P C;  3AZJ C;  3WA9 A;  5BNX B;  4WU9 A;  5E5A D;  5B1M C;  3WA9 B;  4H9S A;  2CV5 D;  5JRG D;  4WU9 B;  3MGP C;  5B32 G;  4NFT A;  4XUJ C;  4EO5 C;  4X23 C;  5B40 A;  3MVD D;  4G92 C;  4UUZ A;  3AZM A;  5B40 B;  3W99 C;  4UUZ B;  3AZM B;  3VH6 T;  3X1T A;  2IO5 C;  5CPI C;  3AZI A;  3X1T B;  5AY8 A;  5DNN A;  3MNN C;  3AZI B;  3W98 D;  5CPK A;  5DNN B;  5DNM C;  5AY8 B;  5B0Y A;  4DRA A;  3X1V A;  5CPK B;  4CSR A;  3UT9 D;  5B0Y B;  1WWI A;  4WV4 B;  3WTP A;  3X1V B;  4CSR B;  3MGS C;  3WTP B;  3AZH C;  4CAY A;  5B2I D;  3O62 A;  3MGR C;  4CAY B;  4Z2M G;  3KXB D;  3AV1 D;  1F66 D;  3O62 B;  3R45 A;  1P3G C;  1P3A A;  3B6G A;  3LEL C;  1M18 D;  3R45 B;  1P3A B;  3AZE A;  2NQB C;  3B6G B;  3W96 A;  5B0Z C;  4Z66 A;  3AFA A;  4J8W A;  3AZE B;  1Q9C A;  4Z66 B;  3AFA B;  3W96 B;  4J8W B;  4HGA B;  5C3I B;  3WAA A;  3KWQ D;  4J8X A;  3AN2 C;  3WAA B;  5AV6 D;  3LZ1 A;  3X1U D;  4J8X B;  1P3K D;  1ZLA A;  3LZ1 B;  1ZLA B;  5B1L C;  5GT3 A;  3REH A;  3REL D;  1ID3 D;  5GT3 B;  1TZY D;  3MGQ D;  3REH B;  5F99 C;  3WKJ A;  1P3P A;  4H9R A;  3WKJ B;  1P3P B;  4H9R B;  4AWL C;  5CP6 A;  3B6F A;  5E5A C;  5BT1 D;  3MGP A;  5CP6 B;  3A6N D;  2CV5 C;  5JRG C;  1P3F D;  3B6F B;  1HQ3 C;  3MGP B;  5AVB A;  4X23 B;  3MVD C;  4QLC A;  5AVB B;  3AZL C;  1P3L A;  3LZ0 A;  4QLC B;  1P3L B;  5B32 D;  3LZ0 B;  5BS7 A;  1P3B A;  4WU8 D;  4YM6 A;  4KGC D;  3AZF A;  3KUY D;  1P3B B;  4E44 A;  4KUD D;  4NE5 A;  4YM6 B;  3AZF B;  1S32 C;  3UT9 C;  2HIO D;  4R8P A;  2F8N D;  2NZD C;  3AZH A;  2CWE A;  4R8P B;  5B24 A;  1P3M D;  5AV8 D;  3AZH B;  4LD9 C;  3AZK A;  5B2I C;  5B24 B;  3AZK B;  1M1A D;  3LEL A;  2FJ7 D;  3UTB D;  4NE6 A;  2F8N H;  4ZUX C;  3LEL B;  3REJ A;  1M18 C;  3AV2 C;  1KX4 D;  3LJA A;  1JFI A;  4WZS B;  3REJ B;  3VH6 W;  3LJA B;  1P34 D;  1JFI B;  5B2J C;  3NQU A;  1U35 D;  4YS3 D;  4J8V A;  3NQU B;  4J8V B;  4Z5T D;  1P3O C;  5AV6 C;  5GT0 D;  1P3K C;  5B1L A;  3UTA C;  5B1L B;  3REK C;  3REI D;  3VH5 A;  4XZQ D;  3AZG C;  2ARO D;  5F99 A;  3REL C;  1TZY C;  5AV9 C;  3MGQ C;  4G91 C;  5F99 B;  3W97 A;  5GSU A;  4M6B A;  3WA9 D;  3W97 B;  5GSU B;  2BYM A;  4WU9 D;  4AWL B;  1AOI C;  3TU4 C;  2BYM B;  1HQ3 A;  5B31 A;  3A6N C;  4DRB A;  5AV5 A;  2F8N G;  1H3O A;  5B40 D;  1HQ3 B;  5B31 B;  3C1B A;  1KU5 A;  3AZM D;  5AV5 B;  4H9P A;  3AZL A;  1H3O B;  3C1B B;  4JJN C;  3AZL B;  4H9P B;  3X1T D;  3C1C A;  1B6W A;  3AZI D;  1P3I A;  5B32 C;  1M19 C;  5AY8 D;  5DNN D;  3C1C B;  1P3I B;  5CPK D;  5B0Y D;  4KGC C;  3KUY C;  3AZN A;  1S32 A;  3X1V D;  3WTP E; 
#chains in the Genus database with same CATH topology
 5AVC A;  3AZN B;  1S32 B;  3WTP D;  2NZD A;  5BNV A;  2Y2Q A;  5GXQ C;  3V9R A;  2HIO C;  5AVC B;  2NZD B;  4LD9 A;  5BNV B;  3V9R B;  3O62 D;  3KSY A;  5AV8 C;  4LD9 B;  3AYW C;  2ZY5 A;  1P3A D;  3B6G D;  1B67 A;  4ZUX A;  1M1A C;  3AV2 A;  3UTB C;  4E45 A;  4Z66 D;  5KDM A;  3AFA D;  4ZUX B;  3W96 D;  4J8W D;  3AV2 B;  1KX4 C;  5B33 A;  4J8U A;  3H0M C;  5KDM B;  5B2J A;  5B33 B;  4J8U B;  3X1S C;  1EQZ A;  1P34 C;  5B2J B;  3WAA D;  2PYO A;  4J8X D;  1U35 C;  1EQZ B;  1P3O A;  3LZ1 D;  1F1E A;  1KX5 A;  3EPK A;  2PYO B;  1A7W A;  1ZLA D;  3UTA A;  1P3O B;  1KX3 C;  3AZJ A;  1KX5 B;  5CPJ C;  5GT0 C;  3REK A;  3UTA B;  3B0C T;  5GT3 D;  2Y2H A;  3AZJ B;  3REH D;  3AZG A;  5B1M A;  4NE3 A;  3REK B;  3REI C;  5AV9 A;  3AZG B;  5B1M B;  2ARO C;  3WKJ D;  4XUJ A;  4X23 A;  5AV9 B;  1P3P D;  4XUJ B;  4EO5 B;  2DF4 C;  4G92 B;  3W99 A;  3WA9 C;  5CP6 D;  1AOI A;  3TU4 A;  5CPI A;  3B6F D;  3W99 B;  3MGP D;  1AOI B;  2IO5 B;  3TU4 B;  5CPI B;  3MNN A;  5AVB D;  3A6N B;  5DNM A;  5B40 C;  3NQJ A;  3MNN B;  5JA4 A;  3W98 C;  4QLC D;  1P3L D;  4JJN A;  3AZM C;  3VH5 T;  3LZ0 D;  5DNM B;  3NQJ B;  5JA4 B;  4JJN B;  1N1J A;  1M19 A;  5CHL B;  2ZY4 A;  3MGS A;  1P3B D;  3AZI C;  1N1J B;  1M19 B;  5AY8 C;  2HUE C;  4YM6 D;  3MGS B;  3AZF D;  3B0D C;  3MGR A;  1P3G A;  3MGR B;  5GXQ A;  3KXB C;  3AV1 C;  1F66 C;  1R4V A;  1P3G B;  4R8P D;  2NQB A;  5B0Z A;  3WTP C;  5GXQ B;  3AZH D;  3P5J B;  2L5A A;  5B24 D;  2NQB B;  5B0Z B;  5G49 A;  3AZK D;  3AYW A;  3O62 C;  5G49 B;  3LEL D;  3AYW B;  3AN2 A;  1P3A C;  3B6G C;  3REJ D;  2LY8 A;  3KWQ C;  3AN2 B;  3LJA D;  3W96 C;  4Z66 C;  3X1U C;  4J8W C;  4HGA C;  4WNN A;  2F8N K;  3X1S A;  2Y2O A;  4WNN B;  2RVQ D;  3X1S B;  4J8V D;  4J8X C;  1ID3 C;  1KX3 A;  2YFV A;  5CPJ A;  2Y2N A;  2Y2L A;  5B1L D;  1ZLA C;  1KX3 B;  2YFV B;  5CPJ B;  4DQY B;  5GT3 C;  5E5A A;  5F99 D;  2CV5 A;  2Y2P A;  5JRG A;  5E5A B;  5BT1 C;  3WKJ C;  2CV5 B;  1ULY A;  5JRG B;  1P3F C;  3W97 D;  5GSU D;  3MVD A;  3MVD B;  3B0B A;  5CP6 C;  3B6F C;  1HQ3 D;  1BFM A;  5B31 D;  5AV5 D;  3W98 A;  4WU8 C;  3C1B D;  5AVB C;  3AZL D;  3W98 B;  1PZR A;  4QLC C;  1P3L C;  3UT9 A;  3LZ0 C;  3C1C D;  1P3I D;  1HTA A;  3UT9 B;  3B0C W;  5BS7 C;  1P3B C;  4KUD C;  5B2I A;  2HUE B;  4YM6 C;  3B0D B;  3AZF C;  3AZN D;  1P3M C;  1S32 D;  3KXB A;  5B2I B;  3AV1 A;  1F66 A;  5AVC D;  2NZD D;  3KXB B;  1M18 A;  3AV1 B;  1F66 B;  2FJ7 C;  4UPK A;  4R8P C;  3EPL A;  3AZE D;  4LD9 D;  1M18 B;  2JCH A;  3EPH A;  5B24 C;  1BH8 A;  4WJ3 C;  3AZK C;  1TAF A;  1BH8 B;  4ZUX D;  1TAF B;  3KWQ A;  3AV2 D;  4YS3 C;  1T3U A;  5AV6 A;  3REJ C;  3X1U A;  3KWQ B;  3VH5 W;  1P3K A;  5B33 D;  3LJA C;  4Z5T C;  4J8U D;  5AV6 B;  5B2J D;  3X1U B;  2RIQ A;  1P3K B;  2JE5 A;  1EQZ D;  2PYO D;  3REL A;  2RVQ C;  4ZBJ C;  1ID3 A;  4J8V C;  1TZY A;  3MGQ A;  1P3O D;  1KX5 D;  4XZQ C;  3VH6 A;  3REL B;  1ID3 B;  3UTA D;  1TZY B;  3MGQ B;  4G91 B;  5B31 G;  3AZJ D;  2JSS A;  2XD1 A;  4H9Q A;  3REK D;  2Y2J A;  3AZG D;  5B1M D;  4H9Q B;  5AV9 D;  4WU9 C;  1BH9 A;  4H9S C;  4XUJ D;  4X23 D;  3A6N A;  1P3F A;  1BH9 B;  3W97 C;  1P3F B;  5GSU C;  3W99 D;  2BYK A;  1AOI D;  3TU4 D;  5CPI D;  2BYK B;  5B32 A;  3X1T C;  4H9N A;  3MNN D;  5B31 C;  4WU8 A;  5B32 B;  5DNM D;  5DNN C;  4H9N B;  5AV5 C;  4KGC A;  3KUY A;  4WU8 B;  3C1B C;  4JJN D;  5CPK C;  4KUD A;  5B0Y C;  4KGC B;  3KUY B;  2Y2G A;  4KUD B;  3X1V C;  1M19 D;  3MGS D;  2HIO A;  2F8N A;  3C1C C;  1P3I C;  2HIO B;  2F8N B;  1P3M A;  5AV8 A;  3MGR D;  1P3G D;  1P3M B;  5AV8 B;  3AZN C;  4H9O A;  4KHA A;  5GXQ D;  2G5H C;  1M1A A;  2FJ7 A;  3UTB A;  5AVC C;  2NQB D;  5B0Z D;  4H9O B;  4KHA B;  1M1A B;  2FJ7 B;  1W2E A;  1KX4 A;  3UTB B;  3AZE C;  5FUG A;  3AFA C;  3AYW D;  1KX4 B;  5C3I C;  5FUG B;  1P34 A;  3AN2 D;  1U35 A;  4YS3 A;  2UWX A;  1P34 B;  3WAA C;  1U35 B;  2J8P A;  4YS3 B;  2XD5 A;  4Z5T A;  1WWS A;  3LZ1 C;  5GT0 A;  5B33 C;  4Z5T B;  3X1S D;  4J8U C;  5GT0 B;  1EQZ C;  3REI A;  3REH C;  2PYO C;  4XZQ A;  2ARO A;  4ZBJ B;  2F2A C;  2YFW A;  5BO0 A;  3REI B;  1KX3 D;  1KX5 C;  4XZQ B;  5CPJ D;  2ARO B;  2Y2M A;  3FDD A;  2YFW B;  5BNX A;  4Z2M H;  5BO0 B;  3EPJ A;  1P3P C;  3AZJ C;  3WA9 A;  5BNX B;  4WU9 A;  5E5A D;  5B1M C;  3WA9 B;  4H9S A;  2CV5 D;  5JRG D;  4WU9 B;  3MGP C;  5B32 G;  4NFT A;  4XUJ C;  4EO5 C;  4X23 C;  5B40 A;  3MVD D;  4G92 C;  4UUZ A;  3AZM A;  5B40 B;  3W99 C;  4UUZ B;  3AZM B;  3VH6 T;  3X1T A;  2IO5 C;  5CPI C;  3AZI A;  3X1T B;  5AY8 A;  5DNN A;  3MNN C;  3AZI B;  3W98 D;  5CPK A;  5DNN B;  5DNM C;  5AY8 B;  5B0Y A;  1Z2C B;  4DRA A;  3X1V A;  5CPK B;  4CSR A;  3UT9 D;  5B0Y B;  1WWI A;  4WV4 B;  3WTP A;  3X1V B;  4CSR B;  3MGS C;  3WTP B;  3AZH C;  4CAY A;  5B2I D;  3O62 A;  3EG5 B;  3MGR C;  4CAY B;  4Z2M G;  3KXB D;  3AV1 D;  2DQN C;  3O62 B;  3R45 A;  1P3G C;  1P3A A;  1F66 D;  3B6G A;  3LEL C;  1M18 D;  3R45 B;  1P3A B;  3AZE A;  2NQB C;  3B6G B;  3W96 A;  5B0Z C;  4Z66 A;  3AFA A;  4J8W A;  3AZE B;  1Q9C A;  4Z66 B;  3AFA B;  2FFF B;  3W96 B;  4J8W B;  4HGA B;  5C3I B;  3WAA A;  3KWQ D;  4J8X A;  3AN2 C;  3WAA B;  2Y2K A;  5AV6 D;  3LZ1 A;  3X1U D;  4J8X B;  1P3K D;  1ZLA A;  3LZ1 B;  1ZLA B;  5B1L C;  5GT3 A;  3REH A;  3REL D;  3H0L C;  5GT3 B;  1TZY D;  3MGQ D;  1ID3 D;  3REH B;  5F99 C;  3WKJ A;  1P3P A;  4H9R A;  3WKJ B;  1P3P B;  4H9R B;  4AWL C;  5CP6 A;  3B6F A;  5E5A C;  5BT1 D;  3MGP A;  5CP6 B;  3A6N D;  2CV5 C;  5JRG C;  1P3F D;  3B6F B;  1HQ3 C;  3MGP B;  2ZY2 A;  5AVB A;  4X23 B;  3MVD C;  3F6T A;  4QLC A;  5AVB B;  3AZL C;  1P3L A;  3KFU G;  3LZ0 A;  4QLC B;  1P3L B;  5B32 D;  3LZ0 B;  5BS7 A;  1P3B A;  4WU8 D;  4YM6 A;  4KGC D;  3AZF A;  3KUY D;  1P3B B;  4E44 A;  4KUD D;  4NE5 A;  4YM6 B;  3AZF B;  2ZY3 A;  1S32 C;  3UT9 C;  2HIO D;  4R8P A;  2F8N D;  2BG1 A;  2NZD C;  3AZH A;  2VQR A;  2CWE A;  4R8P B;  5B24 A;  1P3M D;  5AV8 D;  3AZH B;  4LD9 C;  3AZK A;  3IP4 C;  5B2I C;  5B24 B;  3AZK B;  1M1A D;  3LEL A;  2FJ7 D;  2W8S A;  3UTB D;  4NE6 A;  2F8N H;  4ZUX C;  3LEL B;  3REJ A;  1M18 C;  3AV2 C;  1KX4 D;  3LJA A;  1JFI A;  4WZS B;  3REJ B;  3VH6 W;  3LJA B;  1P34 D;  1JFI B;  5B2J C;  3NQU A;  2G5I C;  3AL0 C;  1U35 D;  4YS3 D;  4J8V A;  3NQU B;  2Y2I A;  4J8V B;  4Z5T D;  1P3O C;  5AV6 C;  5GT0 D;  1P3K C;  5B1L A;  3UTA C;  5B1L B;  3A1K A;  3REK C;  2ZM5 A;  3REI D;  3VH5 A;  4XZQ D;  3AZG C;  2ARO D;  5F99 A;  3REL C;  1TZY C;  5AV9 C;  3MGQ C;  4G91 C;  5F99 B;  3W97 A;  5GSU A;  4M6B A;  3WA9 D;  3H0R C;  3W97 B;  5GSU B;  2BYM A;  4WU9 D;  4AWL B;  1AOI C;  3TU4 C;  2BYM B;  1HQ3 A;  5B31 A;  3A6N C;  4DRB A;  5AV5 A;  2F8N G;  1H3O A;  5B40 D;  1HQ3 B;  5B31 B;  3C1B A;  1KU5 A;  3AZM D;  5AV5 B;  4H9P A;  3AZL A;  1H3O B;  3C1B B;  4JJN C;  3AZL B;  4H9P B;  3X1T D;  3C1C A;  1B6W A;  3AZI D;  3A1I A;  1P3I A;  5B32 C;  1M19 C;  5AY8 D;  5DNN D;  3C1C B;  1P3I B;  5CPK D;  5B0Y D;  4KGC C;  3KUY C;  3AZN A;  1S32 A;  3X1V D;  3WTP E; 
#chains in the Genus database with same CATH homology
 5AVC A;  3AZN B;  1S32 B;  3WTP D;  2NZD A;  5BNV A;  2Y2Q A;  5GXQ C;  3V9R A;  2HIO C;  5AVC B;  2NZD B;  4LD9 A;  5BNV B;  3V9R B;  3O62 D;  3KSY A;  5AV8 C;  4LD9 B;  3AYW C;  2ZY5 A;  1P3A D;  3B6G D;  1B67 A;  4ZUX A;  1M1A C;  3AV2 A;  3UTB C;  4E45 A;  4Z66 D;  5KDM A;  3AFA D;  4ZUX B;  3W96 D;  4J8W D;  3AV2 B;  1KX4 C;  5B33 A;  4J8U A;  3H0M C;  5KDM B;  5B2J A;  5B33 B;  4J8U B;  3X1S C;  1EQZ A;  1P34 C;  5B2J B;  3WAA D;  2PYO A;  4J8X D;  1U35 C;  1EQZ B;  1P3O A;  3LZ1 D;  1F1E A;  1KX5 A;  3EPK A;  2PYO B;  1A7W A;  1ZLA D;  3UTA A;  1P3O B;  1KX3 C;  3AZJ A;  1KX5 B;  5CPJ C;  5GT0 C;  3REK A;  3UTA B;  3B0C T;  5GT3 D;  2Y2H A;  3AZJ B;  3REH D;  3AZG A;  5B1M A;  4NE3 A;  3REK B;  3REI C;  5AV9 A;  3AZG B;  5B1M B;  2ARO C;  3WKJ D;  4XUJ A;  4X23 A;  5AV9 B;  1P3P D;  4XUJ B;  4EO5 B;  2DF4 C;  4G92 B;  3W99 A;  3WA9 C;  5CP6 D;  1AOI A;  3TU4 A;  5CPI A;  3B6F D;  3W99 B;  3MGP D;  1AOI B;  2IO5 B;  3TU4 B;  5CPI B;  3MNN A;  5AVB D;  3A6N B;  5DNM A;  5B40 C;  3NQJ A;  3MNN B;  5JA4 A;  3W98 C;  4QLC D;  1P3L D;  4JJN A;  3AZM C;  3VH5 T;  3LZ0 D;  5DNM B;  3NQJ B;  5JA4 B;  4JJN B;  1N1J A;  1M19 A;  5CHL B;  2ZY4 A;  3MGS A;  1P3B D;  3AZI C;  1N1J B;  1M19 B;  5AY8 C;  2HUE C;  4YM6 D;  3MGS B;  3AZF D;  3B0D C;  3MGR A;  1P3G A;  3MGR B;  5GXQ A;  3KXB C;  3AV1 C;  1F66 C;  1R4V A;  1P3G B;  4R8P D;  2NQB A;  5B0Z A;  3WTP C;  5GXQ B;  3AZH D;  3P5J B;  2L5A A;  5B24 D;  2NQB B;  5B0Z B;  5G49 A;  3AZK D;  3AYW A;  3O62 C;  5G49 B;  3LEL D;  3AYW B;  3AN2 A;  1P3A C;  3B6G C;  3REJ D;  2LY8 A;  3KWQ C;  3AN2 B;  3LJA D;  3W96 C;  4Z66 C;  3X1U C;  4J8W C;  4HGA C;  4WNN A;  2F8N K;  3X1S A;  2Y2O A;  4WNN B;  2RVQ D;  3X1S B;  4J8V D;  4J8X C;  1ID3 C;  1KX3 A;  2YFV A;  5CPJ A;  2Y2N A;  2Y2L A;  5B1L D;  1ZLA C;  1KX3 B;  2YFV B;  5CPJ B;  4DQY B;  5GT3 C;  5E5A A;  5F99 D;  2CV5 A;  2Y2P A;  5JRG A;  5E5A B;  5BT1 C;  3WKJ C;  2CV5 B;  1ULY A;  5JRG B;  1P3F C;  3W97 D;  5GSU D;  3MVD A;  3MVD B;  3B0B A;  5CP6 C;  3B6F C;  1HQ3 D;  1BFM A;  5B31 D;  5AV5 D;  3W98 A;  4WU8 C;  3C1B D;  5AVB C;  3AZL D;  3W98 B;  1PZR A;  4QLC C;  1P3L C;  3UT9 A;  3LZ0 C;  3C1C D;  1P3I D;  1HTA A;  3UT9 B;  3B0C W;  5BS7 C;  1P3B C;  4KUD C;  5B2I A;  2HUE B;  4YM6 C;  3B0D B;  3AZF C;  3AZN D;  1P3M C;  1S32 D;  3KXB A;  5B2I B;  3AV1 A;  1F66 A;  5AVC D;  2NZD D;  3KXB B;  1M18 A;  3AV1 B;  1F66 B;  2FJ7 C;  4UPK A;  4R8P C;  3EPL A;  3AZE D;  4LD9 D;  1M18 B;  2JCH A;  3EPH A;  5B24 C;  1BH8 A;  4WJ3 C;  3AZK C;  1TAF A;  1BH8 B;  4ZUX D;  1TAF B;  3KWQ A;  3AV2 D;  4YS3 C;  1T3U A;  5AV6 A;  3REJ C;  3X1U A;  3KWQ B;  3VH5 W;  1P3K A;  5B33 D;  3LJA C;  4Z5T C;  4J8U D;  5AV6 B;  5B2J D;  3X1U B;  2RIQ A;  1P3K B;  2JE5 A;  1EQZ D;  2PYO D;  3REL A;  2RVQ C;  4ZBJ C;  1ID3 A;  4J8V C;  1TZY A;  3MGQ A;  1P3O D;  1KX5 D;  4XZQ C;  3VH6 A;  3REL B;  1ID3 B;  3UTA D;  1TZY B;  3MGQ B;  4G91 B;  5B31 G;  3AZJ D;  2JSS A;  2XD1 A;  4H9Q A;  3REK D;  2Y2J A;  3AZG D;  5B1M D;  4H9Q B;  5AV9 D;  4WU9 C;  1BH9 A;  4H9S C;  4XUJ D;  4X23 D;  3A6N A;  1P3F A;  1BH9 B;  3W97 C;  1P3F B;  5GSU C;  3W99 D;  2BYK A;  1AOI D;  3TU4 D;  5CPI D;  2BYK B;  5B32 A;  3X1T C;  4H9N A;  3MNN D;  5B31 C;  4WU8 A;  5B32 B;  5DNM D;  5DNN C;  4H9N B;  5AV5 C;  4KGC A;  3KUY A;  4WU8 B;  3C1B C;  4JJN D;  5CPK C;  4KUD A;  5B0Y C;  4KGC B;  3KUY B;  2Y2G A;  4KUD B;  3X1V C;  1M19 D;  3MGS D;  2HIO A;  2F8N A;  3C1C C;  1P3I C;  2HIO B;  2F8N B;  1P3M A;  5AV8 A;  3MGR D;  1P3G D;  1P3M B;  5AV8 B;  3AZN C;  4H9O A;  4KHA A;  5GXQ D;  2G5H C;  1M1A A;  2FJ7 A;  3UTB A;  5AVC C;  2NQB D;  5B0Z D;  4H9O B;  4KHA B;  1M1A B;  2FJ7 B;  1W2E A;  1KX4 A;  3UTB B;  3AZE C;  5FUG A;  3AFA C;  3AYW D;  1KX4 B;  5C3I C;  5FUG B;  1P34 A;  3AN2 D;  1U35 A;  4YS3 A;  2UWX A;  1P34 B;  3WAA C;  1U35 B;  2J8P A;  4YS3 B;  2XD5 A;  4Z5T A;  1WWS A;  3LZ1 C;  5GT0 A;  5B33 C;  4Z5T B;  3X1S D;  4J8U C;  5GT0 B;  1EQZ C;  3REI A;  3REH C;  2PYO C;  4XZQ A;  2ARO A;  4ZBJ B;  2F2A C;  2YFW A;  5BO0 A;  3REI B;  1KX3 D;  1KX5 C;  4XZQ B;  5CPJ D;  2ARO B;  2Y2M A;  3FDD A;  2YFW B;  5BNX A;  4Z2M H;  5BO0 B;  3EPJ A;  1P3P C;  3AZJ C;  3WA9 A;  5BNX B;  4WU9 A;  5E5A D;  5B1M C;  3WA9 B;  4H9S A;  2CV5 D;  5JRG D;  4WU9 B;  3MGP C;  5B32 G;  4NFT A;  4XUJ C;  4EO5 C;  4X23 C;  5B40 A;  3MVD D;  4G92 C;  4UUZ A;  3AZM A;  5B40 B;  3W99 C;  4UUZ B;  3AZM B;  3VH6 T;  3X1T A;  2IO5 C;  5CPI C;  3AZI A;  3X1T B;  5AY8 A;  5DNN A;  3MNN C;  3AZI B;  3W98 D;  5CPK A;  5DNN B;  5DNM C;  5AY8 B;  5B0Y A;  1Z2C B;  4DRA A;  3X1V A;  5CPK B;  4CSR A;  3UT9 D;  5B0Y B;  1WWI A;  4WV4 B;  3WTP A;  3X1V B;  4CSR B;  3MGS C;  3WTP B;  3AZH C;  4CAY A;  5B2I D;  3O62 A;  3EG5 B;  3MGR C;  4CAY B;  4Z2M G;  3KXB D;  3AV1 D;  2DQN C;  3O62 B;  3R45 A;  1P3G C;  1P3A A;  1F66 D;  3B6G A;  3LEL C;  1M18 D;  3R45 B;  1P3A B;  3AZE A;  2NQB C;  3B6G B;  3W96 A;  5B0Z C;  4Z66 A;  3AFA A;  4J8W A;  3AZE B;  1Q9C A;  4Z66 B;  3AFA B;  2FFF B;  3W96 B;  4J8W B;  4HGA B;  5C3I B;  3WAA A;  3KWQ D;  4J8X A;  3AN2 C;  3WAA B;  2Y2K A;  5AV6 D;  3LZ1 A;  3X1U D;  4J8X B;  1P3K D;  1ZLA A;  3LZ1 B;  1ZLA B;  5B1L C;  5GT3 A;  3REH A;  3REL D;  3H0L C;  5GT3 B;  1TZY D;  3MGQ D;  1ID3 D;  3REH B;  5F99 C;  3WKJ A;  1P3P A;  4H9R A;  3WKJ B;  1P3P B;  4H9R B;  4AWL C;  5CP6 A;  3B6F A;  5E5A C;  5BT1 D;  3MGP A;  5CP6 B;  3A6N D;  2CV5 C;  5JRG C;  1P3F D;  3B6F B;  1HQ3 C;  3MGP B;  2ZY2 A;  5AVB A;  4X23 B;  3MVD C;  3F6T A;  4QLC A;  5AVB B;  3AZL C;  1P3L A;  3KFU G;  3LZ0 A;  4QLC B;  1P3L B;  5B32 D;  3LZ0 B;  5BS7 A;  1P3B A;  4WU8 D;  4YM6 A;  4KGC D;  3AZF A;  3KUY D;  1P3B B;  4E44 A;  4KUD D;  4NE5 A;  4YM6 B;  3AZF B;  2ZY3 A;  1S32 C;  3UT9 C;  2HIO D;  4R8P A;  2F8N D;  2BG1 A;  2NZD C;  3AZH A;  2VQR A;  2CWE A;  4R8P B;  5B24 A;  1P3M D;  5AV8 D;  3AZH B;  4LD9 C;  3AZK A;  3IP4 C;  5B2I C;  5B24 B;  3AZK B;  1M1A D;  3LEL A;  2FJ7 D;  2W8S A;  3UTB D;  4NE6 A;  2F8N H;  4ZUX C;  3LEL B;  3REJ A;  1M18 C;  3AV2 C;  1KX4 D;  3LJA A;  1JFI A;  4WZS B;  3REJ B;  3VH6 W;  3LJA B;  1P34 D;  1JFI B;  5B2J C;  3NQU A;  2G5I C;  3AL0 C;  1U35 D;  4YS3 D;  4J8V A;  3NQU B;  2Y2I A;  4J8V B;  4Z5T D;  1P3O C;  5AV6 C;  5GT0 D;  1P3K C;  5B1L A;  3UTA C;  5B1L B;  3A1K A;  3REK C;  2ZM5 A;  3REI D;  3VH5 A;  4XZQ D;  3AZG C;  2ARO D;  5F99 A;  3REL C;  1TZY C;  5AV9 C;  3MGQ C;  4G91 C;  5F99 B;  3W97 A;  5GSU A;  4M6B A;  3WA9 D;  3H0R C;  3W97 B;  5GSU B;  2BYM A;  4WU9 D;  4AWL B;  1AOI C;  3TU4 C;  2BYM B;  1HQ3 A;  5B31 A;  3A6N C;  4DRB A;  5AV5 A;  2F8N G;  1H3O A;  5B40 D;  1HQ3 B;  5B31 B;  3C1B A;  1KU5 A;  3AZM D;  5AV5 B;  4H9P A;  3AZL A;  1H3O B;  3C1B B;  4JJN C;  3AZL B;  4H9P B;  3X1T D;  3C1C A;  1B6W A;  3AZI D;  3A1I A;  1P3I A;  5B32 C;  1M19 C;  5AY8 D;  5DNN D;  3C1C B;  1P3I B;  5CPK D;  5B0Y D;  4KGC C;  3KUY C;  3AZN A;  1S32 A;  3X1V D;  3WTP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...