4J8VD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vD00
3WTPC 4KGCD 4R8PC 3W97B 1P3IC 3NQUB 4CAYB 3AFAC 1ULYA 1ID3A 3RELD 3W96A 1P3OC 1ZLAD 3WAAA 5AV5D 3LELD 3WA9D 5GT0A 4M6BA 4NE5A 2YFVB 1M19A 4QLCB 4J8WB 4H9PB 3LJAC 3KWQD 5B1MB 1P3KA 1HQ3C 1P3MC 5AVCD 1P3BA 5F99D 4HGAB 3C1CD 1F66C 3KXBA 4G92B 2PYOA 1P3AD 2JSSA 1WWIA 4E45A 3X1SD 2FJ7B 1P3LB 3AYWD 4J8VB 5E5AD 1P3FD 5G49A 5CPJC 4H9QB 3W98A 3AZNA 1H3OB 4ZBJC 5GSUB 5CP6D 2CV5A 5B31C 3MNNC 4J8UB 1A7WA 1P3ID 1M18B 1P3OD 2F8NK 3A6NB 1P3PC 3B6GC 4ZUXB 2BYKA 1P34C 4JJND 4AWLB 3MGRB 2NZDA 4E44A 3MGPC 5B0ZC 1B67A 4H9NA 5CPIB 1P3GD 3AZEA 3W99C 5GT0B 3LJAD 3UT9C 3VH5A 3REKA 1M19B 1HQ3D 1KX3D 4XZQB 5BNVA 1EQZD 3WKJC 3MVDB 4KGCA 4WU8D 4KUDB 1P3KB 2YFWA 3AZLA 3RELA 3MGSB 3AN2A 5B40C 1U35C 4YS3C 3WA9A 1KX4B 3X1UC 3REHD 5B32G 4Z5TC 4WZSB 3TU4C 3AZID 3MNND 3AZMD 3AZGC 5G49B 2AROC 1P3PD 3AZKA 5DNND 5B32D 3AZNB 4WU9C 3W98B 1S32C 5B1LD 2CV5B 1P34D 5AVBD 4Z66A 3C1CA 4XUJB 5B0ZD 1P3BC 4KHAA 3R45A 3W99D 1R4VA 3KXBC 3O62B 3X1SA 5DNMB 2IO5C 5E5AA 1P3FA 4H9NB 3VH5W 5B24A 1KU5A 3WKJD 4WV4B 2HIOB 4G91C 2HUEB 5B2JC 1JFIB 2LY8A 5BNVB 4X23D 3MGQC 5AY8D 3AZHC 1U35D 2YFVA 4KGCB 4JJNA 4QLCA 3B0CW 3RELB 2NQBD 1ZLAB 5AV5B 3LELB 3TU4D 5B1MA 1P3GA 3WA9B 5KDMB 3AZGD 2AROD 4YM6C 4WU9D 5AV6D 3UTBD 1KX3A 1EQZA 4WU8A 5JRGD 3KWQB 3REIC 1TZYC 5GXQD 2FJ7A 1AOIC 5AVCB 3X1VD 4DRAA 3REJC 5F99B 3REHA 1H3OA 1HTAA 3C1CB 4J8UA 3X1SB 3AZIA 5AV9D 3AZFC 5GT3D 5E5AB 2CWEA 3KUYC 3UTAC 1P3FB 5B24B 5DNNA 5B32A 3MGRA 3MGQD 1KX5C 3AV1C 5B1LA 5BT1D 5CP6B 5AV8D 5AVBA 5CPIA 4Z2MG 1P3IB 5B2IC 4Z66C 1P3OB 1M1AC 5B33D 5B0YA 4JJNB 4XZQA 4YM6D 3B6FD 3MVDA 4KUDA 3LZ1C 1P3GB 3W97C 3MGSA 3LJAB 3X1TD 1TZYD 1KX4A 1HQ3B 1AOID 4LD9C 2F8NG 1KX3B 4X23A 1EQZB 5AY8A 3REJD 4WU8B 3C1BD 2NQBA 2F8ND 4QLCC 4J8WC 3AZFD 3REHB 3WTPD 4R8PD 3AZJC 3AFAD 1KX5D 3AV1D 5AV6A 3UTBA 3AZIB 1B6WA 4XUJA 4HGAC 3MNNB 3AZMB 5B2ID 5JRGA 4G92C 3O62A 3LZ0C 1P3PB 5DNNB 5B32B 5B1LB 5DNMA 5CPKC 1P34B 3X1VA 1P3LC 5AVBB 4J8VC 2HIOA 5B0ZB 4J8XC 3LZ1D 5GSUC 5B0YB 1P3MD 5AV9A 1JFIA 1M18C 5GT3A 3AV2C 3A6NC 4LD9D 4ZUXC 1F66D 3MGRC 1ZLAA 1BH9A 5AV8A 5AV5A 3LELA 1ID3C 3W96C 3WAAC 5KDMA 5B31G 4X23B 1U35B 5GT0C 5AY8B 5B33A 4NE6A 5CPJD 4H9RA 3NQJA 3AZJD 5B31D 1M19C 3B6FA 2NQBB 1Q9CA 4XZQC 3KWQA 3TU4B 3B6GD 4NFTA 5AVCA 1P3KC 3X1TA 2AROB 3LZ0D 5F99A 4WU9B 5AV6B 3UTBB 3MGPD 5CPKD 1P3AA 5JRGB 2PYOC 3C1BA 5GXQB 3V9RA 4J8XD 3UT9D 3AYWA 3X1VB 3AV2D 3WTPA 5CP6A 4R8PA 3W98C 3AZNC 1P3IA 3AFAA 2CV5C 4G91B 1P3OA 5AV9B 5B40D 5GT3B 1ID3D 4YS3D 3W96D 4H9SA 3WAAD 3X1UD 3MGQB 3O62C 2NZDC 1BH9B 1TAFB 5AV8B 4Z5TD 3B0DC 5FUGA 3VH6T 3AZEC 3LJAA 5B33B 4H9RB 2HUEC 1HQ3A 1S32D 1P3KD 3NQJB 3REKC 4YM6B 3B6FB 1P3BD 1F66A 4KGCC 3KXBD 3AZLC 3X1TB 2PYOD 2RVQC 3RELC 1TZYB 3VH6A 3AN2C 1AOIB 3LELC 5C3IB 3WA9C 3REJB 1P3AB 3C1BB 3V9RB 5B31A 3MNNA 3AYWB 3AZMA 2F8NB 4UUZB 5B2JD 3AZFB 1P3PA 4EO5C 3AZHD 3WTPB 3AZKC 4R8PB 1P34A 3AFAB 1KX5B 3AV1B 3MGPA 5B0ZA 2NZDD 3C1CC 3W99A 5B2IB 3AZED 3X1SC 5E5AC 3REKD 3WKJA 1P3FC 5B24C 5FUGB 4Z2MH 3REID 3LZ1B 5CP6C 1P3MB 5B40A 3AZLD 2RVQD 1U35A 4YS3A 1BH8B 3AN2D 3X1UA 4LD9B 3VH6W 1F66B 4H9SC 4JJNC 1N1JA 4H9OB 4Z5TA 3TU4A 3AZGA 5B1MC 3KUYD 3UTAD 1P3GC 2AROA 1F1EA 5CPJB 4WU9A 2F8NH 4ZBJB 1S32A 3AZKD 3AZJB 5B31B 1KX3C 1EQZC 4Z66D 3B6GB 1M1AD 5GXQA 4WU8C 2FJ7C 3LZ0B 3MGPB 5CPKB 5BS7A 3REHC 3W99B 3B0BA 3W97D 5B24D 4J8UC 3UT9B 4J8XB 3AZIC 4WNNB 5B2JA 3AZMC 5BNXB 3AZHA 3MGQA 3WKJB 3KSYA 3VH5T 4AWLC 3AV2B 5DNNC 5B32C 1TAFA 5B1LC 5AVBC 5CPIC 4QLCD 5B40B 4J8WD 1ID3B 4YS3B 3W96B 3WAAB 1BFMA 3X1UB 3WTPE 5B1MD 4CSRA 5B0YC 4YM6A 1N1JB 3B0CT 4Z5TB 5BO0A 3MVDC 3AZGB 4KUDC 3REIA 1TZYA 3MGSC 1S32B 1AOIA 1KX4C 1P3LD 2FJ7D 2BYMA 3REJA 4J8VD 4X23C 5AY8C 1P3BB 5GSUD 2F8NA 3KXBB 2PYOB 4UUZA 4J8UD 3AZFA 2NQBC 1M18D 2IO5B 3KUYA 3A6ND 3UTAA 4ZUXD 1KX5A 3AV1A 3MGRD 5AV6C 3UTBC 5JA4A 4XUJC 5B2IA 5CPID 5B2JB 1M1AA 3AZHB 5JRGC 5GT0D 5GXQC 5DNMC 2BYKB 5B0YD 3X1VC 1M19D 2NZDB 4XZQD 2HIOC 3B0DB 3LZ1A 3MVDD 5BS7C 3W97A 4KUDD 1P3MA 3AZEB 3NQUA 4CAYA 4CSRB 3MGSD 5AV9C 1BH8A 4LD9A 5GT3C 3REKB 5BO0B 1KX4D 4H9OA 3REIB 5BT1C 1ZLAC 5AV8C 5AV5C 2YFWB 3AZLB 4J8WA 2BYMB 4H9PA 3AN2B 5CPJA 4NE3A 5B33C 3AZJA 1WWSA 3AZND 3W98D 2CV5D 3B6GA 3B6FC 3KWQC 5CHLB 4XUJD 3KUYB 3UTAB 3LZ0A 4EO5B 2L5AA 5AVCC 3X1TC 3O62D 3AZKB 5CPKA 5F99C 1P3LA 5DNMD 4J8VA 5C3IC 5JA4B 4Z66B 1M1AB 1P3AC 4H9QA 3UT9A 4J8XA 2HIOD 5GSUA 3C1BC 4KHAB 3R45B 4WNNA 3AYWC 5BNXA 1M18A 4DRBA 3AV2A 3A6NA 4ZUXA
chains in the Genus database with same CATH superfamily
3WTPC 4KGCD 4R8PC 3W97B 3AL0C 1P3IC 3NQUB 4CAYB 3AFAC 1ULYA 1ID3A 3RELD 2DF4C 3W96A 1P3OC 1ZLAD 3WAAA 5AV5D 3LELD 3WA9D 5GT0A 4M6BA 4NE5A 2YFVB 1M19A 4QLCB 4J8WB 4H9PB 3LJAC 3KWQD 5B1MB 1P3KA 1HQ3C 1P3MC 5AVCD 3P5JB 1P3BA 5F99D 4HGAB 3C1CD 1F66C 3KXBA 4G92B 2PYOA 1P3AD 2JSSA 1WWIA 4E45A 3X1SD 2FJ7B 1P3LB 3AYWD 4J8VB 5E5AD 1P3FD 5G49A 4DQYB 2Y2NA 4H9QB 5CPJC 3AZNA 3W98A 1H3OB 4ZBJC 5GSUB 5CP6D 2CV5A 2ZY2A 5B31C 3MNNC 4J8UB 1A7WA 1P3ID 1M18B 1P3OD 2F8NK 3A6NB 1P3PC 3B6GC 4ZUXB 2BYKA 1P34C 4JJND 4AWLB 3MGRB 2NZDA 3EG5B 1PZRA 4E44A 3MGPC 5B0ZC 1B67A 4H9NA 2ZM5A 5CPIB 1P3GD 3AZEA 3W99C 5GT0B 3LJAD 3UT9C 3VH5A 3REKA 2W8SA 2Y2MA 1HQ3D 1M19B 2XD1A 1KX3D 4XZQB 5BNVA 1EQZD 3WKJC 3MVDB 4KGCA 4WU8D 4KUDB 1P3KB 2YFWA 3AZLA 3RELA 3MGSB 3AN2A 5B40C 1U35C 4YS3C 3WA9A 1KX4B 3X1UC 3REHD 5B32G 4Z5TC 4WZSB 3TU4C 3AZID 3MNND 3AZMD 3AZGC 5G49B 2AROC 1P3PD 3AZKA 5DNND 5B32D 3AZNB 4WU9C 3W98B 1S32C 5B1LD 2CV5B 1P34D 3KFUG 5AVBD 4Z66A 4UPKA 2Y2PA 3C1CA 4XUJB 5B0ZD 1P3BC 4KHAA 3R45A 3W99D 1R4VA 3KXBC 3O62B 3X1SA 2Y2HA 5DNMB 2IO5C 5E5AA 1P3FA 4H9NB 3VH5W 5B24A 1KU5A 3WKJD 4WV4B 2HIOB 4G91C 2HUEB 5B2JC 1JFIB 2LY8A 5BNVB 4X23D 3MGQC 5AY8D 3AZHC 1U35D 2YFVA 4KGCB 4JJNA 2J8PA 4QLCA 3B0CW 3RELB 2NQBD 1ZLAB 5AV5B 3LELB 3TU4D 5B1MA 1P3GA 3WA9B 5KDMB 3AZGD 3A1KA 2AROD 4YM6C 4WU9D 5AV6D 3UTBD 1KX3A 2ZY5A 1EQZA 2Y2QA 4WU8A 5JRGD 2G5HC 3KWQB 3REIC 1TZYC 5GXQD 2FJ7A 1AOIC 5AVCB 3X1VD 4DRAA 3REJC 5F99B 3REHA 1H3OA 1HTAA 3C1CB 3F6TA 4J8UA 3X1SB 3AZIA 5AV9D 3AZFC 5GT3D 5E5AB 2CWEA 3KUYC 3UTAC 1P3FB 5B24B 5DNNA 5B32A 3MGRA 3MGQD 1KX5C 3AV1C 5B1LA 5BT1D 5CP6B 5AV8D 5AVBA 5CPIA 4Z2MG 1P3IB 5B2IC 4Z66C 1P3OB 1M1AC 5B33D 5B0YA 4JJNB 4XZQA 4YM6D 3B6FD 3MVDA 4KUDA 3LZ1C 1P3GB 3W97C 3MGSA 3LJAB 3X1TD 1TZYD 1KX4A 1HQ3B 1AOID 4LD9C 2F8NG 1KX3B 4X23A 1EQZB 5AY8A 3REJD 4WU8B 3C1BD 2NQBA 2F8ND 4QLCC 4J8WC 3AZFD 3REHB 3WTPD 4R8PD 3AZJC 2VQRA 2Y2OA 3AFAD 2Y2JA 1KX5D 3AV1D 5AV6A 3UTBA 3AZIB 1B6WA 4XUJA 4HGAC 3MNNB 3AZMB 5B2ID 5JRGA 4G92C 3O62A 3LZ0C 1P3PB 5DNNB 5B32B 5B1LB 5DNMA 5CPKC 1P34B 3X1VA 1P3LC 5AVBB 4J8VC 2HIOA 5B0ZB 4J8XC 3LZ1D 5GSUC 5B0YB 1P3MD 5AV9A 1JFIA 1M18C 5GT3A 3AV2C 3A6NC 4LD9D 4ZUXC 1F66D 4WJ3C 2DQNC 3MGRC 1ZLAA 1BH9A 3IP4C 5AV8A 5AV5A 3LELA 1ID3C 3W96C 3WAAC 5KDMA 5B31G 4X23B 1U35B 5AY8B 5GT0C 5B33A 4NE6A 5CPJD 4H9RA 2F2AC 3NQJA 3AZJD 2FFFB 5B31D 2JCHA 1M19C 3B6FA 2NQBB 1Q9CA 4XZQC 3KWQA 3TU4B 3A1IA 3B6GD 4NFTA 5AVCA 1P3KC 3X1TA 2AROB 3LZ0D 5F99A 4WU9B 5AV6B 3UTBB 2RIQA 3MGPD 5CPKD 1P3AA 5JRGB 2PYOC 3H0LC 3C1BA 5GXQB 3V9RA 4J8XD 3UT9D 3AYWA 3H0MC 3X1VB 3AV2D 3WTPA 5CP6A 4R8PA 3W98C 3AZNC 1P3IA 3AFAA 2CV5C 2Y2GA 4G91B 1P3OA 5AV9B 5B40D 5GT3B 3EPJA 1ID3D 4YS3D 3W96D 4H9SA 3WAAD 3X1UD 2ZY3A 3MGQB 3O62C 2NZDC 1BH9B 1TAFB 5AV8B 4Z5TD 3EPLA 3B0DC 1W2EA 3EPHA 1Z2CB 5FUGA 3VH6T 3AZEC 3LJAA 5B33B 4H9RB 2HUEC 1HQ3A 1S32D 1P3KD 3NQJB 3REKC 4YM6B 3B6FB 1P3BD 1F66A 4KGCC 3KXBD 3AZLC 3X1TB 2PYOD 2RVQC 3RELC 1TZYB 3VH6A 3AN2C 1T3UA 1AOIB 3LELC 5C3IB 3WA9C 3REJB 1P3AB 3C1BB 3V9RB 5B31A 3MNNA 3AYWB 3AZMA 2F8NB 4UUZB 5B2JD 3AZFB 1P3PA 4EO5C 3AZHD 3WTPB 3AZKC 4R8PB 1P34A 3AFAB 1KX5B 3AV1B 3MGPA 5B0ZA 2NZDD 2Y2IA 3C1CC 3W99A 5B2IB 3AZED 3X1SC 5E5AC 3REKD 3WKJA 1P3FC 5B24C 5FUGB 4Z2MH 3REID 3LZ1B 5CP6C 1P3MB 5B40A 3AZLD 2RVQD 1U35A 4YS3A 1BH8B 3AN2D 3X1UA 4LD9B 3VH6W 1F66B 4H9SC 4JJNC 1N1JA 2Y2LA 4H9OB 4Z5TA 3TU4A 3AZGA 5B1MC 3KUYD 3UTAD 1P3GC 2AROA 1F1EA 5CPJB 4WU9A 2F8NH 4ZBJB 1S32A 3AZKD 3AZJB 2ZY4A 5B31B 1KX3C 1EQZC 4Z66D 3B6GB 1M1AD 5GXQA 4WU8C 2FJ7C 3LZ0B 3MGPB 5CPKB 5BS7A 3REHC 2Y2KA 3W99B 3B0BA 3W97D 5B24D 4J8UC 3UT9B 4J8XB 3AZIC 4WNNB 5B2JA 3AZMC 5BNXB 3AZHA 3MGQA 3WKJB 3KSYA 3VH5T 4AWLC 3AV2B 5DNNC 5B32C 1TAFA 5B1LC 3H0RC 5AVBC 5CPIC 4QLCD 5B40B 4J8WD 1ID3B 4YS3B 3W96B 3WAAB 1BFMA 3X1UB 3WTPE 5B1MD 2BG1A 4CSRA 5B0YC 4YM6A 1N1JB 3B0CT 4Z5TB 5BO0A 3MVDC 3AZGB 4KUDC 3REIA 1TZYA 3MGSC 1S32B 1AOIA 1KX4C 1P3LD 2FJ7D 2BYMA 3REJA 4J8VD 4X23C 5AY8C 1P3BB 5GSUD 2F8NA 3KXBB 2PYOB 4UUZA 4J8UD 3AZFA 2NQBC 1M18D 2IO5B 3KUYA 3A6ND 3UTAA 4ZUXD 1KX5A 3AV1A 3MGRD 5AV6C 3UTBC 2XD5A 5JA4A 4XUJC 5B2IA 5CPID 5B2JB 1M1AA 3AZHB 2G5IC 5JRGC 5GT0D 5GXQC 5DNMC 2BYKB 5B0YD 3X1VC 1M19D 2NZDB 4XZQD 2HIOC 3B0DB 3LZ1A 3MVDD 3FDDA 5BS7C 3W97A 4KUDD 1P3MA 3AZEB 3NQUA 4CAYA 4CSRB 3MGSD 5AV9C 1BH8A 4LD9A 5GT3C 3REKB 5BO0B 1KX4D 4H9OA 3REIB 5BT1C 1ZLAC 5AV8C 5AV5C 2YFWB 3AZLB 4J8WA 2BYMB 4H9PA 3AN2B 5CPJA 4NE3A 5B33C 3AZJA 1WWSA 3AZND 3W98D 2UWXA 2CV5D 3B6GA 3B6FC 3KWQC 5CHLB 3EPKA 4XUJD 3KUYB 3UTAB 3LZ0A 4EO5B 2L5AA 5AVCC 3X1TC 3O62D 3AZKB 5CPKA 5F99C 1P3LA 5DNMD 4J8VA 5C3IC 5JA4B 4Z66B 1M1AB 1P3AC 4H9QA 3UT9A 4J8XA 2HIOD 5GSUA 3C1BC 4KHAB 3R45B 4WNNA 3AYWC 2JE5A 5BNXA 1M18A 4DRBA 3AV2A 3A6NA 4ZUXA
chains in the Genus database with same CATH topology
3WTPC 4KGCD 4R8PC 3W97B 3AL0C 1P3IC 3NQUB 4CAYB 3AFAC 1ULYA 1ID3A 3RELD 2DF4C 3W96A 1P3OC 1ZLAD 3WAAA 5AV5D 3LELD 3WA9D 5GT0A 4M6BA 4NE5A 2YFVB 1M19A 4QLCB 4J8WB 4H9PB 3LJAC 3KWQD 5B1MB 1P3KA 1HQ3C 1P3MC 5AVCD 3P5JB 1P3BA 5F99D 4HGAB 3C1CD 1F66C 3KXBA 4G92B 2PYOA 1P3AD 2JSSA 1WWIA 4E45A 3X1SD 2FJ7B 1P3LB 3AYWD 4J8VB 5E5AD 1P3FD 5G49A 4DQYB 2Y2NA 4H9QB 5CPJC 3AZNA 3W98A 1H3OB 4ZBJC 5GSUB 5CP6D 2CV5A 2ZY2A 5B31C 3MNNC 4J8UB 1A7WA 1P3ID 1M18B 1P3OD 2F8NK 3A6NB 1P3PC 3B6GC 4ZUXB 2BYKA 1P34C 4JJND 4AWLB 3MGRB 2NZDA 3EG5B 1PZRA 4E44A 3MGPC 5B0ZC 1B67A 4H9NA 2ZM5A 5CPIB 1P3GD 3AZEA 3W99C 5GT0B 3LJAD 3UT9C 3VH5A 3REKA 2W8SA 2Y2MA 1HQ3D 1M19B 2XD1A 1KX3D 4XZQB 5BNVA 1EQZD 3WKJC 3MVDB 4KGCA 4WU8D 4KUDB 1P3KB 2YFWA 3AZLA 3RELA 3MGSB 3AN2A 5B40C 1U35C 4YS3C 3WA9A 1KX4B 3X1UC 3REHD 5B32G 4Z5TC 4WZSB 3TU4C 3AZID 3MNND 3AZMD 3AZGC 5G49B 2AROC 1P3PD 3AZKA 5DNND 5B32D 3AZNB 4WU9C 3W98B 1S32C 5B1LD 2CV5B 1P34D 3KFUG 5AVBD 4Z66A 4UPKA 2Y2PA 3C1CA 4XUJB 5B0ZD 1P3BC 4KHAA 3R45A 3W99D 1R4VA 3KXBC 3O62B 3X1SA 2Y2HA 5DNMB 2IO5C 5E5AA 1P3FA 4H9NB 3VH5W 5B24A 1KU5A 3WKJD 4WV4B 2HIOB 4G91C 2HUEB 5B2JC 1JFIB 2LY8A 5BNVB 4X23D 3MGQC 5AY8D 3AZHC 1U35D 2YFVA 4KGCB 4JJNA 2J8PA 4QLCA 3B0CW 3RELB 2NQBD 1ZLAB 5AV5B 3LELB 3TU4D 5B1MA 1P3GA 3WA9B 5KDMB 3AZGD 3A1KA 2AROD 4YM6C 4WU9D 5AV6D 3UTBD 1KX3A 2ZY5A 1EQZA 2Y2QA 4WU8A 5JRGD 2G5HC 3KWQB 3REIC 1TZYC 5GXQD 2FJ7A 1AOIC 5AVCB 3X1VD 4DRAA 3REJC 5F99B 3REHA 1H3OA 1HTAA 3C1CB 3F6TA 4J8UA 3X1SB 3AZIA 5AV9D 3AZFC 5GT3D 5E5AB 2CWEA 3KUYC 3UTAC 1P3FB 5B24B 5DNNA 5B32A 3MGRA 3MGQD 1KX5C 3AV1C 5B1LA 5BT1D 5CP6B 5AV8D 5AVBA 5CPIA 4Z2MG 1P3IB 5B2IC 4Z66C 1P3OB 1M1AC 5B33D 5B0YA 4JJNB 4XZQA 4YM6D 3B6FD 3MVDA 4KUDA 3LZ1C 1P3GB 3W97C 3MGSA 3LJAB 3X1TD 1TZYD 1KX4A 1HQ3B 1AOID 4LD9C 2F8NG 1KX3B 4X23A 1EQZB 5AY8A 3REJD 4WU8B 3C1BD 2NQBA 2F8ND 4QLCC 4J8WC 3AZFD 3REHB 3WTPD 4R8PD 3AZJC 2VQRA 2Y2OA 3AFAD 2Y2JA 1KX5D 3AV1D 5AV6A 3UTBA 3AZIB 1B6WA 4XUJA 4HGAC 3MNNB 3AZMB 5B2ID 5JRGA 4G92C 3O62A 3LZ0C 1P3PB 5DNNB 5B32B 5B1LB 5DNMA 5CPKC 1P34B 3X1VA 1P3LC 5AVBB 4J8VC 2HIOA 5B0ZB 4J8XC 3LZ1D 5GSUC 5B0YB 1P3MD 5AV9A 1JFIA 1M18C 5GT3A 3AV2C 3A6NC 4LD9D 4ZUXC 1F66D 4WJ3C 2DQNC 3MGRC 1ZLAA 1BH9A 3IP4C 5AV8A 5AV5A 3LELA 1ID3C 3W96C 3WAAC 5KDMA 5B31G 4X23B 1U35B 5AY8B 5GT0C 5B33A 4NE6A 5CPJD 4H9RA 2F2AC 3NQJA 3AZJD 2FFFB 5B31D 2JCHA 1M19C 3B6FA 2NQBB 1Q9CA 4XZQC 3KWQA 3TU4B 3A1IA 3B6GD 4NFTA 5AVCA 1P3KC 3X1TA 2AROB 3LZ0D 5F99A 4WU9B 5AV6B 3UTBB 2RIQA 3MGPD 5CPKD 1P3AA 5JRGB 2PYOC 3H0LC 3C1BA 5GXQB 3V9RA 4J8XD 3UT9D 3AYWA 3H0MC 3X1VB 3AV2D 3WTPA 5CP6A 4R8PA 3W98C 3AZNC 1P3IA 3AFAA 2CV5C 2Y2GA 4G91B 1P3OA 5AV9B 5B40D 5GT3B 3EPJA 1ID3D 4YS3D 3W96D 4H9SA 3WAAD 3X1UD 2ZY3A 3MGQB 3O62C 2NZDC 1BH9B 1TAFB 5AV8B 4Z5TD 3EPLA 3B0DC 1W2EA 3EPHA 1Z2CB 5FUGA 3VH6T 3AZEC 3LJAA 5B33B 4H9RB 2HUEC 1HQ3A 1S32D 1P3KD 3NQJB 3REKC 4YM6B 3B6FB 1P3BD 1F66A 4KGCC 3KXBD 3AZLC 3X1TB 2PYOD 2RVQC 3RELC 1TZYB 3VH6A 3AN2C 1T3UA 1AOIB 3LELC 5C3IB 3WA9C 3REJB 1P3AB 3C1BB 3V9RB 5B31A 3MNNA 3AYWB 3AZMA 2F8NB 4UUZB 5B2JD 3AZFB 1P3PA 4EO5C 3AZHD 3WTPB 3AZKC 4R8PB 1P34A 3AFAB 1KX5B 3AV1B 3MGPA 5B0ZA 2NZDD 2Y2IA 3C1CC 3W99A 5B2IB 3AZED 3X1SC 5E5AC 3REKD 3WKJA 1P3FC 5B24C 5FUGB 4Z2MH 3REID 3LZ1B 5CP6C 1P3MB 5B40A 3AZLD 2RVQD 1U35A 4YS3A 1BH8B 3AN2D 3X1UA 4LD9B 3VH6W 1F66B 4H9SC 4JJNC 1N1JA 2Y2LA 4H9OB 4Z5TA 3TU4A 3AZGA 5B1MC 3KUYD 3UTAD 1P3GC 2AROA 1F1EA 5CPJB 4WU9A 2F8NH 4ZBJB 1S32A 3AZKD 3AZJB 2ZY4A 5B31B 1KX3C 1EQZC 4Z66D 3B6GB 1M1AD 5GXQA 4WU8C 2FJ7C 3LZ0B 3MGPB 5CPKB 5BS7A 3REHC 2Y2KA 3W99B 3B0BA 3W97D 5B24D 4J8UC 3UT9B 4J8XB 3AZIC 4WNNB 5B2JA 3AZMC 5BNXB 3AZHA 3MGQA 3WKJB 3KSYA 3VH5T 4AWLC 3AV2B 5DNNC 5B32C 1TAFA 5B1LC 3H0RC 5AVBC 5CPIC 4QLCD 5B40B 4J8WD 1ID3B 4YS3B 3W96B 3WAAB 1BFMA 3X1UB 3WTPE 5B1MD 2BG1A 4CSRA 5B0YC 4YM6A 1N1JB 3B0CT 4Z5TB 5BO0A 3MVDC 3AZGB 4KUDC 3REIA 1TZYA 3MGSC 1S32B 1AOIA 1KX4C 1P3LD 2FJ7D 2BYMA 3REJA 4J8VD 4X23C 5AY8C 1P3BB 5GSUD 2F8NA 3KXBB 2PYOB 4UUZA 4J8UD 3AZFA 2NQBC 1M18D 2IO5B 3KUYA 3A6ND 3UTAA 4ZUXD 1KX5A 3AV1A 3MGRD 5AV6C 3UTBC 2XD5A 5JA4A 4XUJC 5B2IA 5CPID 5B2JB 1M1AA 3AZHB 2G5IC 5JRGC 5GT0D 5GXQC 5DNMC 2BYKB 5B0YD 3X1VC 1M19D 2NZDB 4XZQD 2HIOC 3B0DB 3LZ1A 3MVDD 3FDDA 5BS7C 3W97A 4KUDD 1P3MA 3AZEB 3NQUA 4CAYA 4CSRB 3MGSD 5AV9C 1BH8A 4LD9A 5GT3C 3REKB 5BO0B 1KX4D 4H9OA 3REIB 5BT1C 1ZLAC 5AV8C 5AV5C 2YFWB 3AZLB 4J8WA 2BYMB 4H9PA 3AN2B 5CPJA 4NE3A 5B33C 3AZJA 1WWSA 3AZND 3W98D 2UWXA 2CV5D 3B6GA 3B6FC 3KWQC 5CHLB 3EPKA 4XUJD 3KUYB 3UTAB 3LZ0A 4EO5B 2L5AA 5AVCC 3X1TC 3O62D 3AZKB 5CPKA 5F99C 1P3LA 5DNMD 4J8VA 5C3IC 5JA4B 4Z66B 1M1AB 1P3AC 4H9QA 3UT9A 4J8XA 2HIOD 5GSUA 3C1BC 4KHAB 3R45B 4WNNA 3AYWC 2JE5A 5BNXA 1M18A 4DRBA 3AV2A 3A6NA 4ZUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTP C;  4KGC D;  4R8P C;  3W97 B;  1P3I C;  3NQU B;  4CAY B;  3AFA C;  1ULY A;  1ID3 A;  3REL D;  3W96 A;  1P3O C;  1ZLA D;  3WAA A;  5AV5 D;  3LEL D;  3WA9 D;  5GT0 A;  4M6B A;  4NE5 A;  2YFV B;  1M19 A;  4QLC B;  4J8W B;  4H9P B;  3LJA C;  3KWQ D;  5B1M B;  1P3K A;  1HQ3 C;  1P3M C;  5AVC D;  1P3B A;  5F99 D;  4HGA B;  3C1C D;  1F66 C;  3KXB A;  4G92 B;  2PYO A;  1P3A D;  2JSS A;  1WWI A;  4E45 A;  3X1S D;  2FJ7 B;  1P3L B;  3AYW D;  4J8V B;  5E5A D;  1P3F D;  5G49 A;  5CPJ C;  4H9Q B;  3W98 A;  3AZN A;  1H3O B;  4ZBJ C;  5GSU B;  5CP6 D;  2CV5 A;  5B31 C;  3MNN C;  4J8U B;  1A7W A;  1P3I D;  1M18 B;  1P3O D;  2F8N K;  3A6N B;  1P3P C;  3B6G C;  4ZUX B;  2BYK A;  1P34 C;  4JJN D;  4AWL B;  3MGR B;  2NZD A;  4E44 A;  3MGP C;  5B0Z C;  1B67 A;  4H9N A;  5CPI B;  1P3G D;  3AZE A;  3W99 C;  5GT0 B;  3LJA D;  3UT9 C;  3VH5 A;  3REK A;  1M19 B;  1HQ3 D;  1KX3 D;  4XZQ B;  5BNV A;  1EQZ D;  3WKJ C;  3MVD B;  4KGC A;  4WU8 D;  4KUD B;  1P3K B;  2YFW A;  3AZL A;  3REL A;  3MGS B;  3AN2 A;  5B40 C;  1U35 C;  4YS3 C;  3WA9 A;  1KX4 B;  3X1U C;  3REH D;  5B32 G;  4Z5T C;  4WZS B;  3TU4 C;  3AZI D;  3MNN D;  3AZM D;  3AZG C;  5G49 B;  2ARO C;  1P3P D;  3AZK A;  5DNN D;  5B32 D;  3AZN B;  4WU9 C;  3W98 B;  1S32 C;  5B1L D;  2CV5 B;  1P34 D;  5AVB D;  4Z66 A;  3C1C A;  4XUJ B;  5B0Z D;  1P3B C;  4KHA A;  3R45 A;  3W99 D;  1R4V A;  3KXB C;  3O62 B;  3X1S A;  5DNM B;  2IO5 C;  5E5A A;  1P3F A;  4H9N B;  3VH5 W;  5B24 A;  1KU5 A;  3WKJ D;  4WV4 B;  2HIO B;  4G91 C;  2HUE B;  5B2J C;  1JFI B;  2LY8 A;  5BNV B;  4X23 D;  3MGQ C;  5AY8 D;  3AZH C;  1U35 D;  2YFV A;  4KGC B;  4JJN A;  4QLC A;  3B0C W;  3REL B;  2NQB D;  1ZLA B;  5AV5 B;  3LEL B;  3TU4 D;  5B1M A;  1P3G A;  3WA9 B;  5KDM B;  3AZG D;  2ARO D;  4YM6 C;  4WU9 D;  5AV6 D;  3UTB D;  1KX3 A;  1EQZ A;  4WU8 A;  5JRG D;  3KWQ B;  3REI C;  1TZY C;  5GXQ D;  2FJ7 A;  1AOI C;  5AVC B;  3X1V D;  4DRA A;  3REJ C;  5F99 B;  3REH A;  1H3O A;  1HTA A;  3C1C B;  4J8U A;  3X1S B;  3AZI A;  5AV9 D;  3AZF C;  5GT3 D;  5E5A B;  2CWE A;  3KUY C;  3UTA C;  1P3F B;  5B24 B;  5DNN A;  5B32 A;  3MGR A;  3MGQ D;  1KX5 C;  3AV1 C;  5B1L A;  5BT1 D;  5CP6 B;  5AV8 D;  5AVB A;  5CPI A;  4Z2M G;  1P3I B;  5B2I C;  4Z66 C;  1P3O B;  1M1A C;  5B33 D;  5B0Y A;  4JJN B;  4XZQ A;  4YM6 D;  3B6F D;  3MVD A;  4KUD A;  3LZ1 C;  1P3G B;  3W97 C;  3MGS A;  3LJA B;  3X1T D;  1TZY D;  1KX4 A;  1HQ3 B;  1AOI D;  4LD9 C;  2F8N G;  1KX3 B;  4X23 A;  1EQZ B;  5AY8 A;  3REJ D;  4WU8 B;  3C1B D;  2NQB A;  2F8N D;  4QLC C;  4J8W C;  3AZF D;  3REH B;  3WTP D;  4R8P D;  3AZJ C;  3AFA D;  1KX5 D;  3AV1 D;  5AV6 A;  3UTB A;  3AZI B;  1B6W A;  4XUJ A;  4HGA C;  3MNN B;  3AZM B;  5B2I D;  5JRG A;  4G92 C;  3O62 A;  3LZ0 C;  1P3P B;  5DNN B;  5B32 B;  5B1L B;  5DNM A;  5CPK C;  1P34 B;  3X1V A;  1P3L C;  5AVB B;  4J8V C;  2HIO A;  5B0Z B;  4J8X C;  3LZ1 D;  5GSU C;  5B0Y B;  1P3M D;  5AV9 A;  1JFI A;  1M18 C;  5GT3 A;  3AV2 C;  3A6N C;  4LD9 D;  4ZUX C;  1F66 D;  3MGR C;  1ZLA A;  1BH9 A;  5AV8 A;  5AV5 A;  3LEL A;  1ID3 C;  3W96 C;  3WAA C;  5KDM A;  5B31 G;  4X23 B;  1U35 B;  5GT0 C;  5AY8 B;  5B33 A;  4NE6 A;  5CPJ D;  4H9R A;  3NQJ A;  3AZJ D;  5B31 D;  1M19 C;  3B6F A;  2NQB B;  1Q9C A;  4XZQ C;  3KWQ A;  3TU4 B;  3B6G D;  4NFT A;  5AVC A;  1P3K C;  3X1T A;  2ARO B;  3LZ0 D;  5F99 A;  4WU9 B;  5AV6 B;  3UTB B;  3MGP D;  5CPK D;  1P3A A;  5JRG B;  2PYO C;  3C1B A;  5GXQ B;  3V9R A;  4J8X D;  3UT9 D;  3AYW A;  3X1V B;  3AV2 D;  3WTP A;  5CP6 A;  4R8P A;  3W98 C;  3AZN C;  1P3I A;  3AFA A;  2CV5 C;  4G91 B;  1P3O A;  5AV9 B;  5B40 D;  5GT3 B;  1ID3 D;  4YS3 D;  3W96 D;  4H9S A;  3WAA D;  3X1U D;  3MGQ B;  3O62 C;  2NZD C;  1BH9 B;  1TAF B;  5AV8 B;  4Z5T D;  3B0D C;  5FUG A;  3VH6 T;  3AZE C;  3LJA A;  5B33 B;  4H9R B;  2HUE C;  1HQ3 A;  1S32 D;  1P3K D;  3NQJ B;  3REK C;  4YM6 B;  3B6F B;  1P3B D;  1F66 A;  4KGC C;  3KXB D;  3AZL C;  3X1T B;  2PYO D;  2RVQ C;  3REL C;  1TZY B;  3VH6 A;  3AN2 C;  1AOI B;  3LEL C;  5C3I B;  3WA9 C;  3REJ B;  1P3A B;  3C1B B;  3V9R B;  5B31 A;  3MNN A;  3AYW B;  3AZM A;  2F8N B;  4UUZ B;  5B2J D;  3AZF B;  1P3P A;  4EO5 C;  3AZH D;  3WTP B;  3AZK C;  4R8P B;  1P34 A;  3AFA B;  1KX5 B;  3AV1 B;  3MGP A;  5B0Z A;  2NZD D;  3C1C C;  3W99 A;  5B2I B;  3AZE D;  3X1S C;  5E5A C;  3REK D;  3WKJ A;  1P3F C;  5B24 C;  5FUG B;  4Z2M H;  3REI D;  3LZ1 B;  5CP6 C;  1P3M B;  5B40 A;  3AZL D;  2RVQ D;  1U35 A;  4YS3 A;  1BH8 B;  3AN2 D;  3X1U A;  4LD9 B;  3VH6 W;  1F66 B;  4H9S C;  4JJN C;  1N1J A;  4H9O B;  4Z5T A;  3TU4 A;  3AZG A;  5B1M C;  3KUY D;  3UTA D;  1P3G C;  2ARO A;  1F1E A;  5CPJ B;  4WU9 A;  2F8N H;  4ZBJ B;  1S32 A;  3AZK D;  3AZJ B;  5B31 B;  1KX3 C;  1EQZ C;  4Z66 D;  3B6G B;  1M1A D;  5GXQ A;  4WU8 C;  2FJ7 C;  3LZ0 B;  3MGP B;  5CPK B;  5BS7 A;  3REH C;  3W99 B;  3B0B A;  3W97 D;  5B24 D;  4J8U C;  3UT9 B;  4J8X B;  3AZI C;  4WNN B;  5B2J A;  3AZM C;  5BNX B;  3AZH A;  3MGQ A;  3WKJ B;  3KSY A;  3VH5 T;  4AWL C;  3AV2 B;  5DNN C;  5B32 C;  1TAF A;  5B1L C;  5AVB C;  5CPI C;  4QLC D;  5B40 B;  4J8W D;  1ID3 B;  4YS3 B;  3W96 B;  3WAA B;  1BFM A;  3X1U B;  3WTP E;  5B1M D;  4CSR A;  5B0Y C;  4YM6 A;  1N1J B;  3B0C T;  4Z5T B;  5BO0 A;  3MVD C;  3AZG B;  4KUD C;  3REI A;  1TZY A;  3MGS C;  1S32 B;  1AOI A;  1KX4 C;  1P3L D;  2FJ7 D;  2BYM A;  3REJ A;  4J8V D;  4X23 C;  5AY8 C;  1P3B B;  5GSU D;  2F8N A;  3KXB B;  2PYO B;  4UUZ A;  4J8U D;  3AZF A;  2NQB C;  1M18 D;  2IO5 B;  3KUY A;  3A6N D;  3UTA A;  4ZUX D;  1KX5 A;  3AV1 A;  3MGR D;  5AV6 C;  3UTB C;  5JA4 A;  4XUJ C;  5B2I A;  5CPI D;  5B2J B;  1M1A A;  3AZH B;  5JRG C;  5GT0 D;  5GXQ C;  5DNM C;  2BYK B;  5B0Y D;  3X1V C;  1M19 D;  2NZD B;  4XZQ D;  2HIO C;  3B0D B;  3LZ1 A;  3MVD D;  5BS7 C;  3W97 A;  4KUD D;  1P3M A;  3AZE B;  3NQU A;  4CAY A;  4CSR B;  3MGS D;  5AV9 C;  1BH8 A;  4LD9 A;  5GT3 C;  3REK B;  5BO0 B;  1KX4 D;  4H9O A;  3REI B;  5BT1 C;  1ZLA C;  5AV8 C;  5AV5 C;  2YFW B;  3AZL B;  4J8W A;  2BYM B;  4H9P A;  3AN2 B;  5CPJ A;  4NE3 A;  5B33 C;  3AZJ A;  1WWS A;  3AZN D;  3W98 D;  2CV5 D;  3B6G A;  3B6F C;  3KWQ C;  5CHL B;  4XUJ D;  3KUY B;  3UTA B;  3LZ0 A;  4EO5 B;  2L5A A;  5AVC C;  3X1T C;  3O62 D;  3AZK B;  5CPK A;  5F99 C;  1P3L A;  5DNM D;  4J8V A;  5C3I C;  5JA4 B;  4Z66 B;  1M1A B;  1P3A C;  4H9Q A;  3UT9 A;  4J8X A;  2HIO D;  5GSU A;  3C1B C;  4KHA B;  3R45 B;  4WNN A;  3AYW C;  5BNX A;  1M18 A;  4DRB A;  3AV2 A;  3A6N A;  4ZUX A; 
#chains in the Genus database with same CATH topology
 3WTP C;  4KGC D;  4R8P C;  3W97 B;  3AL0 C;  1P3I C;  3NQU B;  4CAY B;  3AFA C;  1ULY A;  1ID3 A;  3REL D;  2DF4 C;  3W96 A;  1P3O C;  1ZLA D;  3WAA A;  5AV5 D;  3LEL D;  3WA9 D;  5GT0 A;  4M6B A;  4NE5 A;  2YFV B;  1M19 A;  4QLC B;  4J8W B;  4H9P B;  3LJA C;  3KWQ D;  5B1M B;  1P3K A;  1HQ3 C;  1P3M C;  5AVC D;  3P5J B;  1P3B A;  5F99 D;  4HGA B;  3C1C D;  1F66 C;  3KXB A;  4G92 B;  2PYO A;  1P3A D;  2JSS A;  1WWI A;  4E45 A;  3X1S D;  2FJ7 B;  1P3L B;  3AYW D;  4J8V B;  5E5A D;  1P3F D;  5G49 A;  4DQY B;  2Y2N A;  4H9Q B;  5CPJ C;  3AZN A;  3W98 A;  1H3O B;  4ZBJ C;  5GSU B;  5CP6 D;  2CV5 A;  2ZY2 A;  5B31 C;  3MNN C;  4J8U B;  1A7W A;  1P3I D;  1M18 B;  1P3O D;  2F8N K;  3A6N B;  1P3P C;  3B6G C;  4ZUX B;  2BYK A;  1P34 C;  4JJN D;  4AWL B;  3MGR B;  2NZD A;  3EG5 B;  1PZR A;  4E44 A;  3MGP C;  5B0Z C;  1B67 A;  4H9N A;  2ZM5 A;  5CPI B;  1P3G D;  3AZE A;  3W99 C;  5GT0 B;  3LJA D;  3UT9 C;  3VH5 A;  3REK A;  2W8S A;  2Y2M A;  1HQ3 D;  1M19 B;  2XD1 A;  1KX3 D;  4XZQ B;  5BNV A;  1EQZ D;  3WKJ C;  3MVD B;  4KGC A;  4WU8 D;  4KUD B;  1P3K B;  2YFW A;  3AZL A;  3REL A;  3MGS B;  3AN2 A;  5B40 C;  1U35 C;  4YS3 C;  3WA9 A;  1KX4 B;  3X1U C;  3REH D;  5B32 G;  4Z5T C;  4WZS B;  3TU4 C;  3AZI D;  3MNN D;  3AZM D;  3AZG C;  5G49 B;  2ARO C;  1P3P D;  3AZK A;  5DNN D;  5B32 D;  3AZN B;  4WU9 C;  3W98 B;  1S32 C;  5B1L D;  2CV5 B;  1P34 D;  3KFU G;  5AVB D;  4Z66 A;  4UPK A;  2Y2P A;  3C1C A;  4XUJ B;  5B0Z D;  1P3B C;  4KHA A;  3R45 A;  3W99 D;  1R4V A;  3KXB C;  3O62 B;  3X1S A;  2Y2H A;  5DNM B;  2IO5 C;  5E5A A;  1P3F A;  4H9N B;  3VH5 W;  5B24 A;  1KU5 A;  3WKJ D;  4WV4 B;  2HIO B;  4G91 C;  2HUE B;  5B2J C;  1JFI B;  2LY8 A;  5BNV B;  4X23 D;  3MGQ C;  5AY8 D;  3AZH C;  1U35 D;  2YFV A;  4KGC B;  4JJN A;  2J8P A;  4QLC A;  3B0C W;  3REL B;  2NQB D;  1ZLA B;  5AV5 B;  3LEL B;  3TU4 D;  5B1M A;  1P3G A;  3WA9 B;  5KDM B;  3AZG D;  3A1K A;  2ARO D;  4YM6 C;  4WU9 D;  5AV6 D;  3UTB D;  1KX3 A;  2ZY5 A;  1EQZ A;  2Y2Q A;  4WU8 A;  5JRG D;  2G5H C;  3KWQ B;  3REI C;  1TZY C;  5GXQ D;  2FJ7 A;  1AOI C;  5AVC B;  3X1V D;  4DRA A;  3REJ C;  5F99 B;  3REH A;  1H3O A;  1HTA A;  3C1C B;  3F6T A;  4J8U A;  3X1S B;  3AZI A;  5AV9 D;  3AZF C;  5GT3 D;  5E5A B;  2CWE A;  3KUY C;  3UTA C;  1P3F B;  5B24 B;  5DNN A;  5B32 A;  3MGR A;  3MGQ D;  1KX5 C;  3AV1 C;  5B1L A;  5BT1 D;  5CP6 B;  5AV8 D;  5AVB A;  5CPI A;  4Z2M G;  1P3I B;  5B2I C;  4Z66 C;  1P3O B;  1M1A C;  5B33 D;  5B0Y A;  4JJN B;  4XZQ A;  4YM6 D;  3B6F D;  3MVD A;  4KUD A;  3LZ1 C;  1P3G B;  3W97 C;  3MGS A;  3LJA B;  3X1T D;  1TZY D;  1KX4 A;  1HQ3 B;  1AOI D;  4LD9 C;  2F8N G;  1KX3 B;  4X23 A;  1EQZ B;  5AY8 A;  3REJ D;  4WU8 B;  3C1B D;  2NQB A;  2F8N D;  4QLC C;  4J8W C;  3AZF D;  3REH B;  3WTP D;  4R8P D;  3AZJ C;  2VQR A;  2Y2O A;  3AFA D;  2Y2J A;  1KX5 D;  3AV1 D;  5AV6 A;  3UTB A;  3AZI B;  1B6W A;  4XUJ A;  4HGA C;  3MNN B;  3AZM B;  5B2I D;  5JRG A;  4G92 C;  3O62 A;  3LZ0 C;  1P3P B;  5DNN B;  5B32 B;  5B1L B;  5DNM A;  5CPK C;  1P34 B;  3X1V A;  1P3L C;  5AVB B;  4J8V C;  2HIO A;  5B0Z B;  4J8X C;  3LZ1 D;  5GSU C;  5B0Y B;  1P3M D;  5AV9 A;  1JFI A;  1M18 C;  5GT3 A;  3AV2 C;  3A6N C;  4LD9 D;  4ZUX C;  1F66 D;  4WJ3 C;  2DQN C;  3MGR C;  1ZLA A;  1BH9 A;  3IP4 C;  5AV8 A;  5AV5 A;  3LEL A;  1ID3 C;  3W96 C;  3WAA C;  5KDM A;  5B31 G;  4X23 B;  1U35 B;  5AY8 B;  5GT0 C;  5B33 A;  4NE6 A;  5CPJ D;  4H9R A;  2F2A C;  3NQJ A;  3AZJ D;  2FFF B;  5B31 D;  2JCH A;  1M19 C;  3B6F A;  2NQB B;  1Q9C A;  4XZQ C;  3KWQ A;  3TU4 B;  3A1I A;  3B6G D;  4NFT A;  5AVC A;  1P3K C;  3X1T A;  2ARO B;  3LZ0 D;  5F99 A;  4WU9 B;  5AV6 B;  3UTB B;  2RIQ A;  3MGP D;  5CPK D;  1P3A A;  5JRG B;  2PYO C;  3H0L C;  3C1B A;  5GXQ B;  3V9R A;  4J8X D;  3UT9 D;  3AYW A;  3H0M C;  3X1V B;  3AV2 D;  3WTP A;  5CP6 A;  4R8P A;  3W98 C;  3AZN C;  1P3I A;  3AFA A;  2CV5 C;  2Y2G A;  4G91 B;  1P3O A;  5AV9 B;  5B40 D;  5GT3 B;  3EPJ A;  1ID3 D;  4YS3 D;  3W96 D;  4H9S A;  3WAA D;  3X1U D;  2ZY3 A;  3MGQ B;  3O62 C;  2NZD C;  1BH9 B;  1TAF B;  5AV8 B;  4Z5T D;  3EPL A;  3B0D C;  1W2E A;  3EPH A;  1Z2C B;  5FUG A;  3VH6 T;  3AZE C;  3LJA A;  5B33 B;  4H9R B;  2HUE C;  1HQ3 A;  1S32 D;  1P3K D;  3NQJ B;  3REK C;  4YM6 B;  3B6F B;  1P3B D;  1F66 A;  4KGC C;  3KXB D;  3AZL C;  3X1T B;  2PYO D;  2RVQ C;  3REL C;  1TZY B;  3VH6 A;  3AN2 C;  1T3U A;  1AOI B;  3LEL C;  5C3I B;  3WA9 C;  3REJ B;  1P3A B;  3C1B B;  3V9R B;  5B31 A;  3MNN A;  3AYW B;  3AZM A;  2F8N B;  4UUZ B;  5B2J D;  3AZF B;  1P3P A;  4EO5 C;  3AZH D;  3WTP B;  3AZK C;  4R8P B;  1P34 A;  3AFA B;  1KX5 B;  3AV1 B;  3MGP A;  5B0Z A;  2NZD D;  2Y2I A;  3C1C C;  3W99 A;  5B2I B;  3AZE D;  3X1S C;  5E5A C;  3REK D;  3WKJ A;  1P3F C;  5B24 C;  5FUG B;  4Z2M H;  3REI D;  3LZ1 B;  5CP6 C;  1P3M B;  5B40 A;  3AZL D;  2RVQ D;  1U35 A;  4YS3 A;  1BH8 B;  3AN2 D;  3X1U A;  4LD9 B;  3VH6 W;  1F66 B;  4H9S C;  4JJN C;  1N1J A;  2Y2L A;  4H9O B;  4Z5T A;  3TU4 A;  3AZG A;  5B1M C;  3KUY D;  3UTA D;  1P3G C;  2ARO A;  1F1E A;  5CPJ B;  4WU9 A;  2F8N H;  4ZBJ B;  1S32 A;  3AZK D;  3AZJ B;  2ZY4 A;  5B31 B;  1KX3 C;  1EQZ C;  4Z66 D;  3B6G B;  1M1A D;  5GXQ A;  4WU8 C;  2FJ7 C;  3LZ0 B;  3MGP B;  5CPK B;  5BS7 A;  3REH C;  2Y2K A;  3W99 B;  3B0B A;  3W97 D;  5B24 D;  4J8U C;  3UT9 B;  4J8X B;  3AZI C;  4WNN B;  5B2J A;  3AZM C;  5BNX B;  3AZH A;  3MGQ A;  3WKJ B;  3KSY A;  3VH5 T;  4AWL C;  3AV2 B;  5DNN C;  5B32 C;  1TAF A;  5B1L C;  3H0R C;  5AVB C;  5CPI C;  4QLC D;  5B40 B;  4J8W D;  1ID3 B;  4YS3 B;  3W96 B;  3WAA B;  1BFM A;  3X1U B;  3WTP E;  5B1M D;  2BG1 A;  4CSR A;  5B0Y C;  4YM6 A;  1N1J B;  3B0C T;  4Z5T B;  5BO0 A;  3MVD C;  3AZG B;  4KUD C;  3REI A;  1TZY A;  3MGS C;  1S32 B;  1AOI A;  1KX4 C;  1P3L D;  2FJ7 D;  2BYM A;  3REJ A;  4J8V D;  4X23 C;  5AY8 C;  1P3B B;  5GSU D;  2F8N A;  3KXB B;  2PYO B;  4UUZ A;  4J8U D;  3AZF A;  2NQB C;  1M18 D;  2IO5 B;  3KUY A;  3A6N D;  3UTA A;  4ZUX D;  1KX5 A;  3AV1 A;  3MGR D;  5AV6 C;  3UTB C;  2XD5 A;  5JA4 A;  4XUJ C;  5B2I A;  5CPI D;  5B2J B;  1M1A A;  3AZH B;  2G5I C;  5JRG C;  5GT0 D;  5GXQ C;  5DNM C;  2BYK B;  5B0Y D;  3X1V C;  1M19 D;  2NZD B;  4XZQ D;  2HIO C;  3B0D B;  3LZ1 A;  3MVD D;  3FDD A;  5BS7 C;  3W97 A;  4KUD D;  1P3M A;  3AZE B;  3NQU A;  4CAY A;  4CSR B;  3MGS D;  5AV9 C;  1BH8 A;  4LD9 A;  5GT3 C;  3REK B;  5BO0 B;  1KX4 D;  4H9O A;  3REI B;  5BT1 C;  1ZLA C;  5AV8 C;  5AV5 C;  2YFW B;  3AZL B;  4J8W A;  2BYM B;  4H9P A;  3AN2 B;  5CPJ A;  4NE3 A;  5B33 C;  3AZJ A;  1WWS A;  3AZN D;  3W98 D;  2UWX A;  2CV5 D;  3B6G A;  3B6F C;  3KWQ C;  5CHL B;  3EPK A;  4XUJ D;  3KUY B;  3UTA B;  3LZ0 A;  4EO5 B;  2L5A A;  5AVC C;  3X1T C;  3O62 D;  3AZK B;  5CPK A;  5F99 C;  1P3L A;  5DNM D;  4J8V A;  5C3I C;  5JA4 B;  4Z66 B;  1M1A B;  1P3A C;  4H9Q A;  3UT9 A;  4J8X A;  2HIO D;  5GSU A;  3C1B C;  4KHA B;  3R45 B;  4WNN A;  3AYW C;  2JE5 A;  5BNX A;  1M18 A;  4DRB A;  3AV2 A;  3A6N A;  4ZUX A; 
#chains in the Genus database with same CATH homology
 3WTP C;  4KGC D;  4R8P C;  3W97 B;  3AL0 C;  1P3I C;  3NQU B;  4CAY B;  3AFA C;  1ULY A;  1ID3 A;  3REL D;  2DF4 C;  3W96 A;  1P3O C;  1ZLA D;  3WAA A;  5AV5 D;  3LEL D;  3WA9 D;  5GT0 A;  4M6B A;  4NE5 A;  2YFV B;  1M19 A;  4QLC B;  4J8W B;  4H9P B;  3LJA C;  3KWQ D;  5B1M B;  1P3K A;  1HQ3 C;  1P3M C;  5AVC D;  3P5J B;  1P3B A;  5F99 D;  4HGA B;  3C1C D;  1F66 C;  3KXB A;  4G92 B;  2PYO A;  1P3A D;  2JSS A;  1WWI A;  4E45 A;  3X1S D;  2FJ7 B;  1P3L B;  3AYW D;  4J8V B;  5E5A D;  1P3F D;  5G49 A;  4DQY B;  2Y2N A;  4H9Q B;  5CPJ C;  3AZN A;  3W98 A;  1H3O B;  4ZBJ C;  5GSU B;  5CP6 D;  2CV5 A;  2ZY2 A;  5B31 C;  3MNN C;  4J8U B;  1A7W A;  1P3I D;  1M18 B;  1P3O D;  2F8N K;  3A6N B;  1P3P C;  3B6G C;  4ZUX B;  2BYK A;  1P34 C;  4JJN D;  4AWL B;  3MGR B;  2NZD A;  3EG5 B;  1PZR A;  4E44 A;  3MGP C;  5B0Z C;  1B67 A;  4H9N A;  2ZM5 A;  5CPI B;  1P3G D;  3AZE A;  3W99 C;  5GT0 B;  3LJA D;  3UT9 C;  3VH5 A;  3REK A;  2W8S A;  2Y2M A;  1HQ3 D;  1M19 B;  2XD1 A;  1KX3 D;  4XZQ B;  5BNV A;  1EQZ D;  3WKJ C;  3MVD B;  4KGC A;  4WU8 D;  4KUD B;  1P3K B;  2YFW A;  3AZL A;  3REL A;  3MGS B;  3AN2 A;  5B40 C;  1U35 C;  4YS3 C;  3WA9 A;  1KX4 B;  3X1U C;  3REH D;  5B32 G;  4Z5T C;  4WZS B;  3TU4 C;  3AZI D;  3MNN D;  3AZM D;  3AZG C;  5G49 B;  2ARO C;  1P3P D;  3AZK A;  5DNN D;  5B32 D;  3AZN B;  4WU9 C;  3W98 B;  1S32 C;  5B1L D;  2CV5 B;  1P34 D;  3KFU G;  5AVB D;  4Z66 A;  4UPK A;  2Y2P A;  3C1C A;  4XUJ B;  5B0Z D;  1P3B C;  4KHA A;  3R45 A;  3W99 D;  1R4V A;  3KXB C;  3O62 B;  3X1S A;  2Y2H A;  5DNM B;  2IO5 C;  5E5A A;  1P3F A;  4H9N B;  3VH5 W;  5B24 A;  1KU5 A;  3WKJ D;  4WV4 B;  2HIO B;  4G91 C;  2HUE B;  5B2J C;  1JFI B;  2LY8 A;  5BNV B;  4X23 D;  3MGQ C;  5AY8 D;  3AZH C;  1U35 D;  2YFV A;  4KGC B;  4JJN A;  2J8P A;  4QLC A;  3B0C W;  3REL B;  2NQB D;  1ZLA B;  5AV5 B;  3LEL B;  3TU4 D;  5B1M A;  1P3G A;  3WA9 B;  5KDM B;  3AZG D;  3A1K A;  2ARO D;  4YM6 C;  4WU9 D;  5AV6 D;  3UTB D;  1KX3 A;  2ZY5 A;  1EQZ A;  2Y2Q A;  4WU8 A;  5JRG D;  2G5H C;  3KWQ B;  3REI C;  1TZY C;  5GXQ D;  2FJ7 A;  1AOI C;  5AVC B;  3X1V D;  4DRA A;  3REJ C;  5F99 B;  3REH A;  1H3O A;  1HTA A;  3C1C B;  3F6T A;  4J8U A;  3X1S B;  3AZI A;  5AV9 D;  3AZF C;  5GT3 D;  5E5A B;  2CWE A;  3KUY C;  3UTA C;  1P3F B;  5B24 B;  5DNN A;  5B32 A;  3MGR A;  3MGQ D;  1KX5 C;  3AV1 C;  5B1L A;  5BT1 D;  5CP6 B;  5AV8 D;  5AVB A;  5CPI A;  4Z2M G;  1P3I B;  5B2I C;  4Z66 C;  1P3O B;  1M1A C;  5B33 D;  5B0Y A;  4JJN B;  4XZQ A;  4YM6 D;  3B6F D;  3MVD A;  4KUD A;  3LZ1 C;  1P3G B;  3W97 C;  3MGS A;  3LJA B;  3X1T D;  1TZY D;  1KX4 A;  1HQ3 B;  1AOI D;  4LD9 C;  2F8N G;  1KX3 B;  4X23 A;  1EQZ B;  5AY8 A;  3REJ D;  4WU8 B;  3C1B D;  2NQB A;  2F8N D;  4QLC C;  4J8W C;  3AZF D;  3REH B;  3WTP D;  4R8P D;  3AZJ C;  2VQR A;  2Y2O A;  3AFA D;  2Y2J A;  1KX5 D;  3AV1 D;  5AV6 A;  3UTB A;  3AZI B;  1B6W A;  4XUJ A;  4HGA C;  3MNN B;  3AZM B;  5B2I D;  5JRG A;  4G92 C;  3O62 A;  3LZ0 C;  1P3P B;  5DNN B;  5B32 B;  5B1L B;  5DNM A;  5CPK C;  1P34 B;  3X1V A;  1P3L C;  5AVB B;  4J8V C;  2HIO A;  5B0Z B;  4J8X C;  3LZ1 D;  5GSU C;  5B0Y B;  1P3M D;  5AV9 A;  1JFI A;  1M18 C;  5GT3 A;  3AV2 C;  3A6N C;  4LD9 D;  4ZUX C;  1F66 D;  4WJ3 C;  2DQN C;  3MGR C;  1ZLA A;  1BH9 A;  3IP4 C;  5AV8 A;  5AV5 A;  3LEL A;  1ID3 C;  3W96 C;  3WAA C;  5KDM A;  5B31 G;  4X23 B;  1U35 B;  5AY8 B;  5GT0 C;  5B33 A;  4NE6 A;  5CPJ D;  4H9R A;  2F2A C;  3NQJ A;  3AZJ D;  2FFF B;  5B31 D;  2JCH A;  1M19 C;  3B6F A;  2NQB B;  1Q9C A;  4XZQ C;  3KWQ A;  3TU4 B;  3A1I A;  3B6G D;  4NFT A;  5AVC A;  1P3K C;  3X1T A;  2ARO B;  3LZ0 D;  5F99 A;  4WU9 B;  5AV6 B;  3UTB B;  2RIQ A;  3MGP D;  5CPK D;  1P3A A;  5JRG B;  2PYO C;  3H0L C;  3C1B A;  5GXQ B;  3V9R A;  4J8X D;  3UT9 D;  3AYW A;  3H0M C;  3X1V B;  3AV2 D;  3WTP A;  5CP6 A;  4R8P A;  3W98 C;  3AZN C;  1P3I A;  3AFA A;  2CV5 C;  2Y2G A;  4G91 B;  1P3O A;  5AV9 B;  5B40 D;  5GT3 B;  3EPJ A;  1ID3 D;  4YS3 D;  3W96 D;  4H9S A;  3WAA D;  3X1U D;  2ZY3 A;  3MGQ B;  3O62 C;  2NZD C;  1BH9 B;  1TAF B;  5AV8 B;  4Z5T D;  3EPL A;  3B0D C;  1W2E A;  3EPH A;  1Z2C B;  5FUG A;  3VH6 T;  3AZE C;  3LJA A;  5B33 B;  4H9R B;  2HUE C;  1HQ3 A;  1S32 D;  1P3K D;  3NQJ B;  3REK C;  4YM6 B;  3B6F B;  1P3B D;  1F66 A;  4KGC C;  3KXB D;  3AZL C;  3X1T B;  2PYO D;  2RVQ C;  3REL C;  1TZY B;  3VH6 A;  3AN2 C;  1T3U A;  1AOI B;  3LEL C;  5C3I B;  3WA9 C;  3REJ B;  1P3A B;  3C1B B;  3V9R B;  5B31 A;  3MNN A;  3AYW B;  3AZM A;  2F8N B;  4UUZ B;  5B2J D;  3AZF B;  1P3P A;  4EO5 C;  3AZH D;  3WTP B;  3AZK C;  4R8P B;  1P34 A;  3AFA B;  1KX5 B;  3AV1 B;  3MGP A;  5B0Z A;  2NZD D;  2Y2I A;  3C1C C;  3W99 A;  5B2I B;  3AZE D;  3X1S C;  5E5A C;  3REK D;  3WKJ A;  1P3F C;  5B24 C;  5FUG B;  4Z2M H;  3REI D;  3LZ1 B;  5CP6 C;  1P3M B;  5B40 A;  3AZL D;  2RVQ D;  1U35 A;  4YS3 A;  1BH8 B;  3AN2 D;  3X1U A;  4LD9 B;  3VH6 W;  1F66 B;  4H9S C;  4JJN C;  1N1J A;  2Y2L A;  4H9O B;  4Z5T A;  3TU4 A;  3AZG A;  5B1M C;  3KUY D;  3UTA D;  1P3G C;  2ARO A;  1F1E A;  5CPJ B;  4WU9 A;  2F8N H;  4ZBJ B;  1S32 A;  3AZK D;  3AZJ B;  2ZY4 A;  5B31 B;  1KX3 C;  1EQZ C;  4Z66 D;  3B6G B;  1M1A D;  5GXQ A;  4WU8 C;  2FJ7 C;  3LZ0 B;  3MGP B;  5CPK B;  5BS7 A;  3REH C;  2Y2K A;  3W99 B;  3B0B A;  3W97 D;  5B24 D;  4J8U C;  3UT9 B;  4J8X B;  3AZI C;  4WNN B;  5B2J A;  3AZM C;  5BNX B;  3AZH A;  3MGQ A;  3WKJ B;  3KSY A;  3VH5 T;  4AWL C;  3AV2 B;  5DNN C;  5B32 C;  1TAF A;  5B1L C;  3H0R C;  5AVB C;  5CPI C;  4QLC D;  5B40 B;  4J8W D;  1ID3 B;  4YS3 B;  3W96 B;  3WAA B;  1BFM A;  3X1U B;  3WTP E;  5B1M D;  2BG1 A;  4CSR A;  5B0Y C;  4YM6 A;  1N1J B;  3B0C T;  4Z5T B;  5BO0 A;  3MVD C;  3AZG B;  4KUD C;  3REI A;  1TZY A;  3MGS C;  1S32 B;  1AOI A;  1KX4 C;  1P3L D;  2FJ7 D;  2BYM A;  3REJ A;  4J8V D;  4X23 C;  5AY8 C;  1P3B B;  5GSU D;  2F8N A;  3KXB B;  2PYO B;  4UUZ A;  4J8U D;  3AZF A;  2NQB C;  1M18 D;  2IO5 B;  3KUY A;  3A6N D;  3UTA A;  4ZUX D;  1KX5 A;  3AV1 A;  3MGR D;  5AV6 C;  3UTB C;  2XD5 A;  5JA4 A;  4XUJ C;  5B2I A;  5CPI D;  5B2J B;  1M1A A;  3AZH B;  2G5I C;  5JRG C;  5GT0 D;  5GXQ C;  5DNM C;  2BYK B;  5B0Y D;  3X1V C;  1M19 D;  2NZD B;  4XZQ D;  2HIO C;  3B0D B;  3LZ1 A;  3MVD D;  3FDD A;  5BS7 C;  3W97 A;  4KUD D;  1P3M A;  3AZE B;  3NQU A;  4CAY A;  4CSR B;  3MGS D;  5AV9 C;  1BH8 A;  4LD9 A;  5GT3 C;  3REK B;  5BO0 B;  1KX4 D;  4H9O A;  3REI B;  5BT1 C;  1ZLA C;  5AV8 C;  5AV5 C;  2YFW B;  3AZL B;  4J8W A;  2BYM B;  4H9P A;  3AN2 B;  5CPJ A;  4NE3 A;  5B33 C;  3AZJ A;  1WWS A;  3AZN D;  3W98 D;  2UWX A;  2CV5 D;  3B6G A;  3B6F C;  3KWQ C;  5CHL B;  3EPK A;  4XUJ D;  3KUY B;  3UTA B;  3LZ0 A;  4EO5 B;  2L5A A;  5AVC C;  3X1T C;  3O62 D;  3AZK B;  5CPK A;  5F99 C;  1P3L A;  5DNM D;  4J8V A;  5C3I C;  5JA4 B;  4Z66 B;  1M1A B;  1P3A C;  4H9Q A;  3UT9 A;  4J8X A;  2HIO D;  5GSU A;  3C1B C;  4KHA B;  3R45 B;  4WNN A;  3AYW C;  2JE5 A;  5BNX A;  1M18 A;  4DRB A;  3AV2 A;  3A6N A;  4ZUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...