4XZQC

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqC00
3WKJB 1P3AA 2F8NG 5B32A 3A6ND 3X1VB 1TZYB 1P34B 5GT0A 4H9SA 3B6GC 3MGPA 5B1LA 5AV5D 1P3LC 1AOIC 3MGSD 5DNNC 5B0ZD 5FUGA 5AV9C 1KX4B 5BS7A 3MVDA 4X23B 3B6FA 3C1CA 5JRGC 2F8ND 1M18D 4AWLC 3O62A 3KXBD 3AZHD 5B31B 5BNXA 3AZIA 4J8VD 4WV4B 2CV5B 4Z66B 1N1JB 4ZUXB 4KUDC 3AV1B 5AVBD 3W98B 2FJ7A 1BH8B 5B1MD 4WU9C 3KUYB 5CPIA 1KX3A 3WTPD 4CAYB 5DNMA 5BO0A 3C1BC 3UT9A 1M1AA 5B40A 4JJNC 3RELD 3AZMB 1TAFB 1P3IA 1P3BB 5CP6D 5AY8B 3B6GD 3AV2A 4XUJB 4Z2MG 1KX5B 1P3OB 3LZ0D 5DNND 4YS3D 4YM6A 4KGCB 5GXQB 3X1TD 5CPJA 3AZNC 4WU8A 3LELA 1P3AB 4E45A 5B32B 3REKD 1P3GC 4KUDD 4J8UA 5G49A 5GT0B 1P3FC 4KHAA 3MGPB 3AZFA 3REIC 4J8XA 5B1LB 4J8WD 5AV8D 4HGAC 3AZEC 5B0YD 5FUGB 3MVDB 3AZJC 3B6FB 3NQJA 3C1CB 3REHC 2HIOC 5JA4A 5B2IC 3O62B 1P3MC 5BNXB 5CPKD 3AZIB 3A6NA 2AROA 2BYKA 1U35D 4Z5TA 2YFVA 2NQBD 2IO5C 3AYWC 2FJ7B 2RVQC 5AV5A 5BNVA 5B0ZA 3W99D 3X1SD 5CPIB 1KX3B 5DNMB 5BO0B 3MGRC 2L5AA 3KXBA 3UT9B 3AZND 5B40B 1P3PA 1M1AB 5GSUA 4J8VA 3W96A 1P3IB 1F66C 1P3FD 3REID 3AV2B 3UTAC 4LD9C 3NQUA 4H9RA 3W97A 3WA9C 4YM6B 1A7WA 5CPJB 5E5AD 2HUEC 4NE3A 5B2ID 4WU8B 3LELB 1S32C 2NZDC 4DRBA 3B6GA 4J8UB 5G49B 4KHAB 3AZFB 4J8XB 4QLCD 1JFIB 1P3LA 1AOIA 3AN2C 5DNNA 5F99C 5AV9A 1HTAA 3MGSC 5JRGA 3NQJB 5C3IB 1H3OA 1HQ3D 1M18C 3AZGC 3AZHC 1B6WA 2AROB 3A6NB 2BYKB 4KUDA 4Z5TB 2YFVB 5AV5B 5AVBC 4WU9A 5BNVB 5GT3C 5B33D 3UTAD 5AVCC 3B0DC 5B0ZB 5B1MC 2PYOD 3LJAD 3WTPC 3C1BA 3KXBB 4JJNA 1P3PB 1S32D 5GSUB 3MNNC 4J8VB 3W96B 3RELC 3AZLD 4UUZA 5CP6C 5BT1D 3LZ1D 4G92B 3AN2D 5F99D 3NQUB 4H9RB 3W97B 3LZ0C 1ID3A 4YS3C 3KWQD 3X1TC 5B2JD 3R45A 3VH6W 1F1EA 3AZGD 1P3KC 1P3GA 3WTPE 4EO5B 1ZLAC 4XZQC 3B6GB 3MGQC 1KX4C 3REKC 3REIA 3UTBC 1P3LB 5GT3D 3AZEA 1AOIB 5DNNB 5KDMA 5AVCD 5AV9B 4J8WC 5AV8C 5B0YC 3AZJA 3REHA 5JRGB 3REJD 2HIOA 5B2IA 4ZUXC 4AWLB 1H3OB 2CV5C 1P3MA 2BYMA 3TU4C 3MNND 4KUDB 5CPKC 3AYWA 1U35C 4M6BA 2NQBC 4WU9B 2F8NK 3AZKD 5AV6D 3W99C 3WKJD 3X1SC 3MGRA 1WWSA 3C1BB 3X1VD 1TZYD 4JJNB 1P34D 4XUJC 1P3KD 1F66A 4H9PA 1ZLAD 4UUZB 4XZQD 3MGQD 3VH6A 1KX4D 4X23D 3UTBD 3UTAA 4LD9A 4H9NA 3WA9A 4CSRA 1ID3B 2CV5D 4ZUXD 4G91B 4Z66D 5E5AC 3R45B 3AV1D 3AFAA 1S32A 2LY8A 2NZDA 3TU4D 3MGPC 3W98D 1P3GB 3KUYD 3REIB 3X1UC 3AN2A 5F99A 4HGAB 3AZEB 5KDMB 4QLCC 3MGSA 3AZJB 3REHB 1P3BD 1EQZC 5AY8D 5B2IB 2HIOB 2F8NA 5B32G 1P3MB 1M18A 2BYMB 3AZGA 3AZHA 2FJ7C 1B67A 1HQ3C 4XUJD 1KX5D 4WZSB 1P3OD 4H9OA 4NFTA 3VH5T 3AYWB 5AVBA 4KGCD 5GT3A 5AVCA 5B1MA 3UT9C 5B40C 5B33C 5B32D 4ZBJB 3WTPA 1ULYA 3LJAC 2PYOC 3MGRB 4R8PC 5B24C 3MNNA 3MGPD 3RELA 3KSYA 1F66B 4H9PB 5CP6A 3AZLC 3MVDD 3X1UD 3B6FD 3UTAB 4LD9B 5BT1C 4H9NB 3LZ1C 3WA9B 3LZ0A 4CSRB 4YS3A 3AZID 1EQZD 2HUEB 3X1TA 1S32B 2NZDB 3AFAB 3KWQC 5JA4B 5B2JC 1BH9A 1P3KA 2FJ7D 1ZLAA 1KU5A 4XZQA 3MGQA 3REKA 5CPID 1KX3D 3UTBA 5C3IC 3AN2B 5F99B 5DNMD 4J8WA 5AV8A 3UT9D 5B40D 5B0YA 3MGSB 2AROC 4R8PD 2F8NB 3TU4A 3REJC 5B24D 1M18B 3AZHB 3AZGB 3AV2D 1M19C 4WNNA 5CPKA 4H9OB 1U35A 3VH5W 4YM6D 2NQBA 5AVBB 5CPJD 5GT3B 4DRAA 5AVCB 3B0DB 5B1MB 3AZKC 4WU8D 1P3PC 3W99A 3WAAC 3X1SA 3WTPB 5AV6C 3WKJC 3AZNA 3X1VC 3MNNB 1TZYC 3RELB 4J8XD 1P34C 4G92C 5CP6B 3W97C 1P3FA 4X23C 4E44A 3B0BA 2CWEA 3LZ0B 4YS3B 2AROD 5B31C 5E5AA 3X1TB 4EO5C 4Z5TD 4NE6A 4Z66C 3AV1C 1BH9B 1P3KB 1M19D 1ZLAB 3W98C 4XZQB 3MGQB 3REKB 3X1UA 3KUYC 3UTBB 4NE5A 2YFWA 4QLCA 4J8WB 3B0CT 5AV8B 1P3PD 5B0YB 3WAAD 3VH5A 5GSUD 1EQZA 3W96D 3AZMC 1P3BC 5AY8C 3TU4B 5B31G 1HQ3A 4WNNB 1BFMA 5CPKB 1KX5C 1U35B 3W97D 1P3OC 2NQBB 4KGCC 5GXQC 5B33A 3W99B 2PYOA 3X1SB 3LJAA 5B31D 4R8PA 1P3AC 5B32C 5B24A 3AZNB 5GT0C 4H9SC 1P3LD 1AOID 5B1LC 5AV9D 3AZLA 1ID3C 1P3FB 5JRGD 3LZ1A 5BS7C 3MVDC 4G91C 3B6FC 3C1CC 3V9RA 3O62C 3AZMD 5E5AB 3AZIC 3KWQA 5B2JA 1JFIA 5CHLB 4WU9D 3X1UB 2IO5B 5CPIC 1KX3C 3C1BD 2YFWB 4QLCB 5GXQD 4H9QA 3B0CW 4JJND 5DNMC 2JSSA 1M1AC 1EQZB 1P3AD 1P3IC 3REJA 1HQ3B 1M19A 2F8NH 5GT0D 3AV2C 5B1LD 1ID3D 4ZBJC 4YM6C 5CPJC 5B33B 3AZKA 3C1CD 1Q9CA 3WAAA 1R4VA 2PYOB 3O62D 5AV6A 3LJAB 3LELC 4WU8C 3WKJA 4R8PB 1P3GD 3X1VA 5B24B 1TZYA 1P34A 4J8UC 3AZED 3AZFC 4J8XC 3AZLB 3AZJD 1KX4A 3REHD 3LZ1B 4X23A 1WWIA 2HIOD 3VH6T 3AFAC 1P3MD 3V9RB 1M1AD 5B31A 1P3ID 2CV5A 3A6NC 4ZUXA 1N1JA 4Z66A 3KWQB 5B2JB 3AYWD 3AV1A 2RVQD 4Z5TC 3W98A 1BH8A 5AV5C 3KUYA 5B0ZC 4Z2MH 3MGRD 4H9QB 4CAYA 3KXBC 3AZMA 3LELD 1F66D 1TAFA 5GSUC 4J8VC 3W96C 1P3BA 5AY8A 3REJB 1M19B 4J8UD 4LD9D 3AZFD 4XUJA 1KX5A 3WA9D 1P3OA 4KGCA 5GXQA 3AZKB 2NZDD 3AFAD 3WAAB 5AV6B
chains in the Genus database with same CATH superfamily
3WKJB 1P3AA 2F8NG 2Y2KA 5B32A 3A6ND 3X1VB 1TZYB 1P34B 5GT0A 4H9SA 3B6GC 3MGPA 5B1LA 5AV5D 1P3LC 1AOIC 3MGSD 3AL0C 5DNNC 5B0ZD 5FUGA 5AV9C 1KX4B 5BS7A 3MVDA 4X23B 3B6FA 3C1CA 3EG5B 5JRGC 2F8ND 3EPKA 4AWLC 1M18D 3O62A 3KXBD 3AZHD 5B31B 5BNXA 3AZIA 4J8VD 4WV4B 2CV5B 4Z66B 1N1JB 4ZUXB 4KUDC 3AV1B 5AVBD 3W98B 2FJ7A 1BH8B 2J8PA 5B1MD 4WU9C 3KUYB 5CPIA 1KX3A 3WTPD 4CAYB 5DNMA 5BO0A 3C1BC 3UT9A 1M1AA 5B40A 4JJNC 3RELD 3AZMB 1TAFB 1P3IA 1P3BB 5CP6D 5AY8B 3B6GD 3AV2A 4XUJB 4Z2MG 1KX5B 2ZM5A 1P3OB 3LZ0D 5DNND 4YS3D 4YM6A 4KGCB 5GXQB 3X1TD 5CPJA 3AZNC 4WU8A 3LELA 1P3AB 4E45A 5B32B 3EPHA 3REKD 1P3GC 4KUDD 4J8UA 5G49A 5GT0B 1P3FC 4KHAA 2VQRA 3MGPB 3AZFA 3REIC 4J8XA 1W2EA 5B1LB 4J8WD 5AV8D 4HGAC 3AZEC 5B0YD 5FUGB 3MVDB 3AZJC 3B6FB 3NQJA 3C1CB 3REHC 2Y2QA 2HIOC 5JA4A 5B2IC 3O62B 1P3MC 2JE5A 2G5IC 5BNXB 5CPKD 3AZIB 3A6NA 2AROA 2BYKA 4DQYB 1U35D 2XD1A 4Z5TA 2YFVA 2NQBD 2IO5C 1Z2CB 3AYWC 2FJ7B 2RVQC 5AV5A 5BNVA 5B0ZA 3W99D 3X1SD 5CPIB 1KX3B 5DNMB 5BO0B 3MGRC 2L5AA 3KXBA 3UT9B 3AZND 5B40B 1P3PA 1M1AB 5GSUA 4J8VA 3W96A 1P3IB 1F66C 1P3FD 3REID 3AV2B 3UTAC 4LD9C 3NQUA 4H9RA 3W97A 3WA9C 4YM6B 1A7WA 5CPJB 5E5AD 2HUEC 4NE3A 5B2ID 4WU8B 3LELB 1S32C 2NZDC 4DRBA 3B6GA 4J8UB 5G49B 4KHAB 3AZFB 4J8XB 4QLCD 1JFIB 2DQNC 1P3LA 1AOIA 3AN2C 5DNNA 5F99C 5AV9A 1HTAA 3MGSC 5JRGA 3NQJB 3IP4C 5C3IB 1H3OA 1HQ3D 1M18C 3AZGC 3AZHC 1B6WA 2AROB 3A6NB 2BYKB 4KUDA 4Z5TB 2YFVB 5AV5B 5AVBC 4WU9A 5BNVB 5GT3C 5B33D 3UTAD 5AVCC 3B0DC 5B0ZB 5B1MC 2PYOD 3LJAD 3WTPC 3C1BA 3KXBB 4JJNA 1P3PB 1S32D 5GSUB 3MNNC 4J8VB 3W96B 3RELC 3AZLD 4UUZA 5CP6C 5BT1D 3LZ1D 4G92B 3AN2D 5F99D 3NQUB 4H9RB 3W97B 3LZ0C 1ID3A 3EPLA 4YS3C 3KWQD 3X1TC 5B2JD 3R45A 3VH6W 1F1EA 3AZGD 1P3KC 1P3GA 3WTPE 4EO5B 1ZLAC 4XZQC 3B6GB 3MGQC 1KX4C 3REKC 3REIA 3UTBC 1P3LB 5GT3D 3AZEA 1AOIB 5DNNB 5KDMA 5AVCD 5AV9B 4J8WC 5AV8C 5B0YC 3AZJA 4WJ3C 3REHA 5JRGB 3REJD 2HIOA 5B2IA 4ZUXC 4AWLB 1H3OB 2CV5C 1P3MA 2BYMA 3TU4C 3MNND 4KUDB 2F2AC 5CPKC 2Y2JA 3AYWA 1U35C 4M6BA 2NQBC 4WU9B 2F8NK 3AZKD 5AV6D 3W99C 3WKJD 3X1SC 3MGRA 1WWSA 3C1BB 3X1VD 3FDDA 1TZYD 4JJNB 3A1KA 1P34D 3H0MC 4XUJC 1P3KD 1F66A 4H9PA 1ZLAD 4UUZB 4XZQD 3MGQD 3VH6A 1KX4D 4X23D 3UTBD 3UTAA 4LD9A 4H9NA 3WA9A 4CSRA 1ID3B 2CV5D 4ZUXD 4G91B 2XD5A 5E5AC 4Z66D 3R45B 3AV1D 3AFAA 1S32A 2LY8A 2NZDA 3TU4D 3MGPC 3W98D 1P3GB 3KUYD 3REIB 3X1UC 3AN2A 5F99A 4HGAB 3AZEB 5KDMB 4QLCC 3MGSA 3AZJB 3REHB 1P3BD 1EQZC 5AY8D 5B2IB 2HIOB 2F8NA 5B32G 1P3MB 1M18A 2BYMB 3AZGA 3H0LC 3AZHA 1B67A 1HQ3C 2FJ7C 4XUJD 1KX5D 4WZSB 1P3OD 4H9OA 4NFTA 3VH5T 3AYWB 5AVBA 4KGCD 5GT3A 5AVCA 5B1MA 3UT9C 5B40C 5B33C 5B32D 4ZBJB 3WTPA 1ULYA 3LJAC 2PYOC 3MGRB 4R8PC 5B24C 3MNNA 3MGPD 3RELA 3KSYA 4UPKA 1F66B 4H9PB 5CP6A 3AZLC 3A1IA 3MVDD 3X1UD 3B6FD 3UTAB 4LD9B 5BT1C 4H9NB 3LZ1C 3KFUG 3WA9B 3LZ0A 4CSRB 4YS3A 3AZID 2Y2NA 1EQZD 2HUEB 2Y2HA 3X1TA 1S32B 2NZDB 2ZY3A 3AFAB 3KWQC 5JA4B 5B2JC 1BH9A 1P3KA 2FJ7D 1ZLAA 1KU5A 4XZQA 3MGQA 2BG1A 3REKA 5CPID 1KX3D 3UTBA 5C3IC 3AN2B 5F99B 5DNMD 4J8WA 5AV8A 3UT9D 5B40D 2ZY2A 5B0YA 3MGSB 2JCHA 2AROC 4R8PD 2F8NB 3TU4A 3REJC 5B24D 1M18B 3AZHB 3AZGB 3AV2D 1M19C 4WNNA 2Y2IA 5CPKA 4H9OB 2Y2OA 1U35A 3VH5W 4YM6D 2NQBA 5AVBB 5CPJD 5GT3B 4DRAA 5AVCB 3B0DB 5B1MB 3AZKC 4WU8D 1P3PC 3W99A 3WAAC 3X1SA 3WTPB 5AV6C 3WKJC 3AZNA 3X1VC 3MNNB 1TZYC 2UWXA 4J8XD 3RELB 4G92C 1P34C 5CP6B 3W97C 1P3FA 4X23C 4E44A 3B0BA 2CWEA 3LZ0B 4YS3B 3P5JB 2Y2PA 2AROD 5B31C 5E5AA 3X1TB 4EO5C 4Z5TD 4NE6A 4Z66C 2ZY5A 1T3UA 3AV1C 1BH9B 1P3KB 1M19D 1ZLAB 3W98C 4XZQB 3H0RC 3MGQB 3REKB 3X1UA 3KUYC 3UTBB 4NE5A 2YFWA 4QLCA 4J8WB 3B0CT 5AV8B 1P3PD 5B0YB 3WAAD 3VH5A 5GSUD 1EQZA 3W96D 3AZMC 1P3BC 5AY8C 3TU4B 5B31G 1HQ3A 4WNNB 1BFMA 5CPKB 1KX5C 1U35B 3W97D 1P3OC 2NQBB 2G5HC 5GXQC 4KGCC 5B33A 3W99B 3F6TA 2PYOA 3X1SB 3LJAA 5B31D 4R8PA 1P3AC 5B32C 5B24A 2RIQA 3AZNB 5GT0C 4H9SC 1P3LD 1AOID 5B1LC 5AV9D 3AZLA 1ID3C 1P3FB 5JRGD 3LZ1A 5BS7C 3MVDC 4G91C 3B6FC 1PZRA 3C1CC 3V9RA 3O62C 3AZMD 2FFFB 5E5AB 3AZIC 3KWQA 5B2JA 1JFIA 5CHLB 4WU9D 2Y2GA 3EPJA 3X1UB 2IO5B 5CPIC 1KX3C 3C1BD 2YFWB 4QLCB 2Y2LA 5GXQD 4H9QA 3B0CW 4JJND 5DNMC 2JSSA 1M1AC 1EQZB 1P3AD 1P3IC 3REJA 1HQ3B 1M19A 2F8NH 5GT0D 3AV2C 5B1LD 1ID3D 4ZBJC 4YM6C 5CPJC 5B33B 3AZKA 3C1CD 1Q9CA 3WAAA 1R4VA 2PYOB 3O62D 5AV6A 3LJAB 3LELC 4WU8C 3WKJA 4R8PB 1P3GD 3X1VA 5B24B 1TZYA 1P34A 4J8UC 3AZED 3AZFC 4J8XC 3AZLB 3AZJD 1KX4A 3REHD 3LZ1B 4X23A 1WWIA 2HIOD 3VH6T 3AFAC 1P3MD 3V9RB 1M1AD 5B31A 1P3ID 2CV5A 3A6NC 4ZUXA 1N1JA 4Z66A 3KWQB 5B2JB 3AYWD 3AV1A 2RVQD 2DF4C 4Z5TC 3W98A 1BH8A 5AV5C 3KUYA 5B0ZC 4Z2MH 3MGRD 4H9QB 4CAYA 3KXBC 3AZMA 3LELD 1F66D 1TAFA 5GSUC 4J8VC 3W96C 1P3BA 5AY8A 3REJB 1M19B 4J8UD 2W8SA 4LD9D 3AZFD 4XUJA 2ZY4A 1KX5A 3WA9D 1P3OA 2Y2MA 4KGCA 5GXQA 3AZKB 2NZDD 3AFAD 3WAAB 5AV6B
chains in the Genus database with same CATH topology
3WKJB 1P3AA 2F8NG 2Y2KA 5B32A 3A6ND 3X1VB 1TZYB 1P34B 5GT0A 4H9SA 3B6GC 3MGPA 5B1LA 5AV5D 1P3LC 1AOIC 3MGSD 3AL0C 5DNNC 5B0ZD 5FUGA 5AV9C 1KX4B 5BS7A 3MVDA 4X23B 3B6FA 3C1CA 3EG5B 5JRGC 2F8ND 3EPKA 4AWLC 1M18D 3O62A 3KXBD 3AZHD 5B31B 5BNXA 3AZIA 4J8VD 4WV4B 2CV5B 4Z66B 1N1JB 4ZUXB 4KUDC 3AV1B 5AVBD 3W98B 2FJ7A 1BH8B 2J8PA 5B1MD 4WU9C 3KUYB 5CPIA 1KX3A 3WTPD 4CAYB 5DNMA 5BO0A 3C1BC 3UT9A 1M1AA 5B40A 4JJNC 3RELD 3AZMB 1TAFB 1P3IA 1P3BB 5CP6D 5AY8B 3B6GD 3AV2A 4XUJB 4Z2MG 1KX5B 2ZM5A 1P3OB 3LZ0D 5DNND 4YS3D 4YM6A 4KGCB 5GXQB 3X1TD 5CPJA 3AZNC 4WU8A 3LELA 1P3AB 4E45A 5B32B 3EPHA 3REKD 1P3GC 4KUDD 4J8UA 5G49A 5GT0B 1P3FC 4KHAA 2VQRA 3MGPB 3AZFA 3REIC 4J8XA 1W2EA 5B1LB 4J8WD 5AV8D 4HGAC 3AZEC 5B0YD 5FUGB 3MVDB 3AZJC 3B6FB 3NQJA 3C1CB 3REHC 2Y2QA 2HIOC 5JA4A 5B2IC 3O62B 1P3MC 2JE5A 2G5IC 5BNXB 5CPKD 3AZIB 3A6NA 2AROA 2BYKA 4DQYB 1U35D 2XD1A 4Z5TA 2YFVA 2NQBD 2IO5C 1Z2CB 3AYWC 2FJ7B 2RVQC 5AV5A 5BNVA 5B0ZA 3W99D 3X1SD 5CPIB 1KX3B 5DNMB 5BO0B 3MGRC 2L5AA 3KXBA 3UT9B 3AZND 5B40B 1P3PA 1M1AB 5GSUA 4J8VA 3W96A 1P3IB 1F66C 1P3FD 3REID 3AV2B 3UTAC 4LD9C 3NQUA 4H9RA 3W97A 3WA9C 4YM6B 1A7WA 5CPJB 5E5AD 2HUEC 4NE3A 5B2ID 4WU8B 3LELB 1S32C 2NZDC 4DRBA 3B6GA 4J8UB 5G49B 4KHAB 3AZFB 4J8XB 4QLCD 1JFIB 2DQNC 1P3LA 1AOIA 3AN2C 5DNNA 5F99C 5AV9A 1HTAA 3MGSC 5JRGA 3NQJB 3IP4C 5C3IB 1H3OA 1HQ3D 1M18C 3AZGC 3AZHC 1B6WA 2AROB 3A6NB 2BYKB 4KUDA 4Z5TB 2YFVB 5AV5B 5AVBC 4WU9A 5BNVB 5GT3C 5B33D 3UTAD 5AVCC 3B0DC 5B0ZB 5B1MC 2PYOD 3LJAD 3WTPC 3C1BA 3KXBB 4JJNA 1P3PB 1S32D 5GSUB 3MNNC 4J8VB 3W96B 3RELC 3AZLD 4UUZA 5CP6C 5BT1D 3LZ1D 4G92B 3AN2D 5F99D 3NQUB 4H9RB 3W97B 3LZ0C 1ID3A 3EPLA 4YS3C 3KWQD 3X1TC 5B2JD 3R45A 3VH6W 1F1EA 3AZGD 1P3KC 1P3GA 3WTPE 4EO5B 1ZLAC 4XZQC 3B6GB 3MGQC 1KX4C 3REKC 3REIA 3UTBC 1P3LB 5GT3D 3AZEA 1AOIB 5DNNB 5KDMA 5AVCD 5AV9B 4J8WC 5AV8C 5B0YC 3AZJA 4WJ3C 3REHA 5JRGB 3REJD 2HIOA 5B2IA 4ZUXC 4AWLB 1H3OB 2CV5C 1P3MA 2BYMA 3TU4C 3MNND 4KUDB 2F2AC 5CPKC 2Y2JA 3AYWA 1U35C 4M6BA 2NQBC 4WU9B 2F8NK 3AZKD 5AV6D 3W99C 3WKJD 3X1SC 3MGRA 1WWSA 3C1BB 3X1VD 3FDDA 1TZYD 4JJNB 3A1KA 1P34D 3H0MC 4XUJC 1P3KD 1F66A 4H9PA 1ZLAD 4UUZB 4XZQD 3MGQD 3VH6A 1KX4D 4X23D 3UTBD 3UTAA 4LD9A 4H9NA 3WA9A 4CSRA 1ID3B 2CV5D 4ZUXD 4G91B 2XD5A 5E5AC 4Z66D 3R45B 3AV1D 3AFAA 1S32A 2LY8A 2NZDA 3TU4D 3MGPC 3W98D 1P3GB 3KUYD 3REIB 3X1UC 3AN2A 5F99A 4HGAB 3AZEB 5KDMB 4QLCC 3MGSA 3AZJB 3REHB 1P3BD 1EQZC 5AY8D 5B2IB 2HIOB 2F8NA 5B32G 1P3MB 1M18A 2BYMB 3AZGA 3H0LC 3AZHA 1B67A 1HQ3C 2FJ7C 4XUJD 1KX5D 4WZSB 1P3OD 4H9OA 4NFTA 3VH5T 3AYWB 5AVBA 4KGCD 5GT3A 5AVCA 5B1MA 3UT9C 5B40C 5B33C 5B32D 4ZBJB 3WTPA 1ULYA 3LJAC 2PYOC 3MGRB 4R8PC 5B24C 3MNNA 3MGPD 3RELA 3KSYA 4UPKA 1F66B 4H9PB 5CP6A 3AZLC 3A1IA 3MVDD 3X1UD 3B6FD 3UTAB 4LD9B 5BT1C 4H9NB 3LZ1C 3KFUG 3WA9B 3LZ0A 4CSRB 4YS3A 3AZID 2Y2NA 1EQZD 2HUEB 2Y2HA 3X1TA 1S32B 2NZDB 2ZY3A 3AFAB 3KWQC 5JA4B 5B2JC 1BH9A 1P3KA 2FJ7D 1ZLAA 1KU5A 4XZQA 3MGQA 2BG1A 3REKA 5CPID 1KX3D 3UTBA 5C3IC 3AN2B 5F99B 5DNMD 4J8WA 5AV8A 3UT9D 5B40D 2ZY2A 5B0YA 3MGSB 2JCHA 2AROC 4R8PD 2F8NB 3TU4A 3REJC 5B24D 1M18B 3AZHB 3AZGB 3AV2D 1M19C 4WNNA 2Y2IA 5CPKA 4H9OB 2Y2OA 1U35A 3VH5W 4YM6D 2NQBA 5AVBB 5CPJD 5GT3B 4DRAA 5AVCB 3B0DB 5B1MB 3AZKC 4WU8D 1P3PC 3W99A 3WAAC 3X1SA 3WTPB 5AV6C 3WKJC 3AZNA 3X1VC 3MNNB 1TZYC 2UWXA 4J8XD 3RELB 4G92C 1P34C 5CP6B 3W97C 1P3FA 4X23C 4E44A 3B0BA 2CWEA 3LZ0B 4YS3B 3P5JB 2Y2PA 2AROD 5B31C 5E5AA 3X1TB 4EO5C 4Z5TD 4NE6A 4Z66C 2ZY5A 1T3UA 3AV1C 1BH9B 1P3KB 1M19D 1ZLAB 3W98C 4XZQB 3H0RC 3MGQB 3REKB 3X1UA 3KUYC 3UTBB 4NE5A 2YFWA 4QLCA 4J8WB 3B0CT 5AV8B 1P3PD 5B0YB 3WAAD 3VH5A 5GSUD 1EQZA 3W96D 3AZMC 1P3BC 5AY8C 3TU4B 5B31G 1HQ3A 4WNNB 1BFMA 5CPKB 1KX5C 1U35B 3W97D 1P3OC 2NQBB 2G5HC 5GXQC 4KGCC 5B33A 3W99B 3F6TA 2PYOA 3X1SB 3LJAA 5B31D 4R8PA 1P3AC 5B32C 5B24A 2RIQA 3AZNB 5GT0C 4H9SC 1P3LD 1AOID 5B1LC 5AV9D 3AZLA 1ID3C 1P3FB 5JRGD 3LZ1A 5BS7C 3MVDC 4G91C 3B6FC 1PZRA 3C1CC 3V9RA 3O62C 3AZMD 2FFFB 5E5AB 3AZIC 3KWQA 5B2JA 1JFIA 5CHLB 4WU9D 2Y2GA 3EPJA 3X1UB 2IO5B 5CPIC 1KX3C 3C1BD 2YFWB 4QLCB 2Y2LA 5GXQD 4H9QA 3B0CW 4JJND 5DNMC 2JSSA 1M1AC 1EQZB 1P3AD 1P3IC 3REJA 1HQ3B 1M19A 2F8NH 5GT0D 3AV2C 5B1LD 1ID3D 4ZBJC 4YM6C 5CPJC 5B33B 3AZKA 3C1CD 1Q9CA 3WAAA 1R4VA 2PYOB 3O62D 5AV6A 3LJAB 3LELC 4WU8C 3WKJA 4R8PB 1P3GD 3X1VA 5B24B 1TZYA 1P34A 4J8UC 3AZED 3AZFC 4J8XC 3AZLB 3AZJD 1KX4A 3REHD 3LZ1B 4X23A 1WWIA 2HIOD 3VH6T 3AFAC 1P3MD 3V9RB 1M1AD 5B31A 1P3ID 2CV5A 3A6NC 4ZUXA 1N1JA 4Z66A 3KWQB 5B2JB 3AYWD 3AV1A 2RVQD 2DF4C 4Z5TC 3W98A 1BH8A 5AV5C 3KUYA 5B0ZC 4Z2MH 3MGRD 4H9QB 4CAYA 3KXBC 3AZMA 3LELD 1F66D 1TAFA 5GSUC 4J8VC 3W96C 1P3BA 5AY8A 3REJB 1M19B 4J8UD 2W8SA 4LD9D 3AZFD 4XUJA 2ZY4A 1KX5A 3WA9D 1P3OA 2Y2MA 4KGCA 5GXQA 3AZKB 2NZDD 3AFAD 3WAAB 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ B;  1P3A A;  2F8N G;  5B32 A;  3A6N D;  3X1V B;  1TZY B;  1P34 B;  5GT0 A;  4H9S A;  3B6G C;  3MGP A;  5B1L A;  5AV5 D;  1P3L C;  1AOI C;  3MGS D;  5DNN C;  5B0Z D;  5FUG A;  5AV9 C;  1KX4 B;  5BS7 A;  3MVD A;  4X23 B;  3B6F A;  3C1C A;  5JRG C;  2F8N D;  1M18 D;  4AWL C;  3O62 A;  3KXB D;  3AZH D;  5B31 B;  5BNX A;  3AZI A;  4J8V D;  4WV4 B;  2CV5 B;  4Z66 B;  1N1J B;  4ZUX B;  4KUD C;  3AV1 B;  5AVB D;  3W98 B;  2FJ7 A;  1BH8 B;  5B1M D;  4WU9 C;  3KUY B;  5CPI A;  1KX3 A;  3WTP D;  4CAY B;  5DNM A;  5BO0 A;  3C1B C;  3UT9 A;  1M1A A;  5B40 A;  4JJN C;  3REL D;  3AZM B;  1TAF B;  1P3I A;  1P3B B;  5CP6 D;  5AY8 B;  3B6G D;  3AV2 A;  4XUJ B;  4Z2M G;  1KX5 B;  1P3O B;  3LZ0 D;  5DNN D;  4YS3 D;  4YM6 A;  4KGC B;  5GXQ B;  3X1T D;  5CPJ A;  3AZN C;  4WU8 A;  3LEL A;  1P3A B;  4E45 A;  5B32 B;  3REK D;  1P3G C;  4KUD D;  4J8U A;  5G49 A;  5GT0 B;  1P3F C;  4KHA A;  3MGP B;  3AZF A;  3REI C;  4J8X A;  5B1L B;  4J8W D;  5AV8 D;  4HGA C;  3AZE C;  5B0Y D;  5FUG B;  3MVD B;  3AZJ C;  3B6F B;  3NQJ A;  3C1C B;  3REH C;  2HIO C;  5JA4 A;  5B2I C;  3O62 B;  1P3M C;  5BNX B;  5CPK D;  3AZI B;  3A6N A;  2ARO A;  2BYK A;  1U35 D;  4Z5T A;  2YFV A;  2NQB D;  2IO5 C;  3AYW C;  2FJ7 B;  2RVQ C;  5AV5 A;  5BNV A;  5B0Z A;  3W99 D;  3X1S D;  5CPI B;  1KX3 B;  5DNM B;  5BO0 B;  3MGR C;  2L5A A;  3KXB A;  3UT9 B;  3AZN D;  5B40 B;  1P3P A;  1M1A B;  5GSU A;  4J8V A;  3W96 A;  1P3I B;  1F66 C;  1P3F D;  3REI D;  3AV2 B;  3UTA C;  4LD9 C;  3NQU A;  4H9R A;  3W97 A;  3WA9 C;  4YM6 B;  1A7W A;  5CPJ B;  5E5A D;  2HUE C;  4NE3 A;  5B2I D;  4WU8 B;  3LEL B;  1S32 C;  2NZD C;  4DRB A;  3B6G A;  4J8U B;  5G49 B;  4KHA B;  3AZF B;  4J8X B;  4QLC D;  1JFI B;  1P3L A;  1AOI A;  3AN2 C;  5DNN A;  5F99 C;  5AV9 A;  1HTA A;  3MGS C;  5JRG A;  3NQJ B;  5C3I B;  1H3O A;  1HQ3 D;  1M18 C;  3AZG C;  3AZH C;  1B6W A;  2ARO B;  3A6N B;  2BYK B;  4KUD A;  4Z5T B;  2YFV B;  5AV5 B;  5AVB C;  4WU9 A;  5BNV B;  5GT3 C;  5B33 D;  3UTA D;  5AVC C;  3B0D C;  5B0Z B;  5B1M C;  2PYO D;  3LJA D;  3WTP C;  3C1B A;  3KXB B;  4JJN A;  1P3P B;  1S32 D;  5GSU B;  3MNN C;  4J8V B;  3W96 B;  3REL C;  3AZL D;  4UUZ A;  5CP6 C;  5BT1 D;  3LZ1 D;  4G92 B;  3AN2 D;  5F99 D;  3NQU B;  4H9R B;  3W97 B;  3LZ0 C;  1ID3 A;  4YS3 C;  3KWQ D;  3X1T C;  5B2J D;  3R45 A;  3VH6 W;  1F1E A;  3AZG D;  1P3K C;  1P3G A;  3WTP E;  4EO5 B;  1ZLA C;  4XZQ C;  3B6G B;  3MGQ C;  1KX4 C;  3REK C;  3REI A;  3UTB C;  1P3L B;  5GT3 D;  3AZE A;  1AOI B;  5DNN B;  5KDM A;  5AVC D;  5AV9 B;  4J8W C;  5AV8 C;  5B0Y C;  3AZJ A;  3REH A;  5JRG B;  3REJ D;  2HIO A;  5B2I A;  4ZUX C;  4AWL B;  1H3O B;  2CV5 C;  1P3M A;  2BYM A;  3TU4 C;  3MNN D;  4KUD B;  5CPK C;  3AYW A;  1U35 C;  4M6B A;  2NQB C;  4WU9 B;  2F8N K;  3AZK D;  5AV6 D;  3W99 C;  3WKJ D;  3X1S C;  3MGR A;  1WWS A;  3C1B B;  3X1V D;  1TZY D;  4JJN B;  1P34 D;  4XUJ C;  1P3K D;  1F66 A;  4H9P A;  1ZLA D;  4UUZ B;  4XZQ D;  3MGQ D;  3VH6 A;  1KX4 D;  4X23 D;  3UTB D;  3UTA A;  4LD9 A;  4H9N A;  3WA9 A;  4CSR A;  1ID3 B;  2CV5 D;  4ZUX D;  4G91 B;  4Z66 D;  5E5A C;  3R45 B;  3AV1 D;  3AFA A;  1S32 A;  2LY8 A;  2NZD A;  3TU4 D;  3MGP C;  3W98 D;  1P3G B;  3KUY D;  3REI B;  3X1U C;  3AN2 A;  5F99 A;  4HGA B;  3AZE B;  5KDM B;  4QLC C;  3MGS A;  3AZJ B;  3REH B;  1P3B D;  1EQZ C;  5AY8 D;  5B2I B;  2HIO B;  2F8N A;  5B32 G;  1P3M B;  1M18 A;  2BYM B;  3AZG A;  3AZH A;  2FJ7 C;  1B67 A;  1HQ3 C;  4XUJ D;  1KX5 D;  4WZS B;  1P3O D;  4H9O A;  4NFT A;  3VH5 T;  3AYW B;  5AVB A;  4KGC D;  5GT3 A;  5AVC A;  5B1M A;  3UT9 C;  5B40 C;  5B33 C;  5B32 D;  4ZBJ B;  3WTP A;  1ULY A;  3LJA C;  2PYO C;  3MGR B;  4R8P C;  5B24 C;  3MNN A;  3MGP D;  3REL A;  3KSY A;  1F66 B;  4H9P B;  5CP6 A;  3AZL C;  3MVD D;  3X1U D;  3B6F D;  3UTA B;  4LD9 B;  5BT1 C;  4H9N B;  3LZ1 C;  3WA9 B;  3LZ0 A;  4CSR B;  4YS3 A;  3AZI D;  1EQZ D;  2HUE B;  3X1T A;  1S32 B;  2NZD B;  3AFA B;  3KWQ C;  5JA4 B;  5B2J C;  1BH9 A;  1P3K A;  2FJ7 D;  1ZLA A;  1KU5 A;  4XZQ A;  3MGQ A;  3REK A;  5CPI D;  1KX3 D;  3UTB A;  5C3I C;  3AN2 B;  5F99 B;  5DNM D;  4J8W A;  5AV8 A;  3UT9 D;  5B40 D;  5B0Y A;  3MGS B;  2ARO C;  4R8P D;  2F8N B;  3TU4 A;  3REJ C;  5B24 D;  1M18 B;  3AZH B;  3AZG B;  3AV2 D;  1M19 C;  4WNN A;  5CPK A;  4H9O B;  1U35 A;  3VH5 W;  4YM6 D;  2NQB A;  5AVB B;  5CPJ D;  5GT3 B;  4DRA A;  5AVC B;  3B0D B;  5B1M B;  3AZK C;  4WU8 D;  1P3P C;  3W99 A;  3WAA C;  3X1S A;  3WTP B;  5AV6 C;  3WKJ C;  3AZN A;  3X1V C;  3MNN B;  1TZY C;  3REL B;  4J8X D;  1P34 C;  4G92 C;  5CP6 B;  3W97 C;  1P3F A;  4X23 C;  4E44 A;  3B0B A;  2CWE A;  3LZ0 B;  4YS3 B;  2ARO D;  5B31 C;  5E5A A;  3X1T B;  4EO5 C;  4Z5T D;  4NE6 A;  4Z66 C;  3AV1 C;  1BH9 B;  1P3K B;  1M19 D;  1ZLA B;  3W98 C;  4XZQ B;  3MGQ B;  3REK B;  3X1U A;  3KUY C;  3UTB B;  4NE5 A;  2YFW A;  4QLC A;  4J8W B;  3B0C T;  5AV8 B;  1P3P D;  5B0Y B;  3WAA D;  3VH5 A;  5GSU D;  1EQZ A;  3W96 D;  3AZM C;  1P3B C;  5AY8 C;  3TU4 B;  5B31 G;  1HQ3 A;  4WNN B;  1BFM A;  5CPK B;  1KX5 C;  1U35 B;  3W97 D;  1P3O C;  2NQB B;  4KGC C;  5GXQ C;  5B33 A;  3W99 B;  2PYO A;  3X1S B;  3LJA A;  5B31 D;  4R8P A;  1P3A C;  5B32 C;  5B24 A;  3AZN B;  5GT0 C;  4H9S C;  1P3L D;  1AOI D;  5B1L C;  5AV9 D;  3AZL A;  1ID3 C;  1P3F B;  5JRG D;  3LZ1 A;  5BS7 C;  3MVD C;  4G91 C;  3B6F C;  3C1C C;  3V9R A;  3O62 C;  3AZM D;  5E5A B;  3AZI C;  3KWQ A;  5B2J A;  1JFI A;  5CHL B;  4WU9 D;  3X1U B;  2IO5 B;  5CPI C;  1KX3 C;  3C1B D;  2YFW B;  4QLC B;  5GXQ D;  4H9Q A;  3B0C W;  4JJN D;  5DNM C;  2JSS A;  1M1A C;  1EQZ B;  1P3A D;  1P3I C;  3REJ A;  1HQ3 B;  1M19 A;  2F8N H;  5GT0 D;  3AV2 C;  5B1L D;  1ID3 D;  4ZBJ C;  4YM6 C;  5CPJ C;  5B33 B;  3AZK A;  3C1C D;  1Q9C A;  3WAA A;  1R4V A;  2PYO B;  3O62 D;  5AV6 A;  3LJA B;  3LEL C;  4WU8 C;  3WKJ A;  4R8P B;  1P3G D;  3X1V A;  5B24 B;  1TZY A;  1P34 A;  4J8U C;  3AZE D;  3AZF C;  4J8X C;  3AZL B;  3AZJ D;  1KX4 A;  3REH D;  3LZ1 B;  4X23 A;  1WWI A;  2HIO D;  3VH6 T;  3AFA C;  1P3M D;  3V9R B;  1M1A D;  5B31 A;  1P3I D;  2CV5 A;  3A6N C;  4ZUX A;  1N1J A;  4Z66 A;  3KWQ B;  5B2J B;  3AYW D;  3AV1 A;  2RVQ D;  4Z5T C;  3W98 A;  1BH8 A;  5AV5 C;  3KUY A;  5B0Z C;  4Z2M H;  3MGR D;  4H9Q B;  4CAY A;  3KXB C;  3AZM A;  3LEL D;  1F66 D;  1TAF A;  5GSU C;  4J8V C;  3W96 C;  1P3B A;  5AY8 A;  3REJ B;  1M19 B;  4J8U D;  4LD9 D;  3AZF D;  4XUJ A;  1KX5 A;  3WA9 D;  1P3O A;  4KGC A;  5GXQ A;  3AZK B;  2NZD D;  3AFA D;  3WAA B;  5AV6 B; 
#chains in the Genus database with same CATH topology
 3WKJ B;  1P3A A;  2F8N G;  2Y2K A;  5B32 A;  3A6N D;  3X1V B;  1TZY B;  1P34 B;  5GT0 A;  4H9S A;  3B6G C;  3MGP A;  5B1L A;  5AV5 D;  1P3L C;  1AOI C;  3MGS D;  3AL0 C;  5DNN C;  5B0Z D;  5FUG A;  5AV9 C;  1KX4 B;  5BS7 A;  3MVD A;  4X23 B;  3B6F A;  3C1C A;  3EG5 B;  5JRG C;  2F8N D;  3EPK A;  4AWL C;  1M18 D;  3O62 A;  3KXB D;  3AZH D;  5B31 B;  5BNX A;  3AZI A;  4J8V D;  4WV4 B;  2CV5 B;  4Z66 B;  1N1J B;  4ZUX B;  4KUD C;  3AV1 B;  5AVB D;  3W98 B;  2FJ7 A;  1BH8 B;  2J8P A;  5B1M D;  4WU9 C;  3KUY B;  5CPI A;  1KX3 A;  3WTP D;  4CAY B;  5DNM A;  5BO0 A;  3C1B C;  3UT9 A;  1M1A A;  5B40 A;  4JJN C;  3REL D;  3AZM B;  1TAF B;  1P3I A;  1P3B B;  5CP6 D;  5AY8 B;  3B6G D;  3AV2 A;  4XUJ B;  4Z2M G;  1KX5 B;  2ZM5 A;  1P3O B;  3LZ0 D;  5DNN D;  4YS3 D;  4YM6 A;  4KGC B;  5GXQ B;  3X1T D;  5CPJ A;  3AZN C;  4WU8 A;  3LEL A;  1P3A B;  4E45 A;  5B32 B;  3EPH A;  3REK D;  1P3G C;  4KUD D;  4J8U A;  5G49 A;  5GT0 B;  1P3F C;  4KHA A;  2VQR A;  3MGP B;  3AZF A;  3REI C;  4J8X A;  1W2E A;  5B1L B;  4J8W D;  5AV8 D;  4HGA C;  3AZE C;  5B0Y D;  5FUG B;  3MVD B;  3AZJ C;  3B6F B;  3NQJ A;  3C1C B;  3REH C;  2Y2Q A;  2HIO C;  5JA4 A;  5B2I C;  3O62 B;  1P3M C;  2JE5 A;  2G5I C;  5BNX B;  5CPK D;  3AZI B;  3A6N A;  2ARO A;  2BYK A;  4DQY B;  1U35 D;  2XD1 A;  4Z5T A;  2YFV A;  2NQB D;  2IO5 C;  1Z2C B;  3AYW C;  2FJ7 B;  2RVQ C;  5AV5 A;  5BNV A;  5B0Z A;  3W99 D;  3X1S D;  5CPI B;  1KX3 B;  5DNM B;  5BO0 B;  3MGR C;  2L5A A;  3KXB A;  3UT9 B;  3AZN D;  5B40 B;  1P3P A;  1M1A B;  5GSU A;  4J8V A;  3W96 A;  1P3I B;  1F66 C;  1P3F D;  3REI D;  3AV2 B;  3UTA C;  4LD9 C;  3NQU A;  4H9R A;  3W97 A;  3WA9 C;  4YM6 B;  1A7W A;  5CPJ B;  5E5A D;  2HUE C;  4NE3 A;  5B2I D;  4WU8 B;  3LEL B;  1S32 C;  2NZD C;  4DRB A;  3B6G A;  4J8U B;  5G49 B;  4KHA B;  3AZF B;  4J8X B;  4QLC D;  1JFI B;  2DQN C;  1P3L A;  1AOI A;  3AN2 C;  5DNN A;  5F99 C;  5AV9 A;  1HTA A;  3MGS C;  5JRG A;  3NQJ B;  3IP4 C;  5C3I B;  1H3O A;  1HQ3 D;  1M18 C;  3AZG C;  3AZH C;  1B6W A;  2ARO B;  3A6N B;  2BYK B;  4KUD A;  4Z5T B;  2YFV B;  5AV5 B;  5AVB C;  4WU9 A;  5BNV B;  5GT3 C;  5B33 D;  3UTA D;  5AVC C;  3B0D C;  5B0Z B;  5B1M C;  2PYO D;  3LJA D;  3WTP C;  3C1B A;  3KXB B;  4JJN A;  1P3P B;  1S32 D;  5GSU B;  3MNN C;  4J8V B;  3W96 B;  3REL C;  3AZL D;  4UUZ A;  5CP6 C;  5BT1 D;  3LZ1 D;  4G92 B;  3AN2 D;  5F99 D;  3NQU B;  4H9R B;  3W97 B;  3LZ0 C;  1ID3 A;  3EPL A;  4YS3 C;  3KWQ D;  3X1T C;  5B2J D;  3R45 A;  3VH6 W;  1F1E A;  3AZG D;  1P3K C;  1P3G A;  3WTP E;  4EO5 B;  1ZLA C;  4XZQ C;  3B6G B;  3MGQ C;  1KX4 C;  3REK C;  3REI A;  3UTB C;  1P3L B;  5GT3 D;  3AZE A;  1AOI B;  5DNN B;  5KDM A;  5AVC D;  5AV9 B;  4J8W C;  5AV8 C;  5B0Y C;  3AZJ A;  4WJ3 C;  3REH A;  5JRG B;  3REJ D;  2HIO A;  5B2I A;  4ZUX C;  4AWL B;  1H3O B;  2CV5 C;  1P3M A;  2BYM A;  3TU4 C;  3MNN D;  4KUD B;  2F2A C;  5CPK C;  2Y2J A;  3AYW A;  1U35 C;  4M6B A;  2NQB C;  4WU9 B;  2F8N K;  3AZK D;  5AV6 D;  3W99 C;  3WKJ D;  3X1S C;  3MGR A;  1WWS A;  3C1B B;  3X1V D;  3FDD A;  1TZY D;  4JJN B;  3A1K A;  1P34 D;  3H0M C;  4XUJ C;  1P3K D;  1F66 A;  4H9P A;  1ZLA D;  4UUZ B;  4XZQ D;  3MGQ D;  3VH6 A;  1KX4 D;  4X23 D;  3UTB D;  3UTA A;  4LD9 A;  4H9N A;  3WA9 A;  4CSR A;  1ID3 B;  2CV5 D;  4ZUX D;  4G91 B;  2XD5 A;  5E5A C;  4Z66 D;  3R45 B;  3AV1 D;  3AFA A;  1S32 A;  2LY8 A;  2NZD A;  3TU4 D;  3MGP C;  3W98 D;  1P3G B;  3KUY D;  3REI B;  3X1U C;  3AN2 A;  5F99 A;  4HGA B;  3AZE B;  5KDM B;  4QLC C;  3MGS A;  3AZJ B;  3REH B;  1P3B D;  1EQZ C;  5AY8 D;  5B2I B;  2HIO B;  2F8N A;  5B32 G;  1P3M B;  1M18 A;  2BYM B;  3AZG A;  3H0L C;  3AZH A;  1B67 A;  1HQ3 C;  2FJ7 C;  4XUJ D;  1KX5 D;  4WZS B;  1P3O D;  4H9O A;  4NFT A;  3VH5 T;  3AYW B;  5AVB A;  4KGC D;  5GT3 A;  5AVC A;  5B1M A;  3UT9 C;  5B40 C;  5B33 C;  5B32 D;  4ZBJ B;  3WTP A;  1ULY A;  3LJA C;  2PYO C;  3MGR B;  4R8P C;  5B24 C;  3MNN A;  3MGP D;  3REL A;  3KSY A;  4UPK A;  1F66 B;  4H9P B;  5CP6 A;  3AZL C;  3A1I A;  3MVD D;  3X1U D;  3B6F D;  3UTA B;  4LD9 B;  5BT1 C;  4H9N B;  3LZ1 C;  3KFU G;  3WA9 B;  3LZ0 A;  4CSR B;  4YS3 A;  3AZI D;  2Y2N A;  1EQZ D;  2HUE B;  2Y2H A;  3X1T A;  1S32 B;  2NZD B;  2ZY3 A;  3AFA B;  3KWQ C;  5JA4 B;  5B2J C;  1BH9 A;  1P3K A;  2FJ7 D;  1ZLA A;  1KU5 A;  4XZQ A;  3MGQ A;  2BG1 A;  3REK A;  5CPI D;  1KX3 D;  3UTB A;  5C3I C;  3AN2 B;  5F99 B;  5DNM D;  4J8W A;  5AV8 A;  3UT9 D;  5B40 D;  2ZY2 A;  5B0Y A;  3MGS B;  2JCH A;  2ARO C;  4R8P D;  2F8N B;  3TU4 A;  3REJ C;  5B24 D;  1M18 B;  3AZH B;  3AZG B;  3AV2 D;  1M19 C;  4WNN A;  2Y2I A;  5CPK A;  4H9O B;  2Y2O A;  1U35 A;  3VH5 W;  4YM6 D;  2NQB A;  5AVB B;  5CPJ D;  5GT3 B;  4DRA A;  5AVC B;  3B0D B;  5B1M B;  3AZK C;  4WU8 D;  1P3P C;  3W99 A;  3WAA C;  3X1S A;  3WTP B;  5AV6 C;  3WKJ C;  3AZN A;  3X1V C;  3MNN B;  1TZY C;  2UWX A;  4J8X D;  3REL B;  4G92 C;  1P34 C;  5CP6 B;  3W97 C;  1P3F A;  4X23 C;  4E44 A;  3B0B A;  2CWE A;  3LZ0 B;  4YS3 B;  3P5J B;  2Y2P A;  2ARO D;  5B31 C;  5E5A A;  3X1T B;  4EO5 C;  4Z5T D;  4NE6 A;  4Z66 C;  2ZY5 A;  1T3U A;  3AV1 C;  1BH9 B;  1P3K B;  1M19 D;  1ZLA B;  3W98 C;  4XZQ B;  3H0R C;  3MGQ B;  3REK B;  3X1U A;  3KUY C;  3UTB B;  4NE5 A;  2YFW A;  4QLC A;  4J8W B;  3B0C T;  5AV8 B;  1P3P D;  5B0Y B;  3WAA D;  3VH5 A;  5GSU D;  1EQZ A;  3W96 D;  3AZM C;  1P3B C;  5AY8 C;  3TU4 B;  5B31 G;  1HQ3 A;  4WNN B;  1BFM A;  5CPK B;  1KX5 C;  1U35 B;  3W97 D;  1P3O C;  2NQB B;  2G5H C;  5GXQ C;  4KGC C;  5B33 A;  3W99 B;  3F6T A;  2PYO A;  3X1S B;  3LJA A;  5B31 D;  4R8P A;  1P3A C;  5B32 C;  5B24 A;  2RIQ A;  3AZN B;  5GT0 C;  4H9S C;  1P3L D;  1AOI D;  5B1L C;  5AV9 D;  3AZL A;  1ID3 C;  1P3F B;  5JRG D;  3LZ1 A;  5BS7 C;  3MVD C;  4G91 C;  3B6F C;  1PZR A;  3C1C C;  3V9R A;  3O62 C;  3AZM D;  2FFF B;  5E5A B;  3AZI C;  3KWQ A;  5B2J A;  1JFI A;  5CHL B;  4WU9 D;  2Y2G A;  3EPJ A;  3X1U B;  2IO5 B;  5CPI C;  1KX3 C;  3C1B D;  2YFW B;  4QLC B;  2Y2L A;  5GXQ D;  4H9Q A;  3B0C W;  4JJN D;  5DNM C;  2JSS A;  1M1A C;  1EQZ B;  1P3A D;  1P3I C;  3REJ A;  1HQ3 B;  1M19 A;  2F8N H;  5GT0 D;  3AV2 C;  5B1L D;  1ID3 D;  4ZBJ C;  4YM6 C;  5CPJ C;  5B33 B;  3AZK A;  3C1C D;  1Q9C A;  3WAA A;  1R4V A;  2PYO B;  3O62 D;  5AV6 A;  3LJA B;  3LEL C;  4WU8 C;  3WKJ A;  4R8P B;  1P3G D;  3X1V A;  5B24 B;  1TZY A;  1P34 A;  4J8U C;  3AZE D;  3AZF C;  4J8X C;  3AZL B;  3AZJ D;  1KX4 A;  3REH D;  3LZ1 B;  4X23 A;  1WWI A;  2HIO D;  3VH6 T;  3AFA C;  1P3M D;  3V9R B;  1M1A D;  5B31 A;  1P3I D;  2CV5 A;  3A6N C;  4ZUX A;  1N1J A;  4Z66 A;  3KWQ B;  5B2J B;  3AYW D;  3AV1 A;  2RVQ D;  2DF4 C;  4Z5T C;  3W98 A;  1BH8 A;  5AV5 C;  3KUY A;  5B0Z C;  4Z2M H;  3MGR D;  4H9Q B;  4CAY A;  3KXB C;  3AZM A;  3LEL D;  1F66 D;  1TAF A;  5GSU C;  4J8V C;  3W96 C;  1P3B A;  5AY8 A;  3REJ B;  1M19 B;  4J8U D;  2W8S A;  4LD9 D;  3AZF D;  4XUJ A;  2ZY4 A;  1KX5 A;  3WA9 D;  1P3O A;  2Y2M A;  4KGC A;  5GXQ A;  3AZK B;  2NZD D;  3AFA D;  3WAA B;  5AV6 B; 
#chains in the Genus database with same CATH homology
 3WKJ B;  1P3A A;  2F8N G;  2Y2K A;  5B32 A;  3A6N D;  3X1V B;  1TZY B;  1P34 B;  5GT0 A;  4H9S A;  3B6G C;  3MGP A;  5B1L A;  5AV5 D;  1P3L C;  1AOI C;  3MGS D;  3AL0 C;  5DNN C;  5B0Z D;  5FUG A;  5AV9 C;  1KX4 B;  5BS7 A;  3MVD A;  4X23 B;  3B6F A;  3C1C A;  3EG5 B;  5JRG C;  2F8N D;  3EPK A;  4AWL C;  1M18 D;  3O62 A;  3KXB D;  3AZH D;  5B31 B;  5BNX A;  3AZI A;  4J8V D;  4WV4 B;  2CV5 B;  4Z66 B;  1N1J B;  4ZUX B;  4KUD C;  3AV1 B;  5AVB D;  3W98 B;  2FJ7 A;  1BH8 B;  2J8P A;  5B1M D;  4WU9 C;  3KUY B;  5CPI A;  1KX3 A;  3WTP D;  4CAY B;  5DNM A;  5BO0 A;  3C1B C;  3UT9 A;  1M1A A;  5B40 A;  4JJN C;  3REL D;  3AZM B;  1TAF B;  1P3I A;  1P3B B;  5CP6 D;  5AY8 B;  3B6G D;  3AV2 A;  4XUJ B;  4Z2M G;  1KX5 B;  2ZM5 A;  1P3O B;  3LZ0 D;  5DNN D;  4YS3 D;  4YM6 A;  4KGC B;  5GXQ B;  3X1T D;  5CPJ A;  3AZN C;  4WU8 A;  3LEL A;  1P3A B;  4E45 A;  5B32 B;  3EPH A;  3REK D;  1P3G C;  4KUD D;  4J8U A;  5G49 A;  5GT0 B;  1P3F C;  4KHA A;  2VQR A;  3MGP B;  3AZF A;  3REI C;  4J8X A;  1W2E A;  5B1L B;  4J8W D;  5AV8 D;  4HGA C;  3AZE C;  5B0Y D;  5FUG B;  3MVD B;  3AZJ C;  3B6F B;  3NQJ A;  3C1C B;  3REH C;  2Y2Q A;  2HIO C;  5JA4 A;  5B2I C;  3O62 B;  1P3M C;  2JE5 A;  2G5I C;  5BNX B;  5CPK D;  3AZI B;  3A6N A;  2ARO A;  2BYK A;  4DQY B;  1U35 D;  2XD1 A;  4Z5T A;  2YFV A;  2NQB D;  2IO5 C;  1Z2C B;  3AYW C;  2FJ7 B;  2RVQ C;  5AV5 A;  5BNV A;  5B0Z A;  3W99 D;  3X1S D;  5CPI B;  1KX3 B;  5DNM B;  5BO0 B;  3MGR C;  2L5A A;  3KXB A;  3UT9 B;  3AZN D;  5B40 B;  1P3P A;  1M1A B;  5GSU A;  4J8V A;  3W96 A;  1P3I B;  1F66 C;  1P3F D;  3REI D;  3AV2 B;  3UTA C;  4LD9 C;  3NQU A;  4H9R A;  3W97 A;  3WA9 C;  4YM6 B;  1A7W A;  5CPJ B;  5E5A D;  2HUE C;  4NE3 A;  5B2I D;  4WU8 B;  3LEL B;  1S32 C;  2NZD C;  4DRB A;  3B6G A;  4J8U B;  5G49 B;  4KHA B;  3AZF B;  4J8X B;  4QLC D;  1JFI B;  2DQN C;  1P3L A;  1AOI A;  3AN2 C;  5DNN A;  5F99 C;  5AV9 A;  1HTA A;  3MGS C;  5JRG A;  3NQJ B;  3IP4 C;  5C3I B;  1H3O A;  1HQ3 D;  1M18 C;  3AZG C;  3AZH C;  1B6W A;  2ARO B;  3A6N B;  2BYK B;  4KUD A;  4Z5T B;  2YFV B;  5AV5 B;  5AVB C;  4WU9 A;  5BNV B;  5GT3 C;  5B33 D;  3UTA D;  5AVC C;  3B0D C;  5B0Z B;  5B1M C;  2PYO D;  3LJA D;  3WTP C;  3C1B A;  3KXB B;  4JJN A;  1P3P B;  1S32 D;  5GSU B;  3MNN C;  4J8V B;  3W96 B;  3REL C;  3AZL D;  4UUZ A;  5CP6 C;  5BT1 D;  3LZ1 D;  4G92 B;  3AN2 D;  5F99 D;  3NQU B;  4H9R B;  3W97 B;  3LZ0 C;  1ID3 A;  3EPL A;  4YS3 C;  3KWQ D;  3X1T C;  5B2J D;  3R45 A;  3VH6 W;  1F1E A;  3AZG D;  1P3K C;  1P3G A;  3WTP E;  4EO5 B;  1ZLA C;  4XZQ C;  3B6G B;  3MGQ C;  1KX4 C;  3REK C;  3REI A;  3UTB C;  1P3L B;  5GT3 D;  3AZE A;  1AOI B;  5DNN B;  5KDM A;  5AVC D;  5AV9 B;  4J8W C;  5AV8 C;  5B0Y C;  3AZJ A;  4WJ3 C;  3REH A;  5JRG B;  3REJ D;  2HIO A;  5B2I A;  4ZUX C;  4AWL B;  1H3O B;  2CV5 C;  1P3M A;  2BYM A;  3TU4 C;  3MNN D;  4KUD B;  2F2A C;  5CPK C;  2Y2J A;  3AYW A;  1U35 C;  4M6B A;  2NQB C;  4WU9 B;  2F8N K;  3AZK D;  5AV6 D;  3W99 C;  3WKJ D;  3X1S C;  3MGR A;  1WWS A;  3C1B B;  3X1V D;  3FDD A;  1TZY D;  4JJN B;  3A1K A;  1P34 D;  3H0M C;  4XUJ C;  1P3K D;  1F66 A;  4H9P A;  1ZLA D;  4UUZ B;  4XZQ D;  3MGQ D;  3VH6 A;  1KX4 D;  4X23 D;  3UTB D;  3UTA A;  4LD9 A;  4H9N A;  3WA9 A;  4CSR A;  1ID3 B;  2CV5 D;  4ZUX D;  4G91 B;  2XD5 A;  5E5A C;  4Z66 D;  3R45 B;  3AV1 D;  3AFA A;  1S32 A;  2LY8 A;  2NZD A;  3TU4 D;  3MGP C;  3W98 D;  1P3G B;  3KUY D;  3REI B;  3X1U C;  3AN2 A;  5F99 A;  4HGA B;  3AZE B;  5KDM B;  4QLC C;  3MGS A;  3AZJ B;  3REH B;  1P3B D;  1EQZ C;  5AY8 D;  5B2I B;  2HIO B;  2F8N A;  5B32 G;  1P3M B;  1M18 A;  2BYM B;  3AZG A;  3H0L C;  3AZH A;  1B67 A;  1HQ3 C;  2FJ7 C;  4XUJ D;  1KX5 D;  4WZS B;  1P3O D;  4H9O A;  4NFT A;  3VH5 T;  3AYW B;  5AVB A;  4KGC D;  5GT3 A;  5AVC A;  5B1M A;  3UT9 C;  5B40 C;  5B33 C;  5B32 D;  4ZBJ B;  3WTP A;  1ULY A;  3LJA C;  2PYO C;  3MGR B;  4R8P C;  5B24 C;  3MNN A;  3MGP D;  3REL A;  3KSY A;  4UPK A;  1F66 B;  4H9P B;  5CP6 A;  3AZL C;  3A1I A;  3MVD D;  3X1U D;  3B6F D;  3UTA B;  4LD9 B;  5BT1 C;  4H9N B;  3LZ1 C;  3KFU G;  3WA9 B;  3LZ0 A;  4CSR B;  4YS3 A;  3AZI D;  2Y2N A;  1EQZ D;  2HUE B;  2Y2H A;  3X1T A;  1S32 B;  2NZD B;  2ZY3 A;  3AFA B;  3KWQ C;  5JA4 B;  5B2J C;  1BH9 A;  1P3K A;  2FJ7 D;  1ZLA A;  1KU5 A;  4XZQ A;  3MGQ A;  2BG1 A;  3REK A;  5CPI D;  1KX3 D;  3UTB A;  5C3I C;  3AN2 B;  5F99 B;  5DNM D;  4J8W A;  5AV8 A;  3UT9 D;  5B40 D;  2ZY2 A;  5B0Y A;  3MGS B;  2JCH A;  2ARO C;  4R8P D;  2F8N B;  3TU4 A;  3REJ C;  5B24 D;  1M18 B;  3AZH B;  3AZG B;  3AV2 D;  1M19 C;  4WNN A;  2Y2I A;  5CPK A;  4H9O B;  2Y2O A;  1U35 A;  3VH5 W;  4YM6 D;  2NQB A;  5AVB B;  5CPJ D;  5GT3 B;  4DRA A;  5AVC B;  3B0D B;  5B1M B;  3AZK C;  4WU8 D;  1P3P C;  3W99 A;  3WAA C;  3X1S A;  3WTP B;  5AV6 C;  3WKJ C;  3AZN A;  3X1V C;  3MNN B;  1TZY C;  2UWX A;  4J8X D;  3REL B;  4G92 C;  1P34 C;  5CP6 B;  3W97 C;  1P3F A;  4X23 C;  4E44 A;  3B0B A;  2CWE A;  3LZ0 B;  4YS3 B;  3P5J B;  2Y2P A;  2ARO D;  5B31 C;  5E5A A;  3X1T B;  4EO5 C;  4Z5T D;  4NE6 A;  4Z66 C;  2ZY5 A;  1T3U A;  3AV1 C;  1BH9 B;  1P3K B;  1M19 D;  1ZLA B;  3W98 C;  4XZQ B;  3H0R C;  3MGQ B;  3REK B;  3X1U A;  3KUY C;  3UTB B;  4NE5 A;  2YFW A;  4QLC A;  4J8W B;  3B0C T;  5AV8 B;  1P3P D;  5B0Y B;  3WAA D;  3VH5 A;  5GSU D;  1EQZ A;  3W96 D;  3AZM C;  1P3B C;  5AY8 C;  3TU4 B;  5B31 G;  1HQ3 A;  4WNN B;  1BFM A;  5CPK B;  1KX5 C;  1U35 B;  3W97 D;  1P3O C;  2NQB B;  2G5H C;  5GXQ C;  4KGC C;  5B33 A;  3W99 B;  3F6T A;  2PYO A;  3X1S B;  3LJA A;  5B31 D;  4R8P A;  1P3A C;  5B32 C;  5B24 A;  2RIQ A;  3AZN B;  5GT0 C;  4H9S C;  1P3L D;  1AOI D;  5B1L C;  5AV9 D;  3AZL A;  1ID3 C;  1P3F B;  5JRG D;  3LZ1 A;  5BS7 C;  3MVD C;  4G91 C;  3B6F C;  1PZR A;  3C1C C;  3V9R A;  3O62 C;  3AZM D;  2FFF B;  5E5A B;  3AZI C;  3KWQ A;  5B2J A;  1JFI A;  5CHL B;  4WU9 D;  2Y2G A;  3EPJ A;  3X1U B;  2IO5 B;  5CPI C;  1KX3 C;  3C1B D;  2YFW B;  4QLC B;  2Y2L A;  5GXQ D;  4H9Q A;  3B0C W;  4JJN D;  5DNM C;  2JSS A;  1M1A C;  1EQZ B;  1P3A D;  1P3I C;  3REJ A;  1HQ3 B;  1M19 A;  2F8N H;  5GT0 D;  3AV2 C;  5B1L D;  1ID3 D;  4ZBJ C;  4YM6 C;  5CPJ C;  5B33 B;  3AZK A;  3C1C D;  1Q9C A;  3WAA A;  1R4V A;  2PYO B;  3O62 D;  5AV6 A;  3LJA B;  3LEL C;  4WU8 C;  3WKJ A;  4R8P B;  1P3G D;  3X1V A;  5B24 B;  1TZY A;  1P34 A;  4J8U C;  3AZE D;  3AZF C;  4J8X C;  3AZL B;  3AZJ D;  1KX4 A;  3REH D;  3LZ1 B;  4X23 A;  1WWI A;  2HIO D;  3VH6 T;  3AFA C;  1P3M D;  3V9R B;  1M1A D;  5B31 A;  1P3I D;  2CV5 A;  3A6N C;  4ZUX A;  1N1J A;  4Z66 A;  3KWQ B;  5B2J B;  3AYW D;  3AV1 A;  2RVQ D;  2DF4 C;  4Z5T C;  3W98 A;  1BH8 A;  5AV5 C;  3KUY A;  5B0Z C;  4Z2M H;  3MGR D;  4H9Q B;  4CAY A;  3KXB C;  3AZM A;  3LEL D;  1F66 D;  1TAF A;  5GSU C;  4J8V C;  3W96 C;  1P3B A;  5AY8 A;  3REJ B;  1M19 B;  4J8U D;  2W8S A;  4LD9 D;  3AZF D;  4XUJ A;  2ZY4 A;  1KX5 A;  3WA9 D;  1P3O A;  2Y2M A;  4KGC A;  5GXQ A;  3AZK B;  2NZD D;  3AFA D;  3WAA B;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...