3X1VC

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vC00
3W99A 5GT3C 1EQZC 3B0DC 1AOID 3X1UB 1ZLAB 3NQJB 3X1VD 4JJNC 5B0YA 3AYWD 5DNNB 5B2JB 5G49B 3TU4A 1TZYD 5BT1D 4KHAA 4X23B 3LJAB 3W96D 5GT3A 1P3KB 1EQZA 4R8PD 2FJ7B 2IO5B 1P3PC 2LY8A 4H9RB 4JJNA 5B1LD 1HTAA 4QLCD 3W97D 4H9NA 5B40D 5B0ZB 3KXBC 1M1AD 5DNND 4AWLB 1S32C 1P3FC 1M19B 1KX4C 1P3PA 1BH8A 2NQBB 4Z2MH 1P3KD 1P3LC 5B1MC 3WAAB 3KXBA 4DRAA 5JA4A 3B0CW 1P3MB 5CPJB 1S32A 5B33B 3AZKB 1P3FA 1ID3B 1F66C 5CP6D 3REJB 1KX4A 4CSRA 4ZBJC 4WNNB 3VH6A 4Z66C 3AZGA 1P3LA 5B1MA 4DRBA 3MVDB 1M19D 3AZHB 1AOIC 4LD9B 5GXQB 4M6BA 4XZQB 3X1SB 5CPKA 5E5AC 3AYWC 3WAAD 1F66A 3UTAD 3B6FB 3B0CT 3MNNB 5BT1C 4Z66A 3AZKD 1ID3D 3W96C 1WWIA 3MGRC 3RELB 1AOIA 5AVCC 1P3GC 3X1TB 1BH9B 5E5AA 3AYWA 5KDMA 4XUJD 4QLCC 3W97C 3AZHD 1P3OD 5DNNC 5B2JC 3W96A 3LZ0B 3MGRA 3MNND 3W99D 5AVCA 2HUEB 1P3GA 3LJAC 3V9RA 1P3KC 3NQJA 3WTPB 1U35B 5DNNA 5B2JA 4YM6B 1M18B 5G49A 5CP6C 1EQZD 3AV1B 3LJAA 1P3KA 1M19C 3KUYB 1KX3D 3AZJB 2NQBC 3WAAC 5B0ZA 3UTAC 5CP6A 5C3IB 4YM6D 3AZKC 3C1CB 1ID3C 3MGQB 1M19A 2NQBA 3B6GB 5AY8B 1N1JB 4EO5C 3UTBB 4XUJC 3MVDC 3WAAA 3KUYD 3UTAA 3AV2D 4YS3B 1S32D 3AZHC 5CPJA 1P3OC 3X1SC 1KX4D 3AZKA 1BFMA 1ID3A 3AFAB 3REJA 3AZGD 1P3LD 3B0BA 3B6FC 5B1MD 4WNNA 3MNNC 3W99C 1H3OB 4XUJA 3MVDA 3WA9B 5CPKD 2AROB 3RELC 3AZHA 5GXQA 3X1TC 1P3OA 3X1SA 3B6GD 4YS3D 5GT0D 3B6FA 3MNNA 4WU8B 3REHD 2BYKB 5E5AD 3RELA 3X1TA 3AZNB 2PYOB 1BH9A 1KX3C 3AZEB 3A6NB 2AROD 5B2IB 3MGRD 1U35C 4Z5TB 5AVCD 4YM6C 3WTPE 5GSUD 1P3GD 3WKJB 3AV1C 4NFTA 1R4VA 3X1UD 1KX3A 1ZLAD 5DNMB 3AZMB 5B2JD 3KUYC 3AZLB 3AV2C 3AZND 2PYOD 3WTPA 1U35A 5AV9B 3AZJC 4H9OB 4YM6A 4X23D 4E44A 5B2ID 3LJAD 3AZGC 3AV1A 4UUZB 4G91B 2BYMA 1ULYA 5C3IC 2FJ7D 3MGQC 5FUGB 3KUYA 3AV2A 5CPKC 1P3AB 5B0ZD 3AZJA 3B6GC 1B6WA 5F99B 2YFVA 3UTBC 3AZLD 2NZDB 4YS3C 5GT0C 4HGAB 1P34B 3O62B 5JRGB 3MGQA 3AFAC 3REHC 2NQBD 4H9QB 3W98B 3B6GA 1N1JA 3UTBA 3MGSB 1P3MD 5CPJD 5B33D 4YS3A 5GT0A 2AROC 3REJD 4J8WB 1P3IB 4WZSB 5B24B 3AFAA 4J8VB 3VH5T 3REHA 5GSUC 4KGCB 3C1BB 5BNXB 3MVDD 1HQ3B 1P34D 4H9SC 5JRGD 2F8NB 1H3OA 3X1UC 2CV5B 4LD9D 1ZLAC 5GXQD 4XZQD 3AN2B 3X1SD 4WU9B 2AROA 3KWQB 3REIB 3AZNC 2PYOC 3B6FD 2CWEA 5B31G 4X23C 5GSUA 3A6NC 2F8NK 5B2IC 4H9SA 3RELD 3X1UA 2FJ7C 1ZLAA 2IO5C 3X1TD 5B31B 4KGCD 2BYKA 3WKJC 5B32G 3AZNA 2PYOA 3TU4B 4J8XB 5B0ZC 3REKB 4KHAB 4X23A 5BS7C 3A6NA 3UT9B 5B2IA 4AWLC 4NE6A 3AZLC 5B32B 3LZ0D 2FJ7A 4H9RA 3WKJA 4G91C 5BS7A 3WTPD 1U35D 3AZMA 3AZLA 1WWSA 5CPJC 1P3AC 5B33C 1P3MC 1M18D 4WV4B 5AV5B 4H9OA 3REJC 3REKD 3UT9D 3AV1D 4HGAC 3KXBB 1P34C 3O62C 5JRGC 4G92B 4LD9C 1P3MA 5GXQC 4XZQC 3AZJD 5B33A 1P3AA 3AZIB 1TAFB 2L5AA 3R45B 4CSRB 3AZFB 3C1CD 3MGQD 1P34A 4J8WC 3O62A 5JRGA 5B24C 4LD9A 4J8VC 4XZQA 5AY8D 5BO0B 4KGCC 3UTBD 4NE3A 2RVQC 1HQ3C 1A7WA 5AV8B 5AVBB 1F1EA 4ZBJB 2CV5C 3MGPB 4WU9C 3AN2C 3KWQC 3NQUB 3AFAD 4J8WA 3LZ0C 1P3IA 3AZFD 5B24A 2YFWB 4J8VA 2HUEC 3X1VB 4KGCA 3C1BA 3WA9D 1HQ3A 2CV5A 1TZYB 1KX5B 1JFIB 4WU9A 3AN2A 3KSYA 5B31C 3WTPC 3KWQA 5AVBD 3REIA 4J8UB 1M18C 3W96B 3LZ0A 4J8XC 3REKC 3UT9C 4R8PB 5AV6B 4WU8D 3LELB 3V9RB 5B1LB 5B32C 4QLCB 3W97B 5B40B 5B31A 1M1AB 5CPIB 2F8NH 3AZED 3A6ND 1M18A 1P3BB 4J8XA 1KX5D 3REKA 3UT9A 5B32A 4KUDB 4Z5TD 4J8UD 2JSSA 3C1CC 5BNVB 5AV5C 3WKJD 4ZUXB 5AV6D 3LELD 4E45A 5DNMD 5AY8C 3LZ1B 3AZMD 3VH5W 5CP6B 4G92C 5CPID 5AV9D 3C1CA 3AZIC 1P3BD 5AV5A 4H9PB 3AZFC 4KUDD 5AY8A 3WA9C 4ZUXD 1P3AD 3UTAB 3LZ1D 5F99D 2F8NG 3AZIA 1TAFA 5AV8C 5AVBC 2NZDD 3R45A 3AZFA 3MGPC 2HIOB 4WU8C 3O62D 4EO5B 3WA9A 4XUJB 3W98D 1P3OB 3X1VC 5BO0A 3MGSD 5AV8A 5AVBA 4CAYB 3AZEC 1TZYC 3MGPA 1KX5C 1B67A 3W99B 4WU8A 4J8WD 1P3ID 5B24D 3NQUA 4Z5TC 4J8VD 4J8UC 3C1BD 2RVQD 5B0YB 1HQ3D 2YFWA 4R8PC 5AV6C 2HIOD 3X1VA 3LELC 2F8ND 5B1LC 2CV5D 4Z2MG 5DNMC 4WU9D 3AZEA 3AN2D 3KWQD 1TZYA 1KU5A 5B40C 3REID 3AZMC 1KX5A 1M1AC 1JFIA 5GT3B 5CPIC 1EQZB 5AV9C 3B0DB 4Z5TA 4J8UA 1P3BC 4JJNB 4R8PA 5AV6A 3LELA 5B1LA 4KUDC 4H9NB 1KX3B 5DNMA 4QLCA 5B31D 3W97A 5B0YD 4ZUXC 5B40A 1M1AA 5CPIA 3TU4D 5AV9A 4J8XD 3LZ1C 5F99C 1P3PB 4NE5A 1P3BA 5B32D 1BH8B 2NZDC 5GT3D 4UUZA 2BYMB 4KUDA 3VH5A 5BNVA 5JA4B 4JJND 5FUGA 4ZUXA 3AV2B 1S32B 1P3FB 3W98C 3LZ1A 5F99A 1KX4B 2YFVB 3MGSC 2NZDA 3AZGB 1P3LB 5B1MB 5AV5D 5CHLB 1P3IC 1P3PD 5CPKB 4H9PA 3C1BC 4H9QA 3VH6W 3KXBD 1F66B 2HIOC 3W98A 3MGSA 4Z66B 5GT0B 3AZID 1P3FD 3REIC 1Q9CA 1AOIB 3REHB 5E5AB 5BNXA 5KDMB 3AYWB 2HIOA 2F8NA 5B0YC 5AV8D 3VH6T 1F66D 3TU4C 3MGRB 3MGPD 4CAYA 5AVCB 4Z66D 1P3GB 5GSUB
chains in the Genus database with same CATH superfamily
3W99A 5GT3C 1EQZC 3B0DC 1AOID 3X1UB 1ZLAB 3NQJB 3X1VD 4JJNC 5B0YA 2Y2HA 5DNNB 3AYWD 5B2JB 5G49B 3TU4A 2W8SA 1TZYD 5BT1D 4KHAA 4X23B 3LJAB 3W96D 2DF4C 5GT3A 1P3KB 1EQZA 4R8PD 2FJ7B 2IO5B 1P3PC 2LY8A 4H9RB 4JJNA 5B1LD 1HTAA 4QLCD 3W97D 4H9NA 5B40D 5B0ZB 3KXBC 1M1AD 5DNND 4AWLB 1S32C 1P3FC 1M19B 1KX4C 1P3PA 1BH8A 2NQBB 4Z2MH 1P3KD 1P3LC 5B1MC 3WAAB 3A1KA 3KXBA 4DRAA 5JA4A 3B0CW 3EG5B 1P3MB 5CPJB 1S32A 5B33B 3AZKB 1P3FA 1ID3B 1F66C 5CP6D 3REJB 1KX4A 4CSRA 4ZBJC 4WNNB 2G5HC 3VH6A 4Z66C 3AZGA 1P3LA 5B1MA 4DRBA 3MVDB 1M19D 3AZHB 1AOIC 4LD9B 5GXQB 2ZY2A 4M6BA 4XZQB 3X1SB 5CPKA 5E5AC 3AYWC 3WAAD 1F66A 3UTAD 3KFUG 3B6FB 3B0CT 3MNNB 5BT1C 4Z66A 3AZKD 1ID3D 3W96C 1WWIA 2XD5A 3MGRC 3RELB 1AOIA 5AVCC 1P3GC 3X1TB 2J8PA 1BH9B 5E5AA 3AYWA 5KDMA 4XUJD 4QLCC 3W97C 3AZHD 1P3OD 5DNNC 5B2JC 3W96A 3LZ0B 3MGRA 3MNND 3W99D 5AVCA 2HUEB 1P3GA 3LJAC 3V9RA 2Y2LA 2Y2PA 1P3KC 3NQJA 3WTPB 1U35B 5DNNA 5B2JA 4YM6B 1M18B 5G49A 5CP6C 1EQZD 3AV1B 3LJAA 1P3KA 2Y2KA 1M19C 3KUYB 2XD1A 1KX3D 3AZJB 2NQBC 3WAAC 5B0ZA 3UTAC 5CP6A 2Y2IA 5C3IB 4YM6D 3AZKC 3C1CB 1ID3C 3MGQB 1M19A 2NQBA 3B6GB 5AY8B 1N1JB 4EO5C 3UTBB 4XUJC 3MVDC 3WAAA 3KUYD 3UTAA 3AV2D 4YS3B 1S32D 3AZHC 5CPJA 1P3OC 3X1SC 1KX4D 3AZKA 1BFMA 1ID3A 2FFFB 3AFAB 3REJA 3AZGD 1P3LD 3B0BA 3B6FC 5B1MD 4WNNA 3MNNC 3W99C 1H3OB 4XUJA 3MVDA 3WA9B 5CPKD 2AROB 3RELC 3AZHA 3AL0C 5GXQA 3X1TC 1P3OA 3X1SA 3B6GD 4YS3D 5GT0D 3B6FA 3MNNA 4WU8B 3REHD 2BYKB 5E5AD 3RELA 3EPJA 3AZNB 3X1TA 2PYOB 1BH9A 1KX3C 3AZEB 3A6NB 2AROD 5B2IB 3MGRD 1U35C 4Z5TB 5AVCD 4YM6C 3WTPE 5GSUD 1P3GD 3WKJB 3AV1C 1Z2CB 4NFTA 1R4VA 3X1UD 1KX3A 1ZLAD 5DNMB 3AZMB 5B2JD 3KUYC 3AZLB 3AV2C 3AZND 2PYOD 3WTPA 1U35A 5AV9B 3AZJC 4H9OB 4YM6A 4X23D 4E44A 5B2ID 3LJAD 3AZGC 3AV1A 4UUZB 2BYMA 4G91B 1ULYA 2ZM5A 5C3IC 2FJ7D 3MGQC 2UWXA 5FUGB 3KUYA 3AV2A 5CPKC 1P3AB 3F6TA 2Y2JA 5B0ZD 3AZJA 3B6GC 1B6WA 5F99B 2YFVA 3UTBC 3AZLD 2NZDB 4YS3C 5GT0C 3H0MC 4HGAB 1P34B 3O62B 5JRGB 3MGQA 3AFAC 3REHC 2NQBD 4H9QB 2ZY4A 3W98B 3B6GA 1N1JA 3UTBA 3MGSB 1P3MD 5CPJD 5B33D 4YS3A 5GT0A 2AROC 2RIQA 3REJD 2Y2MA 4J8WB 1P3IB 4WZSB 5B24B 3AFAA 3FDDA 3VH5T 4J8VB 5GSUC 3REHA 4KGCB 3C1BB 5BNXB 3MVDD 1HQ3B 1P34D 4H9SC 5JRGD 2F8NB 1H3OA 3X1UC 2CV5B 4LD9D 1ZLAC 5GXQD 4XZQD 3AN2B 3X1SD 4WU9B 2AROA 3EPKA 3KWQB 3REIB 3AZNC 2PYOC 3B6FD 2CWEA 5B31G 4X23C 5GSUA 3A6NC 2F8NK 5B2IC 4H9SA 3RELD 3X1UA 2FJ7C 1ZLAA 2IO5C 2JE5A 5B31B 2ZY3A 2BYKA 3X1TD 4KGCD 3WKJC 5B32G 3AZNA 2PYOA 3TU4B 4J8XB 5B0ZC 3REKB 4KHAB 4X23A 5BS7C 3A6NA 3UT9B 5B2IA 4AWLC 4NE6A 3AZLC 5B32B 3LZ0D 4DQYB 2FJ7A 4H9RA 3WKJA 4G91C 5BS7A 2VQRA 3WTPD 1U35D 3AZMA 3AZLA 1WWSA 5CPJC 1P3AC 5B33C 1P3MC 1M18D 4WV4B 5AV5B 4H9OA 3REJC 3REKD 3UT9D 3AV1D 2G5IC 2JCHA 4HGAC 3KXBB 1P34C 3O62C 5JRGC 4G92B 4LD9C 1P3MA 5GXQC 4XZQC 3AZJD 5B33A 1P3AA 3AZIB 1TAFB 2L5AA 3R45B 4CSRB 3AZFB 3C1CD 3MGQD 1P34A 4J8WC 3O62A 5JRGA 5B24C 4LD9A 4J8VC 4XZQA 5AY8D 5BO0B 4KGCC 3UTBD 4NE3A 2RVQC 1HQ3C 1A7WA 5AV8B 5AVBB 1F1EA 4ZBJB 2CV5C 3MGPB 4WU9C 3AN2C 1PZRA 3KWQC 3NQUB 3AFAD 4J8WA 3LZ0C 1P3IA 3AZFD 5B24A 2YFWB 4J8VA 2HUEC 4UPKA 3X1VB 3C1BA 4KGCA 3WA9D 1HQ3A 2F2AC 2CV5A 1TZYB 1KX5B 1JFIB 4WU9A 3AN2A 3KSYA 5B31C 3WTPC 3KWQA 5AVBD 3REIA 4J8UB 1M18C 3W96B 3H0LC 3LZ0A 4J8XC 3REKC 3UT9C 4R8PB 5AV6B 4WU8D 3LELB 3V9RB 5B1LB 5B32C 4QLCB 3P5JB 3W97B 5B40B 3EPHA 5B31A 1M1AB 5CPIB 2F8NH 3AZED 3A6ND 1M18A 1P3BB 4J8XA 1KX5D 3REKA 3UT9A 2Y2OA 2DQNC 5B32A 4KUDB 4Z5TD 4J8UD 2JSSA 3C1CC 5BNVB 5AV5C 3WKJD 4ZUXB 5AV6D 3LELD 4E45A 5DNMD 5AY8C 3LZ1B 3AZMD 3VH5W 5CP6B 4G92C 5CPID 5AV9D 2Y2GA 3C1CA 3AZIC 1P3BD 5AV5A 4H9PB 3AZFC 4KUDD 5AY8A 3WA9C 4ZUXD 3A1IA 1P3AD 3UTAB 3IP4C 3LZ1D 5F99D 2F8NG 3AZIA 1TAFA 5AV8C 5AVBC 2NZDD 3R45A 3AZFA 3MGPC 2HIOB 4WU8C 3O62D 4EO5B 3WA9A 4XUJB 2Y2NA 3W98D 1P3OB 2BG1A 3X1VC 5BO0A 3MGSD 5AV8A 5AVBA 4CAYB 3AZEC 1TZYC 3MGPA 1KX5C 1B67A 3W99B 4WU8A 4J8WD 1P3ID 5B24D 3NQUA 4Z5TC 4J8VD 4J8UC 3C1BD 2RVQD 5B0YB 1HQ3D 2YFWA 4R8PC 5AV6C 2HIOD 3X1VA 3LELC 2F8ND 5B1LC 2CV5D 4Z2MG 5DNMC 4WU9D 3AZEA 3AN2D 3KWQD 1T3UA 1KU5A 1TZYA 3REID 5B40C 3AZMC 1M1AC 1KX5A 5GT3B 5CPIC 1JFIA 1EQZB 5AV9C 3B0DB 4Z5TA 4J8UA 1P3BC 4JJNB 4R8PA 5AV6A 1W2EA 3LELA 5B1LA 4KUDC 4H9NB 1KX3B 5DNMA 4QLCA 5B31D 3W97A 5B0YD 4ZUXC 5B40A 1M1AA 5CPIA 3TU4D 5AV9A 4J8XD 3LZ1C 5F99C 1P3PB 4NE5A 1P3BA 5B32D 1BH8B 2ZY5A 2NZDC 5GT3D 4UUZA 2BYMB 4KUDA 3VH5A 2Y2QA 5BNVA 5JA4B 4JJND 5FUGA 4ZUXA 3AV2B 1S32B 1P3FB 3W98C 3LZ1A 5F99A 1KX4B 2YFVB 3MGSC 2NZDA 3AZGB 1P3LB 5B1MB 5AV5D 5CHLB 3EPLA 1P3IC 1P3PD 5CPKB 4H9PA 3C1BC 4H9QA 3VH6W 3KXBD 1F66B 2HIOC 3W98A 3MGSA 4Z66B 5GT0B 3AZID 1P3FD 4WJ3C 3REIC 1Q9CA 1AOIB 3REHB 5E5AB 5BNXA 5KDMB 3AYWB 2HIOA 2F8NA 5B0YC 5AV8D 3VH6T 1F66D 3H0RC 3TU4C 3MGRB 3MGPD 4CAYA 5AVCB 4Z66D 1P3GB 5GSUB
chains in the Genus database with same CATH topology
3W99A 5GT3C 1EQZC 3B0DC 1AOID 3X1UB 1ZLAB 3NQJB 3X1VD 4JJNC 5B0YA 2Y2HA 5DNNB 3AYWD 5B2JB 5G49B 3TU4A 2W8SA 1TZYD 5BT1D 4KHAA 4X23B 3LJAB 3W96D 2DF4C 5GT3A 1P3KB 1EQZA 4R8PD 2FJ7B 2IO5B 1P3PC 2LY8A 4H9RB 4JJNA 5B1LD 1HTAA 4QLCD 3W97D 4H9NA 5B40D 5B0ZB 3KXBC 1M1AD 5DNND 4AWLB 1S32C 1P3FC 1M19B 1KX4C 1P3PA 1BH8A 2NQBB 4Z2MH 1P3KD 1P3LC 5B1MC 3WAAB 3A1KA 3KXBA 4DRAA 5JA4A 3B0CW 3EG5B 1P3MB 5CPJB 1S32A 5B33B 3AZKB 1P3FA 1ID3B 1F66C 5CP6D 3REJB 1KX4A 4CSRA 4ZBJC 4WNNB 2G5HC 3VH6A 4Z66C 3AZGA 1P3LA 5B1MA 4DRBA 3MVDB 1M19D 3AZHB 1AOIC 4LD9B 5GXQB 2ZY2A 4M6BA 4XZQB 3X1SB 5CPKA 5E5AC 3AYWC 3WAAD 1F66A 3UTAD 3KFUG 3B6FB 3B0CT 3MNNB 5BT1C 4Z66A 3AZKD 1ID3D 3W96C 1WWIA 2XD5A 3MGRC 3RELB 1AOIA 5AVCC 1P3GC 3X1TB 2J8PA 1BH9B 5E5AA 3AYWA 5KDMA 4XUJD 4QLCC 3W97C 3AZHD 1P3OD 5DNNC 5B2JC 3W96A 3LZ0B 3MGRA 3MNND 3W99D 5AVCA 2HUEB 1P3GA 3LJAC 3V9RA 2Y2LA 2Y2PA 1P3KC 3NQJA 3WTPB 1U35B 5DNNA 5B2JA 4YM6B 1M18B 5G49A 5CP6C 1EQZD 3AV1B 3LJAA 1P3KA 2Y2KA 1M19C 3KUYB 2XD1A 1KX3D 3AZJB 2NQBC 3WAAC 5B0ZA 3UTAC 5CP6A 2Y2IA 5C3IB 4YM6D 3AZKC 3C1CB 1ID3C 3MGQB 1M19A 2NQBA 3B6GB 5AY8B 1N1JB 4EO5C 3UTBB 4XUJC 3MVDC 3WAAA 3KUYD 3UTAA 3AV2D 4YS3B 1S32D 3AZHC 5CPJA 1P3OC 3X1SC 1KX4D 3AZKA 1BFMA 1ID3A 2FFFB 3AFAB 3REJA 3AZGD 1P3LD 3B0BA 3B6FC 5B1MD 4WNNA 3MNNC 3W99C 1H3OB 4XUJA 3MVDA 3WA9B 5CPKD 2AROB 3RELC 3AZHA 3AL0C 5GXQA 3X1TC 1P3OA 3X1SA 3B6GD 4YS3D 5GT0D 3B6FA 3MNNA 4WU8B 3REHD 2BYKB 5E5AD 3RELA 3EPJA 3AZNB 3X1TA 2PYOB 1BH9A 1KX3C 3AZEB 3A6NB 2AROD 5B2IB 3MGRD 1U35C 4Z5TB 5AVCD 4YM6C 3WTPE 5GSUD 1P3GD 3WKJB 3AV1C 1Z2CB 4NFTA 1R4VA 3X1UD 1KX3A 1ZLAD 5DNMB 3AZMB 5B2JD 3KUYC 3AZLB 3AV2C 3AZND 2PYOD 3WTPA 1U35A 5AV9B 3AZJC 4H9OB 4YM6A 4X23D 4E44A 5B2ID 3LJAD 3AZGC 3AV1A 4UUZB 2BYMA 4G91B 1ULYA 2ZM5A 5C3IC 2FJ7D 3MGQC 2UWXA 5FUGB 3KUYA 3AV2A 5CPKC 1P3AB 3F6TA 2Y2JA 5B0ZD 3AZJA 3B6GC 1B6WA 5F99B 2YFVA 3UTBC 3AZLD 2NZDB 4YS3C 5GT0C 3H0MC 4HGAB 1P34B 3O62B 5JRGB 3MGQA 3AFAC 3REHC 2NQBD 4H9QB 2ZY4A 3W98B 3B6GA 1N1JA 3UTBA 3MGSB 1P3MD 5CPJD 5B33D 4YS3A 5GT0A 2AROC 2RIQA 3REJD 2Y2MA 4J8WB 1P3IB 4WZSB 5B24B 3AFAA 3FDDA 3VH5T 4J8VB 5GSUC 3REHA 4KGCB 3C1BB 5BNXB 3MVDD 1HQ3B 1P34D 4H9SC 5JRGD 2F8NB 1H3OA 3X1UC 2CV5B 4LD9D 1ZLAC 5GXQD 4XZQD 3AN2B 3X1SD 4WU9B 2AROA 3EPKA 3KWQB 3REIB 3AZNC 2PYOC 3B6FD 2CWEA 5B31G 4X23C 5GSUA 3A6NC 2F8NK 5B2IC 4H9SA 3RELD 3X1UA 2FJ7C 1ZLAA 2IO5C 2JE5A 5B31B 2ZY3A 2BYKA 3X1TD 4KGCD 3WKJC 5B32G 3AZNA 2PYOA 3TU4B 4J8XB 5B0ZC 3REKB 4KHAB 4X23A 5BS7C 3A6NA 3UT9B 5B2IA 4AWLC 4NE6A 3AZLC 5B32B 3LZ0D 4DQYB 2FJ7A 4H9RA 3WKJA 4G91C 5BS7A 2VQRA 3WTPD 1U35D 3AZMA 3AZLA 1WWSA 5CPJC 1P3AC 5B33C 1P3MC 1M18D 4WV4B 5AV5B 4H9OA 3REJC 3REKD 3UT9D 3AV1D 2G5IC 2JCHA 4HGAC 3KXBB 1P34C 3O62C 5JRGC 4G92B 4LD9C 1P3MA 5GXQC 4XZQC 3AZJD 5B33A 1P3AA 3AZIB 1TAFB 2L5AA 3R45B 4CSRB 3AZFB 3C1CD 3MGQD 1P34A 4J8WC 3O62A 5JRGA 5B24C 4LD9A 4J8VC 4XZQA 5AY8D 5BO0B 4KGCC 3UTBD 4NE3A 2RVQC 1HQ3C 1A7WA 5AV8B 5AVBB 1F1EA 4ZBJB 2CV5C 3MGPB 4WU9C 3AN2C 1PZRA 3KWQC 3NQUB 3AFAD 4J8WA 3LZ0C 1P3IA 3AZFD 5B24A 2YFWB 4J8VA 2HUEC 4UPKA 3X1VB 3C1BA 4KGCA 3WA9D 1HQ3A 2F2AC 2CV5A 1TZYB 1KX5B 1JFIB 4WU9A 3AN2A 3KSYA 5B31C 3WTPC 3KWQA 5AVBD 3REIA 4J8UB 1M18C 3W96B 3H0LC 3LZ0A 4J8XC 3REKC 3UT9C 4R8PB 5AV6B 4WU8D 3LELB 3V9RB 5B1LB 5B32C 4QLCB 3P5JB 3W97B 5B40B 3EPHA 5B31A 1M1AB 5CPIB 2F8NH 3AZED 3A6ND 1M18A 1P3BB 4J8XA 1KX5D 3REKA 3UT9A 2Y2OA 2DQNC 5B32A 4KUDB 4Z5TD 4J8UD 2JSSA 3C1CC 5BNVB 5AV5C 3WKJD 4ZUXB 5AV6D 3LELD 4E45A 5DNMD 5AY8C 3LZ1B 3AZMD 3VH5W 5CP6B 4G92C 5CPID 5AV9D 2Y2GA 3C1CA 3AZIC 1P3BD 5AV5A 4H9PB 3AZFC 4KUDD 5AY8A 3WA9C 4ZUXD 3A1IA 1P3AD 3UTAB 3IP4C 3LZ1D 5F99D 2F8NG 3AZIA 1TAFA 5AV8C 5AVBC 2NZDD 3R45A 3AZFA 3MGPC 2HIOB 4WU8C 3O62D 4EO5B 3WA9A 4XUJB 2Y2NA 3W98D 1P3OB 2BG1A 3X1VC 5BO0A 3MGSD 5AV8A 5AVBA 4CAYB 3AZEC 1TZYC 3MGPA 1KX5C 1B67A 3W99B 4WU8A 4J8WD 1P3ID 5B24D 3NQUA 4Z5TC 4J8VD 4J8UC 3C1BD 2RVQD 5B0YB 1HQ3D 2YFWA 4R8PC 5AV6C 2HIOD 3X1VA 3LELC 2F8ND 5B1LC 2CV5D 4Z2MG 5DNMC 4WU9D 3AZEA 3AN2D 3KWQD 1T3UA 1KU5A 1TZYA 3REID 5B40C 3AZMC 1M1AC 1KX5A 5GT3B 5CPIC 1JFIA 1EQZB 5AV9C 3B0DB 4Z5TA 4J8UA 1P3BC 4JJNB 4R8PA 5AV6A 1W2EA 3LELA 5B1LA 4KUDC 4H9NB 1KX3B 5DNMA 4QLCA 5B31D 3W97A 5B0YD 4ZUXC 5B40A 1M1AA 5CPIA 3TU4D 5AV9A 4J8XD 3LZ1C 5F99C 1P3PB 4NE5A 1P3BA 5B32D 1BH8B 2ZY5A 2NZDC 5GT3D 4UUZA 2BYMB 4KUDA 3VH5A 2Y2QA 5BNVA 5JA4B 4JJND 5FUGA 4ZUXA 3AV2B 1S32B 1P3FB 3W98C 3LZ1A 5F99A 1KX4B 2YFVB 3MGSC 2NZDA 3AZGB 1P3LB 5B1MB 5AV5D 5CHLB 3EPLA 1P3IC 1P3PD 5CPKB 4H9PA 3C1BC 4H9QA 3VH6W 3KXBD 1F66B 2HIOC 3W98A 3MGSA 4Z66B 5GT0B 3AZID 1P3FD 4WJ3C 3REIC 1Q9CA 1AOIB 3REHB 5E5AB 5BNXA 5KDMB 3AYWB 2HIOA 2F8NA 5B0YC 5AV8D 3VH6T 1F66D 3H0RC 3TU4C 3MGRB 3MGPD 4CAYA 5AVCB 4Z66D 1P3GB 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 A;  5GT3 C;  1EQZ C;  3B0D C;  1AOI D;  3X1U B;  1ZLA B;  3NQJ B;  3X1V D;  4JJN C;  5B0Y A;  3AYW D;  5DNN B;  5B2J B;  5G49 B;  3TU4 A;  1TZY D;  5BT1 D;  4KHA A;  4X23 B;  3LJA B;  3W96 D;  5GT3 A;  1P3K B;  1EQZ A;  4R8P D;  2FJ7 B;  2IO5 B;  1P3P C;  2LY8 A;  4H9R B;  4JJN A;  5B1L D;  1HTA A;  4QLC D;  3W97 D;  4H9N A;  5B40 D;  5B0Z B;  3KXB C;  1M1A D;  5DNN D;  4AWL B;  1S32 C;  1P3F C;  1M19 B;  1KX4 C;  1P3P A;  1BH8 A;  2NQB B;  4Z2M H;  1P3K D;  1P3L C;  5B1M C;  3WAA B;  3KXB A;  4DRA A;  5JA4 A;  3B0C W;  1P3M B;  5CPJ B;  1S32 A;  5B33 B;  3AZK B;  1P3F A;  1ID3 B;  1F66 C;  5CP6 D;  3REJ B;  1KX4 A;  4CSR A;  4ZBJ C;  4WNN B;  3VH6 A;  4Z66 C;  3AZG A;  1P3L A;  5B1M A;  4DRB A;  3MVD B;  1M19 D;  3AZH B;  1AOI C;  4LD9 B;  5GXQ B;  4M6B A;  4XZQ B;  3X1S B;  5CPK A;  5E5A C;  3AYW C;  3WAA D;  1F66 A;  3UTA D;  3B6F B;  3B0C T;  3MNN B;  5BT1 C;  4Z66 A;  3AZK D;  1ID3 D;  3W96 C;  1WWI A;  3MGR C;  3REL B;  1AOI A;  5AVC C;  1P3G C;  3X1T B;  1BH9 B;  5E5A A;  3AYW A;  5KDM A;  4XUJ D;  4QLC C;  3W97 C;  3AZH D;  1P3O D;  5DNN C;  5B2J C;  3W96 A;  3LZ0 B;  3MGR A;  3MNN D;  3W99 D;  5AVC A;  2HUE B;  1P3G A;  3LJA C;  3V9R A;  1P3K C;  3NQJ A;  3WTP B;  1U35 B;  5DNN A;  5B2J A;  4YM6 B;  1M18 B;  5G49 A;  5CP6 C;  1EQZ D;  3AV1 B;  3LJA A;  1P3K A;  1M19 C;  3KUY B;  1KX3 D;  3AZJ B;  2NQB C;  3WAA C;  5B0Z A;  3UTA C;  5CP6 A;  5C3I B;  4YM6 D;  3AZK C;  3C1C B;  1ID3 C;  3MGQ B;  1M19 A;  2NQB A;  3B6G B;  5AY8 B;  1N1J B;  4EO5 C;  3UTB B;  4XUJ C;  3MVD C;  3WAA A;  3KUY D;  3UTA A;  3AV2 D;  4YS3 B;  1S32 D;  3AZH C;  5CPJ A;  1P3O C;  3X1S C;  1KX4 D;  3AZK A;  1BFM A;  1ID3 A;  3AFA B;  3REJ A;  3AZG D;  1P3L D;  3B0B A;  3B6F C;  5B1M D;  4WNN A;  3MNN C;  3W99 C;  1H3O B;  4XUJ A;  3MVD A;  3WA9 B;  5CPK D;  2ARO B;  3REL C;  3AZH A;  5GXQ A;  3X1T C;  1P3O A;  3X1S A;  3B6G D;  4YS3 D;  5GT0 D;  3B6F A;  3MNN A;  4WU8 B;  3REH D;  2BYK B;  5E5A D;  3REL A;  3X1T A;  3AZN B;  2PYO B;  1BH9 A;  1KX3 C;  3AZE B;  3A6N B;  2ARO D;  5B2I B;  3MGR D;  1U35 C;  4Z5T B;  5AVC D;  4YM6 C;  3WTP E;  5GSU D;  1P3G D;  3WKJ B;  3AV1 C;  4NFT A;  1R4V A;  3X1U D;  1KX3 A;  1ZLA D;  5DNM B;  3AZM B;  5B2J D;  3KUY C;  3AZL B;  3AV2 C;  3AZN D;  2PYO D;  3WTP A;  1U35 A;  5AV9 B;  3AZJ C;  4H9O B;  4YM6 A;  4X23 D;  4E44 A;  5B2I D;  3LJA D;  3AZG C;  3AV1 A;  4UUZ B;  4G91 B;  2BYM A;  1ULY A;  5C3I C;  2FJ7 D;  3MGQ C;  5FUG B;  3KUY A;  3AV2 A;  5CPK C;  1P3A B;  5B0Z D;  3AZJ A;  3B6G C;  1B6W A;  5F99 B;  2YFV A;  3UTB C;  3AZL D;  2NZD B;  4YS3 C;  5GT0 C;  4HGA B;  1P34 B;  3O62 B;  5JRG B;  3MGQ A;  3AFA C;  3REH C;  2NQB D;  4H9Q B;  3W98 B;  3B6G A;  1N1J A;  3UTB A;  3MGS B;  1P3M D;  5CPJ D;  5B33 D;  4YS3 A;  5GT0 A;  2ARO C;  3REJ D;  4J8W B;  1P3I B;  4WZS B;  5B24 B;  3AFA A;  4J8V B;  3VH5 T;  3REH A;  5GSU C;  4KGC B;  3C1B B;  5BNX B;  3MVD D;  1HQ3 B;  1P34 D;  4H9S C;  5JRG D;  2F8N B;  1H3O A;  3X1U C;  2CV5 B;  4LD9 D;  1ZLA C;  5GXQ D;  4XZQ D;  3AN2 B;  3X1S D;  4WU9 B;  2ARO A;  3KWQ B;  3REI B;  3AZN C;  2PYO C;  3B6F D;  2CWE A;  5B31 G;  4X23 C;  5GSU A;  3A6N C;  2F8N K;  5B2I C;  4H9S A;  3REL D;  3X1U A;  2FJ7 C;  1ZLA A;  2IO5 C;  3X1T D;  5B31 B;  4KGC D;  2BYK A;  3WKJ C;  5B32 G;  3AZN A;  2PYO A;  3TU4 B;  4J8X B;  5B0Z C;  3REK B;  4KHA B;  4X23 A;  5BS7 C;  3A6N A;  3UT9 B;  5B2I A;  4AWL C;  4NE6 A;  3AZL C;  5B32 B;  3LZ0 D;  2FJ7 A;  4H9R A;  3WKJ A;  4G91 C;  5BS7 A;  3WTP D;  1U35 D;  3AZM A;  3AZL A;  1WWS A;  5CPJ C;  1P3A C;  5B33 C;  1P3M C;  1M18 D;  4WV4 B;  5AV5 B;  4H9O A;  3REJ C;  3REK D;  3UT9 D;  3AV1 D;  4HGA C;  3KXB B;  1P34 C;  3O62 C;  5JRG C;  4G92 B;  4LD9 C;  1P3M A;  5GXQ C;  4XZQ C;  3AZJ D;  5B33 A;  1P3A A;  3AZI B;  1TAF B;  2L5A A;  3R45 B;  4CSR B;  3AZF B;  3C1C D;  3MGQ D;  1P34 A;  4J8W C;  3O62 A;  5JRG A;  5B24 C;  4LD9 A;  4J8V C;  4XZQ A;  5AY8 D;  5BO0 B;  4KGC C;  3UTB D;  4NE3 A;  2RVQ C;  1HQ3 C;  1A7W A;  5AV8 B;  5AVB B;  1F1E A;  4ZBJ B;  2CV5 C;  3MGP B;  4WU9 C;  3AN2 C;  3KWQ C;  3NQU B;  3AFA D;  4J8W A;  3LZ0 C;  1P3I A;  3AZF D;  5B24 A;  2YFW B;  4J8V A;  2HUE C;  3X1V B;  4KGC A;  3C1B A;  3WA9 D;  1HQ3 A;  2CV5 A;  1TZY B;  1KX5 B;  1JFI B;  4WU9 A;  3AN2 A;  3KSY A;  5B31 C;  3WTP C;  3KWQ A;  5AVB D;  3REI A;  4J8U B;  1M18 C;  3W96 B;  3LZ0 A;  4J8X C;  3REK C;  3UT9 C;  4R8P B;  5AV6 B;  4WU8 D;  3LEL B;  3V9R B;  5B1L B;  5B32 C;  4QLC B;  3W97 B;  5B40 B;  5B31 A;  1M1A B;  5CPI B;  2F8N H;  3AZE D;  3A6N D;  1M18 A;  1P3B B;  4J8X A;  1KX5 D;  3REK A;  3UT9 A;  5B32 A;  4KUD B;  4Z5T D;  4J8U D;  2JSS A;  3C1C C;  5BNV B;  5AV5 C;  3WKJ D;  4ZUX B;  5AV6 D;  3LEL D;  4E45 A;  5DNM D;  5AY8 C;  3LZ1 B;  3AZM D;  3VH5 W;  5CP6 B;  4G92 C;  5CPI D;  5AV9 D;  3C1C A;  3AZI C;  1P3B D;  5AV5 A;  4H9P B;  3AZF C;  4KUD D;  5AY8 A;  3WA9 C;  4ZUX D;  1P3A D;  3UTA B;  3LZ1 D;  5F99 D;  2F8N G;  3AZI A;  1TAF A;  5AV8 C;  5AVB C;  2NZD D;  3R45 A;  3AZF A;  3MGP C;  2HIO B;  4WU8 C;  3O62 D;  4EO5 B;  3WA9 A;  4XUJ B;  3W98 D;  1P3O B;  3X1V C;  5BO0 A;  3MGS D;  5AV8 A;  5AVB A;  4CAY B;  3AZE C;  1TZY C;  3MGP A;  1KX5 C;  1B67 A;  3W99 B;  4WU8 A;  4J8W D;  1P3I D;  5B24 D;  3NQU A;  4Z5T C;  4J8V D;  4J8U C;  3C1B D;  2RVQ D;  5B0Y B;  1HQ3 D;  2YFW A;  4R8P C;  5AV6 C;  2HIO D;  3X1V A;  3LEL C;  2F8N D;  5B1L C;  2CV5 D;  4Z2M G;  5DNM C;  4WU9 D;  3AZE A;  3AN2 D;  3KWQ D;  1TZY A;  1KU5 A;  5B40 C;  3REI D;  3AZM C;  1KX5 A;  1M1A C;  1JFI A;  5GT3 B;  5CPI C;  1EQZ B;  5AV9 C;  3B0D B;  4Z5T A;  4J8U A;  1P3B C;  4JJN B;  4R8P A;  5AV6 A;  3LEL A;  5B1L A;  4KUD C;  4H9N B;  1KX3 B;  5DNM A;  4QLC A;  5B31 D;  3W97 A;  5B0Y D;  4ZUX C;  5B40 A;  1M1A A;  5CPI A;  3TU4 D;  5AV9 A;  4J8X D;  3LZ1 C;  5F99 C;  1P3P B;  4NE5 A;  1P3B A;  5B32 D;  1BH8 B;  2NZD C;  5GT3 D;  4UUZ A;  2BYM B;  4KUD A;  3VH5 A;  5BNV A;  5JA4 B;  4JJN D;  5FUG A;  4ZUX A;  3AV2 B;  1S32 B;  1P3F B;  3W98 C;  3LZ1 A;  5F99 A;  1KX4 B;  2YFV B;  3MGS C;  2NZD A;  3AZG B;  1P3L B;  5B1M B;  5AV5 D;  5CHL B;  1P3I C;  1P3P D;  5CPK B;  4H9P A;  3C1B C;  4H9Q A;  3VH6 W;  3KXB D;  1F66 B;  2HIO C;  3W98 A;  3MGS A;  4Z66 B;  5GT0 B;  3AZI D;  1P3F D;  3REI C;  1Q9C A;  1AOI B;  3REH B;  5E5A B;  5BNX A;  5KDM B;  3AYW B;  2HIO A;  2F8N A;  5B0Y C;  5AV8 D;  3VH6 T;  1F66 D;  3TU4 C;  3MGR B;  3MGP D;  4CAY A;  5AVC B;  4Z66 D;  1P3G B;  5GSU B; 
#chains in the Genus database with same CATH topology
 3W99 A;  5GT3 C;  1EQZ C;  3B0D C;  1AOI D;  3X1U B;  1ZLA B;  3NQJ B;  3X1V D;  4JJN C;  5B0Y A;  2Y2H A;  5DNN B;  3AYW D;  5B2J B;  5G49 B;  3TU4 A;  2W8S A;  1TZY D;  5BT1 D;  4KHA A;  4X23 B;  3LJA B;  3W96 D;  2DF4 C;  5GT3 A;  1P3K B;  1EQZ A;  4R8P D;  2FJ7 B;  2IO5 B;  1P3P C;  2LY8 A;  4H9R B;  4JJN A;  5B1L D;  1HTA A;  4QLC D;  3W97 D;  4H9N A;  5B40 D;  5B0Z B;  3KXB C;  1M1A D;  5DNN D;  4AWL B;  1S32 C;  1P3F C;  1M19 B;  1KX4 C;  1P3P A;  1BH8 A;  2NQB B;  4Z2M H;  1P3K D;  1P3L C;  5B1M C;  3WAA B;  3A1K A;  3KXB A;  4DRA A;  5JA4 A;  3B0C W;  3EG5 B;  1P3M B;  5CPJ B;  1S32 A;  5B33 B;  3AZK B;  1P3F A;  1ID3 B;  1F66 C;  5CP6 D;  3REJ B;  1KX4 A;  4CSR A;  4ZBJ C;  4WNN B;  2G5H C;  3VH6 A;  4Z66 C;  3AZG A;  1P3L A;  5B1M A;  4DRB A;  3MVD B;  1M19 D;  3AZH B;  1AOI C;  4LD9 B;  5GXQ B;  2ZY2 A;  4M6B A;  4XZQ B;  3X1S B;  5CPK A;  5E5A C;  3AYW C;  3WAA D;  1F66 A;  3UTA D;  3KFU G;  3B6F B;  3B0C T;  3MNN B;  5BT1 C;  4Z66 A;  3AZK D;  1ID3 D;  3W96 C;  1WWI A;  2XD5 A;  3MGR C;  3REL B;  1AOI A;  5AVC C;  1P3G C;  3X1T B;  2J8P A;  1BH9 B;  5E5A A;  3AYW A;  5KDM A;  4XUJ D;  4QLC C;  3W97 C;  3AZH D;  1P3O D;  5DNN C;  5B2J C;  3W96 A;  3LZ0 B;  3MGR A;  3MNN D;  3W99 D;  5AVC A;  2HUE B;  1P3G A;  3LJA C;  3V9R A;  2Y2L A;  2Y2P A;  1P3K C;  3NQJ A;  3WTP B;  1U35 B;  5DNN A;  5B2J A;  4YM6 B;  1M18 B;  5G49 A;  5CP6 C;  1EQZ D;  3AV1 B;  3LJA A;  1P3K A;  2Y2K A;  1M19 C;  3KUY B;  2XD1 A;  1KX3 D;  3AZJ B;  2NQB C;  3WAA C;  5B0Z A;  3UTA C;  5CP6 A;  2Y2I A;  5C3I B;  4YM6 D;  3AZK C;  3C1C B;  1ID3 C;  3MGQ B;  1M19 A;  2NQB A;  3B6G B;  5AY8 B;  1N1J B;  4EO5 C;  3UTB B;  4XUJ C;  3MVD C;  3WAA A;  3KUY D;  3UTA A;  3AV2 D;  4YS3 B;  1S32 D;  3AZH C;  5CPJ A;  1P3O C;  3X1S C;  1KX4 D;  3AZK A;  1BFM A;  1ID3 A;  2FFF B;  3AFA B;  3REJ A;  3AZG D;  1P3L D;  3B0B A;  3B6F C;  5B1M D;  4WNN A;  3MNN C;  3W99 C;  1H3O B;  4XUJ A;  3MVD A;  3WA9 B;  5CPK D;  2ARO B;  3REL C;  3AZH A;  3AL0 C;  5GXQ A;  3X1T C;  1P3O A;  3X1S A;  3B6G D;  4YS3 D;  5GT0 D;  3B6F A;  3MNN A;  4WU8 B;  3REH D;  2BYK B;  5E5A D;  3REL A;  3EPJ A;  3AZN B;  3X1T A;  2PYO B;  1BH9 A;  1KX3 C;  3AZE B;  3A6N B;  2ARO D;  5B2I B;  3MGR D;  1U35 C;  4Z5T B;  5AVC D;  4YM6 C;  3WTP E;  5GSU D;  1P3G D;  3WKJ B;  3AV1 C;  1Z2C B;  4NFT A;  1R4V A;  3X1U D;  1KX3 A;  1ZLA D;  5DNM B;  3AZM B;  5B2J D;  3KUY C;  3AZL B;  3AV2 C;  3AZN D;  2PYO D;  3WTP A;  1U35 A;  5AV9 B;  3AZJ C;  4H9O B;  4YM6 A;  4X23 D;  4E44 A;  5B2I D;  3LJA D;  3AZG C;  3AV1 A;  4UUZ B;  2BYM A;  4G91 B;  1ULY A;  2ZM5 A;  5C3I C;  2FJ7 D;  3MGQ C;  2UWX A;  5FUG B;  3KUY A;  3AV2 A;  5CPK C;  1P3A B;  3F6T A;  2Y2J A;  5B0Z D;  3AZJ A;  3B6G C;  1B6W A;  5F99 B;  2YFV A;  3UTB C;  3AZL D;  2NZD B;  4YS3 C;  5GT0 C;  3H0M C;  4HGA B;  1P34 B;  3O62 B;  5JRG B;  3MGQ A;  3AFA C;  3REH C;  2NQB D;  4H9Q B;  2ZY4 A;  3W98 B;  3B6G A;  1N1J A;  3UTB A;  3MGS B;  1P3M D;  5CPJ D;  5B33 D;  4YS3 A;  5GT0 A;  2ARO C;  2RIQ A;  3REJ D;  2Y2M A;  4J8W B;  1P3I B;  4WZS B;  5B24 B;  3AFA A;  3FDD A;  3VH5 T;  4J8V B;  5GSU C;  3REH A;  4KGC B;  3C1B B;  5BNX B;  3MVD D;  1HQ3 B;  1P34 D;  4H9S C;  5JRG D;  2F8N B;  1H3O A;  3X1U C;  2CV5 B;  4LD9 D;  1ZLA C;  5GXQ D;  4XZQ D;  3AN2 B;  3X1S D;  4WU9 B;  2ARO A;  3EPK A;  3KWQ B;  3REI B;  3AZN C;  2PYO C;  3B6F D;  2CWE A;  5B31 G;  4X23 C;  5GSU A;  3A6N C;  2F8N K;  5B2I C;  4H9S A;  3REL D;  3X1U A;  2FJ7 C;  1ZLA A;  2IO5 C;  2JE5 A;  5B31 B;  2ZY3 A;  2BYK A;  3X1T D;  4KGC D;  3WKJ C;  5B32 G;  3AZN A;  2PYO A;  3TU4 B;  4J8X B;  5B0Z C;  3REK B;  4KHA B;  4X23 A;  5BS7 C;  3A6N A;  3UT9 B;  5B2I A;  4AWL C;  4NE6 A;  3AZL C;  5B32 B;  3LZ0 D;  4DQY B;  2FJ7 A;  4H9R A;  3WKJ A;  4G91 C;  5BS7 A;  2VQR A;  3WTP D;  1U35 D;  3AZM A;  3AZL A;  1WWS A;  5CPJ C;  1P3A C;  5B33 C;  1P3M C;  1M18 D;  4WV4 B;  5AV5 B;  4H9O A;  3REJ C;  3REK D;  3UT9 D;  3AV1 D;  2G5I C;  2JCH A;  4HGA C;  3KXB B;  1P34 C;  3O62 C;  5JRG C;  4G92 B;  4LD9 C;  1P3M A;  5GXQ C;  4XZQ C;  3AZJ D;  5B33 A;  1P3A A;  3AZI B;  1TAF B;  2L5A A;  3R45 B;  4CSR B;  3AZF B;  3C1C D;  3MGQ D;  1P34 A;  4J8W C;  3O62 A;  5JRG A;  5B24 C;  4LD9 A;  4J8V C;  4XZQ A;  5AY8 D;  5BO0 B;  4KGC C;  3UTB D;  4NE3 A;  2RVQ C;  1HQ3 C;  1A7W A;  5AV8 B;  5AVB B;  1F1E A;  4ZBJ B;  2CV5 C;  3MGP B;  4WU9 C;  3AN2 C;  1PZR A;  3KWQ C;  3NQU B;  3AFA D;  4J8W A;  3LZ0 C;  1P3I A;  3AZF D;  5B24 A;  2YFW B;  4J8V A;  2HUE C;  4UPK A;  3X1V B;  3C1B A;  4KGC A;  3WA9 D;  1HQ3 A;  2F2A C;  2CV5 A;  1TZY B;  1KX5 B;  1JFI B;  4WU9 A;  3AN2 A;  3KSY A;  5B31 C;  3WTP C;  3KWQ A;  5AVB D;  3REI A;  4J8U B;  1M18 C;  3W96 B;  3H0L C;  3LZ0 A;  4J8X C;  3REK C;  3UT9 C;  4R8P B;  5AV6 B;  4WU8 D;  3LEL B;  3V9R B;  5B1L B;  5B32 C;  4QLC B;  3P5J B;  3W97 B;  5B40 B;  3EPH A;  5B31 A;  1M1A B;  5CPI B;  2F8N H;  3AZE D;  3A6N D;  1M18 A;  1P3B B;  4J8X A;  1KX5 D;  3REK A;  3UT9 A;  2Y2O A;  2DQN C;  5B32 A;  4KUD B;  4Z5T D;  4J8U D;  2JSS A;  3C1C C;  5BNV B;  5AV5 C;  3WKJ D;  4ZUX B;  5AV6 D;  3LEL D;  4E45 A;  5DNM D;  5AY8 C;  3LZ1 B;  3AZM D;  3VH5 W;  5CP6 B;  4G92 C;  5CPI D;  5AV9 D;  2Y2G A;  3C1C A;  3AZI C;  1P3B D;  5AV5 A;  4H9P B;  3AZF C;  4KUD D;  5AY8 A;  3WA9 C;  4ZUX D;  3A1I A;  1P3A D;  3UTA B;  3IP4 C;  3LZ1 D;  5F99 D;  2F8N G;  3AZI A;  1TAF A;  5AV8 C;  5AVB C;  2NZD D;  3R45 A;  3AZF A;  3MGP C;  2HIO B;  4WU8 C;  3O62 D;  4EO5 B;  3WA9 A;  4XUJ B;  2Y2N A;  3W98 D;  1P3O B;  2BG1 A;  3X1V C;  5BO0 A;  3MGS D;  5AV8 A;  5AVB A;  4CAY B;  3AZE C;  1TZY C;  3MGP A;  1KX5 C;  1B67 A;  3W99 B;  4WU8 A;  4J8W D;  1P3I D;  5B24 D;  3NQU A;  4Z5T C;  4J8V D;  4J8U C;  3C1B D;  2RVQ D;  5B0Y B;  1HQ3 D;  2YFW A;  4R8P C;  5AV6 C;  2HIO D;  3X1V A;  3LEL C;  2F8N D;  5B1L C;  2CV5 D;  4Z2M G;  5DNM C;  4WU9 D;  3AZE A;  3AN2 D;  3KWQ D;  1T3U A;  1KU5 A;  1TZY A;  3REI D;  5B40 C;  3AZM C;  1M1A C;  1KX5 A;  5GT3 B;  5CPI C;  1JFI A;  1EQZ B;  5AV9 C;  3B0D B;  4Z5T A;  4J8U A;  1P3B C;  4JJN B;  4R8P A;  5AV6 A;  1W2E A;  3LEL A;  5B1L A;  4KUD C;  4H9N B;  1KX3 B;  5DNM A;  4QLC A;  5B31 D;  3W97 A;  5B0Y D;  4ZUX C;  5B40 A;  1M1A A;  5CPI A;  3TU4 D;  5AV9 A;  4J8X D;  3LZ1 C;  5F99 C;  1P3P B;  4NE5 A;  1P3B A;  5B32 D;  1BH8 B;  2ZY5 A;  2NZD C;  5GT3 D;  4UUZ A;  2BYM B;  4KUD A;  3VH5 A;  2Y2Q A;  5BNV A;  5JA4 B;  4JJN D;  5FUG A;  4ZUX A;  3AV2 B;  1S32 B;  1P3F B;  3W98 C;  3LZ1 A;  5F99 A;  1KX4 B;  2YFV B;  3MGS C;  2NZD A;  3AZG B;  1P3L B;  5B1M B;  5AV5 D;  5CHL B;  3EPL A;  1P3I C;  1P3P D;  5CPK B;  4H9P A;  3C1B C;  4H9Q A;  3VH6 W;  3KXB D;  1F66 B;  2HIO C;  3W98 A;  3MGS A;  4Z66 B;  5GT0 B;  3AZI D;  1P3F D;  4WJ3 C;  3REI C;  1Q9C A;  1AOI B;  3REH B;  5E5A B;  5BNX A;  5KDM B;  3AYW B;  2HIO A;  2F8N A;  5B0Y C;  5AV8 D;  3VH6 T;  1F66 D;  3H0R C;  3TU4 C;  3MGR B;  3MGP D;  4CAY A;  5AVC B;  4Z66 D;  1P3G B;  5GSU B; 
#chains in the Genus database with same CATH homology
 3W99 A;  5GT3 C;  1EQZ C;  3B0D C;  1AOI D;  3X1U B;  1ZLA B;  3NQJ B;  3X1V D;  4JJN C;  5B0Y A;  2Y2H A;  5DNN B;  3AYW D;  5B2J B;  5G49 B;  3TU4 A;  2W8S A;  1TZY D;  5BT1 D;  4KHA A;  4X23 B;  3LJA B;  3W96 D;  2DF4 C;  5GT3 A;  1P3K B;  1EQZ A;  4R8P D;  2FJ7 B;  2IO5 B;  1P3P C;  2LY8 A;  4H9R B;  4JJN A;  5B1L D;  1HTA A;  4QLC D;  3W97 D;  4H9N A;  5B40 D;  5B0Z B;  3KXB C;  1M1A D;  5DNN D;  4AWL B;  1S32 C;  1P3F C;  1M19 B;  1KX4 C;  1P3P A;  1BH8 A;  2NQB B;  4Z2M H;  1P3K D;  1P3L C;  5B1M C;  3WAA B;  3A1K A;  3KXB A;  4DRA A;  5JA4 A;  3B0C W;  3EG5 B;  1P3M B;  5CPJ B;  1S32 A;  5B33 B;  3AZK B;  1P3F A;  1ID3 B;  1F66 C;  5CP6 D;  3REJ B;  1KX4 A;  4CSR A;  4ZBJ C;  4WNN B;  2G5H C;  3VH6 A;  4Z66 C;  3AZG A;  1P3L A;  5B1M A;  4DRB A;  3MVD B;  1M19 D;  3AZH B;  1AOI C;  4LD9 B;  5GXQ B;  2ZY2 A;  4M6B A;  4XZQ B;  3X1S B;  5CPK A;  5E5A C;  3AYW C;  3WAA D;  1F66 A;  3UTA D;  3KFU G;  3B6F B;  3B0C T;  3MNN B;  5BT1 C;  4Z66 A;  3AZK D;  1ID3 D;  3W96 C;  1WWI A;  2XD5 A;  3MGR C;  3REL B;  1AOI A;  5AVC C;  1P3G C;  3X1T B;  2J8P A;  1BH9 B;  5E5A A;  3AYW A;  5KDM A;  4XUJ D;  4QLC C;  3W97 C;  3AZH D;  1P3O D;  5DNN C;  5B2J C;  3W96 A;  3LZ0 B;  3MGR A;  3MNN D;  3W99 D;  5AVC A;  2HUE B;  1P3G A;  3LJA C;  3V9R A;  2Y2L A;  2Y2P A;  1P3K C;  3NQJ A;  3WTP B;  1U35 B;  5DNN A;  5B2J A;  4YM6 B;  1M18 B;  5G49 A;  5CP6 C;  1EQZ D;  3AV1 B;  3LJA A;  1P3K A;  2Y2K A;  1M19 C;  3KUY B;  2XD1 A;  1KX3 D;  3AZJ B;  2NQB C;  3WAA C;  5B0Z A;  3UTA C;  5CP6 A;  2Y2I A;  5C3I B;  4YM6 D;  3AZK C;  3C1C B;  1ID3 C;  3MGQ B;  1M19 A;  2NQB A;  3B6G B;  5AY8 B;  1N1J B;  4EO5 C;  3UTB B;  4XUJ C;  3MVD C;  3WAA A;  3KUY D;  3UTA A;  3AV2 D;  4YS3 B;  1S32 D;  3AZH C;  5CPJ A;  1P3O C;  3X1S C;  1KX4 D;  3AZK A;  1BFM A;  1ID3 A;  2FFF B;  3AFA B;  3REJ A;  3AZG D;  1P3L D;  3B0B A;  3B6F C;  5B1M D;  4WNN A;  3MNN C;  3W99 C;  1H3O B;  4XUJ A;  3MVD A;  3WA9 B;  5CPK D;  2ARO B;  3REL C;  3AZH A;  3AL0 C;  5GXQ A;  3X1T C;  1P3O A;  3X1S A;  3B6G D;  4YS3 D;  5GT0 D;  3B6F A;  3MNN A;  4WU8 B;  3REH D;  2BYK B;  5E5A D;  3REL A;  3EPJ A;  3AZN B;  3X1T A;  2PYO B;  1BH9 A;  1KX3 C;  3AZE B;  3A6N B;  2ARO D;  5B2I B;  3MGR D;  1U35 C;  4Z5T B;  5AVC D;  4YM6 C;  3WTP E;  5GSU D;  1P3G D;  3WKJ B;  3AV1 C;  1Z2C B;  4NFT A;  1R4V A;  3X1U D;  1KX3 A;  1ZLA D;  5DNM B;  3AZM B;  5B2J D;  3KUY C;  3AZL B;  3AV2 C;  3AZN D;  2PYO D;  3WTP A;  1U35 A;  5AV9 B;  3AZJ C;  4H9O B;  4YM6 A;  4X23 D;  4E44 A;  5B2I D;  3LJA D;  3AZG C;  3AV1 A;  4UUZ B;  2BYM A;  4G91 B;  1ULY A;  2ZM5 A;  5C3I C;  2FJ7 D;  3MGQ C;  2UWX A;  5FUG B;  3KUY A;  3AV2 A;  5CPK C;  1P3A B;  3F6T A;  2Y2J A;  5B0Z D;  3AZJ A;  3B6G C;  1B6W A;  5F99 B;  2YFV A;  3UTB C;  3AZL D;  2NZD B;  4YS3 C;  5GT0 C;  3H0M C;  4HGA B;  1P34 B;  3O62 B;  5JRG B;  3MGQ A;  3AFA C;  3REH C;  2NQB D;  4H9Q B;  2ZY4 A;  3W98 B;  3B6G A;  1N1J A;  3UTB A;  3MGS B;  1P3M D;  5CPJ D;  5B33 D;  4YS3 A;  5GT0 A;  2ARO C;  2RIQ A;  3REJ D;  2Y2M A;  4J8W B;  1P3I B;  4WZS B;  5B24 B;  3AFA A;  3FDD A;  3VH5 T;  4J8V B;  5GSU C;  3REH A;  4KGC B;  3C1B B;  5BNX B;  3MVD D;  1HQ3 B;  1P34 D;  4H9S C;  5JRG D;  2F8N B;  1H3O A;  3X1U C;  2CV5 B;  4LD9 D;  1ZLA C;  5GXQ D;  4XZQ D;  3AN2 B;  3X1S D;  4WU9 B;  2ARO A;  3EPK A;  3KWQ B;  3REI B;  3AZN C;  2PYO C;  3B6F D;  2CWE A;  5B31 G;  4X23 C;  5GSU A;  3A6N C;  2F8N K;  5B2I C;  4H9S A;  3REL D;  3X1U A;  2FJ7 C;  1ZLA A;  2IO5 C;  2JE5 A;  5B31 B;  2ZY3 A;  2BYK A;  3X1T D;  4KGC D;  3WKJ C;  5B32 G;  3AZN A;  2PYO A;  3TU4 B;  4J8X B;  5B0Z C;  3REK B;  4KHA B;  4X23 A;  5BS7 C;  3A6N A;  3UT9 B;  5B2I A;  4AWL C;  4NE6 A;  3AZL C;  5B32 B;  3LZ0 D;  4DQY B;  2FJ7 A;  4H9R A;  3WKJ A;  4G91 C;  5BS7 A;  2VQR A;  3WTP D;  1U35 D;  3AZM A;  3AZL A;  1WWS A;  5CPJ C;  1P3A C;  5B33 C;  1P3M C;  1M18 D;  4WV4 B;  5AV5 B;  4H9O A;  3REJ C;  3REK D;  3UT9 D;  3AV1 D;  2G5I C;  2JCH A;  4HGA C;  3KXB B;  1P34 C;  3O62 C;  5JRG C;  4G92 B;  4LD9 C;  1P3M A;  5GXQ C;  4XZQ C;  3AZJ D;  5B33 A;  1P3A A;  3AZI B;  1TAF B;  2L5A A;  3R45 B;  4CSR B;  3AZF B;  3C1C D;  3MGQ D;  1P34 A;  4J8W C;  3O62 A;  5JRG A;  5B24 C;  4LD9 A;  4J8V C;  4XZQ A;  5AY8 D;  5BO0 B;  4KGC C;  3UTB D;  4NE3 A;  2RVQ C;  1HQ3 C;  1A7W A;  5AV8 B;  5AVB B;  1F1E A;  4ZBJ B;  2CV5 C;  3MGP B;  4WU9 C;  3AN2 C;  1PZR A;  3KWQ C;  3NQU B;  3AFA D;  4J8W A;  3LZ0 C;  1P3I A;  3AZF D;  5B24 A;  2YFW B;  4J8V A;  2HUE C;  4UPK A;  3X1V B;  3C1B A;  4KGC A;  3WA9 D;  1HQ3 A;  2F2A C;  2CV5 A;  1TZY B;  1KX5 B;  1JFI B;  4WU9 A;  3AN2 A;  3KSY A;  5B31 C;  3WTP C;  3KWQ A;  5AVB D;  3REI A;  4J8U B;  1M18 C;  3W96 B;  3H0L C;  3LZ0 A;  4J8X C;  3REK C;  3UT9 C;  4R8P B;  5AV6 B;  4WU8 D;  3LEL B;  3V9R B;  5B1L B;  5B32 C;  4QLC B;  3P5J B;  3W97 B;  5B40 B;  3EPH A;  5B31 A;  1M1A B;  5CPI B;  2F8N H;  3AZE D;  3A6N D;  1M18 A;  1P3B B;  4J8X A;  1KX5 D;  3REK A;  3UT9 A;  2Y2O A;  2DQN C;  5B32 A;  4KUD B;  4Z5T D;  4J8U D;  2JSS A;  3C1C C;  5BNV B;  5AV5 C;  3WKJ D;  4ZUX B;  5AV6 D;  3LEL D;  4E45 A;  5DNM D;  5AY8 C;  3LZ1 B;  3AZM D;  3VH5 W;  5CP6 B;  4G92 C;  5CPI D;  5AV9 D;  2Y2G A;  3C1C A;  3AZI C;  1P3B D;  5AV5 A;  4H9P B;  3AZF C;  4KUD D;  5AY8 A;  3WA9 C;  4ZUX D;  3A1I A;  1P3A D;  3UTA B;  3IP4 C;  3LZ1 D;  5F99 D;  2F8N G;  3AZI A;  1TAF A;  5AV8 C;  5AVB C;  2NZD D;  3R45 A;  3AZF A;  3MGP C;  2HIO B;  4WU8 C;  3O62 D;  4EO5 B;  3WA9 A;  4XUJ B;  2Y2N A;  3W98 D;  1P3O B;  2BG1 A;  3X1V C;  5BO0 A;  3MGS D;  5AV8 A;  5AVB A;  4CAY B;  3AZE C;  1TZY C;  3MGP A;  1KX5 C;  1B67 A;  3W99 B;  4WU8 A;  4J8W D;  1P3I D;  5B24 D;  3NQU A;  4Z5T C;  4J8V D;  4J8U C;  3C1B D;  2RVQ D;  5B0Y B;  1HQ3 D;  2YFW A;  4R8P C;  5AV6 C;  2HIO D;  3X1V A;  3LEL C;  2F8N D;  5B1L C;  2CV5 D;  4Z2M G;  5DNM C;  4WU9 D;  3AZE A;  3AN2 D;  3KWQ D;  1T3U A;  1KU5 A;  1TZY A;  3REI D;  5B40 C;  3AZM C;  1M1A C;  1KX5 A;  5GT3 B;  5CPI C;  1JFI A;  1EQZ B;  5AV9 C;  3B0D B;  4Z5T A;  4J8U A;  1P3B C;  4JJN B;  4R8P A;  5AV6 A;  1W2E A;  3LEL A;  5B1L A;  4KUD C;  4H9N B;  1KX3 B;  5DNM A;  4QLC A;  5B31 D;  3W97 A;  5B0Y D;  4ZUX C;  5B40 A;  1M1A A;  5CPI A;  3TU4 D;  5AV9 A;  4J8X D;  3LZ1 C;  5F99 C;  1P3P B;  4NE5 A;  1P3B A;  5B32 D;  1BH8 B;  2ZY5 A;  2NZD C;  5GT3 D;  4UUZ A;  2BYM B;  4KUD A;  3VH5 A;  2Y2Q A;  5BNV A;  5JA4 B;  4JJN D;  5FUG A;  4ZUX A;  3AV2 B;  1S32 B;  1P3F B;  3W98 C;  3LZ1 A;  5F99 A;  1KX4 B;  2YFV B;  3MGS C;  2NZD A;  3AZG B;  1P3L B;  5B1M B;  5AV5 D;  5CHL B;  3EPL A;  1P3I C;  1P3P D;  5CPK B;  4H9P A;  3C1B C;  4H9Q A;  3VH6 W;  3KXB D;  1F66 B;  2HIO C;  3W98 A;  3MGS A;  4Z66 B;  5GT0 B;  3AZI D;  1P3F D;  4WJ3 C;  3REI C;  1Q9C A;  1AOI B;  3REH B;  5E5A B;  5BNX A;  5KDM B;  3AYW B;  2HIO A;  2F8N A;  5B0Y C;  5AV8 D;  3VH6 T;  1F66 D;  3H0R C;  3TU4 C;  3MGR B;  3MGP D;  4CAY A;  5AVC B;  4Z66 D;  1P3G B;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...