4J8VD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vD00
3W99C 5AVCA 3WKJA 1H3OA 1M19D 4YM6D 3REKA 3AV2C 3VH6W 3AZLC 3MGSB 5CPJD 3B0CW 5B0ZC 5BT1C 1KU5A 5AY8D 5AVBA 3KWQA 2NQBD 3MGQD 3AV1D 3KSYA 5AV5D 5GT0D 5CHLB 4H9RB 3B0BA 3O62C 2F8NH 5F99B 3C1BD 3RELA 3AV2A 3AZLA 1P3BD 1HQ3D 5B24B 4Z5TB 5B0ZA 3W97C 3WTPB 5GSUC 3AN2B 1KX5D 2FJ7C 5B31B 1P3KB 5AV8B 3AZEC 4G91B 4YS3D 3REJC 3REHD 3O62A 3X1UA 3MNND 4ZUXB 5AVCD 3WKJD 5GXQB 2YFVA 3W97A 3REKD 1ID3D 3X1VB 4NE5A 5E5AB 4WU9D 4J8XD 5B2JB 4WU8D 3AZEA 2FJ7A 4H9PB 2YFWB 3R45A 3REJA 2IO5B 5B2ID 3AYWB 1ZLAC 3X1TB 5CP6C 4YM6B 3WTPE 1U35D 3WAAC 3RELD 3AZID 1BH8A 5CPJB 5AY8B 3AZGB 2NQBB 3MGQB 3AV1B 2CWEA 5B0YD 5AV5B 1P3FB 5FUGA 5GT0B 2AROB 3MGSC 1WWIA 1ZLAA 4X23D 2RVQD 3X1UD 2PYOD 5B1LA 1P3BB 1HQ3B 3LJAD 5F99C 1KX5B 3V9RB 5B32G 4YS3B 3REHB 5GT3D 5B24C 4Z66B 4J8UC 3MNNB 3AN2C 5B31C 1P3KC 5AV8C 4G91C 4H9RA 4CAYB 3REKB 1ID3B 3VH6A 4H9SC 4WU8B 4J8XB 4ZUXC 4WU9B 4EO5B 3LZ1D 5GXQC 4M6BA 5B24A 4Z5TA 5BS7C 5B2IB 3W98C 3WTPA 3AN2A 1BFMA 3X1VC 5E5AC 5B31A 1P3KA 5B2JC 5AV8A 1U35B 5CPKA 3RELB 2IO5C 3AZIB 3AYWC 1P3IA 2LY8A 4H9SA 5B1LD 4ZUXA 5GXQA 1M19C 4YM6C 5BS7A 5B0YB 4ZBJC 3X1SA 3X1VA 5E5AA 5CPJC 5B2JA 4X23B 4H9PA 2YFWA 5AY8C 4NE6A 1KX4D 2NQBC 3NQUB 5G49B 4XUJD 5AV5C 3X1UB 2HIOA 3MGQC 3AYWA 3AV1C 2PYOB 1EQZB 5GT0C 2AROC 4WZSB 3LJAB 3MGPD 3TU4B 3X1TA 3C1BC 1P3BC 5B32D 5GT3B 1HQ3C 5CPJA 1P34D 4Z5TD 5AY8A 3AZGA 2NQBA 3MGQA 3WTPD 1KX5C 5AV5A 1P3FA 3MGRA 1P3KD 5GT0A 2AROA 4YS3C 3REHC 5CPKD 3LELB 4Z66C 1P3ID 3MNNC 1BH8B 3LZ1B 5AVCC 1P3BA 1HQ3A 3REKC 4Z2MH 1ID3C 3AZJD 4WU8C 3X1SD 3LZ0D 3V9RA 4EO5C 4J8XC 4WU9C 3NQJA 4YS3A 1P3LD 3REHA 2F8NG 5B2IC 4Z66A 2HIOD 3UT9D 3MNNA 5B1LB 5DNND 3A6ND 2BYKB 3X1TD 1U35C 5BNXB 4CAYA 3RELC 3AZIC 1ID3A 1M18A 4NFTA 4WU9A 4WU8A 4J8XA 3C1CD 1KX4B 4XUJB 3AZGD 5B0YC 5B2IA 1P3FD 3MGRD 2AROD 3MGPB 4X23C 1U35A 2RVQC 4R8PB 3X1UC 4LD9D 3AZIA 2PYOC 2L5AA 5B32B 1P34B 3B6GD 3LJAC 5B0YA 5B33A 5GT3C 3UTAD 5CPKB 4XZQD 4X23A 1P3GB 4Z66D 5C3IB 1P3IB 2HUEB 3NQUA 5G49A 3VH5T 2PYOA 1EQZA 4J8VD 3LJAA 3TU4A 3AZJB 1M18D 3X1SB 3LZ0B 3LZ1C 1P3LB 5GT3A 2HIOB 3UT9B 5AV6D 5DNNB 4E45A 3A6NB 4H9QB 1F66D 2BYMB 3LELA 4CSRA 5B1LC 3LZ1A 3C1CB 5B33D 3MGRB 3KUYD 4G92B 1KX4C 4XUJC 4LD9B 1EQZD 3B6GB 3MGPC 2BYKA 3TU4D 5JRGD 5BNXA 4KUDA 3NQJB 5B32C 3UTAB 3REID 1P34C 3WA9A 4XZQB 3AZMB 4Z5TC 1KX4A 5B1MD 4XUJA 3WTPC 4J8VB 3MGPA 5CPKC 3AZHD 3LELD 5C3IC 1P3IC 2HUEC 1P3OD 1M18B 4R8PA 5JA4B 5B32A 1P34A 2F8NB 3VH5W 5AV6B 1BH9A 3AZJC 3X1SC 3LZ0C 1P3LC 1TZYD 1P3AD 1F66B 5DNMA 1P3GA 4E44A 2HIOC 5AV9D 3UT9C 5DNNC 5CPID 3A6NC 4QLCD 3X1TC 3AZFD 5B33B 3KUYB 1JFIB 4KUDD 3AZJA 3LZ0A 3B6FD 3WA9D 1P3LA 3C1CC 3AZGC 1P3FC 3MGRC 3UT9A 1AOIB 5DNNA 4G92C 3A6NA 4H9QA 5JRGB 2BYMA 4LD9C 4Z2MG 4R8PD 1S32D 5BNVB 3REIB 3B6GC 3C1CA 5B1MB 1P3PD 3UTAC 3AZHB 4XZQC 4CSRB 5DNMD 1P3GD 1P3OB 4LD9A 4J8VC 3B6GA 1KX3D 1M18C 1TZYB 1P3AB 1N1JB 3UTAA 4XZQA 3AZMA 5AV9B 1R4VA 5AV6C 5CPIB 4QLCB 3B0DB 4H9NB 4DRBA 4J8VA 1F66C 3AZFB 1P3MD 5B40D 4KUDB 3W96B 3AZKB 3B6FB 3WA9B 4WNNB 5JA4A 2F8NA 5B33C 5AV6A 3KUYC 2NZDD 1F66A 4KGCD 1S32B 1AOIC 1EQZC 3WAAB 3VH5A 3TU4C 5JRGC 1P3PB 1BH9B 1TAFB 3KUYA 1JFIA 1A7WA 3REIC 3AZND 5DNMB 3AZMD 5B1MC 1M1AD 4WV4B 1AOIA 3AZHC 3LELC 4NE3A 5JRGA 1P3OC 1KX3B 1WWSA 3W99A 4JJND 4UUZB 5BNVA 3REIA 3AFAD 2CV5B 2F8ND 5B1MA 3MVDB 4J8UB 1TZYC 4J8WD 3UTBD 1P3AC 3AZHA 3KXBD 4H9OB 1P3MB 5B40B 5AV9C 1P3OA 5CPIC 4KHAB 4QLCC 3B0DC 1B67A 3AZFC 5BO0B 4KUDC 3W96C 3AZKC 2NZDB 3B6FC 3WA9C 3W98B 4AWLB 1TZYA 1P3AA 1N1JA 5GSUA 4KGCB 5AV9A 5CPIA 1AOID 4QLCA 4H9NA 5AVBD 3KWQD 3AZFA 4R8PC 3W99D 1S32C 3W96A 3AZKA 1M19B 3B6FA 4WNNA 3AZNB 2F8NK 4ZBJB 4DRAA 3AV2D 1ULYA 3AZLD 1P3PC 1M1AB 5B0ZD 5BT1D 5DNMC 1P3GC 5KDMB 4JJNB 1S32A 5CP6A 3O62D 3AFAB 3C1BB 3WAAA 1P3PA 1KX3C 1TAFA 1Q9CA 3UTBB 4J8WB 3W97D 5GSUD 3KXBB 2CV5C 2FJ7D 3AZED 3MGSA 3REJD 3MVDC 4HGAB 5B31G 1P3MC 5AVCB 5B40C 3WKJB 1KX3A 3W96D 1H3OB 3AZKD 4UUZA 5F99A 2CV5A 2NZDC 5AVBB 3KWQB 3MVDA 4AWLC 4J8UA 4KGCC 4H9OA 1P3MA 5B40A 3W99B 1ZLAD 3VH6T 5CP6D 4KHAA 3B0CT 3WAAD 3AV2B 3AZLB 5BO0A 5B0ZB 2NZDA 3W98A 3AZNC 3AZMC 4KGCA 1B6WA 1M1AC 3MGSD 3O62B 4JJNC 1M19A 2YFVB 4YM6A 5GSUB 3AFAC 5F99D 3W97B 3AZNA 2FJ7B 2CV5D 3AZEB 1M1AA 3REJB 3R45B 5B24D 3UTBC 3MVDD 4J8WC 4J8UD 3AV1A 1F1EA 3KXBC 3AN2D 5B31D 5AV8D 5KDMA 4JJNA 3AFAA 3C1BA 4HGAC 1HTAA 4ZUXD 3WKJC 5GXQD 3UTBA 4J8WA 3W98D 5FUGB 1KX5A 3KXBA 2JSSA 5E5AD 3X1VD 1ZLAB 5B2JD 5CP6B 5AVBC 3KWQC 3AYWD
chains in the Genus database with same CATH superfamily
3W99C 5AVCA 3WKJA 1H3OA 1M19D 4YM6D 3REKA 3AV2C 3VH6W 3AZLC 2Y2OA 3MGSB 5CPJD 3B0CW 5B0ZC 5BT1C 1KU5A 5AY8D 5AVBA 3KWQA 2NQBD 3MGQD 3AV1D 3KSYA 5AV5D 3EPHA 2J8PA 5GT0D 5CHLB 4H9RB 3B0BA 3O62C 2F8NH 5F99B 3C1BD 3RELA 3AV2A 3AZLA 1P3BD 1HQ3D 5B24B 4Z5TB 5B0ZA 3W97C 3WTPB 5GSUC 3AN2B 1KX5D 2FJ7C 5B31B 1P3KB 3A1IA 5AV8B 3AZEC 4G91B 4YS3D 3REJC 3REHD 3O62A 3X1UA 3MNND 4ZUXB 2ZY5A 5AVCD 3WKJD 5GXQB 2Y2QA 2YFVA 3W97A 3REKD 1ID3D 3X1VB 4NE5A 5E5AB 4WU9D 4J8XD 5B2JB 4WU8D 3AZEA 2FJ7A 4H9PB 2YFWB 3R45A 3REJA 3KFUG 3F6TA 2IO5B 5B2ID 3AYWB 1ZLAC 2DQNC 5CP6C 3X1TB 4YM6B 3WTPE 1U35D 3WAAC 3RELD 3AZID 1BH8A 5CPJB 5AY8B 3AZGB 2NQBB 3MGQB 3AV1B 2CWEA 5B0YD 5AV5B 1P3FB 5FUGA 5GT0B 2AROB 3MGSC 1WWIA 1ZLAA 2Y2NA 4X23D 2RVQD 3X1UD 2PYOD 5B1LA 1P3BB 1HQ3B 3LJAD 5F99C 1KX5B 3V9RB 5B32G 4YS3B 3REHB 5GT3D 5B24C 4Z66B 4J8UC 3MNNB 3AN2C 5B31C 1P3KC 5AV8C 4G91C 4H9RA 4CAYB 3REKB 1ID3B 3VH6A 4H9SC 4WU8B 4J8XB 4ZUXC 4WU9B 4EO5B 3LZ1D 2UWXA 5GXQC 4M6BA 5B24A 4Z5TA 5BS7C 5B2IB 3W98C 3WTPA 3AN2A 1BFMA 3X1VC 5E5AC 5B31A 1P3KA 5B2JC 5AV8A 1U35B 5CPKA 3RELB 2IO5C 3AZIB 3AYWC 3EPKA 1P3IA 2LY8A 4H9SA 5B1LD 4ZUXA 3FDDA 5GXQA 1M19C 4YM6C 5BS7A 5B0YB 4ZBJC 3X1SA 3X1VA 5E5AA 5CPJC 5B2JA 4X23B 4H9PA 2YFWA 5AY8C 4NE6A 1KX4D 2NQBC 3NQUB 5G49B 4XUJD 5AV5C 3X1UB 2HIOA 3MGQC 3AYWA 3AV1C 2PYOB 1EQZB 5GT0C 2AROC 4WZSB 3LJAB 3MGPD 3TU4B 3X1TA 3C1BC 1P3BC 5B32D 5GT3B 1HQ3C 5CPJA 1P34D 4Z5TD 5AY8A 3AZGA 2NQBA 3MGQA 3WTPD 1KX5C 5AV5A 1P3FA 3MGRA 1P3KD 5GT0A 2AROA 4YS3C 3REHC 5CPKD 3LELB 4Z66C 1P3ID 3MNNC 1BH8B 3LZ1B 5AVCC 1P3BA 1HQ3A 3A1KA 3REKC 4Z2MH 1ID3C 3AZJD 4WU8C 3X1SD 3LZ0D 3V9RA 4EO5C 4J8XC 4WU9C 3NQJA 4YS3A 2Y2PA 2Y2MA 3REHA 1P3LD 2Y2HA 2F8NG 5B2IC 4Z66A 2HIOD 3UT9D 3MNNA 1PZRA 5B1LB 5DNND 3A6ND 2BYKB 3X1TD 1U35C 5BNXB 4CAYA 3RELC 3AZIC 1ID3A 1M18A 4NFTA 4WU9A 4WU8A 4J8XA 3C1CD 1KX4B 4XUJB 3AZGD 5B0YC 5B2IA 1P3FD 3MGRD 2AROD 2XD1A 3MGPB 4X23C 1U35A 2RVQC 4R8PB 3X1UC 4LD9D 3AZIA 2PYOC 2L5AA 5B32B 1P34B 3AL0C 3B6GD 3LJAC 5B0YA 5B33A 5GT3C 3UTAD 5CPKB 4XZQD 4X23A 1P3GB 5C3IB 4Z66D 1P3IB 2HUEB 2JCHA 3NQUA 5G49A 3VH5T 2PYOA 1EQZA 4J8VD 3LJAA 3TU4A 3AZJB 1M18D 3X1SB 3LZ0B 3EPJA 3LZ1C 1P3LB 2JE5A 5GT3A 2HIOB 3UT9B 5AV6D 5DNNB 4E45A 3A6NB 4H9QB 1F66D 2BYMB 3LELA 4CSRA 5B1LC 3LZ1A 1W2EA 3C1CB 5B33D 3MGRB 3KUYD 2ZY2A 4G92B 2F2AC 1KX4C 4XUJC 4LD9B 1EQZD 3B6GB 3MGPC 2BYKA 2XD5A 2ZY4A 3TU4D 5JRGD 5BNXA 4KUDA 3NQJB 5B32C 3UTAB 3REID 1P34C 3WA9A 4XZQB 3AZMB 4Z5TC 1KX4A 5B1MD 4XUJA 3WTPC 4J8VB 3MGPA 5CPKC 3AZHD 3LELD 5C3IC 1P3IC 2HUEC 1P3OD 1M18B 4R8PA 5JA4B 5B32A 1P34A 2F8NB 3VH5W 5AV6B 1BH9A 3AZJC 3X1SC 3LZ0C 1P3LC 1TZYD 1P3AD 1F66B 5DNMA 1P3GA 4E44A 2HIOC 5AV9D 3UT9C 5DNNC 5CPID 3A6NC 4QLCD 3X1TC 3AZFD 5B33B 3KUYB 1JFIB 4KUDD 3AZJA 3LZ0A 3B6FD 3WA9D 1P3LA 3C1CC 3AZGC 1P3FC 3MGRC 3UT9A 1AOIB 5DNNA 4G92C 3A6NA 4H9QA 2Y2GA 5JRGB 2BYMA 4LD9C 4Z2MG 4R8PD 1S32D 5BNVB 3REIB 3B6GC 3C1CA 5B1MB 1P3PD 3UTAC 3AZHB 4XZQC 4CSRB 5DNMD 1P3GD 1P3OB 4LD9A 2Y2IA 4J8VC 3B6GA 1KX3D 1M18C 1TZYB 1P3AB 1N1JB 3UTAA 4XZQA 3AZMA 5AV9B 1R4VA 5AV6C 5CPIB 4QLCB 3B0DB 4H9NB 4DRBA 4J8VA 1F66C 3AZFB 1P3MD 5B40D 4KUDB 3W96B 3AZKB 3B6FB 3WA9B 4WNNB 5JA4A 2G5IC 2F8NA 5B33C 5AV6A 3KUYC 2NZDD 1F66A 4KGCD 1S32B 3P5JB 1AOIC 1EQZC 3WAAB 3VH5A 3TU4C 5JRGC 1P3PB 2Y2LA 1BH9B 1TAFB 3KUYA 1JFIA 1A7WA 2Y2JA 3REIC 3AZND 5DNMB 3AZMD 5B1MC 1M1AD 4WV4B 1AOIA 3AZHC 3LELC 4NE3A 1Z2CB 5JRGA 1P3OC 1KX3B 1WWSA 3W99A 4JJND 4UUZB 5BNVA 3REIA 3AFAD 2CV5B 2F8ND 5B1MA 3MVDB 4J8UB 1TZYC 4J8WD 3UTBD 1P3AC 3AZHA 3KXBD 4H9OB 1P3MB 5B40B 5AV9C 1P3OA 5CPIC 4KHAB 4QLCC 3B0DC 1B67A 3AZFC 5BO0B 4KUDC 3W96C 3AZKC 2NZDB 3B6FC 3WA9C 3W98B 4AWLB 1TZYA 1P3AA 1N1JA 3EG5B 5GSUA 4KGCB 5AV9A 2ZY3A 5CPIA 1AOID 4QLCA 4H9NA 5AVBD 3KWQD 3AZFA 4UPKA 4R8PC 3W99D 1S32C 3W96A 3AZKA 1M19B 3B6FA 4WNNA 3AZNB 2F8NK 4ZBJB 4DRAA 3AV2D 1ULYA 3AZLD 1P3PC 1M1AB 5B0ZD 5BT1D 5DNMC 1P3GC 2Y2KA 5KDMB 4JJNB 1S32A 5CP6A 3O62D 3AFAB 3C1BB 2DF4C 3WAAA 1P3PA 1KX3C 1TAFA 1Q9CA 3UTBB 4J8WB 3IP4C 3W97D 5GSUD 3KXBB 2CV5C 2FJ7D 2FFFB 3AZED 3MGSA 3REJD 3MVDC 4WJ3C 4HGAB 5B31G 1P3MC 5AVCB 5B40C 3WKJB 1KX3A 3W96D 1H3OB 3AZKD 4UUZA 2BG1A 5F99A 2CV5A 2NZDC 5AVBB 3KWQB 2ZM5A 3MVDA 4AWLC 4J8UA 4KGCC 4H9OA 1P3MA 5B40A 3W99B 1ZLAD 3VH6T 5CP6D 1T3UA 3H0LC 4KHAA 3B0CT 3WAAD 3AV2B 3AZLB 5BO0A 5B0ZB 3H0MC 2NZDA 3W98A 3AZNC 3AZMC 4KGCA 1B6WA 3EPLA 1M1AC 3MGSD 3O62B 2VQRA 4JJNC 1M19A 2YFVB 4YM6A 5GSUB 3AFAC 5F99D 4DQYB 3AZNA 3W97B 2FJ7B 2CV5D 3AZEB 1M1AA 3REJB 3R45B 2RIQA 5B24D 3UTBC 3MVDD 4J8WC 4J8UD 3AV1A 1F1EA 3KXBC 3AN2D 5B31D 5AV8D 5KDMA 4JJNA 3AFAA 3C1BA 4HGAC 1HTAA 4ZUXD 2W8SA 3WKJC 3H0RC 5GXQD 3UTBA 4J8WA 3W98D 5FUGB 2G5HC 1KX5A 3KXBA 2JSSA 5E5AD 3X1VD 1ZLAB 5B2JD 5CP6B 5AVBC 3KWQC 3AYWD
chains in the Genus database with same CATH topology
3W99C 5AVCA 3WKJA 1H3OA 1M19D 4YM6D 3REKA 3AV2C 3VH6W 3AZLC 2Y2OA 3MGSB 5CPJD 3B0CW 5B0ZC 5BT1C 1KU5A 5AY8D 5AVBA 3KWQA 2NQBD 3MGQD 3AV1D 3KSYA 5AV5D 3EPHA 2J8PA 5GT0D 5CHLB 4H9RB 3B0BA 3O62C 2F8NH 5F99B 3C1BD 3RELA 3AV2A 3AZLA 1P3BD 1HQ3D 5B24B 4Z5TB 5B0ZA 3W97C 3WTPB 5GSUC 3AN2B 1KX5D 2FJ7C 5B31B 1P3KB 3A1IA 5AV8B 3AZEC 4G91B 4YS3D 3REJC 3REHD 3O62A 3X1UA 3MNND 4ZUXB 2ZY5A 5AVCD 3WKJD 5GXQB 2Y2QA 2YFVA 3W97A 3REKD 1ID3D 3X1VB 4NE5A 5E5AB 4WU9D 4J8XD 5B2JB 4WU8D 3AZEA 2FJ7A 4H9PB 2YFWB 3R45A 3REJA 3KFUG 3F6TA 2IO5B 5B2ID 3AYWB 1ZLAC 2DQNC 5CP6C 3X1TB 4YM6B 3WTPE 1U35D 3WAAC 3RELD 3AZID 1BH8A 5CPJB 5AY8B 3AZGB 2NQBB 3MGQB 3AV1B 2CWEA 5B0YD 5AV5B 1P3FB 5FUGA 5GT0B 2AROB 3MGSC 1WWIA 1ZLAA 2Y2NA 4X23D 2RVQD 3X1UD 2PYOD 5B1LA 1P3BB 1HQ3B 3LJAD 5F99C 1KX5B 3V9RB 5B32G 4YS3B 3REHB 5GT3D 5B24C 4Z66B 4J8UC 3MNNB 3AN2C 5B31C 1P3KC 5AV8C 4G91C 4H9RA 4CAYB 3REKB 1ID3B 3VH6A 4H9SC 4WU8B 4J8XB 4ZUXC 4WU9B 4EO5B 3LZ1D 2UWXA 5GXQC 4M6BA 5B24A 4Z5TA 5BS7C 5B2IB 3W98C 3WTPA 3AN2A 1BFMA 3X1VC 5E5AC 5B31A 1P3KA 5B2JC 5AV8A 1U35B 5CPKA 3RELB 2IO5C 3AZIB 3AYWC 3EPKA 1P3IA 2LY8A 4H9SA 5B1LD 4ZUXA 3FDDA 5GXQA 1M19C 4YM6C 5BS7A 5B0YB 4ZBJC 3X1SA 3X1VA 5E5AA 5CPJC 5B2JA 4X23B 4H9PA 2YFWA 5AY8C 4NE6A 1KX4D 2NQBC 3NQUB 5G49B 4XUJD 5AV5C 3X1UB 2HIOA 3MGQC 3AYWA 3AV1C 2PYOB 1EQZB 5GT0C 2AROC 4WZSB 3LJAB 3MGPD 3TU4B 3X1TA 3C1BC 1P3BC 5B32D 5GT3B 1HQ3C 5CPJA 1P34D 4Z5TD 5AY8A 3AZGA 2NQBA 3MGQA 3WTPD 1KX5C 5AV5A 1P3FA 3MGRA 1P3KD 5GT0A 2AROA 4YS3C 3REHC 5CPKD 3LELB 4Z66C 1P3ID 3MNNC 1BH8B 3LZ1B 5AVCC 1P3BA 1HQ3A 3A1KA 3REKC 4Z2MH 1ID3C 3AZJD 4WU8C 3X1SD 3LZ0D 3V9RA 4EO5C 4J8XC 4WU9C 3NQJA 4YS3A 2Y2PA 2Y2MA 3REHA 1P3LD 2Y2HA 2F8NG 5B2IC 4Z66A 2HIOD 3UT9D 3MNNA 1PZRA 5B1LB 5DNND 3A6ND 2BYKB 3X1TD 1U35C 5BNXB 4CAYA 3RELC 3AZIC 1ID3A 1M18A 4NFTA 4WU9A 4WU8A 4J8XA 3C1CD 1KX4B 4XUJB 3AZGD 5B0YC 5B2IA 1P3FD 3MGRD 2AROD 2XD1A 3MGPB 4X23C 1U35A 2RVQC 4R8PB 3X1UC 4LD9D 3AZIA 2PYOC 2L5AA 5B32B 1P34B 3AL0C 3B6GD 3LJAC 5B0YA 5B33A 5GT3C 3UTAD 5CPKB 4XZQD 4X23A 1P3GB 5C3IB 4Z66D 1P3IB 2HUEB 2JCHA 3NQUA 5G49A 3VH5T 2PYOA 1EQZA 4J8VD 3LJAA 3TU4A 3AZJB 1M18D 3X1SB 3LZ0B 3EPJA 3LZ1C 1P3LB 2JE5A 5GT3A 2HIOB 3UT9B 5AV6D 5DNNB 4E45A 3A6NB 4H9QB 1F66D 2BYMB 3LELA 4CSRA 5B1LC 3LZ1A 1W2EA 3C1CB 5B33D 3MGRB 3KUYD 2ZY2A 4G92B 2F2AC 1KX4C 4XUJC 4LD9B 1EQZD 3B6GB 3MGPC 2BYKA 2XD5A 2ZY4A 3TU4D 5JRGD 5BNXA 4KUDA 3NQJB 5B32C 3UTAB 3REID 1P34C 3WA9A 4XZQB 3AZMB 4Z5TC 1KX4A 5B1MD 4XUJA 3WTPC 4J8VB 3MGPA 5CPKC 3AZHD 3LELD 5C3IC 1P3IC 2HUEC 1P3OD 1M18B 4R8PA 5JA4B 5B32A 1P34A 2F8NB 3VH5W 5AV6B 1BH9A 3AZJC 3X1SC 3LZ0C 1P3LC 1TZYD 1P3AD 1F66B 5DNMA 1P3GA 4E44A 2HIOC 5AV9D 3UT9C 5DNNC 5CPID 3A6NC 4QLCD 3X1TC 3AZFD 5B33B 3KUYB 1JFIB 4KUDD 3AZJA 3LZ0A 3B6FD 3WA9D 1P3LA 3C1CC 3AZGC 1P3FC 3MGRC 3UT9A 1AOIB 5DNNA 4G92C 3A6NA 4H9QA 2Y2GA 5JRGB 2BYMA 4LD9C 4Z2MG 4R8PD 1S32D 5BNVB 3REIB 3B6GC 3C1CA 5B1MB 1P3PD 3UTAC 3AZHB 4XZQC 4CSRB 5DNMD 1P3GD 1P3OB 4LD9A 2Y2IA 4J8VC 3B6GA 1KX3D 1M18C 1TZYB 1P3AB 1N1JB 3UTAA 4XZQA 3AZMA 5AV9B 1R4VA 5AV6C 5CPIB 4QLCB 3B0DB 4H9NB 4DRBA 4J8VA 1F66C 3AZFB 1P3MD 5B40D 4KUDB 3W96B 3AZKB 3B6FB 3WA9B 4WNNB 5JA4A 2G5IC 2F8NA 5B33C 5AV6A 3KUYC 2NZDD 1F66A 4KGCD 1S32B 3P5JB 1AOIC 1EQZC 3WAAB 3VH5A 3TU4C 5JRGC 1P3PB 2Y2LA 1BH9B 1TAFB 3KUYA 1JFIA 1A7WA 2Y2JA 3REIC 3AZND 5DNMB 3AZMD 5B1MC 1M1AD 4WV4B 1AOIA 3AZHC 3LELC 4NE3A 1Z2CB 5JRGA 1P3OC 1KX3B 1WWSA 3W99A 4JJND 4UUZB 5BNVA 3REIA 3AFAD 2CV5B 2F8ND 5B1MA 3MVDB 4J8UB 1TZYC 4J8WD 3UTBD 1P3AC 3AZHA 3KXBD 4H9OB 1P3MB 5B40B 5AV9C 1P3OA 5CPIC 4KHAB 4QLCC 3B0DC 1B67A 3AZFC 5BO0B 4KUDC 3W96C 3AZKC 2NZDB 3B6FC 3WA9C 3W98B 4AWLB 1TZYA 1P3AA 1N1JA 3EG5B 5GSUA 4KGCB 5AV9A 2ZY3A 5CPIA 1AOID 4QLCA 4H9NA 5AVBD 3KWQD 3AZFA 4UPKA 4R8PC 3W99D 1S32C 3W96A 3AZKA 1M19B 3B6FA 4WNNA 3AZNB 2F8NK 4ZBJB 4DRAA 3AV2D 1ULYA 3AZLD 1P3PC 1M1AB 5B0ZD 5BT1D 5DNMC 1P3GC 2Y2KA 5KDMB 4JJNB 1S32A 5CP6A 3O62D 3AFAB 3C1BB 2DF4C 3WAAA 1P3PA 1KX3C 1TAFA 1Q9CA 3UTBB 4J8WB 3IP4C 3W97D 5GSUD 3KXBB 2CV5C 2FJ7D 2FFFB 3AZED 3MGSA 3REJD 3MVDC 4WJ3C 4HGAB 5B31G 1P3MC 5AVCB 5B40C 3WKJB 1KX3A 3W96D 1H3OB 3AZKD 4UUZA 2BG1A 5F99A 2CV5A 2NZDC 5AVBB 3KWQB 2ZM5A 3MVDA 4AWLC 4J8UA 4KGCC 4H9OA 1P3MA 5B40A 3W99B 1ZLAD 3VH6T 5CP6D 1T3UA 3H0LC 4KHAA 3B0CT 3WAAD 3AV2B 3AZLB 5BO0A 5B0ZB 3H0MC 2NZDA 3W98A 3AZNC 3AZMC 4KGCA 1B6WA 3EPLA 1M1AC 3MGSD 3O62B 2VQRA 4JJNC 1M19A 2YFVB 4YM6A 5GSUB 3AFAC 5F99D 4DQYB 3AZNA 3W97B 2FJ7B 2CV5D 3AZEB 1M1AA 3REJB 3R45B 2RIQA 5B24D 3UTBC 3MVDD 4J8WC 4J8UD 3AV1A 1F1EA 3KXBC 3AN2D 5B31D 5AV8D 5KDMA 4JJNA 3AFAA 3C1BA 4HGAC 1HTAA 4ZUXD 2W8SA 3WKJC 3H0RC 5GXQD 3UTBA 4J8WA 3W98D 5FUGB 2G5HC 1KX5A 3KXBA 2JSSA 5E5AD 3X1VD 1ZLAB 5B2JD 5CP6B 5AVBC 3KWQC 3AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 C;  5AVC A;  3WKJ A;  1H3O A;  1M19 D;  4YM6 D;  3REK A;  3AV2 C;  3VH6 W;  3AZL C;  3MGS B;  5CPJ D;  3B0C W;  5B0Z C;  5BT1 C;  1KU5 A;  5AY8 D;  5AVB A;  3KWQ A;  2NQB D;  3MGQ D;  3AV1 D;  3KSY A;  5AV5 D;  5GT0 D;  5CHL B;  4H9R B;  3B0B A;  3O62 C;  2F8N H;  5F99 B;  3C1B D;  3REL A;  3AV2 A;  3AZL A;  1P3B D;  1HQ3 D;  5B24 B;  4Z5T B;  5B0Z A;  3W97 C;  3WTP B;  5GSU C;  3AN2 B;  1KX5 D;  2FJ7 C;  5B31 B;  1P3K B;  5AV8 B;  3AZE C;  4G91 B;  4YS3 D;  3REJ C;  3REH D;  3O62 A;  3X1U A;  3MNN D;  4ZUX B;  5AVC D;  3WKJ D;  5GXQ B;  2YFV A;  3W97 A;  3REK D;  1ID3 D;  3X1V B;  4NE5 A;  5E5A B;  4WU9 D;  4J8X D;  5B2J B;  4WU8 D;  3AZE A;  2FJ7 A;  4H9P B;  2YFW B;  3R45 A;  3REJ A;  2IO5 B;  5B2I D;  3AYW B;  1ZLA C;  3X1T B;  5CP6 C;  4YM6 B;  3WTP E;  1U35 D;  3WAA C;  3REL D;  3AZI D;  1BH8 A;  5CPJ B;  5AY8 B;  3AZG B;  2NQB B;  3MGQ B;  3AV1 B;  2CWE A;  5B0Y D;  5AV5 B;  1P3F B;  5FUG A;  5GT0 B;  2ARO B;  3MGS C;  1WWI A;  1ZLA A;  4X23 D;  2RVQ D;  3X1U D;  2PYO D;  5B1L A;  1P3B B;  1HQ3 B;  3LJA D;  5F99 C;  1KX5 B;  3V9R B;  5B32 G;  4YS3 B;  3REH B;  5GT3 D;  5B24 C;  4Z66 B;  4J8U C;  3MNN B;  3AN2 C;  5B31 C;  1P3K C;  5AV8 C;  4G91 C;  4H9R A;  4CAY B;  3REK B;  1ID3 B;  3VH6 A;  4H9S C;  4WU8 B;  4J8X B;  4ZUX C;  4WU9 B;  4EO5 B;  3LZ1 D;  5GXQ C;  4M6B A;  5B24 A;  4Z5T A;  5BS7 C;  5B2I B;  3W98 C;  3WTP A;  3AN2 A;  1BFM A;  3X1V C;  5E5A C;  5B31 A;  1P3K A;  5B2J C;  5AV8 A;  1U35 B;  5CPK A;  3REL B;  2IO5 C;  3AZI B;  3AYW C;  1P3I A;  2LY8 A;  4H9S A;  5B1L D;  4ZUX A;  5GXQ A;  1M19 C;  4YM6 C;  5BS7 A;  5B0Y B;  4ZBJ C;  3X1S A;  3X1V A;  5E5A A;  5CPJ C;  5B2J A;  4X23 B;  4H9P A;  2YFW A;  5AY8 C;  4NE6 A;  1KX4 D;  2NQB C;  3NQU B;  5G49 B;  4XUJ D;  5AV5 C;  3X1U B;  2HIO A;  3MGQ C;  3AYW A;  3AV1 C;  2PYO B;  1EQZ B;  5GT0 C;  2ARO C;  4WZS B;  3LJA B;  3MGP D;  3TU4 B;  3X1T A;  3C1B C;  1P3B C;  5B32 D;  5GT3 B;  1HQ3 C;  5CPJ A;  1P34 D;  4Z5T D;  5AY8 A;  3AZG A;  2NQB A;  3MGQ A;  3WTP D;  1KX5 C;  5AV5 A;  1P3F A;  3MGR A;  1P3K D;  5GT0 A;  2ARO A;  4YS3 C;  3REH C;  5CPK D;  3LEL B;  4Z66 C;  1P3I D;  3MNN C;  1BH8 B;  3LZ1 B;  5AVC C;  1P3B A;  1HQ3 A;  3REK C;  4Z2M H;  1ID3 C;  3AZJ D;  4WU8 C;  3X1S D;  3LZ0 D;  3V9R A;  4EO5 C;  4J8X C;  4WU9 C;  3NQJ A;  4YS3 A;  1P3L D;  3REH A;  2F8N G;  5B2I C;  4Z66 A;  2HIO D;  3UT9 D;  3MNN A;  5B1L B;  5DNN D;  3A6N D;  2BYK B;  3X1T D;  1U35 C;  5BNX B;  4CAY A;  3REL C;  3AZI C;  1ID3 A;  1M18 A;  4NFT A;  4WU9 A;  4WU8 A;  4J8X A;  3C1C D;  1KX4 B;  4XUJ B;  3AZG D;  5B0Y C;  5B2I A;  1P3F D;  3MGR D;  2ARO D;  3MGP B;  4X23 C;  1U35 A;  2RVQ C;  4R8P B;  3X1U C;  4LD9 D;  3AZI A;  2PYO C;  2L5A A;  5B32 B;  1P34 B;  3B6G D;  3LJA C;  5B0Y A;  5B33 A;  5GT3 C;  3UTA D;  5CPK B;  4XZQ D;  4X23 A;  1P3G B;  4Z66 D;  5C3I B;  1P3I B;  2HUE B;  3NQU A;  5G49 A;  3VH5 T;  2PYO A;  1EQZ A;  4J8V D;  3LJA A;  3TU4 A;  3AZJ B;  1M18 D;  3X1S B;  3LZ0 B;  3LZ1 C;  1P3L B;  5GT3 A;  2HIO B;  3UT9 B;  5AV6 D;  5DNN B;  4E45 A;  3A6N B;  4H9Q B;  1F66 D;  2BYM B;  3LEL A;  4CSR A;  5B1L C;  3LZ1 A;  3C1C B;  5B33 D;  3MGR B;  3KUY D;  4G92 B;  1KX4 C;  4XUJ C;  4LD9 B;  1EQZ D;  3B6G B;  3MGP C;  2BYK A;  3TU4 D;  5JRG D;  5BNX A;  4KUD A;  3NQJ B;  5B32 C;  3UTA B;  3REI D;  1P34 C;  3WA9 A;  4XZQ B;  3AZM B;  4Z5T C;  1KX4 A;  5B1M D;  4XUJ A;  3WTP C;  4J8V B;  3MGP A;  5CPK C;  3AZH D;  3LEL D;  5C3I C;  1P3I C;  2HUE C;  1P3O D;  1M18 B;  4R8P A;  5JA4 B;  5B32 A;  1P34 A;  2F8N B;  3VH5 W;  5AV6 B;  1BH9 A;  3AZJ C;  3X1S C;  3LZ0 C;  1P3L C;  1TZY D;  1P3A D;  1F66 B;  5DNM A;  1P3G A;  4E44 A;  2HIO C;  5AV9 D;  3UT9 C;  5DNN C;  5CPI D;  3A6N C;  4QLC D;  3X1T C;  3AZF D;  5B33 B;  3KUY B;  1JFI B;  4KUD D;  3AZJ A;  3LZ0 A;  3B6F D;  3WA9 D;  1P3L A;  3C1C C;  3AZG C;  1P3F C;  3MGR C;  3UT9 A;  1AOI B;  5DNN A;  4G92 C;  3A6N A;  4H9Q A;  5JRG B;  2BYM A;  4LD9 C;  4Z2M G;  4R8P D;  1S32 D;  5BNV B;  3REI B;  3B6G C;  3C1C A;  5B1M B;  1P3P D;  3UTA C;  3AZH B;  4XZQ C;  4CSR B;  5DNM D;  1P3G D;  1P3O B;  4LD9 A;  4J8V C;  3B6G A;  1KX3 D;  1M18 C;  1TZY B;  1P3A B;  1N1J B;  3UTA A;  4XZQ A;  3AZM A;  5AV9 B;  1R4V A;  5AV6 C;  5CPI B;  4QLC B;  3B0D B;  4H9N B;  4DRB A;  4J8V A;  1F66 C;  3AZF B;  1P3M D;  5B40 D;  4KUD B;  3W96 B;  3AZK B;  3B6F B;  3WA9 B;  4WNN B;  5JA4 A;  2F8N A;  5B33 C;  5AV6 A;  3KUY C;  2NZD D;  1F66 A;  4KGC D;  1S32 B;  1AOI C;  1EQZ C;  3WAA B;  3VH5 A;  3TU4 C;  5JRG C;  1P3P B;  1BH9 B;  1TAF B;  3KUY A;  1JFI A;  1A7W A;  3REI C;  3AZN D;  5DNM B;  3AZM D;  5B1M C;  1M1A D;  4WV4 B;  1AOI A;  3AZH C;  3LEL C;  4NE3 A;  5JRG A;  1P3O C;  1KX3 B;  1WWS A;  3W99 A;  4JJN D;  4UUZ B;  5BNV A;  3REI A;  3AFA D;  2CV5 B;  2F8N D;  5B1M A;  3MVD B;  4J8U B;  1TZY C;  4J8W D;  3UTB D;  1P3A C;  3AZH A;  3KXB D;  4H9O B;  1P3M B;  5B40 B;  5AV9 C;  1P3O A;  5CPI C;  4KHA B;  4QLC C;  3B0D C;  1B67 A;  3AZF C;  5BO0 B;  4KUD C;  3W96 C;  3AZK C;  2NZD B;  3B6F C;  3WA9 C;  3W98 B;  4AWL B;  1TZY A;  1P3A A;  1N1J A;  5GSU A;  4KGC B;  5AV9 A;  5CPI A;  1AOI D;  4QLC A;  4H9N A;  5AVB D;  3KWQ D;  3AZF A;  4R8P C;  3W99 D;  1S32 C;  3W96 A;  3AZK A;  1M19 B;  3B6F A;  4WNN A;  3AZN B;  2F8N K;  4ZBJ B;  4DRA A;  3AV2 D;  1ULY A;  3AZL D;  1P3P C;  1M1A B;  5B0Z D;  5BT1 D;  5DNM C;  1P3G C;  5KDM B;  4JJN B;  1S32 A;  5CP6 A;  3O62 D;  3AFA B;  3C1B B;  3WAA A;  1P3P A;  1KX3 C;  1TAF A;  1Q9C A;  3UTB B;  4J8W B;  3W97 D;  5GSU D;  3KXB B;  2CV5 C;  2FJ7 D;  3AZE D;  3MGS A;  3REJ D;  3MVD C;  4HGA B;  5B31 G;  1P3M C;  5AVC B;  5B40 C;  3WKJ B;  1KX3 A;  3W96 D;  1H3O B;  3AZK D;  4UUZ A;  5F99 A;  2CV5 A;  2NZD C;  5AVB B;  3KWQ B;  3MVD A;  4AWL C;  4J8U A;  4KGC C;  4H9O A;  1P3M A;  5B40 A;  3W99 B;  1ZLA D;  3VH6 T;  5CP6 D;  4KHA A;  3B0C T;  3WAA D;  3AV2 B;  3AZL B;  5BO0 A;  5B0Z B;  2NZD A;  3W98 A;  3AZN C;  3AZM C;  4KGC A;  1B6W A;  1M1A C;  3MGS D;  3O62 B;  4JJN C;  1M19 A;  2YFV B;  4YM6 A;  5GSU B;  3AFA C;  5F99 D;  3W97 B;  3AZN A;  2FJ7 B;  2CV5 D;  3AZE B;  1M1A A;  3REJ B;  3R45 B;  5B24 D;  3UTB C;  3MVD D;  4J8W C;  4J8U D;  3AV1 A;  1F1E A;  3KXB C;  3AN2 D;  5B31 D;  5AV8 D;  5KDM A;  4JJN A;  3AFA A;  3C1B A;  4HGA C;  1HTA A;  4ZUX D;  3WKJ C;  5GXQ D;  3UTB A;  4J8W A;  3W98 D;  5FUG B;  1KX5 A;  3KXB A;  2JSS A;  5E5A D;  3X1V D;  1ZLA B;  5B2J D;  5CP6 B;  5AVB C;  3KWQ C;  3AYW D; 
#chains in the Genus database with same CATH topology
 3W99 C;  5AVC A;  3WKJ A;  1H3O A;  1M19 D;  4YM6 D;  3REK A;  3AV2 C;  3VH6 W;  3AZL C;  2Y2O A;  3MGS B;  5CPJ D;  3B0C W;  5B0Z C;  5BT1 C;  1KU5 A;  5AY8 D;  5AVB A;  3KWQ A;  2NQB D;  3MGQ D;  3AV1 D;  3KSY A;  5AV5 D;  3EPH A;  2J8P A;  5GT0 D;  5CHL B;  4H9R B;  3B0B A;  3O62 C;  2F8N H;  5F99 B;  3C1B D;  3REL A;  3AV2 A;  3AZL A;  1P3B D;  1HQ3 D;  5B24 B;  4Z5T B;  5B0Z A;  3W97 C;  3WTP B;  5GSU C;  3AN2 B;  1KX5 D;  2FJ7 C;  5B31 B;  1P3K B;  3A1I A;  5AV8 B;  3AZE C;  4G91 B;  4YS3 D;  3REJ C;  3REH D;  3O62 A;  3X1U A;  3MNN D;  4ZUX B;  2ZY5 A;  5AVC D;  3WKJ D;  5GXQ B;  2Y2Q A;  2YFV A;  3W97 A;  3REK D;  1ID3 D;  3X1V B;  4NE5 A;  5E5A B;  4WU9 D;  4J8X D;  5B2J B;  4WU8 D;  3AZE A;  2FJ7 A;  4H9P B;  2YFW B;  3R45 A;  3REJ A;  3KFU G;  3F6T A;  2IO5 B;  5B2I D;  3AYW B;  1ZLA C;  2DQN C;  5CP6 C;  3X1T B;  4YM6 B;  3WTP E;  1U35 D;  3WAA C;  3REL D;  3AZI D;  1BH8 A;  5CPJ B;  5AY8 B;  3AZG B;  2NQB B;  3MGQ B;  3AV1 B;  2CWE A;  5B0Y D;  5AV5 B;  1P3F B;  5FUG A;  5GT0 B;  2ARO B;  3MGS C;  1WWI A;  1ZLA A;  2Y2N A;  4X23 D;  2RVQ D;  3X1U D;  2PYO D;  5B1L A;  1P3B B;  1HQ3 B;  3LJA D;  5F99 C;  1KX5 B;  3V9R B;  5B32 G;  4YS3 B;  3REH B;  5GT3 D;  5B24 C;  4Z66 B;  4J8U C;  3MNN B;  3AN2 C;  5B31 C;  1P3K C;  5AV8 C;  4G91 C;  4H9R A;  4CAY B;  3REK B;  1ID3 B;  3VH6 A;  4H9S C;  4WU8 B;  4J8X B;  4ZUX C;  4WU9 B;  4EO5 B;  3LZ1 D;  2UWX A;  5GXQ C;  4M6B A;  5B24 A;  4Z5T A;  5BS7 C;  5B2I B;  3W98 C;  3WTP A;  3AN2 A;  1BFM A;  3X1V C;  5E5A C;  5B31 A;  1P3K A;  5B2J C;  5AV8 A;  1U35 B;  5CPK A;  3REL B;  2IO5 C;  3AZI B;  3AYW C;  3EPK A;  1P3I A;  2LY8 A;  4H9S A;  5B1L D;  4ZUX A;  3FDD A;  5GXQ A;  1M19 C;  4YM6 C;  5BS7 A;  5B0Y B;  4ZBJ C;  3X1S A;  3X1V A;  5E5A A;  5CPJ C;  5B2J A;  4X23 B;  4H9P A;  2YFW A;  5AY8 C;  4NE6 A;  1KX4 D;  2NQB C;  3NQU B;  5G49 B;  4XUJ D;  5AV5 C;  3X1U B;  2HIO A;  3MGQ C;  3AYW A;  3AV1 C;  2PYO B;  1EQZ B;  5GT0 C;  2ARO C;  4WZS B;  3LJA B;  3MGP D;  3TU4 B;  3X1T A;  3C1B C;  1P3B C;  5B32 D;  5GT3 B;  1HQ3 C;  5CPJ A;  1P34 D;  4Z5T D;  5AY8 A;  3AZG A;  2NQB A;  3MGQ A;  3WTP D;  1KX5 C;  5AV5 A;  1P3F A;  3MGR A;  1P3K D;  5GT0 A;  2ARO A;  4YS3 C;  3REH C;  5CPK D;  3LEL B;  4Z66 C;  1P3I D;  3MNN C;  1BH8 B;  3LZ1 B;  5AVC C;  1P3B A;  1HQ3 A;  3A1K A;  3REK C;  4Z2M H;  1ID3 C;  3AZJ D;  4WU8 C;  3X1S D;  3LZ0 D;  3V9R A;  4EO5 C;  4J8X C;  4WU9 C;  3NQJ A;  4YS3 A;  2Y2P A;  2Y2M A;  3REH A;  1P3L D;  2Y2H A;  2F8N G;  5B2I C;  4Z66 A;  2HIO D;  3UT9 D;  3MNN A;  1PZR A;  5B1L B;  5DNN D;  3A6N D;  2BYK B;  3X1T D;  1U35 C;  5BNX B;  4CAY A;  3REL C;  3AZI C;  1ID3 A;  1M18 A;  4NFT A;  4WU9 A;  4WU8 A;  4J8X A;  3C1C D;  1KX4 B;  4XUJ B;  3AZG D;  5B0Y C;  5B2I A;  1P3F D;  3MGR D;  2ARO D;  2XD1 A;  3MGP B;  4X23 C;  1U35 A;  2RVQ C;  4R8P B;  3X1U C;  4LD9 D;  3AZI A;  2PYO C;  2L5A A;  5B32 B;  1P34 B;  3AL0 C;  3B6G D;  3LJA C;  5B0Y A;  5B33 A;  5GT3 C;  3UTA D;  5CPK B;  4XZQ D;  4X23 A;  1P3G B;  5C3I B;  4Z66 D;  1P3I B;  2HUE B;  2JCH A;  3NQU A;  5G49 A;  3VH5 T;  2PYO A;  1EQZ A;  4J8V D;  3LJA A;  3TU4 A;  3AZJ B;  1M18 D;  3X1S B;  3LZ0 B;  3EPJ A;  3LZ1 C;  1P3L B;  2JE5 A;  5GT3 A;  2HIO B;  3UT9 B;  5AV6 D;  5DNN B;  4E45 A;  3A6N B;  4H9Q B;  1F66 D;  2BYM B;  3LEL A;  4CSR A;  5B1L C;  3LZ1 A;  1W2E A;  3C1C B;  5B33 D;  3MGR B;  3KUY D;  2ZY2 A;  4G92 B;  2F2A C;  1KX4 C;  4XUJ C;  4LD9 B;  1EQZ D;  3B6G B;  3MGP C;  2BYK A;  2XD5 A;  2ZY4 A;  3TU4 D;  5JRG D;  5BNX A;  4KUD A;  3NQJ B;  5B32 C;  3UTA B;  3REI D;  1P34 C;  3WA9 A;  4XZQ B;  3AZM B;  4Z5T C;  1KX4 A;  5B1M D;  4XUJ A;  3WTP C;  4J8V B;  3MGP A;  5CPK C;  3AZH D;  3LEL D;  5C3I C;  1P3I C;  2HUE C;  1P3O D;  1M18 B;  4R8P A;  5JA4 B;  5B32 A;  1P34 A;  2F8N B;  3VH5 W;  5AV6 B;  1BH9 A;  3AZJ C;  3X1S C;  3LZ0 C;  1P3L C;  1TZY D;  1P3A D;  1F66 B;  5DNM A;  1P3G A;  4E44 A;  2HIO C;  5AV9 D;  3UT9 C;  5DNN C;  5CPI D;  3A6N C;  4QLC D;  3X1T C;  3AZF D;  5B33 B;  3KUY B;  1JFI B;  4KUD D;  3AZJ A;  3LZ0 A;  3B6F D;  3WA9 D;  1P3L A;  3C1C C;  3AZG C;  1P3F C;  3MGR C;  3UT9 A;  1AOI B;  5DNN A;  4G92 C;  3A6N A;  4H9Q A;  2Y2G A;  5JRG B;  2BYM A;  4LD9 C;  4Z2M G;  4R8P D;  1S32 D;  5BNV B;  3REI B;  3B6G C;  3C1C A;  5B1M B;  1P3P D;  3UTA C;  3AZH B;  4XZQ C;  4CSR B;  5DNM D;  1P3G D;  1P3O B;  4LD9 A;  2Y2I A;  4J8V C;  3B6G A;  1KX3 D;  1M18 C;  1TZY B;  1P3A B;  1N1J B;  3UTA A;  4XZQ A;  3AZM A;  5AV9 B;  1R4V A;  5AV6 C;  5CPI B;  4QLC B;  3B0D B;  4H9N B;  4DRB A;  4J8V A;  1F66 C;  3AZF B;  1P3M D;  5B40 D;  4KUD B;  3W96 B;  3AZK B;  3B6F B;  3WA9 B;  4WNN B;  5JA4 A;  2G5I C;  2F8N A;  5B33 C;  5AV6 A;  3KUY C;  2NZD D;  1F66 A;  4KGC D;  1S32 B;  3P5J B;  1AOI C;  1EQZ C;  3WAA B;  3VH5 A;  3TU4 C;  5JRG C;  1P3P B;  2Y2L A;  1BH9 B;  1TAF B;  3KUY A;  1JFI A;  1A7W A;  2Y2J A;  3REI C;  3AZN D;  5DNM B;  3AZM D;  5B1M C;  1M1A D;  4WV4 B;  1AOI A;  3AZH C;  3LEL C;  4NE3 A;  1Z2C B;  5JRG A;  1P3O C;  1KX3 B;  1WWS A;  3W99 A;  4JJN D;  4UUZ B;  5BNV A;  3REI A;  3AFA D;  2CV5 B;  2F8N D;  5B1M A;  3MVD B;  4J8U B;  1TZY C;  4J8W D;  3UTB D;  1P3A C;  3AZH A;  3KXB D;  4H9O B;  1P3M B;  5B40 B;  5AV9 C;  1P3O A;  5CPI C;  4KHA B;  4QLC C;  3B0D C;  1B67 A;  3AZF C;  5BO0 B;  4KUD C;  3W96 C;  3AZK C;  2NZD B;  3B6F C;  3WA9 C;  3W98 B;  4AWL B;  1TZY A;  1P3A A;  1N1J A;  3EG5 B;  5GSU A;  4KGC B;  5AV9 A;  2ZY3 A;  5CPI A;  1AOI D;  4QLC A;  4H9N A;  5AVB D;  3KWQ D;  3AZF A;  4UPK A;  4R8P C;  3W99 D;  1S32 C;  3W96 A;  3AZK A;  1M19 B;  3B6F A;  4WNN A;  3AZN B;  2F8N K;  4ZBJ B;  4DRA A;  3AV2 D;  1ULY A;  3AZL D;  1P3P C;  1M1A B;  5B0Z D;  5BT1 D;  5DNM C;  1P3G C;  2Y2K A;  5KDM B;  4JJN B;  1S32 A;  5CP6 A;  3O62 D;  3AFA B;  3C1B B;  2DF4 C;  3WAA A;  1P3P A;  1KX3 C;  1TAF A;  1Q9C A;  3UTB B;  4J8W B;  3IP4 C;  3W97 D;  5GSU D;  3KXB B;  2CV5 C;  2FJ7 D;  2FFF B;  3AZE D;  3MGS A;  3REJ D;  3MVD C;  4WJ3 C;  4HGA B;  5B31 G;  1P3M C;  5AVC B;  5B40 C;  3WKJ B;  1KX3 A;  3W96 D;  1H3O B;  3AZK D;  4UUZ A;  2BG1 A;  5F99 A;  2CV5 A;  2NZD C;  5AVB B;  3KWQ B;  2ZM5 A;  3MVD A;  4AWL C;  4J8U A;  4KGC C;  4H9O A;  1P3M A;  5B40 A;  3W99 B;  1ZLA D;  3VH6 T;  5CP6 D;  1T3U A;  3H0L C;  4KHA A;  3B0C T;  3WAA D;  3AV2 B;  3AZL B;  5BO0 A;  5B0Z B;  3H0M C;  2NZD A;  3W98 A;  3AZN C;  3AZM C;  4KGC A;  1B6W A;  3EPL A;  1M1A C;  3MGS D;  3O62 B;  2VQR A;  4JJN C;  1M19 A;  2YFV B;  4YM6 A;  5GSU B;  3AFA C;  5F99 D;  4DQY B;  3AZN A;  3W97 B;  2FJ7 B;  2CV5 D;  3AZE B;  1M1A A;  3REJ B;  3R45 B;  2RIQ A;  5B24 D;  3UTB C;  3MVD D;  4J8W C;  4J8U D;  3AV1 A;  1F1E A;  3KXB C;  3AN2 D;  5B31 D;  5AV8 D;  5KDM A;  4JJN A;  3AFA A;  3C1B A;  4HGA C;  1HTA A;  4ZUX D;  2W8S A;  3WKJ C;  3H0R C;  5GXQ D;  3UTB A;  4J8W A;  3W98 D;  5FUG B;  2G5H C;  1KX5 A;  3KXB A;  2JSS A;  5E5A D;  3X1V D;  1ZLA B;  5B2J D;  5CP6 B;  5AVB C;  3KWQ C;  3AYW D; 
#chains in the Genus database with same CATH homology
 3W99 C;  5AVC A;  3WKJ A;  1H3O A;  1M19 D;  4YM6 D;  3REK A;  3AV2 C;  3VH6 W;  3AZL C;  2Y2O A;  3MGS B;  5CPJ D;  3B0C W;  5B0Z C;  5BT1 C;  1KU5 A;  5AY8 D;  5AVB A;  3KWQ A;  2NQB D;  3MGQ D;  3AV1 D;  3KSY A;  5AV5 D;  3EPH A;  2J8P A;  5GT0 D;  5CHL B;  4H9R B;  3B0B A;  3O62 C;  2F8N H;  5F99 B;  3C1B D;  3REL A;  3AV2 A;  3AZL A;  1P3B D;  1HQ3 D;  5B24 B;  4Z5T B;  5B0Z A;  3W97 C;  3WTP B;  5GSU C;  3AN2 B;  1KX5 D;  2FJ7 C;  5B31 B;  1P3K B;  3A1I A;  5AV8 B;  3AZE C;  4G91 B;  4YS3 D;  3REJ C;  3REH D;  3O62 A;  3X1U A;  3MNN D;  4ZUX B;  2ZY5 A;  5AVC D;  3WKJ D;  5GXQ B;  2Y2Q A;  2YFV A;  3W97 A;  3REK D;  1ID3 D;  3X1V B;  4NE5 A;  5E5A B;  4WU9 D;  4J8X D;  5B2J B;  4WU8 D;  3AZE A;  2FJ7 A;  4H9P B;  2YFW B;  3R45 A;  3REJ A;  3KFU G;  3F6T A;  2IO5 B;  5B2I D;  3AYW B;  1ZLA C;  2DQN C;  5CP6 C;  3X1T B;  4YM6 B;  3WTP E;  1U35 D;  3WAA C;  3REL D;  3AZI D;  1BH8 A;  5CPJ B;  5AY8 B;  3AZG B;  2NQB B;  3MGQ B;  3AV1 B;  2CWE A;  5B0Y D;  5AV5 B;  1P3F B;  5FUG A;  5GT0 B;  2ARO B;  3MGS C;  1WWI A;  1ZLA A;  2Y2N A;  4X23 D;  2RVQ D;  3X1U D;  2PYO D;  5B1L A;  1P3B B;  1HQ3 B;  3LJA D;  5F99 C;  1KX5 B;  3V9R B;  5B32 G;  4YS3 B;  3REH B;  5GT3 D;  5B24 C;  4Z66 B;  4J8U C;  3MNN B;  3AN2 C;  5B31 C;  1P3K C;  5AV8 C;  4G91 C;  4H9R A;  4CAY B;  3REK B;  1ID3 B;  3VH6 A;  4H9S C;  4WU8 B;  4J8X B;  4ZUX C;  4WU9 B;  4EO5 B;  3LZ1 D;  2UWX A;  5GXQ C;  4M6B A;  5B24 A;  4Z5T A;  5BS7 C;  5B2I B;  3W98 C;  3WTP A;  3AN2 A;  1BFM A;  3X1V C;  5E5A C;  5B31 A;  1P3K A;  5B2J C;  5AV8 A;  1U35 B;  5CPK A;  3REL B;  2IO5 C;  3AZI B;  3AYW C;  3EPK A;  1P3I A;  2LY8 A;  4H9S A;  5B1L D;  4ZUX A;  3FDD A;  5GXQ A;  1M19 C;  4YM6 C;  5BS7 A;  5B0Y B;  4ZBJ C;  3X1S A;  3X1V A;  5E5A A;  5CPJ C;  5B2J A;  4X23 B;  4H9P A;  2YFW A;  5AY8 C;  4NE6 A;  1KX4 D;  2NQB C;  3NQU B;  5G49 B;  4XUJ D;  5AV5 C;  3X1U B;  2HIO A;  3MGQ C;  3AYW A;  3AV1 C;  2PYO B;  1EQZ B;  5GT0 C;  2ARO C;  4WZS B;  3LJA B;  3MGP D;  3TU4 B;  3X1T A;  3C1B C;  1P3B C;  5B32 D;  5GT3 B;  1HQ3 C;  5CPJ A;  1P34 D;  4Z5T D;  5AY8 A;  3AZG A;  2NQB A;  3MGQ A;  3WTP D;  1KX5 C;  5AV5 A;  1P3F A;  3MGR A;  1P3K D;  5GT0 A;  2ARO A;  4YS3 C;  3REH C;  5CPK D;  3LEL B;  4Z66 C;  1P3I D;  3MNN C;  1BH8 B;  3LZ1 B;  5AVC C;  1P3B A;  1HQ3 A;  3A1K A;  3REK C;  4Z2M H;  1ID3 C;  3AZJ D;  4WU8 C;  3X1S D;  3LZ0 D;  3V9R A;  4EO5 C;  4J8X C;  4WU9 C;  3NQJ A;  4YS3 A;  2Y2P A;  2Y2M A;  3REH A;  1P3L D;  2Y2H A;  2F8N G;  5B2I C;  4Z66 A;  2HIO D;  3UT9 D;  3MNN A;  1PZR A;  5B1L B;  5DNN D;  3A6N D;  2BYK B;  3X1T D;  1U35 C;  5BNX B;  4CAY A;  3REL C;  3AZI C;  1ID3 A;  1M18 A;  4NFT A;  4WU9 A;  4WU8 A;  4J8X A;  3C1C D;  1KX4 B;  4XUJ B;  3AZG D;  5B0Y C;  5B2I A;  1P3F D;  3MGR D;  2ARO D;  2XD1 A;  3MGP B;  4X23 C;  1U35 A;  2RVQ C;  4R8P B;  3X1U C;  4LD9 D;  3AZI A;  2PYO C;  2L5A A;  5B32 B;  1P34 B;  3AL0 C;  3B6G D;  3LJA C;  5B0Y A;  5B33 A;  5GT3 C;  3UTA D;  5CPK B;  4XZQ D;  4X23 A;  1P3G B;  5C3I B;  4Z66 D;  1P3I B;  2HUE B;  2JCH A;  3NQU A;  5G49 A;  3VH5 T;  2PYO A;  1EQZ A;  4J8V D;  3LJA A;  3TU4 A;  3AZJ B;  1M18 D;  3X1S B;  3LZ0 B;  3EPJ A;  3LZ1 C;  1P3L B;  2JE5 A;  5GT3 A;  2HIO B;  3UT9 B;  5AV6 D;  5DNN B;  4E45 A;  3A6N B;  4H9Q B;  1F66 D;  2BYM B;  3LEL A;  4CSR A;  5B1L C;  3LZ1 A;  1W2E A;  3C1C B;  5B33 D;  3MGR B;  3KUY D;  2ZY2 A;  4G92 B;  2F2A C;  1KX4 C;  4XUJ C;  4LD9 B;  1EQZ D;  3B6G B;  3MGP C;  2BYK A;  2XD5 A;  2ZY4 A;  3TU4 D;  5JRG D;  5BNX A;  4KUD A;  3NQJ B;  5B32 C;  3UTA B;  3REI D;  1P34 C;  3WA9 A;  4XZQ B;  3AZM B;  4Z5T C;  1KX4 A;  5B1M D;  4XUJ A;  3WTP C;  4J8V B;  3MGP A;  5CPK C;  3AZH D;  3LEL D;  5C3I C;  1P3I C;  2HUE C;  1P3O D;  1M18 B;  4R8P A;  5JA4 B;  5B32 A;  1P34 A;  2F8N B;  3VH5 W;  5AV6 B;  1BH9 A;  3AZJ C;  3X1S C;  3LZ0 C;  1P3L C;  1TZY D;  1P3A D;  1F66 B;  5DNM A;  1P3G A;  4E44 A;  2HIO C;  5AV9 D;  3UT9 C;  5DNN C;  5CPI D;  3A6N C;  4QLC D;  3X1T C;  3AZF D;  5B33 B;  3KUY B;  1JFI B;  4KUD D;  3AZJ A;  3LZ0 A;  3B6F D;  3WA9 D;  1P3L A;  3C1C C;  3AZG C;  1P3F C;  3MGR C;  3UT9 A;  1AOI B;  5DNN A;  4G92 C;  3A6N A;  4H9Q A;  2Y2G A;  5JRG B;  2BYM A;  4LD9 C;  4Z2M G;  4R8P D;  1S32 D;  5BNV B;  3REI B;  3B6G C;  3C1C A;  5B1M B;  1P3P D;  3UTA C;  3AZH B;  4XZQ C;  4CSR B;  5DNM D;  1P3G D;  1P3O B;  4LD9 A;  2Y2I A;  4J8V C;  3B6G A;  1KX3 D;  1M18 C;  1TZY B;  1P3A B;  1N1J B;  3UTA A;  4XZQ A;  3AZM A;  5AV9 B;  1R4V A;  5AV6 C;  5CPI B;  4QLC B;  3B0D B;  4H9N B;  4DRB A;  4J8V A;  1F66 C;  3AZF B;  1P3M D;  5B40 D;  4KUD B;  3W96 B;  3AZK B;  3B6F B;  3WA9 B;  4WNN B;  5JA4 A;  2G5I C;  2F8N A;  5B33 C;  5AV6 A;  3KUY C;  2NZD D;  1F66 A;  4KGC D;  1S32 B;  3P5J B;  1AOI C;  1EQZ C;  3WAA B;  3VH5 A;  3TU4 C;  5JRG C;  1P3P B;  2Y2L A;  1BH9 B;  1TAF B;  3KUY A;  1JFI A;  1A7W A;  2Y2J A;  3REI C;  3AZN D;  5DNM B;  3AZM D;  5B1M C;  1M1A D;  4WV4 B;  1AOI A;  3AZH C;  3LEL C;  4NE3 A;  1Z2C B;  5JRG A;  1P3O C;  1KX3 B;  1WWS A;  3W99 A;  4JJN D;  4UUZ B;  5BNV A;  3REI A;  3AFA D;  2CV5 B;  2F8N D;  5B1M A;  3MVD B;  4J8U B;  1TZY C;  4J8W D;  3UTB D;  1P3A C;  3AZH A;  3KXB D;  4H9O B;  1P3M B;  5B40 B;  5AV9 C;  1P3O A;  5CPI C;  4KHA B;  4QLC C;  3B0D C;  1B67 A;  3AZF C;  5BO0 B;  4KUD C;  3W96 C;  3AZK C;  2NZD B;  3B6F C;  3WA9 C;  3W98 B;  4AWL B;  1TZY A;  1P3A A;  1N1J A;  3EG5 B;  5GSU A;  4KGC B;  5AV9 A;  2ZY3 A;  5CPI A;  1AOI D;  4QLC A;  4H9N A;  5AVB D;  3KWQ D;  3AZF A;  4UPK A;  4R8P C;  3W99 D;  1S32 C;  3W96 A;  3AZK A;  1M19 B;  3B6F A;  4WNN A;  3AZN B;  2F8N K;  4ZBJ B;  4DRA A;  3AV2 D;  1ULY A;  3AZL D;  1P3P C;  1M1A B;  5B0Z D;  5BT1 D;  5DNM C;  1P3G C;  2Y2K A;  5KDM B;  4JJN B;  1S32 A;  5CP6 A;  3O62 D;  3AFA B;  3C1B B;  2DF4 C;  3WAA A;  1P3P A;  1KX3 C;  1TAF A;  1Q9C A;  3UTB B;  4J8W B;  3IP4 C;  3W97 D;  5GSU D;  3KXB B;  2CV5 C;  2FJ7 D;  2FFF B;  3AZE D;  3MGS A;  3REJ D;  3MVD C;  4WJ3 C;  4HGA B;  5B31 G;  1P3M C;  5AVC B;  5B40 C;  3WKJ B;  1KX3 A;  3W96 D;  1H3O B;  3AZK D;  4UUZ A;  2BG1 A;  5F99 A;  2CV5 A;  2NZD C;  5AVB B;  3KWQ B;  2ZM5 A;  3MVD A;  4AWL C;  4J8U A;  4KGC C;  4H9O A;  1P3M A;  5B40 A;  3W99 B;  1ZLA D;  3VH6 T;  5CP6 D;  1T3U A;  3H0L C;  4KHA A;  3B0C T;  3WAA D;  3AV2 B;  3AZL B;  5BO0 A;  5B0Z B;  3H0M C;  2NZD A;  3W98 A;  3AZN C;  3AZM C;  4KGC A;  1B6W A;  3EPL A;  1M1A C;  3MGS D;  3O62 B;  2VQR A;  4JJN C;  1M19 A;  2YFV B;  4YM6 A;  5GSU B;  3AFA C;  5F99 D;  4DQY B;  3AZN A;  3W97 B;  2FJ7 B;  2CV5 D;  3AZE B;  1M1A A;  3REJ B;  3R45 B;  2RIQ A;  5B24 D;  3UTB C;  3MVD D;  4J8W C;  4J8U D;  3AV1 A;  1F1E A;  3KXB C;  3AN2 D;  5B31 D;  5AV8 D;  5KDM A;  4JJN A;  3AFA A;  3C1B A;  4HGA C;  1HTA A;  4ZUX D;  2W8S A;  3WKJ C;  3H0R C;  5GXQ D;  3UTB A;  4J8W A;  3W98 D;  5FUG B;  2G5H C;  1KX5 A;  3KXB A;  2JSS A;  5E5A D;  3X1V D;  1ZLA B;  5B2J D;  5CP6 B;  5AVB C;  3KWQ C;  3AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...