4XZQC

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqC00
3REHA 1H3OA 3VH6W 3X1TD 5CPIB 3AZGC 5GXQA 1P3PC 3MNNC 4J8XD 3X1TA 2CWEA 3O62D 3AZGB 1U35C 3LELD 4JJNC 1P3PB 1Q9CA 1ULYA 3MNNB 5FUGA 3MGPC 4J8XA 3AZGD 4KHAB 1P3PD 3MNND 3O62A 3LELA 1U35B 4JJNB 5B2IC 3AZGA 3MGPB 1U35D 1EQZC 4JJND 1M18D 1P3PA 2NZDC 5B32G 4X23C 1F66D 3MNNA 2PYOD 4YS3B 2BYKB 4KHAA 1N1JB 4M6BA 3LZ1C 3AFAD 5B2IB 1U35A 1EQZB 4JJNA 4R8PC 1M18A 2NZDB 4WNNB 1F66A 4X23B 2PYOA 1EQZD 3TU4C 5B2JC 2NZDD 4X23D 3LZ1B 2BYKA 3AFAA 4R8PB 5JA4B 3LJAC 4R8PD 3TU4B 5B2JB 3B0DC 4X23A 3NQJB 2NZDA 3B0CW 3TU4D 1P3MC 5C3IC 3AZFC 3LJAB 2LY8A 2YFWA 1P3OC 4R8PA 4Z2MG 5JA4A 3B0DB 5GT0C 3LJAD 4KGCC 3TU4A 1P3MB 4UUZB 3NQJA 5C3IB 3AZFB 1P3MD 1P3OB 3AZFD 3LJAA 5GT0B 4YM6C 4KGCB 3AYWD 5GT0D 4J8VC 4J8UD 4UUZA 1P3MA 3AZFA 4H9NB 4YM6B 1BFMA 3REKD 3AYWA 5GT0A 4YM6D 4J8VB 4J8UA 4KUDC 5B31C 4Z66C 2NQBC 1WWIA 3AV1C 4H9NA 3REKA 3MVDD 4Z5TC 4YM6A 1P3IC 3WKJD 4KUDB 5CP6C 4Z66B 5B31B 2HIOC 3AV1B 3C1BD 1KX3C 4H9OA 4Z66D 3MVDA 2NQBD 4Z5TB 1P3IB 3WKJA 3RELC 1P3FC 1AOID 4Z5TD 5CP6B 1P3ID 4ZUXC 2HIOB 4EO5C 1P3GC 3C1BA 1KX3B 5CP6D 4Z66A 2NQBA 5AV9C 1KX3D 3RELB 4J8WC 1P3FB 5GT3C 4H9RA 4Z5TA 1BH9A 3KSYA 3V9RB 4ZUXB 1P3IA 1AOIA 4EO5B 1P3GB 1ID3C 5CP6A 4ZUXD 5AV9B 1P3GD 5DNMC 3AZHC 4J8WB 5GT3B 3VH5W 4J8WD 5GT3D 3V9RA 1ID3B 4ZUXA 3AZMD 1P3GA 3AZHB 1S32C 1ZLAC 3NQUB 4NFTA 5DNMD 4J8WA 5GT3A 1TZYC 1P3KD 3AZMA 4XZQC 5E5AD 1S32B 1ZLAB 5DNMA 5B1MC 1ZLAD 5GXQC 5B1LD 1TZYB 4Z2MH 1P3KA 3X1UD 4XZQB 5E5AA 2RVQD 1TZYD 4XZQD 3X1TC 3KWQD 4DRAA 5B1MB 1ZLAA 5GXQB 5B1LA 3X1UA 5B1MD 4J8XC 5GXQD 1TZYA 3C1CC 4XZQA 3X1TB 3KWQA 3O62C 4H9QB 3LELC 5B1MA 4J8XB 5FUGB 3C1CB 2YFVA 3C1CD 3O62B 3LELB 3MGSC 4H9QA 1M18C 1F66C 2PYOC 3C1CA 3MGSB 3AFAC 1M18B 3MGSD 1F66B 2PYOB 5DNNC 4WU9C 2AROD 5AVCD 3AFAB 3MGSA 3WTPE 4NE6A 3VH5T 5DNNB 3AV2D 3VH6A 4WU9B 2AROA 1P3LC 4H9PA 5AVCA 5DNND 5B31G 4WU9D 5AY8C 3X1VD 4CAYB 2YFWB 3AV2A 4AWLC 4G91C 1P3LB 5DNNA 4WU9A 5AY8B 1P3LD 3X1VA 3AZID 5AY8D 1P3BC 4AWLB 4G91B 4CAYA 3AYWC 1P3LA 4WV4B 4J8UC 3AZIA 4E45A 5AY8A 5CHLB 1P3BB 1M19D 5KDMB 3MGQC 1P3BD 3REKC 3AYWB 2F8NB 4J8UB 4DRBA 1M19A 2F8ND 3MGQB 5B40C 3UTBD 1P3BA 5KDMA 3REKB 3MGQD 5AVBC 5AV6D 3MVDC 3WKJC 2F8NA 5B40B 3UTBA 3C1BC 1KX5C 4H9OB 3MGQA 5AV6A 5AVBB 5B40D 3MVDB 4QLCC 3WKJB 1AOIC 5AVBD 3WA9D 2CV5C 3A6NC 3W97C 3C1BB 1HQ3D 1KX5B 2NQBB 5F99D 5B40A 5GSUC 1JFIA 4QLCB 1KX5D 5AVBA 4H9RB 1B6WA 1BH9B 1AOIB 3WA9A 2F8NK 4QLCD 3R45B 4E44A 3A6NB 2CV5B 3W97B 1HQ3A 1TAFB 5F99A 5B0YD 3A6ND 2CV5D 5GSUB 3W97D 1KX5A 2HUEC 2BYMB 5GSUD 4XUJA 4QLCA 5B32D 1P34D 3R45A 5B0YA 3A6NA 3AZMC 3W97A 2CV5A 2FJ7D 4NE3A 1TAFA 2HUEB 3MGRC 5GSUA 4HGAC 2BYMA 5B32A 1P34A 1P3KC 3AZMB 3W96C 5E5AC 4ZBJC 2FJ7A 3MGRB 4HGAB 5DNMB 5CPKC 5B1LC 3MGRD 3X1UC 1P3KB 3W96B 5E5AB 3AZLC 2RVQC 4ZBJB 3W96D 1BH8A 3KWQC 5CPKB 4LD9C 3MGRA 5B1LB 3X1UB 3AZLB 5CPKD 3REID 3W96A 3AZLD 3KWQB 4LD9B 4H9SC 3AZNC 5CPKA 4LD9D 3REIA 3REJC 3WAAC 3AZLA 2YFVB 5B0ZD 3AZNB 4LD9A 5JRGD 5AV8D 5BNVA 3REJB 3AZND 3WAAB 1KX4D 3UTAA 3REJD 3AN2C 3WAAD 5B0ZA 5BT1C 5JRGA 5AV5C 4H9SA 5AV8A 3AZNA 1KX4A 3W99A 3REJA 3AN2B 2F8NG 2L5AA 3KUYA 3WAAA 2AROC 5AVCC 3AN2D 5AV5B 5BT1D 1P3AD 4G92C 4WU8D 5AV5D 3AV2C 2AROB 4H9PB 5AVCB 3AN2A 1P3AA 4G92B 3X1SC 3X1VC 4WU8A 5AV5A 1R4VA 3AV2B 5CPID 3AZEC 5BO0B 3X1SB 3X1VB 3AZIC 5CPIA 3X1SD 3B6FC 3AZEB 2IO5C 5B33C 4YS3C 3AZED 3AZIB 3AZJC 5BO0A 3WTPC 1M19C 3X1SA 3AZKC 3B6FB 2IO5B 5B33B 3MGPD 3B6FD 3AZEA 5B33D 3AZJB 4YS3D 3WTPB 1M19B 3B0BA 3UTBC 3AZKB 3AZJD 3WTPD 5B2ID 5AV6C 3MGPA 3LZ0C 3AZKD 3B6FA 5B33A 4YS3A 3UTBB 1N1JA 3AZJA 3LZ1D 3WTPA 5B2IA 1EQZA 5AV6B 3LZ0B 3AZKA 5BS7C 4WNNA 1M1AC 3UT9C 3LZ0D 3WA9C 5B2JD 3LZ1A 1HQ3C 5F99C 1JFIB 1M1AB 3UT9B 3LZ0A 3WA9B 5B2JA 4XUJC 1M1AD 1HQ3B 3UT9D 5B0YC 5F99B 1P3OD 5BS7A 4XUJB 5B24C 5CPJC 1M1AA 5BNXB 3VH6T 5B32C 3UT9A 1P34C 2F8NH 4XUJD 4KGCD 5B0YB 2FJ7C 5G49B 1P3OA 5B24B 5CPJB 5B32B 1P34B 4KGCA 5B24D 5CPJD 5BNXA 2FJ7B 4J8VD 1F1EA 3KXBC 5G49A 4WZSB 5B24A 5CPJA 3B6GC 4J8VA 4KUDD 4CSRB 3KXBB 1BH8B 5B31D 2JSSA 3AV1D 3KXBD 3B6GB 3REIC 4KUDA 3B6GD 5B31A 2HIOD 4CSRA 3AV1A 3KXBA 1HTAA 3REIB 3RELD 1P3FD 3B6GA 1WWSA 3UTAC 2HIOA 1B67A 5B0ZC 1KX3A 3W98C 5AV9D 5JRGC 5AV8C 3RELA 5BNVB 3B0CT 1P3FA 1KX4C 3W99C 3UTAB 5B0ZB 3KUYC 1ID3D 3UTAD 3W98B 1A7WA 5AV9A 5JRGB 3VH5A 5AV8B 3AZHD 4NE5A 3W98D 1KX4B 3REHC 3W99B 1ID3A 3KUYB 3W99D 3AZHA 3KUYD 1S32D 1P3AC 3W98A 3NQUA 4WU8C 3REHB 3REHD 1H3OB 1S32A 1P3AB 4WU8B 5CPIC 1KU5A
chains in the Genus database with same CATH superfamily
3REHA 3IP4C 1H3OA 3VH6W 3X1TD 5CPIB 3AZGC 5GXQA 1P3PC 3MNNC 4J8XD 3X1TA 2CWEA 2Y2HA 3O62D 3AZGB 1U35C 3LELD 4JJNC 1P3PB 2ZY5A 1Q9CA 1ULYA 3MNNB 5FUGA 3MGPC 4J8XA 3AZGD 4KHAB 1P3PD 3MNND 3O62A 3LELA 1U35B 4JJNB 5B2IC 3AZGA 3MGPB 1U35D 1EQZC 4JJND 1M18D 1P3PA 2NZDC 5B32G 4X23C 1F66D 3MNNA 2PYOD 4YS3B 2BYKB 2RIQA 4KHAA 1N1JB 2UWXA 4M6BA 3LZ1C 3AFAD 5B2IB 1U35A 1EQZB 4JJNA 4R8PC 1M18A 2NZDB 4WNNB 1F66A 4X23B 2PYOA 1EQZD 3TU4C 5B2JC 2NZDD 4X23D 3LZ1B 2BYKA 3AFAA 4R8PB 5JA4B 3LJAC 4R8PD 3TU4B 5B2JB 3B0DC 4X23A 3NQJB 2NZDA 2ZY3A 3B0CW 3TU4D 1P3MC 5C3IC 3AZFC 3LJAB 2LY8A 2YFWA 1P3OC 4R8PA 4Z2MG 5JA4A 3B0DB 5GT0C 3LJAD 4KGCC 3TU4A 1P3MB 4UUZB 3NQJA 5C3IB 3AZFB 1P3MD 1P3OB 3AZFD 3LJAA 5GT0B 4YM6C 4KGCB 3AYWD 5GT0D 4J8VC 3EPJA 4UUZA 4J8UD 1P3MA 3AZFA 4H9NB 4YM6B 1BFMA 3EPKA 3REKD 3AYWA 1T3UA 5GT0A 4YM6D 4J8VB 4J8UA 4KUDC 5B31C 4Z66C 2Y2PA 2NQBC 1WWIA 3AV1C 4H9NA 3REKA 3MVDD 4Z5TC 4YM6A 1P3IC 3WKJD 4KUDB 5CP6C 4Z66B 5B31B 2HIOC 3AV1B 3C1BD 1KX3C 4H9OA 4Z66D 3MVDA 2NQBD 4Z5TB 1P3IB 3WKJA 3RELC 1P3FC 3EG5B 1AOID 4Z5TD 5CP6B 1P3ID 4ZUXC 2Y2IA 2HIOB 4EO5C 1P3GC 3C1BA 1KX3B 5CP6D 4Z66A 2NQBA 5AV9C 1KX3D 3RELB 4J8WC 1P3FB 4WJ3C 5GT3C 4H9RA 4Z5TA 1BH9A 3KSYA 3V9RB 4ZUXB 1P3IA 1AOIA 4EO5B 1P3GB 1ID3C 5CP6A 4ZUXD 5AV9B 1P3GD 5DNMC 3AZHC 4J8WB 5GT3B 3VH5W 4J8WD 5GT3D 3V9RA 1ID3B 2ZM5A 4ZUXA 3AZMD 2XD1A 1P3GA 3AZHB 1S32C 1ZLAC 3NQUB 4NFTA 5DNMD 4J8WA 5GT3A 1TZYC 1P3KD 3AZMA 4XZQC 5E5AD 1S32B 3H0RC 1ZLAB 5DNMA 5B1MC 1ZLAD 5GXQC 1Z2CB 1TZYB 5B1LD 4Z2MH 3X1UD 1P3KA 4XZQB 5E5AA 2RVQD 1TZYD 4XZQD 3X1TC 3KWQD 4DRAA 2ZY4A 5B1MB 1ZLAA 5GXQB 5B1LA 3X1UA 5B1MD 4J8XC 5GXQD 1TZYA 3C1CC 4XZQA 3X1TB 3KWQA 3O62C 4H9QB 3LELC 5B1MA 4J8XB 5FUGB 3C1CB 2VQRA 2YFVA 3C1CD 3O62B 3LELB 3MGSC 4H9QA 1M18C 1F66C 2PYOC 3C1CA 3MGSB 3AFAC 1M18B 3MGSD 1F66B 2PYOB 5DNNC 4WU9C 2AROD 5AVCD 3AFAB 3MGSA 3WTPE 4NE6A 2Y2OA 3VH5T 5DNNB 3AV2D 3VH6A 4WU9B 2AROA 1P3LC 4H9PA 5AVCA 5DNND 5B31G 4WU9D 5AY8C 2Y2JA 3X1VD 4CAYB 2YFWB 3AV2A 4AWLC 4G91C 1P3LB 5DNNA 4WU9A 5AY8B 1P3LD 3X1VA 3AZID 2G5IC 5AY8D 1P3BC 4AWLB 4G91B 4CAYA 3AYWC 1P3LA 2Y2QA 4WV4B 4J8UC 3AZIA 4E45A 5AY8A 5CHLB 1P3BB 1M19D 5KDMB 3MGQC 1P3BD 3REKC 3AYWB 3A1IA 2F8NB 4J8UB 4DRBA 1M19A 2F8ND 3MGQB 5B40C 3UTBD 3EPLA 1P3BA 2FFFB 5KDMA 3REKB 3MGQD 5AVBC 5AV6D 3MVDC 3WKJC 2F8NA 2DQNC 5B40B 3UTBA 3C1BC 1KX5C 4H9OB 3MGQA 5AV6A 5AVBB 5B40D 3MVDB 4QLCC 3WKJB 1AOIC 5AVBD 2JE5A 3WA9D 2CV5C 3A6NC 2BG1A 2W8SA 3C1BB 1HQ3D 1KX5B 3W97C 2NQBB 5F99D 5B40A 5GSUC 1JFIA 4QLCB 1KX5D 5AVBA 4H9RB 1B6WA 1BH9B 1AOIB 3WA9A 2F8NK 4QLCD 1W2EA 3R45B 4E44A 3A6NB 2CV5B 3W97B 1HQ3A 1TAFB 5F99A 5B0YD 3A6ND 2CV5D 5GSUB 3W97D 1KX5A 2HUEC 2BYMB 5GSUD 4XUJA 4QLCA 5B32D 1P34D 3H0LC 2JCHA 3R45A 5B0YA 3A6NA 3AZMC 3W97A 2CV5A 2FJ7D 4NE3A 1TAFA 2F2AC 2HUEB 3MGRC 5GSUA 4HGAC 2BYMA 5B32A 1P34A 1P3KC 3AZMB 3W96C 5E5AC 4ZBJC 2FJ7A 3MGRB 4HGAB 5DNMB 5CPKC 5B1LC 3MGRD 3X1UC 1P3KB 2G5HC 5E5AB 3AZLC 3W96B 2RVQC 4ZBJB 3W96D 1BH8A 3KWQC 5CPKB 4LD9C 3MGRA 5B1LB 3X1UB 3AZLB 5CPKD 3REID 2Y2KA 3W96A 3AZLD 3KWQB 4LD9B 4H9SC 3AZNC 5CPKA 4LD9D 3REIA 3REJC 3WAAC 3AZLA 2YFVB 5B0ZD 3AZNB 4LD9A 5JRGD 5AV8D 5BNVA 3REJB 3AZND 3WAAB 1KX4D 3UTAA 3REJD 3AN2C 3WAAD 5B0ZA 5BT1C 5JRGA 5AV5C 4H9SA 5AV8A 3AZNA 1KX4A 3W99A 2ZY2A 3REJA 3AN2B 2F8NG 2L5AA 3KUYA 3WAAA 3FDDA 2AROC 5AVCC 3H0MC 3AN2D 5AV5B 5BT1D 1P3AD 4G92C 4WU8D 5AV5D 2J8PA 3AV2C 2AROB 4H9PB 5AVCB 3AN2A 1P3AA 4G92B 3X1SC 3X1VC 4WU8A 5AV5A 1R4VA 3AV2B 5CPID 2Y2LA 3AZEC 5BO0B 2DF4C 3X1SB 3X1VB 3AZIC 5CPIA 3X1SD 3B6FC 3AZEB 2IO5C 5B33C 4YS3C 3AZED 3AZIB 3AZJC 5BO0A 3WTPC 1M19C 3X1SA 3AZKC 3B6FB 2IO5B 5B33B 3MGPD 3B6FD 3AZEA 5B33D 3AZJB 4YS3D 3WTPB 1M19B 3A1KA 3B0BA 3UTBC 3AZKB 3AZJD 3WTPD 5B2ID 5AV6C 3MGPA 3LZ0C 3AZKD 3B6FA 5B33A 4YS3A 2XD5A 2Y2NA 3UTBB 1N1JA 1PZRA 3LZ1D 3AZJA 3WTPA 5B2IA 1EQZA 5AV6B 3LZ0B 3AZKA 5BS7C 4WNNA 1M1AC 3UT9C 3LZ0D 3WA9C 5B2JD 3LZ1A 1HQ3C 3KFUG 5F99C 1JFIB 1M1AB 2Y2MA 3UT9B 3LZ0A 3WA9B 5B2JA 4XUJC 1M1AD 1HQ3B 2Y2GA 3UT9D 5B0YC 5F99B 1P3OD 5BS7A 4XUJB 5B24C 5CPJC 1M1AA 4UPKA 5BNXB 3VH6T 5B32C 3UT9A 1P34C 2F8NH 4XUJD 4KGCD 5B0YB 2FJ7C 5G49B 1P3OA 4DQYB 5B24B 5CPJB 5B32B 1P34B 4KGCA 5B24D 5CPJD 5BNXA 2FJ7B 4J8VD 1F1EA 3KXBC 5G49A 4WZSB 5B24A 5CPJA 3B6GC 4J8VA 4KUDD 4CSRB 3KXBB 1BH8B 5B31D 2JSSA 3AV1D 3KXBD 3B6GB 3EPHA 3REIC 4KUDA 3B6GD 5B31A 2HIOD 4CSRA 3AV1A 3KXBA 1HTAA 3REIB 3RELD 1P3FD 3B6GA 1WWSA 3UTAC 2HIOA 1B67A 3F6TA 5B0ZC 1KX3A 3W98C 3AL0C 5AV9D 5JRGC 5AV8C 3RELA 5BNVB 3B0CT 1P3FA 1KX4C 3W99C 3UTAB 5B0ZB 3KUYC 1ID3D 3UTAD 3W98B 1A7WA 5AV9A 5JRGB 3VH5A 5AV8B 3AZHD 4NE5A 3W98D 1KX4B 3REHC 3W99B 1ID3A 3KUYB 3W99D 3AZHA 3KUYD 1S32D 1P3AC 3W98A 3NQUA 4WU8C 3REHB 3REHD 1H3OB 1S32A 1P3AB 3P5JB 4WU8B 5CPIC 1KU5A
chains in the Genus database with same CATH topology
3REHA 3IP4C 1H3OA 3VH6W 3X1TD 5CPIB 3AZGC 5GXQA 1P3PC 3MNNC 4J8XD 3X1TA 2CWEA 2Y2HA 3O62D 3AZGB 1U35C 3LELD 4JJNC 1P3PB 2ZY5A 1Q9CA 1ULYA 3MNNB 5FUGA 3MGPC 4J8XA 3AZGD 4KHAB 1P3PD 3MNND 3O62A 3LELA 1U35B 4JJNB 5B2IC 3AZGA 3MGPB 1U35D 1EQZC 4JJND 1M18D 1P3PA 2NZDC 5B32G 4X23C 1F66D 3MNNA 2PYOD 4YS3B 2BYKB 2RIQA 4KHAA 1N1JB 2UWXA 4M6BA 3LZ1C 3AFAD 5B2IB 1U35A 1EQZB 4JJNA 4R8PC 1M18A 2NZDB 4WNNB 1F66A 4X23B 2PYOA 1EQZD 3TU4C 5B2JC 2NZDD 4X23D 3LZ1B 2BYKA 3AFAA 4R8PB 5JA4B 3LJAC 4R8PD 3TU4B 5B2JB 3B0DC 4X23A 3NQJB 2NZDA 2ZY3A 3B0CW 3TU4D 1P3MC 5C3IC 3AZFC 3LJAB 2LY8A 2YFWA 1P3OC 4R8PA 4Z2MG 5JA4A 3B0DB 5GT0C 3LJAD 4KGCC 3TU4A 1P3MB 4UUZB 3NQJA 5C3IB 3AZFB 1P3MD 1P3OB 3AZFD 3LJAA 5GT0B 4YM6C 4KGCB 3AYWD 5GT0D 4J8VC 3EPJA 4UUZA 4J8UD 1P3MA 3AZFA 4H9NB 4YM6B 1BFMA 3EPKA 3REKD 3AYWA 1T3UA 5GT0A 4YM6D 4J8VB 4J8UA 4KUDC 5B31C 4Z66C 2Y2PA 2NQBC 1WWIA 3AV1C 4H9NA 3REKA 3MVDD 4Z5TC 4YM6A 1P3IC 3WKJD 4KUDB 5CP6C 4Z66B 5B31B 2HIOC 3AV1B 3C1BD 1KX3C 4H9OA 4Z66D 3MVDA 2NQBD 4Z5TB 1P3IB 3WKJA 3RELC 1P3FC 3EG5B 1AOID 4Z5TD 5CP6B 1P3ID 4ZUXC 2Y2IA 2HIOB 4EO5C 1P3GC 3C1BA 1KX3B 5CP6D 4Z66A 2NQBA 5AV9C 1KX3D 3RELB 4J8WC 1P3FB 4WJ3C 5GT3C 4H9RA 4Z5TA 1BH9A 3KSYA 3V9RB 4ZUXB 1P3IA 1AOIA 4EO5B 1P3GB 1ID3C 5CP6A 4ZUXD 5AV9B 1P3GD 5DNMC 3AZHC 4J8WB 5GT3B 3VH5W 4J8WD 5GT3D 3V9RA 1ID3B 2ZM5A 4ZUXA 3AZMD 2XD1A 1P3GA 3AZHB 1S32C 1ZLAC 3NQUB 4NFTA 5DNMD 4J8WA 5GT3A 1TZYC 1P3KD 3AZMA 4XZQC 5E5AD 1S32B 3H0RC 1ZLAB 5DNMA 5B1MC 1ZLAD 5GXQC 1Z2CB 1TZYB 5B1LD 4Z2MH 3X1UD 1P3KA 4XZQB 5E5AA 2RVQD 1TZYD 4XZQD 3X1TC 3KWQD 4DRAA 2ZY4A 5B1MB 1ZLAA 5GXQB 5B1LA 3X1UA 5B1MD 4J8XC 5GXQD 1TZYA 3C1CC 4XZQA 3X1TB 3KWQA 3O62C 4H9QB 3LELC 5B1MA 4J8XB 5FUGB 3C1CB 2VQRA 2YFVA 3C1CD 3O62B 3LELB 3MGSC 4H9QA 1M18C 1F66C 2PYOC 3C1CA 3MGSB 3AFAC 1M18B 3MGSD 1F66B 2PYOB 5DNNC 4WU9C 2AROD 5AVCD 3AFAB 3MGSA 3WTPE 4NE6A 2Y2OA 3VH5T 5DNNB 3AV2D 3VH6A 4WU9B 2AROA 1P3LC 4H9PA 5AVCA 5DNND 5B31G 4WU9D 5AY8C 2Y2JA 3X1VD 4CAYB 2YFWB 3AV2A 4AWLC 4G91C 1P3LB 5DNNA 4WU9A 5AY8B 1P3LD 3X1VA 3AZID 2G5IC 5AY8D 1P3BC 4AWLB 4G91B 4CAYA 3AYWC 1P3LA 2Y2QA 4WV4B 4J8UC 3AZIA 4E45A 5AY8A 5CHLB 1P3BB 1M19D 5KDMB 3MGQC 1P3BD 3REKC 3AYWB 3A1IA 2F8NB 4J8UB 4DRBA 1M19A 2F8ND 3MGQB 5B40C 3UTBD 3EPLA 1P3BA 2FFFB 5KDMA 3REKB 3MGQD 5AVBC 5AV6D 3MVDC 3WKJC 2F8NA 2DQNC 5B40B 3UTBA 3C1BC 1KX5C 4H9OB 3MGQA 5AV6A 5AVBB 5B40D 3MVDB 4QLCC 3WKJB 1AOIC 5AVBD 2JE5A 3WA9D 2CV5C 3A6NC 2BG1A 2W8SA 3C1BB 1HQ3D 1KX5B 3W97C 2NQBB 5F99D 5B40A 5GSUC 1JFIA 4QLCB 1KX5D 5AVBA 4H9RB 1B6WA 1BH9B 1AOIB 3WA9A 2F8NK 4QLCD 1W2EA 3R45B 4E44A 3A6NB 2CV5B 3W97B 1HQ3A 1TAFB 5F99A 5B0YD 3A6ND 2CV5D 5GSUB 3W97D 1KX5A 2HUEC 2BYMB 5GSUD 4XUJA 4QLCA 5B32D 1P34D 3H0LC 2JCHA 3R45A 5B0YA 3A6NA 3AZMC 3W97A 2CV5A 2FJ7D 4NE3A 1TAFA 2F2AC 2HUEB 3MGRC 5GSUA 4HGAC 2BYMA 5B32A 1P34A 1P3KC 3AZMB 3W96C 5E5AC 4ZBJC 2FJ7A 3MGRB 4HGAB 5DNMB 5CPKC 5B1LC 3MGRD 3X1UC 1P3KB 2G5HC 5E5AB 3AZLC 3W96B 2RVQC 4ZBJB 3W96D 1BH8A 3KWQC 5CPKB 4LD9C 3MGRA 5B1LB 3X1UB 3AZLB 5CPKD 3REID 2Y2KA 3W96A 3AZLD 3KWQB 4LD9B 4H9SC 3AZNC 5CPKA 4LD9D 3REIA 3REJC 3WAAC 3AZLA 2YFVB 5B0ZD 3AZNB 4LD9A 5JRGD 5AV8D 5BNVA 3REJB 3AZND 3WAAB 1KX4D 3UTAA 3REJD 3AN2C 3WAAD 5B0ZA 5BT1C 5JRGA 5AV5C 4H9SA 5AV8A 3AZNA 1KX4A 3W99A 2ZY2A 3REJA 3AN2B 2F8NG 2L5AA 3KUYA 3WAAA 3FDDA 2AROC 5AVCC 3H0MC 3AN2D 5AV5B 5BT1D 1P3AD 4G92C 4WU8D 5AV5D 2J8PA 3AV2C 2AROB 4H9PB 5AVCB 3AN2A 1P3AA 4G92B 3X1SC 3X1VC 4WU8A 5AV5A 1R4VA 3AV2B 5CPID 2Y2LA 3AZEC 5BO0B 2DF4C 3X1SB 3X1VB 3AZIC 5CPIA 3X1SD 3B6FC 3AZEB 2IO5C 5B33C 4YS3C 3AZED 3AZIB 3AZJC 5BO0A 3WTPC 1M19C 3X1SA 3AZKC 3B6FB 2IO5B 5B33B 3MGPD 3B6FD 3AZEA 5B33D 3AZJB 4YS3D 3WTPB 1M19B 3A1KA 3B0BA 3UTBC 3AZKB 3AZJD 3WTPD 5B2ID 5AV6C 3MGPA 3LZ0C 3AZKD 3B6FA 5B33A 4YS3A 2XD5A 2Y2NA 3UTBB 1N1JA 1PZRA 3LZ1D 3AZJA 3WTPA 5B2IA 1EQZA 5AV6B 3LZ0B 3AZKA 5BS7C 4WNNA 1M1AC 3UT9C 3LZ0D 3WA9C 5B2JD 3LZ1A 1HQ3C 3KFUG 5F99C 1JFIB 1M1AB 2Y2MA 3UT9B 3LZ0A 3WA9B 5B2JA 4XUJC 1M1AD 1HQ3B 2Y2GA 3UT9D 5B0YC 5F99B 1P3OD 5BS7A 4XUJB 5B24C 5CPJC 1M1AA 4UPKA 5BNXB 3VH6T 5B32C 3UT9A 1P34C 2F8NH 4XUJD 4KGCD 5B0YB 2FJ7C 5G49B 1P3OA 4DQYB 5B24B 5CPJB 5B32B 1P34B 4KGCA 5B24D 5CPJD 5BNXA 2FJ7B 4J8VD 1F1EA 3KXBC 5G49A 4WZSB 5B24A 5CPJA 3B6GC 4J8VA 4KUDD 4CSRB 3KXBB 1BH8B 5B31D 2JSSA 3AV1D 3KXBD 3B6GB 3EPHA 3REIC 4KUDA 3B6GD 5B31A 2HIOD 4CSRA 3AV1A 3KXBA 1HTAA 3REIB 3RELD 1P3FD 3B6GA 1WWSA 3UTAC 2HIOA 1B67A 3F6TA 5B0ZC 1KX3A 3W98C 3AL0C 5AV9D 5JRGC 5AV8C 3RELA 5BNVB 3B0CT 1P3FA 1KX4C 3W99C 3UTAB 5B0ZB 3KUYC 1ID3D 3UTAD 3W98B 1A7WA 5AV9A 5JRGB 3VH5A 5AV8B 3AZHD 4NE5A 3W98D 1KX4B 3REHC 3W99B 1ID3A 3KUYB 3W99D 3AZHA 3KUYD 1S32D 1P3AC 3W98A 3NQUA 4WU8C 3REHB 3REHD 1H3OB 1S32A 1P3AB 3P5JB 4WU8B 5CPIC 1KU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH A;  1H3O A;  3VH6 W;  3X1T D;  5CPI B;  3AZG C;  5GXQ A;  1P3P C;  3MNN C;  4J8X D;  3X1T A;  2CWE A;  3O62 D;  3AZG B;  1U35 C;  3LEL D;  4JJN C;  1P3P B;  1Q9C A;  1ULY A;  3MNN B;  5FUG A;  3MGP C;  4J8X A;  3AZG D;  4KHA B;  1P3P D;  3MNN D;  3O62 A;  3LEL A;  1U35 B;  4JJN B;  5B2I C;  3AZG A;  3MGP B;  1U35 D;  1EQZ C;  4JJN D;  1M18 D;  1P3P A;  2NZD C;  5B32 G;  4X23 C;  1F66 D;  3MNN A;  2PYO D;  4YS3 B;  2BYK B;  4KHA A;  1N1J B;  4M6B A;  3LZ1 C;  3AFA D;  5B2I B;  1U35 A;  1EQZ B;  4JJN A;  4R8P C;  1M18 A;  2NZD B;  4WNN B;  1F66 A;  4X23 B;  2PYO A;  1EQZ D;  3TU4 C;  5B2J C;  2NZD D;  4X23 D;  3LZ1 B;  2BYK A;  3AFA A;  4R8P B;  5JA4 B;  3LJA C;  4R8P D;  3TU4 B;  5B2J B;  3B0D C;  4X23 A;  3NQJ B;  2NZD A;  3B0C W;  3TU4 D;  1P3M C;  5C3I C;  3AZF C;  3LJA B;  2LY8 A;  2YFW A;  1P3O C;  4R8P A;  4Z2M G;  5JA4 A;  3B0D B;  5GT0 C;  3LJA D;  4KGC C;  3TU4 A;  1P3M B;  4UUZ B;  3NQJ A;  5C3I B;  3AZF B;  1P3M D;  1P3O B;  3AZF D;  3LJA A;  5GT0 B;  4YM6 C;  4KGC B;  3AYW D;  5GT0 D;  4J8V C;  4J8U D;  4UUZ A;  1P3M A;  3AZF A;  4H9N B;  4YM6 B;  1BFM A;  3REK D;  3AYW A;  5GT0 A;  4YM6 D;  4J8V B;  4J8U A;  4KUD C;  5B31 C;  4Z66 C;  2NQB C;  1WWI A;  3AV1 C;  4H9N A;  3REK A;  3MVD D;  4Z5T C;  4YM6 A;  1P3I C;  3WKJ D;  4KUD B;  5CP6 C;  4Z66 B;  5B31 B;  2HIO C;  3AV1 B;  3C1B D;  1KX3 C;  4H9O A;  4Z66 D;  3MVD A;  2NQB D;  4Z5T B;  1P3I B;  3WKJ A;  3REL C;  1P3F C;  1AOI D;  4Z5T D;  5CP6 B;  1P3I D;  4ZUX C;  2HIO B;  4EO5 C;  1P3G C;  3C1B A;  1KX3 B;  5CP6 D;  4Z66 A;  2NQB A;  5AV9 C;  1KX3 D;  3REL B;  4J8W C;  1P3F B;  5GT3 C;  4H9R A;  4Z5T A;  1BH9 A;  3KSY A;  3V9R B;  4ZUX B;  1P3I A;  1AOI A;  4EO5 B;  1P3G B;  1ID3 C;  5CP6 A;  4ZUX D;  5AV9 B;  1P3G D;  5DNM C;  3AZH C;  4J8W B;  5GT3 B;  3VH5 W;  4J8W D;  5GT3 D;  3V9R A;  1ID3 B;  4ZUX A;  3AZM D;  1P3G A;  3AZH B;  1S32 C;  1ZLA C;  3NQU B;  4NFT A;  5DNM D;  4J8W A;  5GT3 A;  1TZY C;  1P3K D;  3AZM A;  4XZQ C;  5E5A D;  1S32 B;  1ZLA B;  5DNM A;  5B1M C;  1ZLA D;  5GXQ C;  5B1L D;  1TZY B;  4Z2M H;  1P3K A;  3X1U D;  4XZQ B;  5E5A A;  2RVQ D;  1TZY D;  4XZQ D;  3X1T C;  3KWQ D;  4DRA A;  5B1M B;  1ZLA A;  5GXQ B;  5B1L A;  3X1U A;  5B1M D;  4J8X C;  5GXQ D;  1TZY A;  3C1C C;  4XZQ A;  3X1T B;  3KWQ A;  3O62 C;  4H9Q B;  3LEL C;  5B1M A;  4J8X B;  5FUG B;  3C1C B;  2YFV A;  3C1C D;  3O62 B;  3LEL B;  3MGS C;  4H9Q A;  1M18 C;  1F66 C;  2PYO C;  3C1C A;  3MGS B;  3AFA C;  1M18 B;  3MGS D;  1F66 B;  2PYO B;  5DNN C;  4WU9 C;  2ARO D;  5AVC D;  3AFA B;  3MGS A;  3WTP E;  4NE6 A;  3VH5 T;  5DNN B;  3AV2 D;  3VH6 A;  4WU9 B;  2ARO A;  1P3L C;  4H9P A;  5AVC A;  5DNN D;  5B31 G;  4WU9 D;  5AY8 C;  3X1V D;  4CAY B;  2YFW B;  3AV2 A;  4AWL C;  4G91 C;  1P3L B;  5DNN A;  4WU9 A;  5AY8 B;  1P3L D;  3X1V A;  3AZI D;  5AY8 D;  1P3B C;  4AWL B;  4G91 B;  4CAY A;  3AYW C;  1P3L A;  4WV4 B;  4J8U C;  3AZI A;  4E45 A;  5AY8 A;  5CHL B;  1P3B B;  1M19 D;  5KDM B;  3MGQ C;  1P3B D;  3REK C;  3AYW B;  2F8N B;  4J8U B;  4DRB A;  1M19 A;  2F8N D;  3MGQ B;  5B40 C;  3UTB D;  1P3B A;  5KDM A;  3REK B;  3MGQ D;  5AVB C;  5AV6 D;  3MVD C;  3WKJ C;  2F8N A;  5B40 B;  3UTB A;  3C1B C;  1KX5 C;  4H9O B;  3MGQ A;  5AV6 A;  5AVB B;  5B40 D;  3MVD B;  4QLC C;  3WKJ B;  1AOI C;  5AVB D;  3WA9 D;  2CV5 C;  3A6N C;  3W97 C;  3C1B B;  1HQ3 D;  1KX5 B;  2NQB B;  5F99 D;  5B40 A;  5GSU C;  1JFI A;  4QLC B;  1KX5 D;  5AVB A;  4H9R B;  1B6W A;  1BH9 B;  1AOI B;  3WA9 A;  2F8N K;  4QLC D;  3R45 B;  4E44 A;  3A6N B;  2CV5 B;  3W97 B;  1HQ3 A;  1TAF B;  5F99 A;  5B0Y D;  3A6N D;  2CV5 D;  5GSU B;  3W97 D;  1KX5 A;  2HUE C;  2BYM B;  5GSU D;  4XUJ A;  4QLC A;  5B32 D;  1P34 D;  3R45 A;  5B0Y A;  3A6N A;  3AZM C;  3W97 A;  2CV5 A;  2FJ7 D;  4NE3 A;  1TAF A;  2HUE B;  3MGR C;  5GSU A;  4HGA C;  2BYM A;  5B32 A;  1P34 A;  1P3K C;  3AZM B;  3W96 C;  5E5A C;  4ZBJ C;  2FJ7 A;  3MGR B;  4HGA B;  5DNM B;  5CPK C;  5B1L C;  3MGR D;  3X1U C;  1P3K B;  3W96 B;  5E5A B;  3AZL C;  2RVQ C;  4ZBJ B;  3W96 D;  1BH8 A;  3KWQ C;  5CPK B;  4LD9 C;  3MGR A;  5B1L B;  3X1U B;  3AZL B;  5CPK D;  3REI D;  3W96 A;  3AZL D;  3KWQ B;  4LD9 B;  4H9S C;  3AZN C;  5CPK A;  4LD9 D;  3REI A;  3REJ C;  3WAA C;  3AZL A;  2YFV B;  5B0Z D;  3AZN B;  4LD9 A;  5JRG D;  5AV8 D;  5BNV A;  3REJ B;  3AZN D;  3WAA B;  1KX4 D;  3UTA A;  3REJ D;  3AN2 C;  3WAA D;  5B0Z A;  5BT1 C;  5JRG A;  5AV5 C;  4H9S A;  5AV8 A;  3AZN A;  1KX4 A;  3W99 A;  3REJ A;  3AN2 B;  2F8N G;  2L5A A;  3KUY A;  3WAA A;  2ARO C;  5AVC C;  3AN2 D;  5AV5 B;  5BT1 D;  1P3A D;  4G92 C;  4WU8 D;  5AV5 D;  3AV2 C;  2ARO B;  4H9P B;  5AVC B;  3AN2 A;  1P3A A;  4G92 B;  3X1S C;  3X1V C;  4WU8 A;  5AV5 A;  1R4V A;  3AV2 B;  5CPI D;  3AZE C;  5BO0 B;  3X1S B;  3X1V B;  3AZI C;  5CPI A;  3X1S D;  3B6F C;  3AZE B;  2IO5 C;  5B33 C;  4YS3 C;  3AZE D;  3AZI B;  3AZJ C;  5BO0 A;  3WTP C;  1M19 C;  3X1S A;  3AZK C;  3B6F B;  2IO5 B;  5B33 B;  3MGP D;  3B6F D;  3AZE A;  5B33 D;  3AZJ B;  4YS3 D;  3WTP B;  1M19 B;  3B0B A;  3UTB C;  3AZK B;  3AZJ D;  3WTP D;  5B2I D;  5AV6 C;  3MGP A;  3LZ0 C;  3AZK D;  3B6F A;  5B33 A;  4YS3 A;  3UTB B;  1N1J A;  3AZJ A;  3LZ1 D;  3WTP A;  5B2I A;  1EQZ A;  5AV6 B;  3LZ0 B;  3AZK A;  5BS7 C;  4WNN A;  1M1A C;  3UT9 C;  3LZ0 D;  3WA9 C;  5B2J D;  3LZ1 A;  1HQ3 C;  5F99 C;  1JFI B;  1M1A B;  3UT9 B;  3LZ0 A;  3WA9 B;  5B2J A;  4XUJ C;  1M1A D;  1HQ3 B;  3UT9 D;  5B0Y C;  5F99 B;  1P3O D;  5BS7 A;  4XUJ B;  5B24 C;  5CPJ C;  1M1A A;  5BNX B;  3VH6 T;  5B32 C;  3UT9 A;  1P34 C;  2F8N H;  4XUJ D;  4KGC D;  5B0Y B;  2FJ7 C;  5G49 B;  1P3O A;  5B24 B;  5CPJ B;  5B32 B;  1P34 B;  4KGC A;  5B24 D;  5CPJ D;  5BNX A;  2FJ7 B;  4J8V D;  1F1E A;  3KXB C;  5G49 A;  4WZS B;  5B24 A;  5CPJ A;  3B6G C;  4J8V A;  4KUD D;  4CSR B;  3KXB B;  1BH8 B;  5B31 D;  2JSS A;  3AV1 D;  3KXB D;  3B6G B;  3REI C;  4KUD A;  3B6G D;  5B31 A;  2HIO D;  4CSR A;  3AV1 A;  3KXB A;  1HTA A;  3REI B;  3REL D;  1P3F D;  3B6G A;  1WWS A;  3UTA C;  2HIO A;  1B67 A;  5B0Z C;  1KX3 A;  3W98 C;  5AV9 D;  5JRG C;  5AV8 C;  3REL A;  5BNV B;  3B0C T;  1P3F A;  1KX4 C;  3W99 C;  3UTA B;  5B0Z B;  3KUY C;  1ID3 D;  3UTA D;  3W98 B;  1A7W A;  5AV9 A;  5JRG B;  3VH5 A;  5AV8 B;  3AZH D;  4NE5 A;  3W98 D;  1KX4 B;  3REH C;  3W99 B;  1ID3 A;  3KUY B;  3W99 D;  3AZH A;  3KUY D;  1S32 D;  1P3A C;  3W98 A;  3NQU A;  4WU8 C;  3REH B;  3REH D;  1H3O B;  1S32 A;  1P3A B;  4WU8 B;  5CPI C;  1KU5 A; 
#chains in the Genus database with same CATH topology
 3REH A;  3IP4 C;  1H3O A;  3VH6 W;  3X1T D;  5CPI B;  3AZG C;  5GXQ A;  1P3P C;  3MNN C;  4J8X D;  3X1T A;  2CWE A;  2Y2H A;  3O62 D;  3AZG B;  1U35 C;  3LEL D;  4JJN C;  1P3P B;  2ZY5 A;  1Q9C A;  1ULY A;  3MNN B;  5FUG A;  3MGP C;  4J8X A;  3AZG D;  4KHA B;  1P3P D;  3MNN D;  3O62 A;  3LEL A;  1U35 B;  4JJN B;  5B2I C;  3AZG A;  3MGP B;  1U35 D;  1EQZ C;  4JJN D;  1M18 D;  1P3P A;  2NZD C;  5B32 G;  4X23 C;  1F66 D;  3MNN A;  2PYO D;  4YS3 B;  2BYK B;  2RIQ A;  4KHA A;  1N1J B;  2UWX A;  4M6B A;  3LZ1 C;  3AFA D;  5B2I B;  1U35 A;  1EQZ B;  4JJN A;  4R8P C;  1M18 A;  2NZD B;  4WNN B;  1F66 A;  4X23 B;  2PYO A;  1EQZ D;  3TU4 C;  5B2J C;  2NZD D;  4X23 D;  3LZ1 B;  2BYK A;  3AFA A;  4R8P B;  5JA4 B;  3LJA C;  4R8P D;  3TU4 B;  5B2J B;  3B0D C;  4X23 A;  3NQJ B;  2NZD A;  2ZY3 A;  3B0C W;  3TU4 D;  1P3M C;  5C3I C;  3AZF C;  3LJA B;  2LY8 A;  2YFW A;  1P3O C;  4R8P A;  4Z2M G;  5JA4 A;  3B0D B;  5GT0 C;  3LJA D;  4KGC C;  3TU4 A;  1P3M B;  4UUZ B;  3NQJ A;  5C3I B;  3AZF B;  1P3M D;  1P3O B;  3AZF D;  3LJA A;  5GT0 B;  4YM6 C;  4KGC B;  3AYW D;  5GT0 D;  4J8V C;  3EPJ A;  4UUZ A;  4J8U D;  1P3M A;  3AZF A;  4H9N B;  4YM6 B;  1BFM A;  3EPK A;  3REK D;  3AYW A;  1T3U A;  5GT0 A;  4YM6 D;  4J8V B;  4J8U A;  4KUD C;  5B31 C;  4Z66 C;  2Y2P A;  2NQB C;  1WWI A;  3AV1 C;  4H9N A;  3REK A;  3MVD D;  4Z5T C;  4YM6 A;  1P3I C;  3WKJ D;  4KUD B;  5CP6 C;  4Z66 B;  5B31 B;  2HIO C;  3AV1 B;  3C1B D;  1KX3 C;  4H9O A;  4Z66 D;  3MVD A;  2NQB D;  4Z5T B;  1P3I B;  3WKJ A;  3REL C;  1P3F C;  3EG5 B;  1AOI D;  4Z5T D;  5CP6 B;  1P3I D;  4ZUX C;  2Y2I A;  2HIO B;  4EO5 C;  1P3G C;  3C1B A;  1KX3 B;  5CP6 D;  4Z66 A;  2NQB A;  5AV9 C;  1KX3 D;  3REL B;  4J8W C;  1P3F B;  4WJ3 C;  5GT3 C;  4H9R A;  4Z5T A;  1BH9 A;  3KSY A;  3V9R B;  4ZUX B;  1P3I A;  1AOI A;  4EO5 B;  1P3G B;  1ID3 C;  5CP6 A;  4ZUX D;  5AV9 B;  1P3G D;  5DNM C;  3AZH C;  4J8W B;  5GT3 B;  3VH5 W;  4J8W D;  5GT3 D;  3V9R A;  1ID3 B;  2ZM5 A;  4ZUX A;  3AZM D;  2XD1 A;  1P3G A;  3AZH B;  1S32 C;  1ZLA C;  3NQU B;  4NFT A;  5DNM D;  4J8W A;  5GT3 A;  1TZY C;  1P3K D;  3AZM A;  4XZQ C;  5E5A D;  1S32 B;  3H0R C;  1ZLA B;  5DNM A;  5B1M C;  1ZLA D;  5GXQ C;  1Z2C B;  1TZY B;  5B1L D;  4Z2M H;  3X1U D;  1P3K A;  4XZQ B;  5E5A A;  2RVQ D;  1TZY D;  4XZQ D;  3X1T C;  3KWQ D;  4DRA A;  2ZY4 A;  5B1M B;  1ZLA A;  5GXQ B;  5B1L A;  3X1U A;  5B1M D;  4J8X C;  5GXQ D;  1TZY A;  3C1C C;  4XZQ A;  3X1T B;  3KWQ A;  3O62 C;  4H9Q B;  3LEL C;  5B1M A;  4J8X B;  5FUG B;  3C1C B;  2VQR A;  2YFV A;  3C1C D;  3O62 B;  3LEL B;  3MGS C;  4H9Q A;  1M18 C;  1F66 C;  2PYO C;  3C1C A;  3MGS B;  3AFA C;  1M18 B;  3MGS D;  1F66 B;  2PYO B;  5DNN C;  4WU9 C;  2ARO D;  5AVC D;  3AFA B;  3MGS A;  3WTP E;  4NE6 A;  2Y2O A;  3VH5 T;  5DNN B;  3AV2 D;  3VH6 A;  4WU9 B;  2ARO A;  1P3L C;  4H9P A;  5AVC A;  5DNN D;  5B31 G;  4WU9 D;  5AY8 C;  2Y2J A;  3X1V D;  4CAY B;  2YFW B;  3AV2 A;  4AWL C;  4G91 C;  1P3L B;  5DNN A;  4WU9 A;  5AY8 B;  1P3L D;  3X1V A;  3AZI D;  2G5I C;  5AY8 D;  1P3B C;  4AWL B;  4G91 B;  4CAY A;  3AYW C;  1P3L A;  2Y2Q A;  4WV4 B;  4J8U C;  3AZI A;  4E45 A;  5AY8 A;  5CHL B;  1P3B B;  1M19 D;  5KDM B;  3MGQ C;  1P3B D;  3REK C;  3AYW B;  3A1I A;  2F8N B;  4J8U B;  4DRB A;  1M19 A;  2F8N D;  3MGQ B;  5B40 C;  3UTB D;  3EPL A;  1P3B A;  2FFF B;  5KDM A;  3REK B;  3MGQ D;  5AVB C;  5AV6 D;  3MVD C;  3WKJ C;  2F8N A;  2DQN C;  5B40 B;  3UTB A;  3C1B C;  1KX5 C;  4H9O B;  3MGQ A;  5AV6 A;  5AVB B;  5B40 D;  3MVD B;  4QLC C;  3WKJ B;  1AOI C;  5AVB D;  2JE5 A;  3WA9 D;  2CV5 C;  3A6N C;  2BG1 A;  2W8S A;  3C1B B;  1HQ3 D;  1KX5 B;  3W97 C;  2NQB B;  5F99 D;  5B40 A;  5GSU C;  1JFI A;  4QLC B;  1KX5 D;  5AVB A;  4H9R B;  1B6W A;  1BH9 B;  1AOI B;  3WA9 A;  2F8N K;  4QLC D;  1W2E A;  3R45 B;  4E44 A;  3A6N B;  2CV5 B;  3W97 B;  1HQ3 A;  1TAF B;  5F99 A;  5B0Y D;  3A6N D;  2CV5 D;  5GSU B;  3W97 D;  1KX5 A;  2HUE C;  2BYM B;  5GSU D;  4XUJ A;  4QLC A;  5B32 D;  1P34 D;  3H0L C;  2JCH A;  3R45 A;  5B0Y A;  3A6N A;  3AZM C;  3W97 A;  2CV5 A;  2FJ7 D;  4NE3 A;  1TAF A;  2F2A C;  2HUE B;  3MGR C;  5GSU A;  4HGA C;  2BYM A;  5B32 A;  1P34 A;  1P3K C;  3AZM B;  3W96 C;  5E5A C;  4ZBJ C;  2FJ7 A;  3MGR B;  4HGA B;  5DNM B;  5CPK C;  5B1L C;  3MGR D;  3X1U C;  1P3K B;  2G5H C;  5E5A B;  3AZL C;  3W96 B;  2RVQ C;  4ZBJ B;  3W96 D;  1BH8 A;  3KWQ C;  5CPK B;  4LD9 C;  3MGR A;  5B1L B;  3X1U B;  3AZL B;  5CPK D;  3REI D;  2Y2K A;  3W96 A;  3AZL D;  3KWQ B;  4LD9 B;  4H9S C;  3AZN C;  5CPK A;  4LD9 D;  3REI A;  3REJ C;  3WAA C;  3AZL A;  2YFV B;  5B0Z D;  3AZN B;  4LD9 A;  5JRG D;  5AV8 D;  5BNV A;  3REJ B;  3AZN D;  3WAA B;  1KX4 D;  3UTA A;  3REJ D;  3AN2 C;  3WAA D;  5B0Z A;  5BT1 C;  5JRG A;  5AV5 C;  4H9S A;  5AV8 A;  3AZN A;  1KX4 A;  3W99 A;  2ZY2 A;  3REJ A;  3AN2 B;  2F8N G;  2L5A A;  3KUY A;  3WAA A;  3FDD A;  2ARO C;  5AVC C;  3H0M C;  3AN2 D;  5AV5 B;  5BT1 D;  1P3A D;  4G92 C;  4WU8 D;  5AV5 D;  2J8P A;  3AV2 C;  2ARO B;  4H9P B;  5AVC B;  3AN2 A;  1P3A A;  4G92 B;  3X1S C;  3X1V C;  4WU8 A;  5AV5 A;  1R4V A;  3AV2 B;  5CPI D;  2Y2L A;  3AZE C;  5BO0 B;  2DF4 C;  3X1S B;  3X1V B;  3AZI C;  5CPI A;  3X1S D;  3B6F C;  3AZE B;  2IO5 C;  5B33 C;  4YS3 C;  3AZE D;  3AZI B;  3AZJ C;  5BO0 A;  3WTP C;  1M19 C;  3X1S A;  3AZK C;  3B6F B;  2IO5 B;  5B33 B;  3MGP D;  3B6F D;  3AZE A;  5B33 D;  3AZJ B;  4YS3 D;  3WTP B;  1M19 B;  3A1K A;  3B0B A;  3UTB C;  3AZK B;  3AZJ D;  3WTP D;  5B2I D;  5AV6 C;  3MGP A;  3LZ0 C;  3AZK D;  3B6F A;  5B33 A;  4YS3 A;  2XD5 A;  2Y2N A;  3UTB B;  1N1J A;  1PZR A;  3LZ1 D;  3AZJ A;  3WTP A;  5B2I A;  1EQZ A;  5AV6 B;  3LZ0 B;  3AZK A;  5BS7 C;  4WNN A;  1M1A C;  3UT9 C;  3LZ0 D;  3WA9 C;  5B2J D;  3LZ1 A;  1HQ3 C;  3KFU G;  5F99 C;  1JFI B;  1M1A B;  2Y2M A;  3UT9 B;  3LZ0 A;  3WA9 B;  5B2J A;  4XUJ C;  1M1A D;  1HQ3 B;  2Y2G A;  3UT9 D;  5B0Y C;  5F99 B;  1P3O D;  5BS7 A;  4XUJ B;  5B24 C;  5CPJ C;  1M1A A;  4UPK A;  5BNX B;  3VH6 T;  5B32 C;  3UT9 A;  1P34 C;  2F8N H;  4XUJ D;  4KGC D;  5B0Y B;  2FJ7 C;  5G49 B;  1P3O A;  4DQY B;  5B24 B;  5CPJ B;  5B32 B;  1P34 B;  4KGC A;  5B24 D;  5CPJ D;  5BNX A;  2FJ7 B;  4J8V D;  1F1E A;  3KXB C;  5G49 A;  4WZS B;  5B24 A;  5CPJ A;  3B6G C;  4J8V A;  4KUD D;  4CSR B;  3KXB B;  1BH8 B;  5B31 D;  2JSS A;  3AV1 D;  3KXB D;  3B6G B;  3EPH A;  3REI C;  4KUD A;  3B6G D;  5B31 A;  2HIO D;  4CSR A;  3AV1 A;  3KXB A;  1HTA A;  3REI B;  3REL D;  1P3F D;  3B6G A;  1WWS A;  3UTA C;  2HIO A;  1B67 A;  3F6T A;  5B0Z C;  1KX3 A;  3W98 C;  3AL0 C;  5AV9 D;  5JRG C;  5AV8 C;  3REL A;  5BNV B;  3B0C T;  1P3F A;  1KX4 C;  3W99 C;  3UTA B;  5B0Z B;  3KUY C;  1ID3 D;  3UTA D;  3W98 B;  1A7W A;  5AV9 A;  5JRG B;  3VH5 A;  5AV8 B;  3AZH D;  4NE5 A;  3W98 D;  1KX4 B;  3REH C;  3W99 B;  1ID3 A;  3KUY B;  3W99 D;  3AZH A;  3KUY D;  1S32 D;  1P3A C;  3W98 A;  3NQU A;  4WU8 C;  3REH B;  3REH D;  1H3O B;  1S32 A;  1P3A B;  3P5J B;  4WU8 B;  5CPI C;  1KU5 A; 
#chains in the Genus database with same CATH homology
 3REH A;  3IP4 C;  1H3O A;  3VH6 W;  3X1T D;  5CPI B;  3AZG C;  5GXQ A;  1P3P C;  3MNN C;  4J8X D;  3X1T A;  2CWE A;  2Y2H A;  3O62 D;  3AZG B;  1U35 C;  3LEL D;  4JJN C;  1P3P B;  2ZY5 A;  1Q9C A;  1ULY A;  3MNN B;  5FUG A;  3MGP C;  4J8X A;  3AZG D;  4KHA B;  1P3P D;  3MNN D;  3O62 A;  3LEL A;  1U35 B;  4JJN B;  5B2I C;  3AZG A;  3MGP B;  1U35 D;  1EQZ C;  4JJN D;  1M18 D;  1P3P A;  2NZD C;  5B32 G;  4X23 C;  1F66 D;  3MNN A;  2PYO D;  4YS3 B;  2BYK B;  2RIQ A;  4KHA A;  1N1J B;  2UWX A;  4M6B A;  3LZ1 C;  3AFA D;  5B2I B;  1U35 A;  1EQZ B;  4JJN A;  4R8P C;  1M18 A;  2NZD B;  4WNN B;  1F66 A;  4X23 B;  2PYO A;  1EQZ D;  3TU4 C;  5B2J C;  2NZD D;  4X23 D;  3LZ1 B;  2BYK A;  3AFA A;  4R8P B;  5JA4 B;  3LJA C;  4R8P D;  3TU4 B;  5B2J B;  3B0D C;  4X23 A;  3NQJ B;  2NZD A;  2ZY3 A;  3B0C W;  3TU4 D;  1P3M C;  5C3I C;  3AZF C;  3LJA B;  2LY8 A;  2YFW A;  1P3O C;  4R8P A;  4Z2M G;  5JA4 A;  3B0D B;  5GT0 C;  3LJA D;  4KGC C;  3TU4 A;  1P3M B;  4UUZ B;  3NQJ A;  5C3I B;  3AZF B;  1P3M D;  1P3O B;  3AZF D;  3LJA A;  5GT0 B;  4YM6 C;  4KGC B;  3AYW D;  5GT0 D;  4J8V C;  3EPJ A;  4UUZ A;  4J8U D;  1P3M A;  3AZF A;  4H9N B;  4YM6 B;  1BFM A;  3EPK A;  3REK D;  3AYW A;  1T3U A;  5GT0 A;  4YM6 D;  4J8V B;  4J8U A;  4KUD C;  5B31 C;  4Z66 C;  2Y2P A;  2NQB C;  1WWI A;  3AV1 C;  4H9N A;  3REK A;  3MVD D;  4Z5T C;  4YM6 A;  1P3I C;  3WKJ D;  4KUD B;  5CP6 C;  4Z66 B;  5B31 B;  2HIO C;  3AV1 B;  3C1B D;  1KX3 C;  4H9O A;  4Z66 D;  3MVD A;  2NQB D;  4Z5T B;  1P3I B;  3WKJ A;  3REL C;  1P3F C;  3EG5 B;  1AOI D;  4Z5T D;  5CP6 B;  1P3I D;  4ZUX C;  2Y2I A;  2HIO B;  4EO5 C;  1P3G C;  3C1B A;  1KX3 B;  5CP6 D;  4Z66 A;  2NQB A;  5AV9 C;  1KX3 D;  3REL B;  4J8W C;  1P3F B;  4WJ3 C;  5GT3 C;  4H9R A;  4Z5T A;  1BH9 A;  3KSY A;  3V9R B;  4ZUX B;  1P3I A;  1AOI A;  4EO5 B;  1P3G B;  1ID3 C;  5CP6 A;  4ZUX D;  5AV9 B;  1P3G D;  5DNM C;  3AZH C;  4J8W B;  5GT3 B;  3VH5 W;  4J8W D;  5GT3 D;  3V9R A;  1ID3 B;  2ZM5 A;  4ZUX A;  3AZM D;  2XD1 A;  1P3G A;  3AZH B;  1S32 C;  1ZLA C;  3NQU B;  4NFT A;  5DNM D;  4J8W A;  5GT3 A;  1TZY C;  1P3K D;  3AZM A;  4XZQ C;  5E5A D;  1S32 B;  3H0R C;  1ZLA B;  5DNM A;  5B1M C;  1ZLA D;  5GXQ C;  1Z2C B;  1TZY B;  5B1L D;  4Z2M H;  3X1U D;  1P3K A;  4XZQ B;  5E5A A;  2RVQ D;  1TZY D;  4XZQ D;  3X1T C;  3KWQ D;  4DRA A;  2ZY4 A;  5B1M B;  1ZLA A;  5GXQ B;  5B1L A;  3X1U A;  5B1M D;  4J8X C;  5GXQ D;  1TZY A;  3C1C C;  4XZQ A;  3X1T B;  3KWQ A;  3O62 C;  4H9Q B;  3LEL C;  5B1M A;  4J8X B;  5FUG B;  3C1C B;  2VQR A;  2YFV A;  3C1C D;  3O62 B;  3LEL B;  3MGS C;  4H9Q A;  1M18 C;  1F66 C;  2PYO C;  3C1C A;  3MGS B;  3AFA C;  1M18 B;  3MGS D;  1F66 B;  2PYO B;  5DNN C;  4WU9 C;  2ARO D;  5AVC D;  3AFA B;  3MGS A;  3WTP E;  4NE6 A;  2Y2O A;  3VH5 T;  5DNN B;  3AV2 D;  3VH6 A;  4WU9 B;  2ARO A;  1P3L C;  4H9P A;  5AVC A;  5DNN D;  5B31 G;  4WU9 D;  5AY8 C;  2Y2J A;  3X1V D;  4CAY B;  2YFW B;  3AV2 A;  4AWL C;  4G91 C;  1P3L B;  5DNN A;  4WU9 A;  5AY8 B;  1P3L D;  3X1V A;  3AZI D;  2G5I C;  5AY8 D;  1P3B C;  4AWL B;  4G91 B;  4CAY A;  3AYW C;  1P3L A;  2Y2Q A;  4WV4 B;  4J8U C;  3AZI A;  4E45 A;  5AY8 A;  5CHL B;  1P3B B;  1M19 D;  5KDM B;  3MGQ C;  1P3B D;  3REK C;  3AYW B;  3A1I A;  2F8N B;  4J8U B;  4DRB A;  1M19 A;  2F8N D;  3MGQ B;  5B40 C;  3UTB D;  3EPL A;  1P3B A;  2FFF B;  5KDM A;  3REK B;  3MGQ D;  5AVB C;  5AV6 D;  3MVD C;  3WKJ C;  2F8N A;  2DQN C;  5B40 B;  3UTB A;  3C1B C;  1KX5 C;  4H9O B;  3MGQ A;  5AV6 A;  5AVB B;  5B40 D;  3MVD B;  4QLC C;  3WKJ B;  1AOI C;  5AVB D;  2JE5 A;  3WA9 D;  2CV5 C;  3A6N C;  2BG1 A;  2W8S A;  3C1B B;  1HQ3 D;  1KX5 B;  3W97 C;  2NQB B;  5F99 D;  5B40 A;  5GSU C;  1JFI A;  4QLC B;  1KX5 D;  5AVB A;  4H9R B;  1B6W A;  1BH9 B;  1AOI B;  3WA9 A;  2F8N K;  4QLC D;  1W2E A;  3R45 B;  4E44 A;  3A6N B;  2CV5 B;  3W97 B;  1HQ3 A;  1TAF B;  5F99 A;  5B0Y D;  3A6N D;  2CV5 D;  5GSU B;  3W97 D;  1KX5 A;  2HUE C;  2BYM B;  5GSU D;  4XUJ A;  4QLC A;  5B32 D;  1P34 D;  3H0L C;  2JCH A;  3R45 A;  5B0Y A;  3A6N A;  3AZM C;  3W97 A;  2CV5 A;  2FJ7 D;  4NE3 A;  1TAF A;  2F2A C;  2HUE B;  3MGR C;  5GSU A;  4HGA C;  2BYM A;  5B32 A;  1P34 A;  1P3K C;  3AZM B;  3W96 C;  5E5A C;  4ZBJ C;  2FJ7 A;  3MGR B;  4HGA B;  5DNM B;  5CPK C;  5B1L C;  3MGR D;  3X1U C;  1P3K B;  2G5H C;  5E5A B;  3AZL C;  3W96 B;  2RVQ C;  4ZBJ B;  3W96 D;  1BH8 A;  3KWQ C;  5CPK B;  4LD9 C;  3MGR A;  5B1L B;  3X1U B;  3AZL B;  5CPK D;  3REI D;  2Y2K A;  3W96 A;  3AZL D;  3KWQ B;  4LD9 B;  4H9S C;  3AZN C;  5CPK A;  4LD9 D;  3REI A;  3REJ C;  3WAA C;  3AZL A;  2YFV B;  5B0Z D;  3AZN B;  4LD9 A;  5JRG D;  5AV8 D;  5BNV A;  3REJ B;  3AZN D;  3WAA B;  1KX4 D;  3UTA A;  3REJ D;  3AN2 C;  3WAA D;  5B0Z A;  5BT1 C;  5JRG A;  5AV5 C;  4H9S A;  5AV8 A;  3AZN A;  1KX4 A;  3W99 A;  2ZY2 A;  3REJ A;  3AN2 B;  2F8N G;  2L5A A;  3KUY A;  3WAA A;  3FDD A;  2ARO C;  5AVC C;  3H0M C;  3AN2 D;  5AV5 B;  5BT1 D;  1P3A D;  4G92 C;  4WU8 D;  5AV5 D;  2J8P A;  3AV2 C;  2ARO B;  4H9P B;  5AVC B;  3AN2 A;  1P3A A;  4G92 B;  3X1S C;  3X1V C;  4WU8 A;  5AV5 A;  1R4V A;  3AV2 B;  5CPI D;  2Y2L A;  3AZE C;  5BO0 B;  2DF4 C;  3X1S B;  3X1V B;  3AZI C;  5CPI A;  3X1S D;  3B6F C;  3AZE B;  2IO5 C;  5B33 C;  4YS3 C;  3AZE D;  3AZI B;  3AZJ C;  5BO0 A;  3WTP C;  1M19 C;  3X1S A;  3AZK C;  3B6F B;  2IO5 B;  5B33 B;  3MGP D;  3B6F D;  3AZE A;  5B33 D;  3AZJ B;  4YS3 D;  3WTP B;  1M19 B;  3A1K A;  3B0B A;  3UTB C;  3AZK B;  3AZJ D;  3WTP D;  5B2I D;  5AV6 C;  3MGP A;  3LZ0 C;  3AZK D;  3B6F A;  5B33 A;  4YS3 A;  2XD5 A;  2Y2N A;  3UTB B;  1N1J A;  1PZR A;  3LZ1 D;  3AZJ A;  3WTP A;  5B2I A;  1EQZ A;  5AV6 B;  3LZ0 B;  3AZK A;  5BS7 C;  4WNN A;  1M1A C;  3UT9 C;  3LZ0 D;  3WA9 C;  5B2J D;  3LZ1 A;  1HQ3 C;  3KFU G;  5F99 C;  1JFI B;  1M1A B;  2Y2M A;  3UT9 B;  3LZ0 A;  3WA9 B;  5B2J A;  4XUJ C;  1M1A D;  1HQ3 B;  2Y2G A;  3UT9 D;  5B0Y C;  5F99 B;  1P3O D;  5BS7 A;  4XUJ B;  5B24 C;  5CPJ C;  1M1A A;  4UPK A;  5BNX B;  3VH6 T;  5B32 C;  3UT9 A;  1P34 C;  2F8N H;  4XUJ D;  4KGC D;  5B0Y B;  2FJ7 C;  5G49 B;  1P3O A;  4DQY B;  5B24 B;  5CPJ B;  5B32 B;  1P34 B;  4KGC A;  5B24 D;  5CPJ D;  5BNX A;  2FJ7 B;  4J8V D;  1F1E A;  3KXB C;  5G49 A;  4WZS B;  5B24 A;  5CPJ A;  3B6G C;  4J8V A;  4KUD D;  4CSR B;  3KXB B;  1BH8 B;  5B31 D;  2JSS A;  3AV1 D;  3KXB D;  3B6G B;  3EPH A;  3REI C;  4KUD A;  3B6G D;  5B31 A;  2HIO D;  4CSR A;  3AV1 A;  3KXB A;  1HTA A;  3REI B;  3REL D;  1P3F D;  3B6G A;  1WWS A;  3UTA C;  2HIO A;  1B67 A;  3F6T A;  5B0Z C;  1KX3 A;  3W98 C;  3AL0 C;  5AV9 D;  5JRG C;  5AV8 C;  3REL A;  5BNV B;  3B0C T;  1P3F A;  1KX4 C;  3W99 C;  3UTA B;  5B0Z B;  3KUY C;  1ID3 D;  3UTA D;  3W98 B;  1A7W A;  5AV9 A;  5JRG B;  3VH5 A;  5AV8 B;  3AZH D;  4NE5 A;  3W98 D;  1KX4 B;  3REH C;  3W99 B;  1ID3 A;  3KUY B;  3W99 D;  3AZH A;  3KUY D;  1S32 D;  1P3A C;  3W98 A;  3NQU A;  4WU8 C;  3REH B;  3REH D;  1H3O B;  1S32 A;  1P3A B;  3P5J B;  4WU8 B;  5CPI C;  1KU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...