3X1VC

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vC00
3UTBA 5AV5B 3UT9D 4H9OA 3AZMD 5B1LC 3AFAB 2F8NB 3W99A 3C1CD 4QLCA 3AZIB 5AY8D 4H9SA 5B0ZC 5E5AD 4EO5B 4YS3A 1ID3D 2YFVA 3MGRC 3W98A 5JRGA 3WTPE 1S32B 4CSRB 5KDMB 3LZ1D 3RELB 3LZ0B 3MVDC 5AV8C 1H3OA 2AROD 4H9RB 5BNVA 4Z5TB 1P3FD 1P3KC 3REKA 2PYOC 5AVBC 5GT0B 1A7WA 2NQBB 4WU8B 4J8VD 3UT9B 1EQZB 3LJAB 1U35D 3NQUA 3C1CB 1P3ID 3X1UD 3WAAC 5F99B 2YFWA 3AV2B 3WA9D 5C3IC 1HQ3A 3AYWD 5JA4B 1M19D 5B1LA 5CPID 3B6GC 3B6FC 3MGPD 4KUDD 5B2JD 3LZ1B 5AVCD 5B2ID 1WWIA 3WKJC 5B0ZA 5B33C 4NE6A 4XZQC 1P3GC 5AV6D 1KX4B 5GXQC 5DNNC 1P3FB 4WU9C 3MGSD 4R8PC 3WTPC 1HTAA 2HUEB 3C1BA 5B24D 2HIOB 3MVDA 1F1EA 5AV8A 3X1SC 4J8XD 3X1UB 1P3KA 5AVBA 3W96D 5B32D 4X23D 3X1TB 1M19B 3AN2C 4XUJD 5B1MC 1JFIB 4H9QA 5B2JB 4CAYB 4ZUXC 5AVCB 5CP6D 5B2IB 3AZHC 3WAAA 5B31A 5G49A 4LD9D 3MGQD 5BO0A 1ZLAD 3B6GA 4ZBJC 3MGSB 1P3AB 4HGAB 4Z66C 3MNND 3LELB 3WKJA 5DNMC 5B33A 4XZQA 1P3GA 5FUGA 1KX5B 5DNNA 5GXQA 3A6ND 4J8XB 1P3OB 4WU9A 4G92B 3UTAD 1P3PB 3W96B 4R8PA 3WTPA 2CV5D 5B32B 4X23B 3W97C 4KHAB 4WNNB 3X1SA 4XUJB 3AZJC 5GT3D 3KWQC 5CPKB 1M1AC 4G91C 3TU4C 1ZLAB 3AN2A 3REJD 5B31G 3AZEB 5B1MA 3MNNB 3AZHA 3REHC 1KX3C 5BNXB 3VH6T 3A6NB 3AZMC 3V9RA 3MGRB 4Z2MH 4Z66A 4YM6D 2CV5B 5AY8C 3AZKD 4NE5A 5E5AC 1ID3C 5GT3B 4UUZB 3O62D 2PYOB 3W97A 3AZJA 3KUYA 3KWQA 1M1AA 5GSUD 3AFAD 3TU4A 1B67A 1P3IC 3REHA 1P3MA 1KX3A 3B6FB 3AZKB 3AYWC 5AV9C 4KGCD 3AZMA 3B0CW 1BH9A 3AZND 5CPJB 3RELD 3LZ0D 3MGPC 5AY8A 2F8NG 5E5AA 5B0YB 1ID3A 3VH5A 1WWSA 3KXBD 2NQBD 4WU8D 1N1JB 5GSUB 1EQZD 3LJAD 5B24C 1P3LD 5F99D 3AV2D 3AZFB 2AROA 3B0DB 4ZUXB 2FJ7C 4J8VA 4KGCB 1M18B 5BT1D 3AZNB 3C1BC 1TAFA 1P34D 4E45A 1U35A 1P3IA 1KX4D 3WA9A 3AYWA 5AV9A 4JJND 4H9NA 4J8WB 3MGQC 1AOIB 5DNMB 1TZYD 4H9PB 3KXBB 5B40D 5CPIA 3MGPA 2HIOD 4KUDA 1P3LB 5B31C 5AV6A 1P3BD 4J8UB 4WV4B 3X1TD 3UTAC 2JSSA 3X1VC 3UTBD 5B24A 1P34B 3W99D 2BYKB 3REIC 4YS3D 4JJNB 4AWLB 2FJ7A 2NZDC 3AV1C 4DRAA 1P3AD 1TZYB 3LELD 3REJC 5JRGD 5B40B 1BH8B 5CP6A 3AZGC 1KX5D 4E44A 4LD9A 1P3OD 2BYMB 3MGQA 1P3PD 1P3BB 3REKD 3VH5W 4YM6C 3W98B 3UTBB 4H9OB 3W99B 4QLCB 5CPKD 3KSYA 3UTAA 1HQ3D 4YS3B 3AZED 3X1VA 2YFVB 1F66C 3O62C 4M6BA 5B1LD 5JRGB 1R4VA 3AZLC 5B32G 3R45A 3VH6A 5BS7C 5AV5C 3REIA 2NZDA 3AFAC 3MGRD 3AV1A 1H3OB 5BNVB 3REJA 3REKB 3AZIC 3AZGA 4EO5C 3KUYC 3MVDD 5AV8D 3NQUB 1S32C 3NQJA 1P3KD 2YFWB 3RELC 3LZ0C 2PYOD 1HQ3B 4YM6A 5B1LB 1P3MC 4Z5TC 5GT0C 2NQBC 3UT9C 5B0ZB 1F66A 3O62A 3LJAC 3C1CC 3B6FD 5F99C 3AZLA 3AV2C 3C1BB 3WKJD 5AV5A 5BS7A 1Q9CA 4XZQD 5CPJD 3MVDB 3AFAA 5AV8B 1P3GD 2F8NA 3LZ1C 5BT1C 1P3KB 3AZIA 5AVBB 4R8PD 3WTPD 5B0YD 1KX4C 2AROC 3B0CT 1P3FC 1S32A 4CSRA 4H9QB 5KDMA 3WAAB 2HUEC 5G49B 5B31B 2HIOC 5C3IB 3LZ0A 4J8VC 3RELA 5BO0B 3AZFD 3AN2D 4H9RA 1U35C 3B6GB 5B1MD 4Z5TA 3X1UC 4ZUXD 3WA9C 5GT0A 2NQBA 3WKJB 4WU8A 3UT9A 1M19C 5B33B 1M18D 4XZQB 1P3GB 5FUGB 5CPIC 3LJAA 1EQZA 5GXQB 5DNNB 5B2JC 3C1CA 2IO5C 4KUDC 5AVCC 5B2IC 5F99A 3AV2A 4WU9B 4R8PB 3WTPB 4J8WD 1AOID 5DNMD 5JA4A 5AV6C 4Z2MG 3X1SB 3MGSC 3LZ1A 1P3AC 4HGAC 2L5AA 1KX5C 3AN2B 1KX4A 3W97D 4J8XC 1P3OC 5B1MB 4J8UD 1P3FA 4G92C 2F8NK 3W96C 3AZHB 1B6WA 5B32C 3KWQD 2HIOA 4X23C 1M1AD 3TU4D 4XUJC 4ZBJB 5CP6C 3X1UA 3V9RB 4LD9C 4Z66B 3REHD 5CPKC 3X1TA 1M19A 1ZLAC 3AZEC 1JFIA 5B2JA 4CAYA 5AVCA 3MNNC 5B2IA 3B0BA 3W97B 3A6NC 3AZJB 3MGSA 3KUYB 1P3AA 3W98D 3LELA 2CV5C 3KWQB 1M1AB 4G91B 3TU4B 1KX5A 4QLCD 4J8XA 1P3OA 1P3PA 5GT3C 3W96A 1P3MB 3REHB 2RVQD 3VH5T 5B32A 4X23A 1KX3B 4KHAA 4WNNA 5CHLB 4XUJA 3AZMB 1BH9B 5CPKA 1ZLAA 5AY8B 5AV9D 5E5AB 1ID3B 3AZEA 4DRBA 3MNNA 3AZKC 5BNXA 3A6NA 5CPJC 3MGRA 2AROB 2CV5A 5B0YC 4J8VB 1TAFB 5GT3A 1U35B 4UUZA 5B0ZD 1P3IB 5GSUC 2PYOA 3WA9B 3AYWB 5AV9B 4H9NB 2FJ7D 3AZFC 3C1BD 3B0DC 5CPIB 4KUDB 3MGPB 2IO5B 4KGCC 1M18C 3AZNC 5AV6B 5AVBD 3B6FA 3AZKA 4J8WC 1AOIC 5B24B 3WAAD 5CPJA 3KXBC 5B31D 4WU8C 1EQZC 1P3LC 5B0YA 3X1VD 2FJ7B 3B6GD 4J8UC 1N1JA 5B33D 5CP6B 5GSUA 4NE3A 3REID 5GXQD 5DNND 4LD9B 3MGQB 2NZDD 3AV1D 4WU9D 1P34C 3AZFA 4ZUXA 4WZSB 3AZGD 4JJNC 3X1SD 4AWLC 4KGCA 1M18A 3AZNA 1TZYC 2F8NH 5B40C 1BFMA 3UTAB 4J8WA 3X1VB 1AOIA 5DNMA 3AZHD 4H9PA 3KXBA 1P3BC 2LY8A 3X1TC 3W98C 3R45B 3REIB 3UTBC 1P3LA 3VH6W 1F66D 2NZDB 3AV1B 3W99C 4QLCC 4Z66D 3REJB 4J8UA 3AZLD 4H9SC 4YS3C 3AZGB 2RVQC 5AV5D 3LELC 1P34A 5JRGC 2F8ND 2BYKA 3NQJB 4NFTA 3AZID 4YM6B 4JJNA 3AZJD 1P3PC 3KUYD 1TZYA 5B40A 1S32D 1ULYA 3REKC 1BH8A 2BYMA 2CWEA 1F66B 3O62B 1P3MD 1P3BA 4Z5TD 1KX3D 1KU5A 3AZLB 1HQ3C 5GT0D
chains in the Genus database with same CATH superfamily
3UTBA 5AV5B 3UT9D 4H9OA 3AZMD 5B1LC 3AFAB 2F8NB 3W99A 3C1CD 4QLCA 3AZIB 5AY8D 2Y2GA 4H9SA 5B0ZC 5E5AD 4EO5B 4YS3A 1ID3D 2YFVA 3MGRC 3W98A 5JRGA 3WTPE 1S32B 4CSRB 5KDMB 3LZ1D 3RELB 3LZ0B 3MVDC 5AV8C 1H3OA 2AROD 4H9RB 5BNVA 4Z5TB 1P3FD 1P3KC 3REKA 2PYOC 5AVBC 1W2EA 1A7WA 5GT0B 2NQBB 4WU8B 4J8VD 3UT9B 1EQZB 3LJAB 1U35D 3NQUA 3C1CB 1P3ID 3X1UD 3WAAC 5F99B 2YFWA 3AV2B 3WA9D 5C3IC 1HQ3A 3AYWD 5JA4B 1M19D 5B1LA 5CPID 3B6GC 3B6FC 3MGPD 4KUDD 5B2JD 3LZ1B 5AVCD 5B2ID 1WWIA 3WKJC 5B0ZA 2JCHA 4NE6A 5B33C 4XZQC 1P3GC 5AV6D 1KX4B 5GXQC 5DNNC 1P3FB 4WU9C 3MGSD 4R8PC 3WTPC 1HTAA 2HUEB 3C1BA 5B24D 2HIOB 3MVDA 1F1EA 5AV8A 3X1SC 4J8XD 3X1UB 1P3KA 5AVBA 3W96D 5B32D 4X23D 3X1TB 1M19B 3AN2C 4XUJD 5B1MC 1JFIB 4H9QA 5B2JB 4CAYB 4ZUXC 5AVCB 5CP6D 5B2IB 3AZHC 3WAAA 5B31A 5G49A 4LD9D 3MGQD 5BO0A 1ZLAD 2VQRA 2ZY4A 3B6GA 4ZBJC 3MGSB 1P3AB 4HGAB 4Z66C 3MNND 3LELB 3WKJA 5DNMC 1T3UA 5B33A 3F6TA 4XZQA 1P3GA 5FUGA 1KX5B 5DNNA 5GXQA 3A6ND 4J8XB 1P3OB 4WU9A 4G92B 3UTAD 1P3PB 3W96B 4WJ3C 4R8PA 3WTPA 2CV5D 5B32B 4X23B 3W97C 4KHAB 4WNNB 3X1SA 4XUJB 3AZJC 5GT3D 3KWQC 5CPKB 1M1AC 4G91C 3TU4C 1ZLAB 3AN2A 3REJD 5B31G 3AZEB 5B1MA 3MNNB 3AZHA 3EPHA 3REHC 1KX3C 5BNXB 3VH6T 3A6NB 3AZMC 3V9RA 3MGRB 4Z2MH 4Z66A 4YM6D 2CV5B 5AY8C 3AZKD 4NE5A 5E5AC 1ID3C 2J8PA 5GT3B 4UUZB 3O62D 2PYOB 3FDDA 3W97A 3AZJA 2Y2IA 3KUYA 3KWQA 1M1AA 5GSUD 3AFAD 3TU4A 1B67A 3H0MC 1P3IC 3REHA 1P3MA 1KX3A 3B6FB 3AZKB 3AYWC 5AV9C 4KGCD 3AZMA 3B0CW 1BH9A 3AZND 5CPJB 3RELD 3LZ0D 3MGPC 2Y2KA 3AL0C 5AY8A 2F8NG 5E5AA 5B0YB 3A1IA 1ID3A 1Z2CB 3VH5A 1WWSA 3KXBD 2NQBD 4WU8D 1N1JB 5GSUB 1EQZD 3LJAD 5B24C 4DQYB 1P3LD 5F99D 3AV2D 3AZFB 2AROA 3B0DB 4ZUXB 2Y2LA 2FJ7C 4J8VA 4KGCB 1M18B 5BT1D 3AZNB 3C1BC 1TAFA 1P34D 4E45A 1U35A 1P3IA 1KX4D 3WA9A 3AYWA 5AV9A 4JJND 4H9NA 4J8WB 3MGQC 1AOIB 5DNMB 1TZYD 4H9PB 3KXBB 5B40D 5CPIA 3MGPA 2HIOD 4KUDA 2Y2MA 3H0LC 1P3LB 2Y2JA 5B31C 5AV6A 1P3BD 4J8UB 4WV4B 3X1TD 3UTAC 2JSSA 2W8SA 3X1VC 3UTBD 5B24A 1P34B 3W99D 2BYKB 2DQNC 3REIC 4YS3D 4JJNB 4AWLB 2FJ7A 2NZDC 3AV1C 4DRAA 1P3AD 1TZYB 3LELD 3REJC 5JRGD 3A1KA 5B40B 2XD5A 1BH8B 5CP6A 3AZGC 1KX5D 4E44A 4LD9A 1P3OD 2BYMB 2G5HC 3MGQA 1P3PD 1P3BB 2XD1A 3REKD 3VH5W 4YM6C 3W98B 3UTBB 4H9OB 3W99B 4QLCB 5CPKD 2JE5A 3KSYA 3UTAA 2Y2OA 1HQ3D 4YS3B 3AZED 3X1VA 2YFVB 1F66C 3O62C 4M6BA 5B1LD 1PZRA 5JRGB 1R4VA 3AZLC 5B32G 3R45A 3VH6A 5BS7C 5AV5C 3REIA 2NZDA 3AFAC 3MGRD 3AV1A 1H3OB 5BNVB 3REJA 3REKB 3AZIC 3AZGA 4EO5C 2UWXA 3KUYC 3MVDD 5AV8D 3NQUB 1S32C 3NQJA 1P3KD 2YFWB 3RELC 3LZ0C 2PYOD 1HQ3B 4YM6A 5B1LB 1P3MC 4Z5TC 5GT0C 2NQBC 3UT9C 5B0ZB 1F66A 3O62A 3LJAC 3C1CC 3B6FD 5F99C 3AZLA 3AV2C 3C1BB 3WKJD 5AV5A 2ZY2A 5BS7A 1Q9CA 3KFUG 4XZQD 5CPJD 3MVDB 3AFAA 5AV8B 1P3GD 2F8NA 3LZ1C 5BT1C 1P3KB 3AZIA 5AVBB 4R8PD 3WTPD 5B0YD 2Y2NA 1KX4C 2AROC 3B0CT 1P3FC 1S32A 4CSRA 4H9QB 5KDMA 2Y2QA 3WAAB 2HUEC 5G49B 5B31B 2HIOC 5C3IB 3LZ0A 4J8VC 3RELA 2DF4C 5BO0B 3AZFD 3AN2D 4H9RA 2ZY5A 1U35C 3B6GB 5B1MD 4Z5TA 3X1UC 4ZUXD 3WA9C 5GT0A 2NQBA 3WKJB 4WU8A 3UT9A 1M19C 5B33B 1M18D 4XZQB 1P3GB 5FUGB 5CPIC 3LJAA 1EQZA 5GXQB 5DNNB 5B2JC 3C1CA 2IO5C 4KUDC 5AVCC 5B2IC 2Y2PA 5F99A 3AV2A 4WU9B 4R8PB 3WTPB 3EPKA 4J8WD 1AOID 5DNMD 5JA4A 5AV6C 4Z2MG 3X1SB 3EPJA 3MGSC 3LZ1A 1P3AC 4HGAC 2L5AA 1KX5C 3AN2B 1KX4A 3W97D 4J8XC 1P3OC 5B1MB 4J8UD 1P3FA 4G92C 2F8NK 3W96C 3AZHB 1B6WA 5B32C 3KWQD 2HIOA 4X23C 1M1AD 3TU4D 4XUJC 4ZBJB 5CP6C 3X1UA 3V9RB 3IP4C 4LD9C 4Z66B 3REHD 5CPKC 3X1TA 1M19A 1ZLAC 3AZEC 1JFIA 5B2JA 4CAYA 5AVCA 3MNNC 5B2IA 2FFFB 3B0BA 3W97B 3A6NC 3AZJB 3MGSA 3KUYB 1P3AA 3W98D 3LELA 2CV5C 3KWQB 1M1AB 4G91B 3TU4B 1KX5A 4QLCD 4J8XA 1P3OA 1P3PA 5GT3C 3W96A 1P3MB 3REHB 2RVQD 3VH5T 5B32A 4X23A 1KX3B 4KHAA 4WNNA 5CHLB 4XUJA 3AZMB 1BH9B 3EG5B 5CPKA 1ZLAA 5AY8B 5AV9D 2BG1A 5E5AB 3AZEA 1ID3B 4DRBA 3MNNA 3AZKC 5BNXA 3A6NA 5CPJC 3MGRA 2AROB 2CV5A 5B0YC 4J8VB 1TAFB 5GT3A 1U35B 4UUZA 5B0ZD 1P3IB 5GSUC 2PYOA 3WA9B 3AYWB 5AV9B 4H9NB 2FJ7D 3AZFC 3C1BD 3B0DC 5CPIB 4KUDB 3MGPB 2IO5B 2Y2HA 4KGCC 1M18C 2G5IC 3AZNC 5AV6B 5AVBD 3B6FA 3P5JB 3AZKA 4J8WC 1AOIC 5B24B 3WAAD 5CPJA 3KXBC 5B31D 4WU8C 1EQZC 1P3LC 5B0YA 3X1VD 2FJ7B 3B6GD 4J8UC 1N1JA 5B33D 5CP6B 5GSUA 4NE3A 3REID 5GXQD 5DNND 4LD9B 3MGQB 2NZDD 3AV1D 4WU9D 1P34C 3AZFA 4ZUXA 4WZSB 3AZGD 4JJNC 3X1SD 4AWLC 4KGCA 1M18A 3AZNA 1TZYC 2F8NH 3H0RC 5B40C 1BFMA 3UTAB 4J8WA 3X1VB 1AOIA 5DNMA 3AZHD 4H9PA 3KXBA 1P3BC 2LY8A 3X1TC 3W98C 3R45B 4UPKA 3REIB 3UTBC 1P3LA 3VH6W 1F66D 2NZDB 3AV1B 3EPLA 3W99C 4QLCC 4Z66D 3REJB 4J8UA 3AZLD 2RIQA 4H9SC 4YS3C 3AZGB 2RVQC 5AV5D 2F2AC 3LELC 2ZM5A 5JRGC 1P34A 2F8ND 2BYKA 3NQJB 4NFTA 3AZID 4YM6B 4JJNA 3AZJD 1P3PC 3KUYD 1TZYA 5B40A 1S32D 1ULYA 3REKC 1BH8A 2BYMA 2CWEA 1F66B 3O62B 1P3MD 1P3BA 4Z5TD 1KX3D 1KU5A 3AZLB 1HQ3C 5GT0D 2ZY3A
chains in the Genus database with same CATH topology
3UTBA 5AV5B 3UT9D 4H9OA 3AZMD 5B1LC 3AFAB 2F8NB 3W99A 3C1CD 4QLCA 3AZIB 5AY8D 2Y2GA 4H9SA 5B0ZC 5E5AD 4EO5B 4YS3A 1ID3D 2YFVA 3MGRC 3W98A 5JRGA 3WTPE 1S32B 4CSRB 5KDMB 3LZ1D 3RELB 3LZ0B 3MVDC 5AV8C 1H3OA 2AROD 4H9RB 5BNVA 4Z5TB 1P3FD 1P3KC 3REKA 2PYOC 5AVBC 1W2EA 1A7WA 5GT0B 2NQBB 4WU8B 4J8VD 3UT9B 1EQZB 3LJAB 1U35D 3NQUA 3C1CB 1P3ID 3X1UD 3WAAC 5F99B 2YFWA 3AV2B 3WA9D 5C3IC 1HQ3A 3AYWD 5JA4B 1M19D 5B1LA 5CPID 3B6GC 3B6FC 3MGPD 4KUDD 5B2JD 3LZ1B 5AVCD 5B2ID 1WWIA 3WKJC 5B0ZA 2JCHA 4NE6A 5B33C 4XZQC 1P3GC 5AV6D 1KX4B 5GXQC 5DNNC 1P3FB 4WU9C 3MGSD 4R8PC 3WTPC 1HTAA 2HUEB 3C1BA 5B24D 2HIOB 3MVDA 1F1EA 5AV8A 3X1SC 4J8XD 3X1UB 1P3KA 5AVBA 3W96D 5B32D 4X23D 3X1TB 1M19B 3AN2C 4XUJD 5B1MC 1JFIB 4H9QA 5B2JB 4CAYB 4ZUXC 5AVCB 5CP6D 5B2IB 3AZHC 3WAAA 5B31A 5G49A 4LD9D 3MGQD 5BO0A 1ZLAD 2VQRA 2ZY4A 3B6GA 4ZBJC 3MGSB 1P3AB 4HGAB 4Z66C 3MNND 3LELB 3WKJA 5DNMC 1T3UA 5B33A 3F6TA 4XZQA 1P3GA 5FUGA 1KX5B 5DNNA 5GXQA 3A6ND 4J8XB 1P3OB 4WU9A 4G92B 3UTAD 1P3PB 3W96B 4WJ3C 4R8PA 3WTPA 2CV5D 5B32B 4X23B 3W97C 4KHAB 4WNNB 3X1SA 4XUJB 3AZJC 5GT3D 3KWQC 5CPKB 1M1AC 4G91C 3TU4C 1ZLAB 3AN2A 3REJD 5B31G 3AZEB 5B1MA 3MNNB 3AZHA 3EPHA 3REHC 1KX3C 5BNXB 3VH6T 3A6NB 3AZMC 3V9RA 3MGRB 4Z2MH 4Z66A 4YM6D 2CV5B 5AY8C 3AZKD 4NE5A 5E5AC 1ID3C 2J8PA 5GT3B 4UUZB 3O62D 2PYOB 3FDDA 3W97A 3AZJA 2Y2IA 3KUYA 3KWQA 1M1AA 5GSUD 3AFAD 3TU4A 1B67A 3H0MC 1P3IC 3REHA 1P3MA 1KX3A 3B6FB 3AZKB 3AYWC 5AV9C 4KGCD 3AZMA 3B0CW 1BH9A 3AZND 5CPJB 3RELD 3LZ0D 3MGPC 2Y2KA 3AL0C 5AY8A 2F8NG 5E5AA 5B0YB 3A1IA 1ID3A 1Z2CB 3VH5A 1WWSA 3KXBD 2NQBD 4WU8D 1N1JB 5GSUB 1EQZD 3LJAD 5B24C 4DQYB 1P3LD 5F99D 3AV2D 3AZFB 2AROA 3B0DB 4ZUXB 2Y2LA 2FJ7C 4J8VA 4KGCB 1M18B 5BT1D 3AZNB 3C1BC 1TAFA 1P34D 4E45A 1U35A 1P3IA 1KX4D 3WA9A 3AYWA 5AV9A 4JJND 4H9NA 4J8WB 3MGQC 1AOIB 5DNMB 1TZYD 4H9PB 3KXBB 5B40D 5CPIA 3MGPA 2HIOD 4KUDA 2Y2MA 3H0LC 1P3LB 2Y2JA 5B31C 5AV6A 1P3BD 4J8UB 4WV4B 3X1TD 3UTAC 2JSSA 2W8SA 3X1VC 3UTBD 5B24A 1P34B 3W99D 2BYKB 2DQNC 3REIC 4YS3D 4JJNB 4AWLB 2FJ7A 2NZDC 3AV1C 4DRAA 1P3AD 1TZYB 3LELD 3REJC 5JRGD 3A1KA 5B40B 2XD5A 1BH8B 5CP6A 3AZGC 1KX5D 4E44A 4LD9A 1P3OD 2BYMB 2G5HC 3MGQA 1P3PD 1P3BB 2XD1A 3REKD 3VH5W 4YM6C 3W98B 3UTBB 4H9OB 3W99B 4QLCB 5CPKD 2JE5A 3KSYA 3UTAA 2Y2OA 1HQ3D 4YS3B 3AZED 3X1VA 2YFVB 1F66C 3O62C 4M6BA 5B1LD 1PZRA 5JRGB 1R4VA 3AZLC 5B32G 3R45A 3VH6A 5BS7C 5AV5C 3REIA 2NZDA 3AFAC 3MGRD 3AV1A 1H3OB 5BNVB 3REJA 3REKB 3AZIC 3AZGA 4EO5C 2UWXA 3KUYC 3MVDD 5AV8D 3NQUB 1S32C 3NQJA 1P3KD 2YFWB 3RELC 3LZ0C 2PYOD 1HQ3B 4YM6A 5B1LB 1P3MC 4Z5TC 5GT0C 2NQBC 3UT9C 5B0ZB 1F66A 3O62A 3LJAC 3C1CC 3B6FD 5F99C 3AZLA 3AV2C 3C1BB 3WKJD 5AV5A 2ZY2A 5BS7A 1Q9CA 3KFUG 4XZQD 5CPJD 3MVDB 3AFAA 5AV8B 1P3GD 2F8NA 3LZ1C 5BT1C 1P3KB 3AZIA 5AVBB 4R8PD 3WTPD 5B0YD 2Y2NA 1KX4C 2AROC 3B0CT 1P3FC 1S32A 4CSRA 4H9QB 5KDMA 2Y2QA 3WAAB 2HUEC 5G49B 5B31B 2HIOC 5C3IB 3LZ0A 4J8VC 3RELA 2DF4C 5BO0B 3AZFD 3AN2D 4H9RA 2ZY5A 1U35C 3B6GB 5B1MD 4Z5TA 3X1UC 4ZUXD 3WA9C 5GT0A 2NQBA 3WKJB 4WU8A 3UT9A 1M19C 5B33B 1M18D 4XZQB 1P3GB 5FUGB 5CPIC 3LJAA 1EQZA 5GXQB 5DNNB 5B2JC 3C1CA 2IO5C 4KUDC 5AVCC 5B2IC 2Y2PA 5F99A 3AV2A 4WU9B 4R8PB 3WTPB 3EPKA 4J8WD 1AOID 5DNMD 5JA4A 5AV6C 4Z2MG 3X1SB 3EPJA 3MGSC 3LZ1A 1P3AC 4HGAC 2L5AA 1KX5C 3AN2B 1KX4A 3W97D 4J8XC 1P3OC 5B1MB 4J8UD 1P3FA 4G92C 2F8NK 3W96C 3AZHB 1B6WA 5B32C 3KWQD 2HIOA 4X23C 1M1AD 3TU4D 4XUJC 4ZBJB 5CP6C 3X1UA 3V9RB 3IP4C 4LD9C 4Z66B 3REHD 5CPKC 3X1TA 1M19A 1ZLAC 3AZEC 1JFIA 5B2JA 4CAYA 5AVCA 3MNNC 5B2IA 2FFFB 3B0BA 3W97B 3A6NC 3AZJB 3MGSA 3KUYB 1P3AA 3W98D 3LELA 2CV5C 3KWQB 1M1AB 4G91B 3TU4B 1KX5A 4QLCD 4J8XA 1P3OA 1P3PA 5GT3C 3W96A 1P3MB 3REHB 2RVQD 3VH5T 5B32A 4X23A 1KX3B 4KHAA 4WNNA 5CHLB 4XUJA 3AZMB 1BH9B 3EG5B 5CPKA 1ZLAA 5AY8B 5AV9D 2BG1A 5E5AB 3AZEA 1ID3B 4DRBA 3MNNA 3AZKC 5BNXA 3A6NA 5CPJC 3MGRA 2AROB 2CV5A 5B0YC 4J8VB 1TAFB 5GT3A 1U35B 4UUZA 5B0ZD 1P3IB 5GSUC 2PYOA 3WA9B 3AYWB 5AV9B 4H9NB 2FJ7D 3AZFC 3C1BD 3B0DC 5CPIB 4KUDB 3MGPB 2IO5B 2Y2HA 4KGCC 1M18C 2G5IC 3AZNC 5AV6B 5AVBD 3B6FA 3P5JB 3AZKA 4J8WC 1AOIC 5B24B 3WAAD 5CPJA 3KXBC 5B31D 4WU8C 1EQZC 1P3LC 5B0YA 3X1VD 2FJ7B 3B6GD 4J8UC 1N1JA 5B33D 5CP6B 5GSUA 4NE3A 3REID 5GXQD 5DNND 4LD9B 3MGQB 2NZDD 3AV1D 4WU9D 1P34C 3AZFA 4ZUXA 4WZSB 3AZGD 4JJNC 3X1SD 4AWLC 4KGCA 1M18A 3AZNA 1TZYC 2F8NH 3H0RC 5B40C 1BFMA 3UTAB 4J8WA 3X1VB 1AOIA 5DNMA 3AZHD 4H9PA 3KXBA 1P3BC 2LY8A 3X1TC 3W98C 3R45B 4UPKA 3REIB 3UTBC 1P3LA 3VH6W 1F66D 2NZDB 3AV1B 3EPLA 3W99C 4QLCC 4Z66D 3REJB 4J8UA 3AZLD 2RIQA 4H9SC 4YS3C 3AZGB 2RVQC 5AV5D 2F2AC 3LELC 2ZM5A 5JRGC 1P34A 2F8ND 2BYKA 3NQJB 4NFTA 3AZID 4YM6B 4JJNA 3AZJD 1P3PC 3KUYD 1TZYA 5B40A 1S32D 1ULYA 3REKC 1BH8A 2BYMA 2CWEA 1F66B 3O62B 1P3MD 1P3BA 4Z5TD 1KX3D 1KU5A 3AZLB 1HQ3C 5GT0D 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  5AV5 B;  3UT9 D;  4H9O A;  3AZM D;  5B1L C;  3AFA B;  2F8N B;  3W99 A;  3C1C D;  4QLC A;  3AZI B;  5AY8 D;  4H9S A;  5B0Z C;  5E5A D;  4EO5 B;  4YS3 A;  1ID3 D;  2YFV A;  3MGR C;  3W98 A;  5JRG A;  3WTP E;  1S32 B;  4CSR B;  5KDM B;  3LZ1 D;  3REL B;  3LZ0 B;  3MVD C;  5AV8 C;  1H3O A;  2ARO D;  4H9R B;  5BNV A;  4Z5T B;  1P3F D;  1P3K C;  3REK A;  2PYO C;  5AVB C;  5GT0 B;  1A7W A;  2NQB B;  4WU8 B;  4J8V D;  3UT9 B;  1EQZ B;  3LJA B;  1U35 D;  3NQU A;  3C1C B;  1P3I D;  3X1U D;  3WAA C;  5F99 B;  2YFW A;  3AV2 B;  3WA9 D;  5C3I C;  1HQ3 A;  3AYW D;  5JA4 B;  1M19 D;  5B1L A;  5CPI D;  3B6G C;  3B6F C;  3MGP D;  4KUD D;  5B2J D;  3LZ1 B;  5AVC D;  5B2I D;  1WWI A;  3WKJ C;  5B0Z A;  5B33 C;  4NE6 A;  4XZQ C;  1P3G C;  5AV6 D;  1KX4 B;  5GXQ C;  5DNN C;  1P3F B;  4WU9 C;  3MGS D;  4R8P C;  3WTP C;  1HTA A;  2HUE B;  3C1B A;  5B24 D;  2HIO B;  3MVD A;  1F1E A;  5AV8 A;  3X1S C;  4J8X D;  3X1U B;  1P3K A;  5AVB A;  3W96 D;  5B32 D;  4X23 D;  3X1T B;  1M19 B;  3AN2 C;  4XUJ D;  5B1M C;  1JFI B;  4H9Q A;  5B2J B;  4CAY B;  4ZUX C;  5AVC B;  5CP6 D;  5B2I B;  3AZH C;  3WAA A;  5B31 A;  5G49 A;  4LD9 D;  3MGQ D;  5BO0 A;  1ZLA D;  3B6G A;  4ZBJ C;  3MGS B;  1P3A B;  4HGA B;  4Z66 C;  3MNN D;  3LEL B;  3WKJ A;  5DNM C;  5B33 A;  4XZQ A;  1P3G A;  5FUG A;  1KX5 B;  5DNN A;  5GXQ A;  3A6N D;  4J8X B;  1P3O B;  4WU9 A;  4G92 B;  3UTA D;  1P3P B;  3W96 B;  4R8P A;  3WTP A;  2CV5 D;  5B32 B;  4X23 B;  3W97 C;  4KHA B;  4WNN B;  3X1S A;  4XUJ B;  3AZJ C;  5GT3 D;  3KWQ C;  5CPK B;  1M1A C;  4G91 C;  3TU4 C;  1ZLA B;  3AN2 A;  3REJ D;  5B31 G;  3AZE B;  5B1M A;  3MNN B;  3AZH A;  3REH C;  1KX3 C;  5BNX B;  3VH6 T;  3A6N B;  3AZM C;  3V9R A;  3MGR B;  4Z2M H;  4Z66 A;  4YM6 D;  2CV5 B;  5AY8 C;  3AZK D;  4NE5 A;  5E5A C;  1ID3 C;  5GT3 B;  4UUZ B;  3O62 D;  2PYO B;  3W97 A;  3AZJ A;  3KUY A;  3KWQ A;  1M1A A;  5GSU D;  3AFA D;  3TU4 A;  1B67 A;  1P3I C;  3REH A;  1P3M A;  1KX3 A;  3B6F B;  3AZK B;  3AYW C;  5AV9 C;  4KGC D;  3AZM A;  3B0C W;  1BH9 A;  3AZN D;  5CPJ B;  3REL D;  3LZ0 D;  3MGP C;  5AY8 A;  2F8N G;  5E5A A;  5B0Y B;  1ID3 A;  3VH5 A;  1WWS A;  3KXB D;  2NQB D;  4WU8 D;  1N1J B;  5GSU B;  1EQZ D;  3LJA D;  5B24 C;  1P3L D;  5F99 D;  3AV2 D;  3AZF B;  2ARO A;  3B0D B;  4ZUX B;  2FJ7 C;  4J8V A;  4KGC B;  1M18 B;  5BT1 D;  3AZN B;  3C1B C;  1TAF A;  1P34 D;  4E45 A;  1U35 A;  1P3I A;  1KX4 D;  3WA9 A;  3AYW A;  5AV9 A;  4JJN D;  4H9N A;  4J8W B;  3MGQ C;  1AOI B;  5DNM B;  1TZY D;  4H9P B;  3KXB B;  5B40 D;  5CPI A;  3MGP A;  2HIO D;  4KUD A;  1P3L B;  5B31 C;  5AV6 A;  1P3B D;  4J8U B;  4WV4 B;  3X1T D;  3UTA C;  2JSS A;  3X1V C;  3UTB D;  5B24 A;  1P34 B;  3W99 D;  2BYK B;  3REI C;  4YS3 D;  4JJN B;  4AWL B;  2FJ7 A;  2NZD C;  3AV1 C;  4DRA A;  1P3A D;  1TZY B;  3LEL D;  3REJ C;  5JRG D;  5B40 B;  1BH8 B;  5CP6 A;  3AZG C;  1KX5 D;  4E44 A;  4LD9 A;  1P3O D;  2BYM B;  3MGQ A;  1P3P D;  1P3B B;  3REK D;  3VH5 W;  4YM6 C;  3W98 B;  3UTB B;  4H9O B;  3W99 B;  4QLC B;  5CPK D;  3KSY A;  3UTA A;  1HQ3 D;  4YS3 B;  3AZE D;  3X1V A;  2YFV B;  1F66 C;  3O62 C;  4M6B A;  5B1L D;  5JRG B;  1R4V A;  3AZL C;  5B32 G;  3R45 A;  3VH6 A;  5BS7 C;  5AV5 C;  3REI A;  2NZD A;  3AFA C;  3MGR D;  3AV1 A;  1H3O B;  5BNV B;  3REJ A;  3REK B;  3AZI C;  3AZG A;  4EO5 C;  3KUY C;  3MVD D;  5AV8 D;  3NQU B;  1S32 C;  3NQJ A;  1P3K D;  2YFW B;  3REL C;  3LZ0 C;  2PYO D;  1HQ3 B;  4YM6 A;  5B1L B;  1P3M C;  4Z5T C;  5GT0 C;  2NQB C;  3UT9 C;  5B0Z B;  1F66 A;  3O62 A;  3LJA C;  3C1C C;  3B6F D;  5F99 C;  3AZL A;  3AV2 C;  3C1B B;  3WKJ D;  5AV5 A;  5BS7 A;  1Q9C A;  4XZQ D;  5CPJ D;  3MVD B;  3AFA A;  5AV8 B;  1P3G D;  2F8N A;  3LZ1 C;  5BT1 C;  1P3K B;  3AZI A;  5AVB B;  4R8P D;  3WTP D;  5B0Y D;  1KX4 C;  2ARO C;  3B0C T;  1P3F C;  1S32 A;  4CSR A;  4H9Q B;  5KDM A;  3WAA B;  2HUE C;  5G49 B;  5B31 B;  2HIO C;  5C3I B;  3LZ0 A;  4J8V C;  3REL A;  5BO0 B;  3AZF D;  3AN2 D;  4H9R A;  1U35 C;  3B6G B;  5B1M D;  4Z5T A;  3X1U C;  4ZUX D;  3WA9 C;  5GT0 A;  2NQB A;  3WKJ B;  4WU8 A;  3UT9 A;  1M19 C;  5B33 B;  1M18 D;  4XZQ B;  1P3G B;  5FUG B;  5CPI C;  3LJA A;  1EQZ A;  5GXQ B;  5DNN B;  5B2J C;  3C1C A;  2IO5 C;  4KUD C;  5AVC C;  5B2I C;  5F99 A;  3AV2 A;  4WU9 B;  4R8P B;  3WTP B;  4J8W D;  1AOI D;  5DNM D;  5JA4 A;  5AV6 C;  4Z2M G;  3X1S B;  3MGS C;  3LZ1 A;  1P3A C;  4HGA C;  2L5A A;  1KX5 C;  3AN2 B;  1KX4 A;  3W97 D;  4J8X C;  1P3O C;  5B1M B;  4J8U D;  1P3F A;  4G92 C;  2F8N K;  3W96 C;  3AZH B;  1B6W A;  5B32 C;  3KWQ D;  2HIO A;  4X23 C;  1M1A D;  3TU4 D;  4XUJ C;  4ZBJ B;  5CP6 C;  3X1U A;  3V9R B;  4LD9 C;  4Z66 B;  3REH D;  5CPK C;  3X1T A;  1M19 A;  1ZLA C;  3AZE C;  1JFI A;  5B2J A;  4CAY A;  5AVC A;  3MNN C;  5B2I A;  3B0B A;  3W97 B;  3A6N C;  3AZJ B;  3MGS A;  3KUY B;  1P3A A;  3W98 D;  3LEL A;  2CV5 C;  3KWQ B;  1M1A B;  4G91 B;  3TU4 B;  1KX5 A;  4QLC D;  4J8X A;  1P3O A;  1P3P A;  5GT3 C;  3W96 A;  1P3M B;  3REH B;  2RVQ D;  3VH5 T;  5B32 A;  4X23 A;  1KX3 B;  4KHA A;  4WNN A;  5CHL B;  4XUJ A;  3AZM B;  1BH9 B;  5CPK A;  1ZLA A;  5AY8 B;  5AV9 D;  5E5A B;  1ID3 B;  3AZE A;  4DRB A;  3MNN A;  3AZK C;  5BNX A;  3A6N A;  5CPJ C;  3MGR A;  2ARO B;  2CV5 A;  5B0Y C;  4J8V B;  1TAF B;  5GT3 A;  1U35 B;  4UUZ A;  5B0Z D;  1P3I B;  5GSU C;  2PYO A;  3WA9 B;  3AYW B;  5AV9 B;  4H9N B;  2FJ7 D;  3AZF C;  3C1B D;  3B0D C;  5CPI B;  4KUD B;  3MGP B;  2IO5 B;  4KGC C;  1M18 C;  3AZN C;  5AV6 B;  5AVB D;  3B6F A;  3AZK A;  4J8W C;  1AOI C;  5B24 B;  3WAA D;  5CPJ A;  3KXB C;  5B31 D;  4WU8 C;  1EQZ C;  1P3L C;  5B0Y A;  3X1V D;  2FJ7 B;  3B6G D;  4J8U C;  1N1J A;  5B33 D;  5CP6 B;  5GSU A;  4NE3 A;  3REI D;  5GXQ D;  5DNN D;  4LD9 B;  3MGQ B;  2NZD D;  3AV1 D;  4WU9 D;  1P34 C;  3AZF A;  4ZUX A;  4WZS B;  3AZG D;  4JJN C;  3X1S D;  4AWL C;  4KGC A;  1M18 A;  3AZN A;  1TZY C;  2F8N H;  5B40 C;  1BFM A;  3UTA B;  4J8W A;  3X1V B;  1AOI A;  5DNM A;  3AZH D;  4H9P A;  3KXB A;  1P3B C;  2LY8 A;  3X1T C;  3W98 C;  3R45 B;  3REI B;  3UTB C;  1P3L A;  3VH6 W;  1F66 D;  2NZD B;  3AV1 B;  3W99 C;  4QLC C;  4Z66 D;  3REJ B;  4J8U A;  3AZL D;  4H9S C;  4YS3 C;  3AZG B;  2RVQ C;  5AV5 D;  3LEL C;  1P34 A;  5JRG C;  2F8N D;  2BYK A;  3NQJ B;  4NFT A;  3AZI D;  4YM6 B;  4JJN A;  3AZJ D;  1P3P C;  3KUY D;  1TZY A;  5B40 A;  1S32 D;  1ULY A;  3REK C;  1BH8 A;  2BYM A;  2CWE A;  1F66 B;  3O62 B;  1P3M D;  1P3B A;  4Z5T D;  1KX3 D;  1KU5 A;  3AZL B;  1HQ3 C;  5GT0 D; 
#chains in the Genus database with same CATH topology
 3UTB A;  5AV5 B;  3UT9 D;  4H9O A;  3AZM D;  5B1L C;  3AFA B;  2F8N B;  3W99 A;  3C1C D;  4QLC A;  3AZI B;  5AY8 D;  2Y2G A;  4H9S A;  5B0Z C;  5E5A D;  4EO5 B;  4YS3 A;  1ID3 D;  2YFV A;  3MGR C;  3W98 A;  5JRG A;  3WTP E;  1S32 B;  4CSR B;  5KDM B;  3LZ1 D;  3REL B;  3LZ0 B;  3MVD C;  5AV8 C;  1H3O A;  2ARO D;  4H9R B;  5BNV A;  4Z5T B;  1P3F D;  1P3K C;  3REK A;  2PYO C;  5AVB C;  1W2E A;  1A7W A;  5GT0 B;  2NQB B;  4WU8 B;  4J8V D;  3UT9 B;  1EQZ B;  3LJA B;  1U35 D;  3NQU A;  3C1C B;  1P3I D;  3X1U D;  3WAA C;  5F99 B;  2YFW A;  3AV2 B;  3WA9 D;  5C3I C;  1HQ3 A;  3AYW D;  5JA4 B;  1M19 D;  5B1L A;  5CPI D;  3B6G C;  3B6F C;  3MGP D;  4KUD D;  5B2J D;  3LZ1 B;  5AVC D;  5B2I D;  1WWI A;  3WKJ C;  5B0Z A;  2JCH A;  4NE6 A;  5B33 C;  4XZQ C;  1P3G C;  5AV6 D;  1KX4 B;  5GXQ C;  5DNN C;  1P3F B;  4WU9 C;  3MGS D;  4R8P C;  3WTP C;  1HTA A;  2HUE B;  3C1B A;  5B24 D;  2HIO B;  3MVD A;  1F1E A;  5AV8 A;  3X1S C;  4J8X D;  3X1U B;  1P3K A;  5AVB A;  3W96 D;  5B32 D;  4X23 D;  3X1T B;  1M19 B;  3AN2 C;  4XUJ D;  5B1M C;  1JFI B;  4H9Q A;  5B2J B;  4CAY B;  4ZUX C;  5AVC B;  5CP6 D;  5B2I B;  3AZH C;  3WAA A;  5B31 A;  5G49 A;  4LD9 D;  3MGQ D;  5BO0 A;  1ZLA D;  2VQR A;  2ZY4 A;  3B6G A;  4ZBJ C;  3MGS B;  1P3A B;  4HGA B;  4Z66 C;  3MNN D;  3LEL B;  3WKJ A;  5DNM C;  1T3U A;  5B33 A;  3F6T A;  4XZQ A;  1P3G A;  5FUG A;  1KX5 B;  5DNN A;  5GXQ A;  3A6N D;  4J8X B;  1P3O B;  4WU9 A;  4G92 B;  3UTA D;  1P3P B;  3W96 B;  4WJ3 C;  4R8P A;  3WTP A;  2CV5 D;  5B32 B;  4X23 B;  3W97 C;  4KHA B;  4WNN B;  3X1S A;  4XUJ B;  3AZJ C;  5GT3 D;  3KWQ C;  5CPK B;  1M1A C;  4G91 C;  3TU4 C;  1ZLA B;  3AN2 A;  3REJ D;  5B31 G;  3AZE B;  5B1M A;  3MNN B;  3AZH A;  3EPH A;  3REH C;  1KX3 C;  5BNX B;  3VH6 T;  3A6N B;  3AZM C;  3V9R A;  3MGR B;  4Z2M H;  4Z66 A;  4YM6 D;  2CV5 B;  5AY8 C;  3AZK D;  4NE5 A;  5E5A C;  1ID3 C;  2J8P A;  5GT3 B;  4UUZ B;  3O62 D;  2PYO B;  3FDD A;  3W97 A;  3AZJ A;  2Y2I A;  3KUY A;  3KWQ A;  1M1A A;  5GSU D;  3AFA D;  3TU4 A;  1B67 A;  3H0M C;  1P3I C;  3REH A;  1P3M A;  1KX3 A;  3B6F B;  3AZK B;  3AYW C;  5AV9 C;  4KGC D;  3AZM A;  3B0C W;  1BH9 A;  3AZN D;  5CPJ B;  3REL D;  3LZ0 D;  3MGP C;  2Y2K A;  3AL0 C;  5AY8 A;  2F8N G;  5E5A A;  5B0Y B;  3A1I A;  1ID3 A;  1Z2C B;  3VH5 A;  1WWS A;  3KXB D;  2NQB D;  4WU8 D;  1N1J B;  5GSU B;  1EQZ D;  3LJA D;  5B24 C;  4DQY B;  1P3L D;  5F99 D;  3AV2 D;  3AZF B;  2ARO A;  3B0D B;  4ZUX B;  2Y2L A;  2FJ7 C;  4J8V A;  4KGC B;  1M18 B;  5BT1 D;  3AZN B;  3C1B C;  1TAF A;  1P34 D;  4E45 A;  1U35 A;  1P3I A;  1KX4 D;  3WA9 A;  3AYW A;  5AV9 A;  4JJN D;  4H9N A;  4J8W B;  3MGQ C;  1AOI B;  5DNM B;  1TZY D;  4H9P B;  3KXB B;  5B40 D;  5CPI A;  3MGP A;  2HIO D;  4KUD A;  2Y2M A;  3H0L C;  1P3L B;  2Y2J A;  5B31 C;  5AV6 A;  1P3B D;  4J8U B;  4WV4 B;  3X1T D;  3UTA C;  2JSS A;  2W8S A;  3X1V C;  3UTB D;  5B24 A;  1P34 B;  3W99 D;  2BYK B;  2DQN C;  3REI C;  4YS3 D;  4JJN B;  4AWL B;  2FJ7 A;  2NZD C;  3AV1 C;  4DRA A;  1P3A D;  1TZY B;  3LEL D;  3REJ C;  5JRG D;  3A1K A;  5B40 B;  2XD5 A;  1BH8 B;  5CP6 A;  3AZG C;  1KX5 D;  4E44 A;  4LD9 A;  1P3O D;  2BYM B;  2G5H C;  3MGQ A;  1P3P D;  1P3B B;  2XD1 A;  3REK D;  3VH5 W;  4YM6 C;  3W98 B;  3UTB B;  4H9O B;  3W99 B;  4QLC B;  5CPK D;  2JE5 A;  3KSY A;  3UTA A;  2Y2O A;  1HQ3 D;  4YS3 B;  3AZE D;  3X1V A;  2YFV B;  1F66 C;  3O62 C;  4M6B A;  5B1L D;  1PZR A;  5JRG B;  1R4V A;  3AZL C;  5B32 G;  3R45 A;  3VH6 A;  5BS7 C;  5AV5 C;  3REI A;  2NZD A;  3AFA C;  3MGR D;  3AV1 A;  1H3O B;  5BNV B;  3REJ A;  3REK B;  3AZI C;  3AZG A;  4EO5 C;  2UWX A;  3KUY C;  3MVD D;  5AV8 D;  3NQU B;  1S32 C;  3NQJ A;  1P3K D;  2YFW B;  3REL C;  3LZ0 C;  2PYO D;  1HQ3 B;  4YM6 A;  5B1L B;  1P3M C;  4Z5T C;  5GT0 C;  2NQB C;  3UT9 C;  5B0Z B;  1F66 A;  3O62 A;  3LJA C;  3C1C C;  3B6F D;  5F99 C;  3AZL A;  3AV2 C;  3C1B B;  3WKJ D;  5AV5 A;  2ZY2 A;  5BS7 A;  1Q9C A;  3KFU G;  4XZQ D;  5CPJ D;  3MVD B;  3AFA A;  5AV8 B;  1P3G D;  2F8N A;  3LZ1 C;  5BT1 C;  1P3K B;  3AZI A;  5AVB B;  4R8P D;  3WTP D;  5B0Y D;  2Y2N A;  1KX4 C;  2ARO C;  3B0C T;  1P3F C;  1S32 A;  4CSR A;  4H9Q B;  5KDM A;  2Y2Q A;  3WAA B;  2HUE C;  5G49 B;  5B31 B;  2HIO C;  5C3I B;  3LZ0 A;  4J8V C;  3REL A;  2DF4 C;  5BO0 B;  3AZF D;  3AN2 D;  4H9R A;  2ZY5 A;  1U35 C;  3B6G B;  5B1M D;  4Z5T A;  3X1U C;  4ZUX D;  3WA9 C;  5GT0 A;  2NQB A;  3WKJ B;  4WU8 A;  3UT9 A;  1M19 C;  5B33 B;  1M18 D;  4XZQ B;  1P3G B;  5FUG B;  5CPI C;  3LJA A;  1EQZ A;  5GXQ B;  5DNN B;  5B2J C;  3C1C A;  2IO5 C;  4KUD C;  5AVC C;  5B2I C;  2Y2P A;  5F99 A;  3AV2 A;  4WU9 B;  4R8P B;  3WTP B;  3EPK A;  4J8W D;  1AOI D;  5DNM D;  5JA4 A;  5AV6 C;  4Z2M G;  3X1S B;  3EPJ A;  3MGS C;  3LZ1 A;  1P3A C;  4HGA C;  2L5A A;  1KX5 C;  3AN2 B;  1KX4 A;  3W97 D;  4J8X C;  1P3O C;  5B1M B;  4J8U D;  1P3F A;  4G92 C;  2F8N K;  3W96 C;  3AZH B;  1B6W A;  5B32 C;  3KWQ D;  2HIO A;  4X23 C;  1M1A D;  3TU4 D;  4XUJ C;  4ZBJ B;  5CP6 C;  3X1U A;  3V9R B;  3IP4 C;  4LD9 C;  4Z66 B;  3REH D;  5CPK C;  3X1T A;  1M19 A;  1ZLA C;  3AZE C;  1JFI A;  5B2J A;  4CAY A;  5AVC A;  3MNN C;  5B2I A;  2FFF B;  3B0B A;  3W97 B;  3A6N C;  3AZJ B;  3MGS A;  3KUY B;  1P3A A;  3W98 D;  3LEL A;  2CV5 C;  3KWQ B;  1M1A B;  4G91 B;  3TU4 B;  1KX5 A;  4QLC D;  4J8X A;  1P3O A;  1P3P A;  5GT3 C;  3W96 A;  1P3M B;  3REH B;  2RVQ D;  3VH5 T;  5B32 A;  4X23 A;  1KX3 B;  4KHA A;  4WNN A;  5CHL B;  4XUJ A;  3AZM B;  1BH9 B;  3EG5 B;  5CPK A;  1ZLA A;  5AY8 B;  5AV9 D;  2BG1 A;  5E5A B;  3AZE A;  1ID3 B;  4DRB A;  3MNN A;  3AZK C;  5BNX A;  3A6N A;  5CPJ C;  3MGR A;  2ARO B;  2CV5 A;  5B0Y C;  4J8V B;  1TAF B;  5GT3 A;  1U35 B;  4UUZ A;  5B0Z D;  1P3I B;  5GSU C;  2PYO A;  3WA9 B;  3AYW B;  5AV9 B;  4H9N B;  2FJ7 D;  3AZF C;  3C1B D;  3B0D C;  5CPI B;  4KUD B;  3MGP B;  2IO5 B;  2Y2H A;  4KGC C;  1M18 C;  2G5I C;  3AZN C;  5AV6 B;  5AVB D;  3B6F A;  3P5J B;  3AZK A;  4J8W C;  1AOI C;  5B24 B;  3WAA D;  5CPJ A;  3KXB C;  5B31 D;  4WU8 C;  1EQZ C;  1P3L C;  5B0Y A;  3X1V D;  2FJ7 B;  3B6G D;  4J8U C;  1N1J A;  5B33 D;  5CP6 B;  5GSU A;  4NE3 A;  3REI D;  5GXQ D;  5DNN D;  4LD9 B;  3MGQ B;  2NZD D;  3AV1 D;  4WU9 D;  1P34 C;  3AZF A;  4ZUX A;  4WZS B;  3AZG D;  4JJN C;  3X1S D;  4AWL C;  4KGC A;  1M18 A;  3AZN A;  1TZY C;  2F8N H;  3H0R C;  5B40 C;  1BFM A;  3UTA B;  4J8W A;  3X1V B;  1AOI A;  5DNM A;  3AZH D;  4H9P A;  3KXB A;  1P3B C;  2LY8 A;  3X1T C;  3W98 C;  3R45 B;  4UPK A;  3REI B;  3UTB C;  1P3L A;  3VH6 W;  1F66 D;  2NZD B;  3AV1 B;  3EPL A;  3W99 C;  4QLC C;  4Z66 D;  3REJ B;  4J8U A;  3AZL D;  2RIQ A;  4H9S C;  4YS3 C;  3AZG B;  2RVQ C;  5AV5 D;  2F2A C;  3LEL C;  2ZM5 A;  5JRG C;  1P34 A;  2F8N D;  2BYK A;  3NQJ B;  4NFT A;  3AZI D;  4YM6 B;  4JJN A;  3AZJ D;  1P3P C;  3KUY D;  1TZY A;  5B40 A;  1S32 D;  1ULY A;  3REK C;  1BH8 A;  2BYM A;  2CWE A;  1F66 B;  3O62 B;  1P3M D;  1P3B A;  4Z5T D;  1KX3 D;  1KU5 A;  3AZL B;  1HQ3 C;  5GT0 D;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 3UTB A;  5AV5 B;  3UT9 D;  4H9O A;  3AZM D;  5B1L C;  3AFA B;  2F8N B;  3W99 A;  3C1C D;  4QLC A;  3AZI B;  5AY8 D;  2Y2G A;  4H9S A;  5B0Z C;  5E5A D;  4EO5 B;  4YS3 A;  1ID3 D;  2YFV A;  3MGR C;  3W98 A;  5JRG A;  3WTP E;  1S32 B;  4CSR B;  5KDM B;  3LZ1 D;  3REL B;  3LZ0 B;  3MVD C;  5AV8 C;  1H3O A;  2ARO D;  4H9R B;  5BNV A;  4Z5T B;  1P3F D;  1P3K C;  3REK A;  2PYO C;  5AVB C;  1W2E A;  1A7W A;  5GT0 B;  2NQB B;  4WU8 B;  4J8V D;  3UT9 B;  1EQZ B;  3LJA B;  1U35 D;  3NQU A;  3C1C B;  1P3I D;  3X1U D;  3WAA C;  5F99 B;  2YFW A;  3AV2 B;  3WA9 D;  5C3I C;  1HQ3 A;  3AYW D;  5JA4 B;  1M19 D;  5B1L A;  5CPI D;  3B6G C;  3B6F C;  3MGP D;  4KUD D;  5B2J D;  3LZ1 B;  5AVC D;  5B2I D;  1WWI A;  3WKJ C;  5B0Z A;  2JCH A;  4NE6 A;  5B33 C;  4XZQ C;  1P3G C;  5AV6 D;  1KX4 B;  5GXQ C;  5DNN C;  1P3F B;  4WU9 C;  3MGS D;  4R8P C;  3WTP C;  1HTA A;  2HUE B;  3C1B A;  5B24 D;  2HIO B;  3MVD A;  1F1E A;  5AV8 A;  3X1S C;  4J8X D;  3X1U B;  1P3K A;  5AVB A;  3W96 D;  5B32 D;  4X23 D;  3X1T B;  1M19 B;  3AN2 C;  4XUJ D;  5B1M C;  1JFI B;  4H9Q A;  5B2J B;  4CAY B;  4ZUX C;  5AVC B;  5CP6 D;  5B2I B;  3AZH C;  3WAA A;  5B31 A;  5G49 A;  4LD9 D;  3MGQ D;  5BO0 A;  1ZLA D;  2VQR A;  2ZY4 A;  3B6G A;  4ZBJ C;  3MGS B;  1P3A B;  4HGA B;  4Z66 C;  3MNN D;  3LEL B;  3WKJ A;  5DNM C;  1T3U A;  5B33 A;  3F6T A;  4XZQ A;  1P3G A;  5FUG A;  1KX5 B;  5DNN A;  5GXQ A;  3A6N D;  4J8X B;  1P3O B;  4WU9 A;  4G92 B;  3UTA D;  1P3P B;  3W96 B;  4WJ3 C;  4R8P A;  3WTP A;  2CV5 D;  5B32 B;  4X23 B;  3W97 C;  4KHA B;  4WNN B;  3X1S A;  4XUJ B;  3AZJ C;  5GT3 D;  3KWQ C;  5CPK B;  1M1A C;  4G91 C;  3TU4 C;  1ZLA B;  3AN2 A;  3REJ D;  5B31 G;  3AZE B;  5B1M A;  3MNN B;  3AZH A;  3EPH A;  3REH C;  1KX3 C;  5BNX B;  3VH6 T;  3A6N B;  3AZM C;  3V9R A;  3MGR B;  4Z2M H;  4Z66 A;  4YM6 D;  2CV5 B;  5AY8 C;  3AZK D;  4NE5 A;  5E5A C;  1ID3 C;  2J8P A;  5GT3 B;  4UUZ B;  3O62 D;  2PYO B;  3FDD A;  3W97 A;  3AZJ A;  2Y2I A;  3KUY A;  3KWQ A;  1M1A A;  5GSU D;  3AFA D;  3TU4 A;  1B67 A;  3H0M C;  1P3I C;  3REH A;  1P3M A;  1KX3 A;  3B6F B;  3AZK B;  3AYW C;  5AV9 C;  4KGC D;  3AZM A;  3B0C W;  1BH9 A;  3AZN D;  5CPJ B;  3REL D;  3LZ0 D;  3MGP C;  2Y2K A;  3AL0 C;  5AY8 A;  2F8N G;  5E5A A;  5B0Y B;  3A1I A;  1ID3 A;  1Z2C B;  3VH5 A;  1WWS A;  3KXB D;  2NQB D;  4WU8 D;  1N1J B;  5GSU B;  1EQZ D;  3LJA D;  5B24 C;  4DQY B;  1P3L D;  5F99 D;  3AV2 D;  3AZF B;  2ARO A;  3B0D B;  4ZUX B;  2Y2L A;  2FJ7 C;  4J8V A;  4KGC B;  1M18 B;  5BT1 D;  3AZN B;  3C1B C;  1TAF A;  1P34 D;  4E45 A;  1U35 A;  1P3I A;  1KX4 D;  3WA9 A;  3AYW A;  5AV9 A;  4JJN D;  4H9N A;  4J8W B;  3MGQ C;  1AOI B;  5DNM B;  1TZY D;  4H9P B;  3KXB B;  5B40 D;  5CPI A;  3MGP A;  2HIO D;  4KUD A;  2Y2M A;  3H0L C;  1P3L B;  2Y2J A;  5B31 C;  5AV6 A;  1P3B D;  4J8U B;  4WV4 B;  3X1T D;  3UTA C;  2JSS A;  2W8S A;  3X1V C;  3UTB D;  5B24 A;  1P34 B;  3W99 D;  2BYK B;  2DQN C;  3REI C;  4YS3 D;  4JJN B;  4AWL B;  2FJ7 A;  2NZD C;  3AV1 C;  4DRA A;  1P3A D;  1TZY B;  3LEL D;  3REJ C;  5JRG D;  3A1K A;  5B40 B;  2XD5 A;  1BH8 B;  5CP6 A;  3AZG C;  1KX5 D;  4E44 A;  4LD9 A;  1P3O D;  2BYM B;  2G5H C;  3MGQ A;  1P3P D;  1P3B B;  2XD1 A;  3REK D;  3VH5 W;  4YM6 C;  3W98 B;  3UTB B;  4H9O B;  3W99 B;  4QLC B;  5CPK D;  2JE5 A;  3KSY A;  3UTA A;  2Y2O A;  1HQ3 D;  4YS3 B;  3AZE D;  3X1V A;  2YFV B;  1F66 C;  3O62 C;  4M6B A;  5B1L D;  1PZR A;  5JRG B;  1R4V A;  3AZL C;  5B32 G;  3R45 A;  3VH6 A;  5BS7 C;  5AV5 C;  3REI A;  2NZD A;  3AFA C;  3MGR D;  3AV1 A;  1H3O B;  5BNV B;  3REJ A;  3REK B;  3AZI C;  3AZG A;  4EO5 C;  2UWX A;  3KUY C;  3MVD D;  5AV8 D;  3NQU B;  1S32 C;  3NQJ A;  1P3K D;  2YFW B;  3REL C;  3LZ0 C;  2PYO D;  1HQ3 B;  4YM6 A;  5B1L B;  1P3M C;  4Z5T C;  5GT0 C;  2NQB C;  3UT9 C;  5B0Z B;  1F66 A;  3O62 A;  3LJA C;  3C1C C;  3B6F D;  5F99 C;  3AZL A;  3AV2 C;  3C1B B;  3WKJ D;  5AV5 A;  2ZY2 A;  5BS7 A;  1Q9C A;  3KFU G;  4XZQ D;  5CPJ D;  3MVD B;  3AFA A;  5AV8 B;  1P3G D;  2F8N A;  3LZ1 C;  5BT1 C;  1P3K B;  3AZI A;  5AVB B;  4R8P D;  3WTP D;  5B0Y D;  2Y2N A;  1KX4 C;  2ARO C;  3B0C T;  1P3F C;  1S32 A;  4CSR A;  4H9Q B;  5KDM A;  2Y2Q A;  3WAA B;  2HUE C;  5G49 B;  5B31 B;  2HIO C;  5C3I B;  3LZ0 A;  4J8V C;  3REL A;  2DF4 C;  5BO0 B;  3AZF D;  3AN2 D;  4H9R A;  2ZY5 A;  1U35 C;  3B6G B;  5B1M D;  4Z5T A;  3X1U C;  4ZUX D;  3WA9 C;  5GT0 A;  2NQB A;  3WKJ B;  4WU8 A;  3UT9 A;  1M19 C;  5B33 B;  1M18 D;  4XZQ B;  1P3G B;  5FUG B;  5CPI C;  3LJA A;  1EQZ A;  5GXQ B;  5DNN B;  5B2J C;  3C1C A;  2IO5 C;  4KUD C;  5AVC C;  5B2I C;  2Y2P A;  5F99 A;  3AV2 A;  4WU9 B;  4R8P B;  3WTP B;  3EPK A;  4J8W D;  1AOI D;  5DNM D;  5JA4 A;  5AV6 C;  4Z2M G;  3X1S B;  3EPJ A;  3MGS C;  3LZ1 A;  1P3A C;  4HGA C;  2L5A A;  1KX5 C;  3AN2 B;  1KX4 A;  3W97 D;  4J8X C;  1P3O C;  5B1M B;  4J8U D;  1P3F A;  4G92 C;  2F8N K;  3W96 C;  3AZH B;  1B6W A;  5B32 C;  3KWQ D;  2HIO A;  4X23 C;  1M1A D;  3TU4 D;  4XUJ C;  4ZBJ B;  5CP6 C;  3X1U A;  3V9R B;  3IP4 C;  4LD9 C;  4Z66 B;  3REH D;  5CPK C;  3X1T A;  1M19 A;  1ZLA C;  3AZE C;  1JFI A;  5B2J A;  4CAY A;  5AVC A;  3MNN C;  5B2I A;  2FFF B;  3B0B A;  3W97 B;  3A6N C;  3AZJ B;  3MGS A;  3KUY B;  1P3A A;  3W98 D;  3LEL A;  2CV5 C;  3KWQ B;  1M1A B;  4G91 B;  3TU4 B;  1KX5 A;  4QLC D;  4J8X A;  1P3O A;  1P3P A;  5GT3 C;  3W96 A;  1P3M B;  3REH B;  2RVQ D;  3VH5 T;  5B32 A;  4X23 A;  1KX3 B;  4KHA A;  4WNN A;  5CHL B;  4XUJ A;  3AZM B;  1BH9 B;  3EG5 B;  5CPK A;  1ZLA A;  5AY8 B;  5AV9 D;  2BG1 A;  5E5A B;  3AZE A;  1ID3 B;  4DRB A;  3MNN A;  3AZK C;  5BNX A;  3A6N A;  5CPJ C;  3MGR A;  2ARO B;  2CV5 A;  5B0Y C;  4J8V B;  1TAF B;  5GT3 A;  1U35 B;  4UUZ A;  5B0Z D;  1P3I B;  5GSU C;  2PYO A;  3WA9 B;  3AYW B;  5AV9 B;  4H9N B;  2FJ7 D;  3AZF C;  3C1B D;  3B0D C;  5CPI B;  4KUD B;  3MGP B;  2IO5 B;  2Y2H A;  4KGC C;  1M18 C;  2G5I C;  3AZN C;  5AV6 B;  5AVB D;  3B6F A;  3P5J B;  3AZK A;  4J8W C;  1AOI C;  5B24 B;  3WAA D;  5CPJ A;  3KXB C;  5B31 D;  4WU8 C;  1EQZ C;  1P3L C;  5B0Y A;  3X1V D;  2FJ7 B;  3B6G D;  4J8U C;  1N1J A;  5B33 D;  5CP6 B;  5GSU A;  4NE3 A;  3REI D;  5GXQ D;  5DNN D;  4LD9 B;  3MGQ B;  2NZD D;  3AV1 D;  4WU9 D;  1P34 C;  3AZF A;  4ZUX A;  4WZS B;  3AZG D;  4JJN C;  3X1S D;  4AWL C;  4KGC A;  1M18 A;  3AZN A;  1TZY C;  2F8N H;  3H0R C;  5B40 C;  1BFM A;  3UTA B;  4J8W A;  3X1V B;  1AOI A;  5DNM A;  3AZH D;  4H9P A;  3KXB A;  1P3B C;  2LY8 A;  3X1T C;  3W98 C;  3R45 B;  4UPK A;  3REI B;  3UTB C;  1P3L A;  3VH6 W;  1F66 D;  2NZD B;  3AV1 B;  3EPL A;  3W99 C;  4QLC C;  4Z66 D;  3REJ B;  4J8U A;  3AZL D;  2RIQ A;  4H9S C;  4YS3 C;  3AZG B;  2RVQ C;  5AV5 D;  2F2A C;  3LEL C;  2ZM5 A;  5JRG C;  1P34 A;  2F8N D;  2BYK A;  3NQJ B;  4NFT A;  3AZI D;  4YM6 B;  4JJN A;  3AZJ D;  1P3P C;  3KUY D;  1TZY A;  5B40 A;  1S32 D;  1ULY A;  3REK C;  1BH8 A;  2BYM A;  2CWE A;  1F66 B;  3O62 B;  1P3M D;  1P3B A;  4Z5T D;  1KX3 D;  1KU5 A;  3AZL B;  1HQ3 C;  5GT0 D;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...