4J8VD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vD00
3X1VC 4KHAB 3AZND 3LZ1D 1WWIA 5B2IA 3X1UD 2AROC 3UT9D 3REIB 5AVCC 3MVDC 2BYKB 3UTBD 3AZEA 4X23C 5B31G 1AOID 4XUJD 4Z2MG 5C3IC 5AV6C 5F99C 3W98A 4Z5TD 3LZ0C 3MGPB 5B0ZC 1KX4C 3MGRD 2NQBB 3MGSB 5B0YB 3RELB 3REJD 3B6GC 3AV1D 5CP6C 4G91B 4J8XC 5BS7C 3WA9D 4J8WD 4KUDC 4WNNA 1ID3A 1KX5D 3LZ1B 3B0DC 5AV9B 4J8VC 3X1TC 3UTBA 1BH8A 5B40C 1AOIA 3W97D 4XUJA 5GT0C 4Z66B 3C1CC 5CPIC 3LELB 3AZIA 1P3LB 4Z5TA 3KXBA 3VH5T 1P3MB 4LD9B 5JA4B 5BO0B 3AV1A 2PYOC 1BH9A 5GT3C 5BNVA 4XZQC 2RVQD 5B1MD 3KUYD 1M18A 2YFVA 3KWQB 3AZJA 1M19D 5B33B 5B2IC 4G92B 3REKB 5AY8B 3AFAB 4WU9C 3X1SD 2FJ7A 3AV2C 5B2JA 3WKJC 3TU4C 3AZEC 3W97B 4HGAB 1U35C 3AN2A 5CPKD 3W99D 3W98C 3MNND 4YS3D 1H3OB 5KDMA 4DRAA 5G49B 4R8PB 5AVCD 2F8NH 5GSUB 1KX3D 2HIOB 1M19A 3AZNC 3AZFA 3X1UC 4H9QB 3UT9C 5JRGB 5B32D 5B24D 3AZKB 3UTBC 5AV8D 1P3FA 1AOIC 1P3AB 4XUJC 3NQJA 4CAYB 5CPKA 1HQ3B 4Z5TC 3MGRC 4QLCD 5CP6D 3W99B 3R45A 5B1LB 4YS3A 3REJC 3MGQB 3AV1C 5E5AA 3X1VB 2AROB 1KX3A 4J8WC 3REHA 5AV5D 3WA9C 5AVCB 1M18C 1KX5C 3MVDB 1TAFA 3C1CD 4X23B 5B24A 4NE5A 1M1AA 5AV8A 5C3IB 5AV6B 5F99B 3V9RB 3NQUB 3LZ0B 5B0ZB 1KX4B 2YFWB 4NFTA 4H9RA 3B6GB 3AZLD 5CP6B 4H9NA 3LJAA 4J8XB 1S32A 4AWLC 3C1BA 4KUDB 2RVQC 5B1MC 4UUZB 5AVBD 4J8UA 3KUYC 5AV5A 1EQZD 1ZLAA 3B0DB 5CHLB 4J8VB 3X1TB 1M19C 5B40B 5GT0B 3C1CB 3X1SC 5CPIB 3B0BA 5BNXB 3W98D 3O62D 4H9OB 2PYOB 5CPKC 5GT3B 3AYWA 4WZSB 4XZQB 2NZDA 3MNNC 4DRBA 4YS3C 5GXQA 5AVBA 2JSSA 1B67A 1ID3D 1F66D 1EQZA 5B2IB 4WU9B 1KX3C 1P3BD 3AV2B 2L5AA 3A6NA 2BYMA 3WKJB 3TU4B 4E45A 5DNMD 3AZEB 3AZID 5B32C 5B24C 5DNNA 1P3GD 3KXBD 1U35B 5AV8C 3O62A 3W98B 4YM6D 3WAAD 4QLCC 1M18D 1ULYA 3REIA 1F66A 3AZNB 1BFMA 3AZJD 3X1UB 3UT9B 1F1EA 5AV5C 1KU5A 1P3BA 5FUGA 2FJ7D 5CPJA 5B2JD 3UTBB 5DNMA 1BH8B 3MGPA 1P3GA 1AOIB 2NQBA 4XUJB 3MGSA 3RELA 3AN2D 4Z5TB 4YM6A 3WAAA 3MGRB 3REJB 3B0CW 3AV1B 1BH9B 3AZLC 5BNVB 3WA9B 5AV9A 4J8WB 1M18B 3AZFD 5AVBC 1KX5B 2F8ND 1TZYD 1EQZC 4CSRB 4Z66A 3LELA 3W96D 1P3LA 3AZHD 1P3FD 4H9SA 3WTPA 4LD9A 1P3PA 3O62C 2CV5D 1P3ID 4AWLB 5B1MB 5E5AD 3KWQA 5KDMB 5B33A 3KUYB 3REKA 3REHD 1ID3C 1F66C 2F8NA 1TZYA 1M19B 4ZUXD 3W96A 1P3BC 3X1SB 3AZHA 1M1AD 5CPJC 5DNMC 3AZIC 1Q9CA 1P3GC 3KXBC 1H3OA 3NQJB 5CPKB 2CV5A 5G49A 4R8PA 3B0CT 3WAAC 4YM6C 3MNNB 3LJAD 3AZGD 1P3IA 1P3OD 4YS3B 1S32D 3C1BD 2HIOA 4J8UD 1ZLAD 1P3KA 5JRGA 1KX3B 3AZKA 3AZJC 4ZUXA 1R4VA 2FJ7C 5B32B 5B24B 4CAYA 4E44A 4WU8D 5B2JC 1HQ3A 5AV8B 3AZMD 5B1LA 4H9SC 3WTPC 5BT1D 3AN2C 3MGQA 5B31D 3AYWD 1P3PC 3X1VA 1P3OA 4EO5C 4QLCB 3AZGA 2NZDD 4JJND 2AROA 3B6FD 1N1JB 5GXQD 4X23A 5AV5B 3AZFC 2IO5C 1JFIA 1TZYC 5F99A 3V9RA 3A6ND 4NE6A 3NQUA 4WV4B 3LZ0A 4WU8A 3W96C 1KX4A 2YFWA 5DNND 3AZHC 3AZMA 3B6GA 2HUEC 1P3FC 3UTAD 4J8XA 5B31A 4KGCD 5BS7A 4KUDA 5B32G 3AZLB 4JJNA 2CV5C 1P3IC 3B6FA 3REID 5E5AC 4J8VA 3X1TA 4H9PA 5AVBB 1EQZB 3REHC 5GT0A 3VH6A 1P3KC 5CPIA 5CPJD 4ZUXC 3MGPD 2BYMB 2NQBD 1M1AC 3MGSD 1P34A 4H9OA 5B0YD 3RELD 2PYOA 5GT3A 3UTAA 3WTPE 3O62B 4KGCA 4NE3A 4KHAA 1P3OC 3LJAC 3AZGC 5AV9D 4WU9A 3C1BC 1S32C 4WNNB 1ID3B 2BYKA 3VH6W 3AV2A 1F66B 4J8UC 1ZLAC 3WKJA 3TU4A 4Z66D 3LELD 1P3BB 1B6WA 1P3LD 5FUGB 1U35A 5CPJB 5DNMB 1P3MD 3WTPD 5B0YA 3AZIB 1P3GB 4WU8C 4LD9D 3KXBB 1P3PD 3AZMC 4YM6B 3WAAB 5BT1C 5B31C 3AYWC 3KWQD 3AZNA 2NZDC 3LZ1A 3X1UA 5B33D 4JJNC 3REKD 3UT9A 5AY8D 3AFAD 3B6FC 4ZBJC 5GXQC 2YFVB 3AZJB 2FJ7B 5B2JB 3A6NC 1P3MA 2LY8A 5JA4A 5BO0A 3MGRA 5DNNC 3WTPB 3REJA 3AN2B 1P34C 1P3PB 3UTAC 4EO5B 4R8PD 1A7WA 4KGCC 3WA9A 5GSUD 4J8WA 2HIOD 1KX5A 5AY8A 3AFAA 3VH6T 4CSRA 1P3KD 5JRGD 3REIC 3AZKD 3KSYA 3AZFB 2IO5B 2F8NB 1TZYB 3W97A 1P3AD 3W96B 3AZHB 1HQ3D 2HUEB 1P3FB 3MGPC 2NQBC 5B1LD 3MGSC 5B0YC 3RELC 3MGQD 5B1MA 3X1VD 2CV5B 3R45B 4G91C 5GSUA 2AROD 3KUYA 1P3IB 5E5AB 3MVDD 4H9QA 3LZ1C 4X23D 5AV9C 3REHB 3X1SA 1P3KB 5AV6D 5F99D 1TAFB 1P3AA 4ZUXB 4Z66C 3LZ0D 5B0ZD 3LELC 1KX4D 1P3LC 1M1AB 3B6GD 3W99A 1P3MC 4LD9C 3MNNA 4J8XD 2F8NG 4H9RB 4KUDD 1P3OB 3LJAB 4H9NB 3AZGB 5AVCA 1S32B 3C1BB 3MVDA 3X1TD 3KWQC 4J8VD 1WWSA 5B33C 4J8UB 5B40D 4G92C 3REKC 1ZLAB 5AY8C 5GT0D 3AFAC 5CPID 5B32A 5AV6A 5B0ZA 1JFIB 1HTAA 3W97C 4HGAC 4WU8B 1P34D 2PYOD 5GT3D 3VH5A 4M6BA 3AZMB 4XZQD 4QLCA 5CP6A 1N1JA 4UUZA 5B31B 3AYWB 2F8NK 4R8PC 2NZDB 4JJNB 5B2ID 5GSUC 4WU9D 3B6FB 2HIOC 4ZBJB 5GXQB 3AV2D 5B40A 3WKJD 4H9PB 3C1CA 3TU4D 3AZED 5BNXA 5JRGC 3AZKC 1U35D 3A6NB 1P3AC 3VH5W 5DNNB 1HQ3C 4Z2MH 4XZQA 1P34B 3W99C 3UTAB 3AZLA 5B1LC 4KGCB 2CWEA 3MGQC
chains in the Genus database with same CATH superfamily
3X1VC 4KHAB 3AZND 3LZ1D 1WWIA 5B2IA 3X1UD 2AROC 3UT9D 3REIB 5AVCC 3MVDC 2BYKB 3UTBD 3AZEA 4X23C 5B31G 1AOID 4XUJD 4Z2MG 5C3IC 5AV6C 5F99C 3W98A 4Z5TD 3LZ0C 3MGPB 5B0ZC 1KX4C 3MGRD 2NQBB 3MGSB 5B0YB 3RELB 3REJD 3B6GC 3AV1D 1T3UA 5CP6C 4G91B 4J8XC 5BS7C 3WA9D 4J8WD 4KUDC 4WNNA 1ID3A 1KX5D 3LZ1B 3B0DC 5AV9B 4J8VC 3X1TC 3UTBA 1BH8A 5B40C 1AOIA 3W97D 4XUJA 5GT0C 4Z66B 3C1CC 5CPIC 3LELB 3AZIA 1P3LB 4Z5TA 3KXBA 3VH5T 1P3MB 4LD9B 5JA4B 5BO0B 3EPLA 3AV1A 2PYOC 1BH9A 5GT3C 5BNVA 4XZQC 2RVQD 5B1MD 3F6TA 3KUYD 1Z2CB 1M18A 2YFVA 3KWQB 3AZJA 1M19D 5B33B 5B2IC 4G92B 3REKB 5AY8B 3AFAB 4WU9C 3X1SD 2FJ7A 3AV2C 5B2JA 3WKJC 3TU4C 3AZEC 2Y2JA 3W97B 4HGAB 1U35C 3AN2A 5CPKD 3W99D 3W98C 3MNND 4YS3D 1H3OB 5KDMA 4DRAA 5G49B 4R8PB 5AVCD 2F8NH 5GSUB 1KX3D 2HIOB 1M19A 3AZNC 3AZFA 3X1UC 4H9QB 3UT9C 5JRGB 5B32D 5B24D 3AZKB 3UTBC 5AV8D 1P3FA 1AOIC 1P3AB 4XUJC 3NQJA 3P5JB 4CAYB 5CPKA 1HQ3B 2XD5A 4Z5TC 3MGRC 4QLCD 5CP6D 3W99B 3R45A 5B1LB 2DQNC 4YS3A 2BG1A 3REJC 3MGQB 3AV1C 5E5AA 3X1VB 2AROB 1KX3A 4J8WC 3REHA 5AV5D 3WA9C 5AVCB 3H0RC 1KX5C 1M18C 3MVDB 1TAFA 3C1CD 4X23B 5B24A 4NE5A 1M1AA 5AV8A 5C3IB 5AV6B 5F99B 3V9RB 3NQUB 2Y2QA 3LZ0B 5B0ZB 1KX4B 2YFWB 4NFTA 4H9RA 3B6GB 3AZLD 5CP6B 4H9NA 3EG5B 3LJAA 4J8XB 1S32A 4AWLC 3C1BA 4KUDB 2RVQC 5B1MC 4UUZB 5AVBD 3IP4C 4J8UA 3KUYC 5AV5A 1EQZD 1ZLAA 3B0DB 5CHLB 4J8VB 3X1TB 2DF4C 1M19C 5B40B 5GT0B 3C1CB 3X1SC 5CPIB 3B0BA 5BNXB 3W98D 3O62D 4H9OB 2PYOB 5CPKC 5GT3B 3AYWA 4WZSB 4XZQB 2NZDA 3MNNC 4DRBA 4YS3C 4DQYB 2G5IC 4WJ3C 5GXQA 5AVBA 2JSSA 1B67A 1ID3D 1F66D 2F2AC 1EQZA 5B2IB 4WU9B 1KX3C 1P3BD 3AV2B 2L5AA 3A6NA 2BYMA 3WKJB 3TU4B 5DNMD 4E45A 3AZEB 3AZID 5B32C 5B24C 5DNNA 1P3GD 3KXBD 1U35B 5AV8C 3O62A 3W98B 4YM6D 3WAAD 4QLCC 1M18D 1ULYA 3REIA 1F66A 3AZNB 1BFMA 3AZJD 3X1UB 3UT9B 1F1EA 5AV5C 1KU5A 1P3BA 3A1KA 5FUGA 5CPJA 2FJ7D 2VQRA 5B2JD 3UTBB 5DNMA 1BH8B 3MGPA 1P3GA 1AOIB 2NQBA 4XUJB 3MGSA 3RELA 3AN2D 4Z5TB 4YM6A 3WAAA 3MGRB 3REJB 2Y2IA 3B0CW 3AV1B 1BH9B 3AZLC 5BNVB 2XD1A 3WA9B 5AV9A 4J8WB 1M18B 3AZFD 5AVBC 1KX5B 2F8ND 1TZYD 1EQZC 3FDDA 4CSRB 4Z66A 3LELA 3W96D 1P3LA 3AZHD 1P3FD 2Y2LA 4H9SA 3WTPA 4LD9A 1P3PA 3O62C 2CV5D 3H0MC 1P3ID 4AWLB 5B1MB 5E5AD 3KWQA 5KDMB 5B33A 3KUYB 3REKA 3REHD 1ID3C 1F66C 2F8NA 1TZYA 1M19B 4ZUXD 3W96A 1P3BC 3X1SB 3AZHA 1M1AD 5CPJC 5DNMC 3AZIC 1Q9CA 1P3GC 2J8PA 3KXBC 1H3OA 3NQJB 5CPKB 2CV5A 5G49A 4R8PA 3B0CT 3WAAC 4YM6C 3MNNB 3LJAD 3AZGD 1P3IA 1P3OD 3EPJA 4YS3B 1S32D 3C1BD 2HIOA 4J8UD 1ZLAD 1P3KA 5JRGA 3EPHA 1KX3B 3AZKA 3AZJC 4ZUXA 1R4VA 2FJ7C 5B32B 5B24B 4CAYA 4E44A 4WU8D 5B2JC 1HQ3A 5AV8B 3AZMD 5B1LA 4H9SC 3WTPC 5BT1D 3AN2C 3MGQA 5B31D 3AYWD 1P3PC 2G5HC 3X1VA 1P3OA 4EO5C 4QLCB 3AZGA 2NZDD 4JJND 2AROA 3B6FD 1N1JB 5GXQD 4X23A 2ZY2A 5AV5B 3AZFC 2IO5C 1JFIA 1TZYC 5F99A 3V9RA 3A6ND 4NE6A 3NQUA 4WV4B 3LZ0A 4WU8A 3W96C 1KX4A 2YFWA 5DNND 3AZHC 3AZMA 3B6GA 2HUEC 1P3FC 3UTAD 4J8XA 5B31A 4KGCD 5BS7A 4KUDA 2FFFB 5B32G 4JJNA 3AZLB 2CV5C 1P3IC 2W8SA 3B6FA 3REID 2ZY5A 2Y2KA 5E5AC 4J8VA 3X1TA 4H9PA 5AVBB 1EQZB 3REHC 5GT0A 3VH6A 1P3KC 5CPIA 5CPJD 4ZUXC 3MGPD 2BYMB 2NQBD 1M1AC 3MGSD 1P34A 4H9OA 5B0YD 3RELD 2PYOA 5GT3A 3UTAA 3WTPE 3O62B 4KGCA 4NE3A 4KHAA 1P3OC 3LJAC 3AZGC 5AV9D 4WU9A 3C1BC 1S32C 4WNNB 1ID3B 2BYKA 3VH6W 3AV2A 1F66B 4J8UC 1ZLAC 3WKJA 3TU4A 4Z66D 3LELD 1P3BB 1B6WA 3H0LC 1P3LD 5FUGB 1U35A 5CPJB 5DNMB 1P3MD 3WTPD 5B0YA 3AZIB 1P3GB 4WU8C 4LD9D 3KXBB 1P3PD 3AZMC 4YM6B 3WAAB 5BT1C 5B31C 3AYWC 3KWQD 2Y2HA 3AZNA 2NZDC 3LZ1A 3X1UA 5B33D 4JJNC 3REKD 3UT9A 2ZM5A 2Y2MA 5AY8D 3AFAD 3B6FC 4ZBJC 5GXQC 2YFVB 3AZJB 2FJ7B 5B2JB 3A6NC 1P3MA 2LY8A 5JA4A 5BO0A 3MGRA 5DNNC 3WTPB 3REJA 3AN2B 1P34C 1P3PB 3UTAC 4EO5B 4R8PD 1A7WA 4KGCC 3WA9A 5GSUD 4J8WA 2HIOD 1KX5A 5AY8A 3AFAA 3VH6T 4CSRA 1P3KD 5JRGD 3REIC 3AZKD 3KSYA 3AZFB 2IO5B 2F8NB 1TZYB 3W97A 1P3AD 3W96B 3AZHB 1HQ3D 2HUEB 1P3FB 3MGPC 2NQBC 2JE5A 5B1LD 3MGSC 5B0YC 3RELC 3MGQD 5B1MA 3X1VD 2CV5B 3R45B 4G91C 5GSUA 2AROD 3KUYA 1P3IB 2Y2NA 5E5AB 3MVDD 4H9QA 3LZ1C 4X23D 5AV9C 3REHB 3X1SA 1P3KB 5AV6D 5F99D 1TAFB 1P3AA 4ZUXB 4Z66C 3LZ0D 5B0ZD 3LELC 1KX4D 3KFUG 1P3LC 1M1AB 3B6GD 3W99A 1P3MC 4LD9C 3EPKA 3MNNA 4J8XD 3A1IA 2F8NG 4H9RB 4KUDD 1P3OB 3LJAB 4H9NB 3AZGB 5AVCA 1S32B 3C1BB 2ZY3A 3MVDA 2Y2OA 3X1TD 3KWQC 4J8VD 1WWSA 5B33C 4J8UB 5B40D 4G92C 3REKC 1ZLAB 5AY8C 5GT0D 3AFAC 5CPID 5B32A 5AV6A 2Y2PA 5B0ZA 1JFIB 1HTAA 3W97C 1W2EA 4HGAC 4WU8B 1P34D 2PYOD 5GT3D 3VH5A 4M6BA 3AZMB 4XZQD 4QLCA 5CP6A 1N1JA 4UUZA 5B31B 3AYWB 2RIQA 2F8NK 4R8PC 2NZDB 4JJNB 5B2ID 5GSUC 4WU9D 3B6FB 2HIOC 4ZBJB 5GXQB 3AV2D 5B40A 3WKJD 4H9PB 3C1CA 3TU4D 2Y2GA 3AZED 5BNXA 5JRGC 2UWXA 3AZKC 1U35D 1PZRA 3A6NB 1P3AC 3VH5W 2JCHA 5DNNB 4UPKA 3AL0C 1HQ3C 4Z2MH 4XZQA 1P34B 3W99C 3UTAB 3AZLA 5B1LC 2ZY4A 4KGCB 2CWEA 3MGQC
chains in the Genus database with same CATH topology
3X1VC 4KHAB 3AZND 3LZ1D 1WWIA 5B2IA 3X1UD 2AROC 3UT9D 3REIB 5AVCC 3MVDC 2BYKB 3UTBD 3AZEA 4X23C 5B31G 1AOID 4XUJD 4Z2MG 5C3IC 5AV6C 5F99C 3W98A 4Z5TD 3LZ0C 3MGPB 5B0ZC 1KX4C 3MGRD 2NQBB 3MGSB 5B0YB 3RELB 3REJD 3B6GC 3AV1D 1T3UA 5CP6C 4G91B 4J8XC 5BS7C 3WA9D 4J8WD 4KUDC 4WNNA 1ID3A 1KX5D 3LZ1B 3B0DC 5AV9B 4J8VC 3X1TC 3UTBA 1BH8A 5B40C 1AOIA 3W97D 4XUJA 5GT0C 4Z66B 3C1CC 5CPIC 3LELB 3AZIA 1P3LB 4Z5TA 3KXBA 3VH5T 1P3MB 4LD9B 5JA4B 5BO0B 3EPLA 3AV1A 2PYOC 1BH9A 5GT3C 5BNVA 4XZQC 2RVQD 5B1MD 3F6TA 3KUYD 1Z2CB 1M18A 2YFVA 3KWQB 3AZJA 1M19D 5B33B 5B2IC 4G92B 3REKB 5AY8B 3AFAB 4WU9C 3X1SD 2FJ7A 3AV2C 5B2JA 3WKJC 3TU4C 3AZEC 2Y2JA 3W97B 4HGAB 1U35C 3AN2A 5CPKD 3W99D 3W98C 3MNND 4YS3D 1H3OB 5KDMA 4DRAA 5G49B 4R8PB 5AVCD 2F8NH 5GSUB 1KX3D 2HIOB 1M19A 3AZNC 3AZFA 3X1UC 4H9QB 3UT9C 5JRGB 5B32D 5B24D 3AZKB 3UTBC 5AV8D 1P3FA 1AOIC 1P3AB 4XUJC 3NQJA 3P5JB 4CAYB 5CPKA 1HQ3B 2XD5A 4Z5TC 3MGRC 4QLCD 5CP6D 3W99B 3R45A 5B1LB 2DQNC 4YS3A 2BG1A 3REJC 3MGQB 3AV1C 5E5AA 3X1VB 2AROB 1KX3A 4J8WC 3REHA 5AV5D 3WA9C 5AVCB 3H0RC 1KX5C 1M18C 3MVDB 1TAFA 3C1CD 4X23B 5B24A 4NE5A 1M1AA 5AV8A 5C3IB 5AV6B 5F99B 3V9RB 3NQUB 2Y2QA 3LZ0B 5B0ZB 1KX4B 2YFWB 4NFTA 4H9RA 3B6GB 3AZLD 5CP6B 4H9NA 3EG5B 3LJAA 4J8XB 1S32A 4AWLC 3C1BA 4KUDB 2RVQC 5B1MC 4UUZB 5AVBD 3IP4C 4J8UA 3KUYC 5AV5A 1EQZD 1ZLAA 3B0DB 5CHLB 4J8VB 3X1TB 2DF4C 1M19C 5B40B 5GT0B 3C1CB 3X1SC 5CPIB 3B0BA 5BNXB 3W98D 3O62D 4H9OB 2PYOB 5CPKC 5GT3B 3AYWA 4WZSB 4XZQB 2NZDA 3MNNC 4DRBA 4YS3C 4DQYB 2G5IC 4WJ3C 5GXQA 5AVBA 2JSSA 1B67A 1ID3D 1F66D 2F2AC 1EQZA 5B2IB 4WU9B 1KX3C 1P3BD 3AV2B 2L5AA 3A6NA 2BYMA 3WKJB 3TU4B 5DNMD 4E45A 3AZEB 3AZID 5B32C 5B24C 5DNNA 1P3GD 3KXBD 1U35B 5AV8C 3O62A 3W98B 4YM6D 3WAAD 4QLCC 1M18D 1ULYA 3REIA 1F66A 3AZNB 1BFMA 3AZJD 3X1UB 3UT9B 1F1EA 5AV5C 1KU5A 1P3BA 3A1KA 5FUGA 5CPJA 2FJ7D 2VQRA 5B2JD 3UTBB 5DNMA 1BH8B 3MGPA 1P3GA 1AOIB 2NQBA 4XUJB 3MGSA 3RELA 3AN2D 4Z5TB 4YM6A 3WAAA 3MGRB 3REJB 2Y2IA 3B0CW 3AV1B 1BH9B 3AZLC 5BNVB 2XD1A 3WA9B 5AV9A 4J8WB 1M18B 3AZFD 5AVBC 1KX5B 2F8ND 1TZYD 1EQZC 3FDDA 4CSRB 4Z66A 3LELA 3W96D 1P3LA 3AZHD 1P3FD 2Y2LA 4H9SA 3WTPA 4LD9A 1P3PA 3O62C 2CV5D 3H0MC 1P3ID 4AWLB 5B1MB 5E5AD 3KWQA 5KDMB 5B33A 3KUYB 3REKA 3REHD 1ID3C 1F66C 2F8NA 1TZYA 1M19B 4ZUXD 3W96A 1P3BC 3X1SB 3AZHA 1M1AD 5CPJC 5DNMC 3AZIC 1Q9CA 1P3GC 2J8PA 3KXBC 1H3OA 3NQJB 5CPKB 2CV5A 5G49A 4R8PA 3B0CT 3WAAC 4YM6C 3MNNB 3LJAD 3AZGD 1P3IA 1P3OD 3EPJA 4YS3B 1S32D 3C1BD 2HIOA 4J8UD 1ZLAD 1P3KA 5JRGA 3EPHA 1KX3B 3AZKA 3AZJC 4ZUXA 1R4VA 2FJ7C 5B32B 5B24B 4CAYA 4E44A 4WU8D 5B2JC 1HQ3A 5AV8B 3AZMD 5B1LA 4H9SC 3WTPC 5BT1D 3AN2C 3MGQA 5B31D 3AYWD 1P3PC 2G5HC 3X1VA 1P3OA 4EO5C 4QLCB 3AZGA 2NZDD 4JJND 2AROA 3B6FD 1N1JB 5GXQD 4X23A 2ZY2A 5AV5B 3AZFC 2IO5C 1JFIA 1TZYC 5F99A 3V9RA 3A6ND 4NE6A 3NQUA 4WV4B 3LZ0A 4WU8A 3W96C 1KX4A 2YFWA 5DNND 3AZHC 3AZMA 3B6GA 2HUEC 1P3FC 3UTAD 4J8XA 5B31A 4KGCD 5BS7A 4KUDA 2FFFB 5B32G 4JJNA 3AZLB 2CV5C 1P3IC 2W8SA 3B6FA 3REID 2ZY5A 2Y2KA 5E5AC 4J8VA 3X1TA 4H9PA 5AVBB 1EQZB 3REHC 5GT0A 3VH6A 1P3KC 5CPIA 5CPJD 4ZUXC 3MGPD 2BYMB 2NQBD 1M1AC 3MGSD 1P34A 4H9OA 5B0YD 3RELD 2PYOA 5GT3A 3UTAA 3WTPE 3O62B 4KGCA 4NE3A 4KHAA 1P3OC 3LJAC 3AZGC 5AV9D 4WU9A 3C1BC 1S32C 4WNNB 1ID3B 2BYKA 3VH6W 3AV2A 1F66B 4J8UC 1ZLAC 3WKJA 3TU4A 4Z66D 3LELD 1P3BB 1B6WA 3H0LC 1P3LD 5FUGB 1U35A 5CPJB 5DNMB 1P3MD 3WTPD 5B0YA 3AZIB 1P3GB 4WU8C 4LD9D 3KXBB 1P3PD 3AZMC 4YM6B 3WAAB 5BT1C 5B31C 3AYWC 3KWQD 2Y2HA 3AZNA 2NZDC 3LZ1A 3X1UA 5B33D 4JJNC 3REKD 3UT9A 2ZM5A 2Y2MA 5AY8D 3AFAD 3B6FC 4ZBJC 5GXQC 2YFVB 3AZJB 2FJ7B 5B2JB 3A6NC 1P3MA 2LY8A 5JA4A 5BO0A 3MGRA 5DNNC 3WTPB 3REJA 3AN2B 1P34C 1P3PB 3UTAC 4EO5B 4R8PD 1A7WA 4KGCC 3WA9A 5GSUD 4J8WA 2HIOD 1KX5A 5AY8A 3AFAA 3VH6T 4CSRA 1P3KD 5JRGD 3REIC 3AZKD 3KSYA 3AZFB 2IO5B 2F8NB 1TZYB 3W97A 1P3AD 3W96B 3AZHB 1HQ3D 2HUEB 1P3FB 3MGPC 2NQBC 2JE5A 5B1LD 3MGSC 5B0YC 3RELC 3MGQD 5B1MA 3X1VD 2CV5B 3R45B 4G91C 5GSUA 2AROD 3KUYA 1P3IB 2Y2NA 5E5AB 3MVDD 4H9QA 3LZ1C 4X23D 5AV9C 3REHB 3X1SA 1P3KB 5AV6D 5F99D 1TAFB 1P3AA 4ZUXB 4Z66C 3LZ0D 5B0ZD 3LELC 1KX4D 3KFUG 1P3LC 1M1AB 3B6GD 3W99A 1P3MC 4LD9C 3EPKA 3MNNA 4J8XD 3A1IA 2F8NG 4H9RB 4KUDD 1P3OB 3LJAB 4H9NB 3AZGB 5AVCA 1S32B 3C1BB 2ZY3A 3MVDA 2Y2OA 3X1TD 3KWQC 4J8VD 1WWSA 5B33C 4J8UB 5B40D 4G92C 3REKC 1ZLAB 5AY8C 5GT0D 3AFAC 5CPID 5B32A 5AV6A 2Y2PA 5B0ZA 1JFIB 1HTAA 3W97C 1W2EA 4HGAC 4WU8B 1P34D 2PYOD 5GT3D 3VH5A 4M6BA 3AZMB 4XZQD 4QLCA 5CP6A 1N1JA 4UUZA 5B31B 3AYWB 2RIQA 2F8NK 4R8PC 2NZDB 4JJNB 5B2ID 5GSUC 4WU9D 3B6FB 2HIOC 4ZBJB 5GXQB 3AV2D 5B40A 3WKJD 4H9PB 3C1CA 3TU4D 2Y2GA 3AZED 5BNXA 5JRGC 2UWXA 3AZKC 1U35D 1PZRA 3A6NB 1P3AC 3VH5W 2JCHA 5DNNB 4UPKA 3AL0C 1HQ3C 4Z2MH 4XZQA 1P34B 3W99C 3UTAB 3AZLA 5B1LC 2ZY4A 4KGCB 2CWEA 3MGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V C;  4KHA B;  3AZN D;  3LZ1 D;  1WWI A;  5B2I A;  3X1U D;  2ARO C;  3UT9 D;  3REI B;  5AVC C;  3MVD C;  2BYK B;  3UTB D;  3AZE A;  4X23 C;  5B31 G;  1AOI D;  4XUJ D;  4Z2M G;  5C3I C;  5AV6 C;  5F99 C;  3W98 A;  4Z5T D;  3LZ0 C;  3MGP B;  5B0Z C;  1KX4 C;  3MGR D;  2NQB B;  3MGS B;  5B0Y B;  3REL B;  3REJ D;  3B6G C;  3AV1 D;  5CP6 C;  4G91 B;  4J8X C;  5BS7 C;  3WA9 D;  4J8W D;  4KUD C;  4WNN A;  1ID3 A;  1KX5 D;  3LZ1 B;  3B0D C;  5AV9 B;  4J8V C;  3X1T C;  3UTB A;  1BH8 A;  5B40 C;  1AOI A;  3W97 D;  4XUJ A;  5GT0 C;  4Z66 B;  3C1C C;  5CPI C;  3LEL B;  3AZI A;  1P3L B;  4Z5T A;  3KXB A;  3VH5 T;  1P3M B;  4LD9 B;  5JA4 B;  5BO0 B;  3AV1 A;  2PYO C;  1BH9 A;  5GT3 C;  5BNV A;  4XZQ C;  2RVQ D;  5B1M D;  3KUY D;  1M18 A;  2YFV A;  3KWQ B;  3AZJ A;  1M19 D;  5B33 B;  5B2I C;  4G92 B;  3REK B;  5AY8 B;  3AFA B;  4WU9 C;  3X1S D;  2FJ7 A;  3AV2 C;  5B2J A;  3WKJ C;  3TU4 C;  3AZE C;  3W97 B;  4HGA B;  1U35 C;  3AN2 A;  5CPK D;  3W99 D;  3W98 C;  3MNN D;  4YS3 D;  1H3O B;  5KDM A;  4DRA A;  5G49 B;  4R8P B;  5AVC D;  2F8N H;  5GSU B;  1KX3 D;  2HIO B;  1M19 A;  3AZN C;  3AZF A;  3X1U C;  4H9Q B;  3UT9 C;  5JRG B;  5B32 D;  5B24 D;  3AZK B;  3UTB C;  5AV8 D;  1P3F A;  1AOI C;  1P3A B;  4XUJ C;  3NQJ A;  4CAY B;  5CPK A;  1HQ3 B;  4Z5T C;  3MGR C;  4QLC D;  5CP6 D;  3W99 B;  3R45 A;  5B1L B;  4YS3 A;  3REJ C;  3MGQ B;  3AV1 C;  5E5A A;  3X1V B;  2ARO B;  1KX3 A;  4J8W C;  3REH A;  5AV5 D;  3WA9 C;  5AVC B;  1M18 C;  1KX5 C;  3MVD B;  1TAF A;  3C1C D;  4X23 B;  5B24 A;  4NE5 A;  1M1A A;  5AV8 A;  5C3I B;  5AV6 B;  5F99 B;  3V9R B;  3NQU B;  3LZ0 B;  5B0Z B;  1KX4 B;  2YFW B;  4NFT A;  4H9R A;  3B6G B;  3AZL D;  5CP6 B;  4H9N A;  3LJA A;  4J8X B;  1S32 A;  4AWL C;  3C1B A;  4KUD B;  2RVQ C;  5B1M C;  4UUZ B;  5AVB D;  4J8U A;  3KUY C;  5AV5 A;  1EQZ D;  1ZLA A;  3B0D B;  5CHL B;  4J8V B;  3X1T B;  1M19 C;  5B40 B;  5GT0 B;  3C1C B;  3X1S C;  5CPI B;  3B0B A;  5BNX B;  3W98 D;  3O62 D;  4H9O B;  2PYO B;  5CPK C;  5GT3 B;  3AYW A;  4WZS B;  4XZQ B;  2NZD A;  3MNN C;  4DRB A;  4YS3 C;  5GXQ A;  5AVB A;  2JSS A;  1B67 A;  1ID3 D;  1F66 D;  1EQZ A;  5B2I B;  4WU9 B;  1KX3 C;  1P3B D;  3AV2 B;  2L5A A;  3A6N A;  2BYM A;  3WKJ B;  3TU4 B;  4E45 A;  5DNM D;  3AZE B;  3AZI D;  5B32 C;  5B24 C;  5DNN A;  1P3G D;  3KXB D;  1U35 B;  5AV8 C;  3O62 A;  3W98 B;  4YM6 D;  3WAA D;  4QLC C;  1M18 D;  1ULY A;  3REI A;  1F66 A;  3AZN B;  1BFM A;  3AZJ D;  3X1U B;  3UT9 B;  1F1E A;  5AV5 C;  1KU5 A;  1P3B A;  5FUG A;  2FJ7 D;  5CPJ A;  5B2J D;  3UTB B;  5DNM A;  1BH8 B;  3MGP A;  1P3G A;  1AOI B;  2NQB A;  4XUJ B;  3MGS A;  3REL A;  3AN2 D;  4Z5T B;  4YM6 A;  3WAA A;  3MGR B;  3REJ B;  3B0C W;  3AV1 B;  1BH9 B;  3AZL C;  5BNV B;  3WA9 B;  5AV9 A;  4J8W B;  1M18 B;  3AZF D;  5AVB C;  1KX5 B;  2F8N D;  1TZY D;  1EQZ C;  4CSR B;  4Z66 A;  3LEL A;  3W96 D;  1P3L A;  3AZH D;  1P3F D;  4H9S A;  3WTP A;  4LD9 A;  1P3P A;  3O62 C;  2CV5 D;  1P3I D;  4AWL B;  5B1M B;  5E5A D;  3KWQ A;  5KDM B;  5B33 A;  3KUY B;  3REK A;  3REH D;  1ID3 C;  1F66 C;  2F8N A;  1TZY A;  1M19 B;  4ZUX D;  3W96 A;  1P3B C;  3X1S B;  3AZH A;  1M1A D;  5CPJ C;  5DNM C;  3AZI C;  1Q9C A;  1P3G C;  3KXB C;  1H3O A;  3NQJ B;  5CPK B;  2CV5 A;  5G49 A;  4R8P A;  3B0C T;  3WAA C;  4YM6 C;  3MNN B;  3LJA D;  3AZG D;  1P3I A;  1P3O D;  4YS3 B;  1S32 D;  3C1B D;  2HIO A;  4J8U D;  1ZLA D;  1P3K A;  5JRG A;  1KX3 B;  3AZK A;  3AZJ C;  4ZUX A;  1R4V A;  2FJ7 C;  5B32 B;  5B24 B;  4CAY A;  4E44 A;  4WU8 D;  5B2J C;  1HQ3 A;  5AV8 B;  3AZM D;  5B1L A;  4H9S C;  3WTP C;  5BT1 D;  3AN2 C;  3MGQ A;  5B31 D;  3AYW D;  1P3P C;  3X1V A;  1P3O A;  4EO5 C;  4QLC B;  3AZG A;  2NZD D;  4JJN D;  2ARO A;  3B6F D;  1N1J B;  5GXQ D;  4X23 A;  5AV5 B;  3AZF C;  2IO5 C;  1JFI A;  1TZY C;  5F99 A;  3V9R A;  3A6N D;  4NE6 A;  3NQU A;  4WV4 B;  3LZ0 A;  4WU8 A;  3W96 C;  1KX4 A;  2YFW A;  5DNN D;  3AZH C;  3AZM A;  3B6G A;  2HUE C;  1P3F C;  3UTA D;  4J8X A;  5B31 A;  4KGC D;  5BS7 A;  4KUD A;  5B32 G;  3AZL B;  4JJN A;  2CV5 C;  1P3I C;  3B6F A;  3REI D;  5E5A C;  4J8V A;  3X1T A;  4H9P A;  5AVB B;  1EQZ B;  3REH C;  5GT0 A;  3VH6 A;  1P3K C;  5CPI A;  5CPJ D;  4ZUX C;  3MGP D;  2BYM B;  2NQB D;  1M1A C;  3MGS D;  1P34 A;  4H9O A;  5B0Y D;  3REL D;  2PYO A;  5GT3 A;  3UTA A;  3WTP E;  3O62 B;  4KGC A;  4NE3 A;  4KHA A;  1P3O C;  3LJA C;  3AZG C;  5AV9 D;  4WU9 A;  3C1B C;  1S32 C;  4WNN B;  1ID3 B;  2BYK A;  3VH6 W;  3AV2 A;  1F66 B;  4J8U C;  1ZLA C;  3WKJ A;  3TU4 A;  4Z66 D;  3LEL D;  1P3B B;  1B6W A;  1P3L D;  5FUG B;  1U35 A;  5CPJ B;  5DNM B;  1P3M D;  3WTP D;  5B0Y A;  3AZI B;  1P3G B;  4WU8 C;  4LD9 D;  3KXB B;  1P3P D;  3AZM C;  4YM6 B;  3WAA B;  5BT1 C;  5B31 C;  3AYW C;  3KWQ D;  3AZN A;  2NZD C;  3LZ1 A;  3X1U A;  5B33 D;  4JJN C;  3REK D;  3UT9 A;  5AY8 D;  3AFA D;  3B6F C;  4ZBJ C;  5GXQ C;  2YFV B;  3AZJ B;  2FJ7 B;  5B2J B;  3A6N C;  1P3M A;  2LY8 A;  5JA4 A;  5BO0 A;  3MGR A;  5DNN C;  3WTP B;  3REJ A;  3AN2 B;  1P34 C;  1P3P B;  3UTA C;  4EO5 B;  4R8P D;  1A7W A;  4KGC C;  3WA9 A;  5GSU D;  4J8W A;  2HIO D;  1KX5 A;  5AY8 A;  3AFA A;  3VH6 T;  4CSR A;  1P3K D;  5JRG D;  3REI C;  3AZK D;  3KSY A;  3AZF B;  2IO5 B;  2F8N B;  1TZY B;  3W97 A;  1P3A D;  3W96 B;  3AZH B;  1HQ3 D;  2HUE B;  1P3F B;  3MGP C;  2NQB C;  5B1L D;  3MGS C;  5B0Y C;  3REL C;  3MGQ D;  5B1M A;  3X1V D;  2CV5 B;  3R45 B;  4G91 C;  5GSU A;  2ARO D;  3KUY A;  1P3I B;  5E5A B;  3MVD D;  4H9Q A;  3LZ1 C;  4X23 D;  5AV9 C;  3REH B;  3X1S A;  1P3K B;  5AV6 D;  5F99 D;  1TAF B;  1P3A A;  4ZUX B;  4Z66 C;  3LZ0 D;  5B0Z D;  3LEL C;  1KX4 D;  1P3L C;  1M1A B;  3B6G D;  3W99 A;  1P3M C;  4LD9 C;  3MNN A;  4J8X D;  2F8N G;  4H9R B;  4KUD D;  1P3O B;  3LJA B;  4H9N B;  3AZG B;  5AVC A;  1S32 B;  3C1B B;  3MVD A;  3X1T D;  3KWQ C;  4J8V D;  1WWS A;  5B33 C;  4J8U B;  5B40 D;  4G92 C;  3REK C;  1ZLA B;  5AY8 C;  5GT0 D;  3AFA C;  5CPI D;  5B32 A;  5AV6 A;  5B0Z A;  1JFI B;  1HTA A;  3W97 C;  4HGA C;  4WU8 B;  1P34 D;  2PYO D;  5GT3 D;  3VH5 A;  4M6B A;  3AZM B;  4XZQ D;  4QLC A;  5CP6 A;  1N1J A;  4UUZ A;  5B31 B;  3AYW B;  2F8N K;  4R8P C;  2NZD B;  4JJN B;  5B2I D;  5GSU C;  4WU9 D;  3B6F B;  2HIO C;  4ZBJ B;  5GXQ B;  3AV2 D;  5B40 A;  3WKJ D;  4H9P B;  3C1C A;  3TU4 D;  3AZE D;  5BNX A;  5JRG C;  3AZK C;  1U35 D;  3A6N B;  1P3A C;  3VH5 W;  5DNN B;  1HQ3 C;  4Z2M H;  4XZQ A;  1P34 B;  3W99 C;  3UTA B;  3AZL A;  5B1L C;  4KGC B;  2CWE A;  3MGQ C; 
#chains in the Genus database with same CATH topology
 3X1V C;  4KHA B;  3AZN D;  3LZ1 D;  1WWI A;  5B2I A;  3X1U D;  2ARO C;  3UT9 D;  3REI B;  5AVC C;  3MVD C;  2BYK B;  3UTB D;  3AZE A;  4X23 C;  5B31 G;  1AOI D;  4XUJ D;  4Z2M G;  5C3I C;  5AV6 C;  5F99 C;  3W98 A;  4Z5T D;  3LZ0 C;  3MGP B;  5B0Z C;  1KX4 C;  3MGR D;  2NQB B;  3MGS B;  5B0Y B;  3REL B;  3REJ D;  3B6G C;  3AV1 D;  1T3U A;  5CP6 C;  4G91 B;  4J8X C;  5BS7 C;  3WA9 D;  4J8W D;  4KUD C;  4WNN A;  1ID3 A;  1KX5 D;  3LZ1 B;  3B0D C;  5AV9 B;  4J8V C;  3X1T C;  3UTB A;  1BH8 A;  5B40 C;  1AOI A;  3W97 D;  4XUJ A;  5GT0 C;  4Z66 B;  3C1C C;  5CPI C;  3LEL B;  3AZI A;  1P3L B;  4Z5T A;  3KXB A;  3VH5 T;  1P3M B;  4LD9 B;  5JA4 B;  5BO0 B;  3EPL A;  3AV1 A;  2PYO C;  1BH9 A;  5GT3 C;  5BNV A;  4XZQ C;  2RVQ D;  5B1M D;  3F6T A;  3KUY D;  1Z2C B;  1M18 A;  2YFV A;  3KWQ B;  3AZJ A;  1M19 D;  5B33 B;  5B2I C;  4G92 B;  3REK B;  5AY8 B;  3AFA B;  4WU9 C;  3X1S D;  2FJ7 A;  3AV2 C;  5B2J A;  3WKJ C;  3TU4 C;  3AZE C;  2Y2J A;  3W97 B;  4HGA B;  1U35 C;  3AN2 A;  5CPK D;  3W99 D;  3W98 C;  3MNN D;  4YS3 D;  1H3O B;  5KDM A;  4DRA A;  5G49 B;  4R8P B;  5AVC D;  2F8N H;  5GSU B;  1KX3 D;  2HIO B;  1M19 A;  3AZN C;  3AZF A;  3X1U C;  4H9Q B;  3UT9 C;  5JRG B;  5B32 D;  5B24 D;  3AZK B;  3UTB C;  5AV8 D;  1P3F A;  1AOI C;  1P3A B;  4XUJ C;  3NQJ A;  3P5J B;  4CAY B;  5CPK A;  1HQ3 B;  2XD5 A;  4Z5T C;  3MGR C;  4QLC D;  5CP6 D;  3W99 B;  3R45 A;  5B1L B;  2DQN C;  4YS3 A;  2BG1 A;  3REJ C;  3MGQ B;  3AV1 C;  5E5A A;  3X1V B;  2ARO B;  1KX3 A;  4J8W C;  3REH A;  5AV5 D;  3WA9 C;  5AVC B;  3H0R C;  1KX5 C;  1M18 C;  3MVD B;  1TAF A;  3C1C D;  4X23 B;  5B24 A;  4NE5 A;  1M1A A;  5AV8 A;  5C3I B;  5AV6 B;  5F99 B;  3V9R B;  3NQU B;  2Y2Q A;  3LZ0 B;  5B0Z B;  1KX4 B;  2YFW B;  4NFT A;  4H9R A;  3B6G B;  3AZL D;  5CP6 B;  4H9N A;  3EG5 B;  3LJA A;  4J8X B;  1S32 A;  4AWL C;  3C1B A;  4KUD B;  2RVQ C;  5B1M C;  4UUZ B;  5AVB D;  3IP4 C;  4J8U A;  3KUY C;  5AV5 A;  1EQZ D;  1ZLA A;  3B0D B;  5CHL B;  4J8V B;  3X1T B;  2DF4 C;  1M19 C;  5B40 B;  5GT0 B;  3C1C B;  3X1S C;  5CPI B;  3B0B A;  5BNX B;  3W98 D;  3O62 D;  4H9O B;  2PYO B;  5CPK C;  5GT3 B;  3AYW A;  4WZS B;  4XZQ B;  2NZD A;  3MNN C;  4DRB A;  4YS3 C;  4DQY B;  2G5I C;  4WJ3 C;  5GXQ A;  5AVB A;  2JSS A;  1B67 A;  1ID3 D;  1F66 D;  2F2A C;  1EQZ A;  5B2I B;  4WU9 B;  1KX3 C;  1P3B D;  3AV2 B;  2L5A A;  3A6N A;  2BYM A;  3WKJ B;  3TU4 B;  5DNM D;  4E45 A;  3AZE B;  3AZI D;  5B32 C;  5B24 C;  5DNN A;  1P3G D;  3KXB D;  1U35 B;  5AV8 C;  3O62 A;  3W98 B;  4YM6 D;  3WAA D;  4QLC C;  1M18 D;  1ULY A;  3REI A;  1F66 A;  3AZN B;  1BFM A;  3AZJ D;  3X1U B;  3UT9 B;  1F1E A;  5AV5 C;  1KU5 A;  1P3B A;  3A1K A;  5FUG A;  5CPJ A;  2FJ7 D;  2VQR A;  5B2J D;  3UTB B;  5DNM A;  1BH8 B;  3MGP A;  1P3G A;  1AOI B;  2NQB A;  4XUJ B;  3MGS A;  3REL A;  3AN2 D;  4Z5T B;  4YM6 A;  3WAA A;  3MGR B;  3REJ B;  2Y2I A;  3B0C W;  3AV1 B;  1BH9 B;  3AZL C;  5BNV B;  2XD1 A;  3WA9 B;  5AV9 A;  4J8W B;  1M18 B;  3AZF D;  5AVB C;  1KX5 B;  2F8N D;  1TZY D;  1EQZ C;  3FDD A;  4CSR B;  4Z66 A;  3LEL A;  3W96 D;  1P3L A;  3AZH D;  1P3F D;  2Y2L A;  4H9S A;  3WTP A;  4LD9 A;  1P3P A;  3O62 C;  2CV5 D;  3H0M C;  1P3I D;  4AWL B;  5B1M B;  5E5A D;  3KWQ A;  5KDM B;  5B33 A;  3KUY B;  3REK A;  3REH D;  1ID3 C;  1F66 C;  2F8N A;  1TZY A;  1M19 B;  4ZUX D;  3W96 A;  1P3B C;  3X1S B;  3AZH A;  1M1A D;  5CPJ C;  5DNM C;  3AZI C;  1Q9C A;  1P3G C;  2J8P A;  3KXB C;  1H3O A;  3NQJ B;  5CPK B;  2CV5 A;  5G49 A;  4R8P A;  3B0C T;  3WAA C;  4YM6 C;  3MNN B;  3LJA D;  3AZG D;  1P3I A;  1P3O D;  3EPJ A;  4YS3 B;  1S32 D;  3C1B D;  2HIO A;  4J8U D;  1ZLA D;  1P3K A;  5JRG A;  3EPH A;  1KX3 B;  3AZK A;  3AZJ C;  4ZUX A;  1R4V A;  2FJ7 C;  5B32 B;  5B24 B;  4CAY A;  4E44 A;  4WU8 D;  5B2J C;  1HQ3 A;  5AV8 B;  3AZM D;  5B1L A;  4H9S C;  3WTP C;  5BT1 D;  3AN2 C;  3MGQ A;  5B31 D;  3AYW D;  1P3P C;  2G5H C;  3X1V A;  1P3O A;  4EO5 C;  4QLC B;  3AZG A;  2NZD D;  4JJN D;  2ARO A;  3B6F D;  1N1J B;  5GXQ D;  4X23 A;  2ZY2 A;  5AV5 B;  3AZF C;  2IO5 C;  1JFI A;  1TZY C;  5F99 A;  3V9R A;  3A6N D;  4NE6 A;  3NQU A;  4WV4 B;  3LZ0 A;  4WU8 A;  3W96 C;  1KX4 A;  2YFW A;  5DNN D;  3AZH C;  3AZM A;  3B6G A;  2HUE C;  1P3F C;  3UTA D;  4J8X A;  5B31 A;  4KGC D;  5BS7 A;  4KUD A;  2FFF B;  5B32 G;  4JJN A;  3AZL B;  2CV5 C;  1P3I C;  2W8S A;  3B6F A;  3REI D;  2ZY5 A;  2Y2K A;  5E5A C;  4J8V A;  3X1T A;  4H9P A;  5AVB B;  1EQZ B;  3REH C;  5GT0 A;  3VH6 A;  1P3K C;  5CPI A;  5CPJ D;  4ZUX C;  3MGP D;  2BYM B;  2NQB D;  1M1A C;  3MGS D;  1P34 A;  4H9O A;  5B0Y D;  3REL D;  2PYO A;  5GT3 A;  3UTA A;  3WTP E;  3O62 B;  4KGC A;  4NE3 A;  4KHA A;  1P3O C;  3LJA C;  3AZG C;  5AV9 D;  4WU9 A;  3C1B C;  1S32 C;  4WNN B;  1ID3 B;  2BYK A;  3VH6 W;  3AV2 A;  1F66 B;  4J8U C;  1ZLA C;  3WKJ A;  3TU4 A;  4Z66 D;  3LEL D;  1P3B B;  1B6W A;  3H0L C;  1P3L D;  5FUG B;  1U35 A;  5CPJ B;  5DNM B;  1P3M D;  3WTP D;  5B0Y A;  3AZI B;  1P3G B;  4WU8 C;  4LD9 D;  3KXB B;  1P3P D;  3AZM C;  4YM6 B;  3WAA B;  5BT1 C;  5B31 C;  3AYW C;  3KWQ D;  2Y2H A;  3AZN A;  2NZD C;  3LZ1 A;  3X1U A;  5B33 D;  4JJN C;  3REK D;  3UT9 A;  2ZM5 A;  2Y2M A;  5AY8 D;  3AFA D;  3B6F C;  4ZBJ C;  5GXQ C;  2YFV B;  3AZJ B;  2FJ7 B;  5B2J B;  3A6N C;  1P3M A;  2LY8 A;  5JA4 A;  5BO0 A;  3MGR A;  5DNN C;  3WTP B;  3REJ A;  3AN2 B;  1P34 C;  1P3P B;  3UTA C;  4EO5 B;  4R8P D;  1A7W A;  4KGC C;  3WA9 A;  5GSU D;  4J8W A;  2HIO D;  1KX5 A;  5AY8 A;  3AFA A;  3VH6 T;  4CSR A;  1P3K D;  5JRG D;  3REI C;  3AZK D;  3KSY A;  3AZF B;  2IO5 B;  2F8N B;  1TZY B;  3W97 A;  1P3A D;  3W96 B;  3AZH B;  1HQ3 D;  2HUE B;  1P3F B;  3MGP C;  2NQB C;  2JE5 A;  5B1L D;  3MGS C;  5B0Y C;  3REL C;  3MGQ D;  5B1M A;  3X1V D;  2CV5 B;  3R45 B;  4G91 C;  5GSU A;  2ARO D;  3KUY A;  1P3I B;  2Y2N A;  5E5A B;  3MVD D;  4H9Q A;  3LZ1 C;  4X23 D;  5AV9 C;  3REH B;  3X1S A;  1P3K B;  5AV6 D;  5F99 D;  1TAF B;  1P3A A;  4ZUX B;  4Z66 C;  3LZ0 D;  5B0Z D;  3LEL C;  1KX4 D;  3KFU G;  1P3L C;  1M1A B;  3B6G D;  3W99 A;  1P3M C;  4LD9 C;  3EPK A;  3MNN A;  4J8X D;  3A1I A;  2F8N G;  4H9R B;  4KUD D;  1P3O B;  3LJA B;  4H9N B;  3AZG B;  5AVC A;  1S32 B;  3C1B B;  2ZY3 A;  3MVD A;  2Y2O A;  3X1T D;  3KWQ C;  4J8V D;  1WWS A;  5B33 C;  4J8U B;  5B40 D;  4G92 C;  3REK C;  1ZLA B;  5AY8 C;  5GT0 D;  3AFA C;  5CPI D;  5B32 A;  5AV6 A;  2Y2P A;  5B0Z A;  1JFI B;  1HTA A;  3W97 C;  1W2E A;  4HGA C;  4WU8 B;  1P34 D;  2PYO D;  5GT3 D;  3VH5 A;  4M6B A;  3AZM B;  4XZQ D;  4QLC A;  5CP6 A;  1N1J A;  4UUZ A;  5B31 B;  3AYW B;  2RIQ A;  2F8N K;  4R8P C;  2NZD B;  4JJN B;  5B2I D;  5GSU C;  4WU9 D;  3B6F B;  2HIO C;  4ZBJ B;  5GXQ B;  3AV2 D;  5B40 A;  3WKJ D;  4H9P B;  3C1C A;  3TU4 D;  2Y2G A;  3AZE D;  5BNX A;  5JRG C;  2UWX A;  3AZK C;  1U35 D;  1PZR A;  3A6N B;  1P3A C;  3VH5 W;  2JCH A;  5DNN B;  4UPK A;  3AL0 C;  1HQ3 C;  4Z2M H;  4XZQ A;  1P34 B;  3W99 C;  3UTA B;  3AZL A;  5B1L C;  2ZY4 A;  4KGC B;  2CWE A;  3MGQ C; 
#chains in the Genus database with same CATH homology
 3X1V C;  4KHA B;  3AZN D;  3LZ1 D;  1WWI A;  5B2I A;  3X1U D;  2ARO C;  3UT9 D;  3REI B;  5AVC C;  3MVD C;  2BYK B;  3UTB D;  3AZE A;  4X23 C;  5B31 G;  1AOI D;  4XUJ D;  4Z2M G;  5C3I C;  5AV6 C;  5F99 C;  3W98 A;  4Z5T D;  3LZ0 C;  3MGP B;  5B0Z C;  1KX4 C;  3MGR D;  2NQB B;  3MGS B;  5B0Y B;  3REL B;  3REJ D;  3B6G C;  3AV1 D;  1T3U A;  5CP6 C;  4G91 B;  4J8X C;  5BS7 C;  3WA9 D;  4J8W D;  4KUD C;  4WNN A;  1ID3 A;  1KX5 D;  3LZ1 B;  3B0D C;  5AV9 B;  4J8V C;  3X1T C;  3UTB A;  1BH8 A;  5B40 C;  1AOI A;  3W97 D;  4XUJ A;  5GT0 C;  4Z66 B;  3C1C C;  5CPI C;  3LEL B;  3AZI A;  1P3L B;  4Z5T A;  3KXB A;  3VH5 T;  1P3M B;  4LD9 B;  5JA4 B;  5BO0 B;  3EPL A;  3AV1 A;  2PYO C;  1BH9 A;  5GT3 C;  5BNV A;  4XZQ C;  2RVQ D;  5B1M D;  3F6T A;  3KUY D;  1Z2C B;  1M18 A;  2YFV A;  3KWQ B;  3AZJ A;  1M19 D;  5B33 B;  5B2I C;  4G92 B;  3REK B;  5AY8 B;  3AFA B;  4WU9 C;  3X1S D;  2FJ7 A;  3AV2 C;  5B2J A;  3WKJ C;  3TU4 C;  3AZE C;  2Y2J A;  3W97 B;  4HGA B;  1U35 C;  3AN2 A;  5CPK D;  3W99 D;  3W98 C;  3MNN D;  4YS3 D;  1H3O B;  5KDM A;  4DRA A;  5G49 B;  4R8P B;  5AVC D;  2F8N H;  5GSU B;  1KX3 D;  2HIO B;  1M19 A;  3AZN C;  3AZF A;  3X1U C;  4H9Q B;  3UT9 C;  5JRG B;  5B32 D;  5B24 D;  3AZK B;  3UTB C;  5AV8 D;  1P3F A;  1AOI C;  1P3A B;  4XUJ C;  3NQJ A;  3P5J B;  4CAY B;  5CPK A;  1HQ3 B;  2XD5 A;  4Z5T C;  3MGR C;  4QLC D;  5CP6 D;  3W99 B;  3R45 A;  5B1L B;  2DQN C;  4YS3 A;  2BG1 A;  3REJ C;  3MGQ B;  3AV1 C;  5E5A A;  3X1V B;  2ARO B;  1KX3 A;  4J8W C;  3REH A;  5AV5 D;  3WA9 C;  5AVC B;  3H0R C;  1KX5 C;  1M18 C;  3MVD B;  1TAF A;  3C1C D;  4X23 B;  5B24 A;  4NE5 A;  1M1A A;  5AV8 A;  5C3I B;  5AV6 B;  5F99 B;  3V9R B;  3NQU B;  2Y2Q A;  3LZ0 B;  5B0Z B;  1KX4 B;  2YFW B;  4NFT A;  4H9R A;  3B6G B;  3AZL D;  5CP6 B;  4H9N A;  3EG5 B;  3LJA A;  4J8X B;  1S32 A;  4AWL C;  3C1B A;  4KUD B;  2RVQ C;  5B1M C;  4UUZ B;  5AVB D;  3IP4 C;  4J8U A;  3KUY C;  5AV5 A;  1EQZ D;  1ZLA A;  3B0D B;  5CHL B;  4J8V B;  3X1T B;  2DF4 C;  1M19 C;  5B40 B;  5GT0 B;  3C1C B;  3X1S C;  5CPI B;  3B0B A;  5BNX B;  3W98 D;  3O62 D;  4H9O B;  2PYO B;  5CPK C;  5GT3 B;  3AYW A;  4WZS B;  4XZQ B;  2NZD A;  3MNN C;  4DRB A;  4YS3 C;  4DQY B;  2G5I C;  4WJ3 C;  5GXQ A;  5AVB A;  2JSS A;  1B67 A;  1ID3 D;  1F66 D;  2F2A C;  1EQZ A;  5B2I B;  4WU9 B;  1KX3 C;  1P3B D;  3AV2 B;  2L5A A;  3A6N A;  2BYM A;  3WKJ B;  3TU4 B;  5DNM D;  4E45 A;  3AZE B;  3AZI D;  5B32 C;  5B24 C;  5DNN A;  1P3G D;  3KXB D;  1U35 B;  5AV8 C;  3O62 A;  3W98 B;  4YM6 D;  3WAA D;  4QLC C;  1M18 D;  1ULY A;  3REI A;  1F66 A;  3AZN B;  1BFM A;  3AZJ D;  3X1U B;  3UT9 B;  1F1E A;  5AV5 C;  1KU5 A;  1P3B A;  3A1K A;  5FUG A;  5CPJ A;  2FJ7 D;  2VQR A;  5B2J D;  3UTB B;  5DNM A;  1BH8 B;  3MGP A;  1P3G A;  1AOI B;  2NQB A;  4XUJ B;  3MGS A;  3REL A;  3AN2 D;  4Z5T B;  4YM6 A;  3WAA A;  3MGR B;  3REJ B;  2Y2I A;  3B0C W;  3AV1 B;  1BH9 B;  3AZL C;  5BNV B;  2XD1 A;  3WA9 B;  5AV9 A;  4J8W B;  1M18 B;  3AZF D;  5AVB C;  1KX5 B;  2F8N D;  1TZY D;  1EQZ C;  3FDD A;  4CSR B;  4Z66 A;  3LEL A;  3W96 D;  1P3L A;  3AZH D;  1P3F D;  2Y2L A;  4H9S A;  3WTP A;  4LD9 A;  1P3P A;  3O62 C;  2CV5 D;  3H0M C;  1P3I D;  4AWL B;  5B1M B;  5E5A D;  3KWQ A;  5KDM B;  5B33 A;  3KUY B;  3REK A;  3REH D;  1ID3 C;  1F66 C;  2F8N A;  1TZY A;  1M19 B;  4ZUX D;  3W96 A;  1P3B C;  3X1S B;  3AZH A;  1M1A D;  5CPJ C;  5DNM C;  3AZI C;  1Q9C A;  1P3G C;  2J8P A;  3KXB C;  1H3O A;  3NQJ B;  5CPK B;  2CV5 A;  5G49 A;  4R8P A;  3B0C T;  3WAA C;  4YM6 C;  3MNN B;  3LJA D;  3AZG D;  1P3I A;  1P3O D;  3EPJ A;  4YS3 B;  1S32 D;  3C1B D;  2HIO A;  4J8U D;  1ZLA D;  1P3K A;  5JRG A;  3EPH A;  1KX3 B;  3AZK A;  3AZJ C;  4ZUX A;  1R4V A;  2FJ7 C;  5B32 B;  5B24 B;  4CAY A;  4E44 A;  4WU8 D;  5B2J C;  1HQ3 A;  5AV8 B;  3AZM D;  5B1L A;  4H9S C;  3WTP C;  5BT1 D;  3AN2 C;  3MGQ A;  5B31 D;  3AYW D;  1P3P C;  2G5H C;  3X1V A;  1P3O A;  4EO5 C;  4QLC B;  3AZG A;  2NZD D;  4JJN D;  2ARO A;  3B6F D;  1N1J B;  5GXQ D;  4X23 A;  2ZY2 A;  5AV5 B;  3AZF C;  2IO5 C;  1JFI A;  1TZY C;  5F99 A;  3V9R A;  3A6N D;  4NE6 A;  3NQU A;  4WV4 B;  3LZ0 A;  4WU8 A;  3W96 C;  1KX4 A;  2YFW A;  5DNN D;  3AZH C;  3AZM A;  3B6G A;  2HUE C;  1P3F C;  3UTA D;  4J8X A;  5B31 A;  4KGC D;  5BS7 A;  4KUD A;  2FFF B;  5B32 G;  4JJN A;  3AZL B;  2CV5 C;  1P3I C;  2W8S A;  3B6F A;  3REI D;  2ZY5 A;  2Y2K A;  5E5A C;  4J8V A;  3X1T A;  4H9P A;  5AVB B;  1EQZ B;  3REH C;  5GT0 A;  3VH6 A;  1P3K C;  5CPI A;  5CPJ D;  4ZUX C;  3MGP D;  2BYM B;  2NQB D;  1M1A C;  3MGS D;  1P34 A;  4H9O A;  5B0Y D;  3REL D;  2PYO A;  5GT3 A;  3UTA A;  3WTP E;  3O62 B;  4KGC A;  4NE3 A;  4KHA A;  1P3O C;  3LJA C;  3AZG C;  5AV9 D;  4WU9 A;  3C1B C;  1S32 C;  4WNN B;  1ID3 B;  2BYK A;  3VH6 W;  3AV2 A;  1F66 B;  4J8U C;  1ZLA C;  3WKJ A;  3TU4 A;  4Z66 D;  3LEL D;  1P3B B;  1B6W A;  3H0L C;  1P3L D;  5FUG B;  1U35 A;  5CPJ B;  5DNM B;  1P3M D;  3WTP D;  5B0Y A;  3AZI B;  1P3G B;  4WU8 C;  4LD9 D;  3KXB B;  1P3P D;  3AZM C;  4YM6 B;  3WAA B;  5BT1 C;  5B31 C;  3AYW C;  3KWQ D;  2Y2H A;  3AZN A;  2NZD C;  3LZ1 A;  3X1U A;  5B33 D;  4JJN C;  3REK D;  3UT9 A;  2ZM5 A;  2Y2M A;  5AY8 D;  3AFA D;  3B6F C;  4ZBJ C;  5GXQ C;  2YFV B;  3AZJ B;  2FJ7 B;  5B2J B;  3A6N C;  1P3M A;  2LY8 A;  5JA4 A;  5BO0 A;  3MGR A;  5DNN C;  3WTP B;  3REJ A;  3AN2 B;  1P34 C;  1P3P B;  3UTA C;  4EO5 B;  4R8P D;  1A7W A;  4KGC C;  3WA9 A;  5GSU D;  4J8W A;  2HIO D;  1KX5 A;  5AY8 A;  3AFA A;  3VH6 T;  4CSR A;  1P3K D;  5JRG D;  3REI C;  3AZK D;  3KSY A;  3AZF B;  2IO5 B;  2F8N B;  1TZY B;  3W97 A;  1P3A D;  3W96 B;  3AZH B;  1HQ3 D;  2HUE B;  1P3F B;  3MGP C;  2NQB C;  2JE5 A;  5B1L D;  3MGS C;  5B0Y C;  3REL C;  3MGQ D;  5B1M A;  3X1V D;  2CV5 B;  3R45 B;  4G91 C;  5GSU A;  2ARO D;  3KUY A;  1P3I B;  2Y2N A;  5E5A B;  3MVD D;  4H9Q A;  3LZ1 C;  4X23 D;  5AV9 C;  3REH B;  3X1S A;  1P3K B;  5AV6 D;  5F99 D;  1TAF B;  1P3A A;  4ZUX B;  4Z66 C;  3LZ0 D;  5B0Z D;  3LEL C;  1KX4 D;  3KFU G;  1P3L C;  1M1A B;  3B6G D;  3W99 A;  1P3M C;  4LD9 C;  3EPK A;  3MNN A;  4J8X D;  3A1I A;  2F8N G;  4H9R B;  4KUD D;  1P3O B;  3LJA B;  4H9N B;  3AZG B;  5AVC A;  1S32 B;  3C1B B;  2ZY3 A;  3MVD A;  2Y2O A;  3X1T D;  3KWQ C;  4J8V D;  1WWS A;  5B33 C;  4J8U B;  5B40 D;  4G92 C;  3REK C;  1ZLA B;  5AY8 C;  5GT0 D;  3AFA C;  5CPI D;  5B32 A;  5AV6 A;  2Y2P A;  5B0Z A;  1JFI B;  1HTA A;  3W97 C;  1W2E A;  4HGA C;  4WU8 B;  1P34 D;  2PYO D;  5GT3 D;  3VH5 A;  4M6B A;  3AZM B;  4XZQ D;  4QLC A;  5CP6 A;  1N1J A;  4UUZ A;  5B31 B;  3AYW B;  2RIQ A;  2F8N K;  4R8P C;  2NZD B;  4JJN B;  5B2I D;  5GSU C;  4WU9 D;  3B6F B;  2HIO C;  4ZBJ B;  5GXQ B;  3AV2 D;  5B40 A;  3WKJ D;  4H9P B;  3C1C A;  3TU4 D;  2Y2G A;  3AZE D;  5BNX A;  5JRG C;  2UWX A;  3AZK C;  1U35 D;  1PZR A;  3A6N B;  1P3A C;  3VH5 W;  2JCH A;  5DNN B;  4UPK A;  3AL0 C;  1HQ3 C;  4Z2M H;  4XZQ A;  1P34 B;  3W99 C;  3UTA B;  3AZL A;  5B1L C;  2ZY4 A;  4KGC B;  2CWE A;  3MGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...