4J8VD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vD00
5AVCB 4ZUXC 3KWQB 5AV8C 4DRBA 3AZEC 5KDMB 1P3MD 3AZNC 3KXBC 3O62A 5BNVB 4YM6D 3REKB 4J8XA 5B0ZB 1JFIA 1BH8A 4WNNB 3C1CD 1P3GB 1M1AD 3B6FC 5E5AC 5GT0D 1AOIA 4Z66D 3KUYC 3RELD 3NQJA 3MNND 5DNNC 4E44A 3B0DC 4WU8B 3MVDA 4J8WB 3LELD 4J8UB 3X1SB 4YS3A 3LZ1C 1P3MA 2NQBB 5JRGB 3MGSA 5AV6D 3W97C 4NFTA 4H9PB 2FJ7A 2CWEA 3AYWD 5CPKD 4Z2MG 1N1JB 2AROC 4Z66A 3RELA 4EO5C 3AZKD 5B33D 5B1MC 1M19B 3LELA 4UUZB 2YFVA 4ZBJC 2BYKB 5AV6A 3AZJB 3AZMD 4AWLB 4G91B 4G92B 3C1BC 3TU4D 4LD9C 5CPJC 1F66D 2F8NB 1U35D 5B40D 3AZKA 5B33A 3WTPD 4KUDB 1BFMA 5AY8B 3MGRB 3MGPC 3VH6A 1EQZB 2HIOA 1P3BD 4KGCB 5BNXA 4H9QA 3LZ0B 5AVCD 1ZLAA 3KWQD 3WA9B 1TZYD 3REJB 3AZMA 1KX3B 3UT9B 1S32B 2F8NG 1P3LD 4XZQB 3AZHA 3R45B 5GT3C 4Z5TB 5B0YD 1Q9CA 1F66A 5AV5C 3REKD 1P3OB 5B31B 5B40A 1P3IC 1HQ3B 3AZLC 1M18B 3B6GD 5DNMB 3AFAD 2NZDB 1P3BA 3WAAA 5B2JD 5B24C 5AVCA 3KWQA 3AZID 1TZYA 5AV8B 3X1SD 5GXQD 5KDMA 5B31G 5B32C 1KX4C 3AZEB 4HGAC 3AZNB 5BS7C 3KXBB 5BNVA 5AV9C 3REKA 2PYOC 5B0ZA 5CP6C 4WNNA 1P3GA 3B6FB 5JA4A 1WWSA 5E5AB 3B6GA 5BT1D 2CV5C 3W98D 4QLCD 5DNNB 3AZGC 3B0DB 1BH9B 4J8WA 4R8PD 5AVBD 3KSYA 3X1SA 2NQBA 5JRGA 3UTBC 3X1TC 1P34C 1P3PC 3X1UC 3MGQC 4H9PA 5B2IC 3AV2C 3W97B 5G49B 3W96B 4XUJC 4X23B 3LJAC 4WU9B 3W98A 3O62D 2AROB 4EO5B 4QLCA 3W99D 1M19A 1EQZD 4UUZA 5B1MB 5AVBA 3X1VD 2BYMB 4J8XC 3REHC 3AZJA 5FUGB 5BO0A 4XZQD 3UTAC 4J8VB 3MVDD 1AOIC 3C1BB 4Z5TD 5CPID 4YS3D 4H9SA 3MGSD 2F8NA 1A7WA 3REID 5B31D 4KUDA 2RVQC 5AY8A 1P3MC 1M18D 3W99A 2FJ7D 4CAYB 1EQZA 3MGPB 3X1VA 4KGCA 1B67A 4YM6C 3LZ0A 3WA9A 4CSRB 3UT9A 3C1CC 1S32A 1M1AC 2JSSA 4XZQA 3R45A 5GT0C 4Z66C 3RELC 4Z5TA 5CPIA 5GT3B 3MNNC 1P3OA 3REIA 5B31A 5AV5B 5F99D 3LELC 1HQ3A 1ID3D 1M18A 3AZLB 3AN2B 5AV6C 2NZDA 4H9RB 5B24B 3AYWC 5CPKC 3V9RB 3AZEA 5B32B 1KX4B 3WKJD 4HGAB 3AZNA 2HIOD 4E45A 3AZFD 3KXBA 3AZKC 5B33C 5AV9B 1ZLAD 3W96D 5B1LD 1P3AD 2PYOB 4X23D 5CP6B 5F99A 1ID3A 3AZHD 3A6ND 3B6FA 5E5AA 4WU9D 1B6WA 4NE3A 5B32G 3AZMC 2CV5B 5DNNA 3AZGB 3TU4C 4Z2MH 1KX5C 1F66C 3WKJA 3X1TB 3UTBB 1P3PB 1U35C 1P34B 3AZFA 5B40C 3WAAD 3NQUB 2HUEC 3W97A 3WTPC 3X1UB 3MGQB 3W96A 5B2IB 5B1LA 4J8VD 4WZSB 3AV1B 4X23A 1P3AA 1P3FC 1P3BC 3A6NA 4WU9A 5AVCC 5GSUC 2AROA 1TZYC 3LJAB 4JJNB 1P3KB 1P3LC 5B0ZD 1TAFB 4H9OB 1P3GD 5B1MA 5B0YC 3REKC 5FUGA 3REHB 4WU8D 4J8VA 1HTAA 4J8WD 3UTAB 3AFAC 4J8UD 4ZUXB 3C1BA 3B6GC 2NQBD 5JRGD 5B2JC 3AZIC 2F8NH 3X1SC 5GXQC 3AN2D 1P3MB 1F1EA 4CSRA 4YM6B 3KUYB 3C1CB 4WU8A 1M1AB 3WTPE 1M19D 5GT0B 5BT1C 4J8UA 3W98C 4H9NB 2F8NK 4QLCC 3LZ1B 3MNNB 5AV5A 3AZJD 4R8PC 2L5AA 5AVBC 3LELB 3AZLA 3AN2A 5C3IC 5AV6B 4H9RA 1N1JA 2F8ND 5B24A 4KUDD 2YFWB 3V9RA 5AY8D 4H9SC 3AYWB 3MGRD 5CPKB 5B32A 3O62C 5BS7A 4KGCD 4ZBJB 2BYKA 5B33B 3LZ0D 3MGQD 3AZKB 3W99C 3AV1D 3WA9D 2PYOA 3REJD 1KX3D 5CP6A 3UT9D 1S32D 3X1VC 4JJND 2CV5A 2IO5C 4LD9B 5CPJB 3AZMB 1P3KD 1P3OD 3MVDC 1HQ3D 4M6BA 4Z5TC 5CPIC 4KHAB 4YS3C 3TU4B 3MGRA 1KX5B 5DNMD 3MGSC 1P34A 3REIC 3REHD 2NZDD 3NQUA 1U35B 5B40B 3X1UA 3MGQA 2HUEB 5B2IA 3WTPB 3AV1A 1M18C 3REJA 4ZUXD 1KX3A 2FJ7C 5AV8D 1P3FB 3AZED 3VH5T 3AZND 4JJNA 3KXBD 5GSUB 4WV4B 1TZYB 1P3KA 3VH5W 2RVQD 1P3LB 1TAFA 4H9OA 3B6FD 1P3IB 5E5AD 5DNMA 5B0YB 3REHA 3KUYD 5F99C 5CHLB 5DNND 1ID3C 3UTAA 5JA4B 4ZUXA 5AV8A 3B6GB 3AFAB 3B0CT 3LZ1D 5B2JB 2LY8A 3B0CW 3AZIB 3W97D 5GXQB 3WKJC 2HIOC 3AZFC 4NE6A 3W96C 4YM6A 5B1LC 1P3AC 1ZLAC 2AROD 4X23C 3KUYA 3C1CA 1M1AA 3AZHC 3A6NC 1BH9A 5GT0A 4WU9C 1H3OB 5B1MD 3W98B 4H9NA 3LZ1A 3MNNA 4QLCB 4R8PB 5AVBB 5G49A 1ULYA 3AV2B 3C1BD 4XUJB 4LD9D 3WAAC 5CPJD 5C3IB 5BO0B 4J8VC 3KWQC 2YFWA 3AYWA 5CPKA 1KX5D 3MGPD 3B0BA 3O62B 2BYMA 5B0ZC 3W99B 4J8XB 1P3FD 1P3GC 1JFIB 1BH8B 3X1VB 4LD9A 5GT3D 1AOIB 5GSUD 5CPJA 2IO5B 3NQJB 4WU8C 5AV5D 4J8WC 4J8UC 3MVDB 3VH5A 3TU4A 4KHAA 1P3ID 2NQBC 5CPIB 5JRGC 3AZLD 4YS3B 1KX5A 4CAYA 3MGPA 3MGSB 1U35A 3REIB 4NE5A 3WTPA 3AN2C 5B24D 1P3FA 2FJ7B 5B32D 1KX4D 5GT3A 4Z66B 5GSUA 3RELB 5AV9D 1R4VA 1P3LA 2PYOD 5CP6D 1M19C 1P3IA 1KU5A 2YFVB 5B0YA 3AZJC 2CV5D 4AWLC 4G91C 4G92C 5F99B 1ID3B 3AZGD 3AFAA 1KX4A 3X1TD 3UTBD 1P3PD 1P34D 5B2JA 3AZIA 4KUDC 5AY8C 5AV9A 3X1UD 5GXQA 5B2ID 3MGRC 3AV2D 1EQZC 4XUJD 3WKJB 4DRAA 2HIOB 3AZFB 4KGCC 3WA9C 3LZ0C 3AV1C 5BNXB 4H9QB 3LJAD 3REJC 1KX3C 1ZLAB 5B1LB 3UT9C 1S32C 1P3AB 4XZQC 3AZHB 3A6NB 3AZGA 1H3OA 4JJNC 1P3KC 3VH6T 3UTBA 3X1TA 1P3OC 1P3PA 5B31C 4J8XD 1F66B 1HQ3C 4R8PA 3VH6W 3AV2A 3UTAD 5DNMC 4XUJA 1AOID 2NZDC 1P3BB 3WAAB 1WWIA 3LJAA
chains in the Genus database with same CATH superfamily
5AVCB 4ZUXC 3KWQB 5AV8C 4DRBA 3AZEC 5KDMB 1P3MD 3P5JB 3AZNC 3KXBC 3O62A 2ZM5A 5BNVB 4YM6D 3REKB 4J8XA 5B0ZB 1JFIA 1BH8A 4WNNB 3C1CD 1P3GB 1M1AD 3B6FC 5E5AC 5GT0D 1AOIA 4Z66D 3KUYC 3RELD 3EG5B 3NQJA 3MNND 5DNNC 4E44A 3B0DC 4WU8B 3MVDA 4J8WB 3LELD 4J8UB 3X1SB 4YS3A 3LZ1C 1P3MA 2Y2HA 2NQBB 5JRGB 3MGSA 5AV6D 3W97C 4NFTA 4H9PB 2FJ7A 2BG1A 2CWEA 3AYWD 3A1KA 4Z2MG 5CPKD 1N1JB 2AROC 4Z66A 3RELA 4EO5C 3AZKD 5B33D 5B1MC 1M19B 3LELA 3IP4C 4UUZB 2YFVA 4ZBJC 4DQYB 2BYKB 5AV6A 3AZJB 3AZMD 4AWLB 4G91B 4G92B 2G5IC 3C1BC 3TU4D 4LD9C 3FDDA 5CPJC 1F66D 2F8NB 1U35D 5B40D 3AZKA 5B33A 3WTPD 4KUDB 1BFMA 5AY8B 2F2AC 3MGRB 3MGPC 3H0MC 3VH6A 1EQZB 2HIOA 1P3BD 4KGCB 5BNXA 4H9QA 3LZ0B 5AVCD 1ZLAA 3KWQD 3WA9B 2VQRA 1TZYD 3REJB 3AZMA 1KX3B 3UT9B 1S32B 2F8NG 1P3LD 4XZQB 3AZHA 3R45B 5GT3C 4Z5TB 5B0YD 1Q9CA 1F66A 5AV5C 3REKD 1P3OB 1Z2CB 5B31B 5B40A 1P3IC 1HQ3B 3AZLC 1M18B 3B6GD 5DNMB 3AFAD 2NZDB 1P3BA 3WAAA 5B2JD 5B24C 5AVCA 3KWQA 3AZID 1TZYA 5AV8B 3X1SD 2DQNC 5GXQD 5KDMA 5B31G 5B32C 1KX4C 3AZEB 4HGAC 3AZNB 5BS7C 3KXBB 5BNVA 5AV9C 3REKA 2PYOC 5B0ZA 5CP6C 4WNNA 1P3GA 3B6FB 5JA4A 1WWSA 2JE5A 5E5AB 3B6GA 5BT1D 2CV5C 3W98D 4QLCD 5DNNB 3AZGC 3B0DB 1BH9B 4J8WA 4R8PD 5AVBD 3KSYA 3X1SA 2NQBA 5JRGA 3UTBC 3X1TC 1P34C 1P3PC 3H0LC 3X1UC 3MGQC 2UWXA 4H9PA 5B2IC 3AV2C 5G49B 3W97B 3W96B 4XUJC 4X23B 3LJAC 4WU9B 3W98A 3O62D 2AROB 2ZY4A 4EO5B 4QLCA 3W99D 1M19A 1EQZD 2Y2JA 4UUZA 5B1MB 5AVBA 3X1VD 2BYMB 2G5HC 4J8XC 3REHC 3AZJA 5FUGB 5BO0A 4XZQD 3UTAC 2RIQA 4J8VB 3MVDD 1AOIC 3C1BB 4Z5TD 5CPID 4YS3D 4H9SA 3MGSD 2F8NA 1A7WA 3REID 5B31D 4KUDA 2RVQC 5AY8A 1P3MC 1M18D 3W99A 2FJ7D 2JCHA 2FFFB 4CAYB 1EQZA 3F6TA 3MGPB 3X1VA 4KGCA 1B67A 4YM6C 3LZ0A 3WA9A 4CSRB 3UT9A 3C1CC 1S32A 1M1AC 2JSSA 4XZQA 3R45A 5GT0C 4Z66C 3RELC 4Z5TA 5CPIA 5GT3B 3MNNC 1P3OA 2Y2QA 3REIA 5B31A 5AV5B 5F99D 3LELC 1HQ3A 1ID3D 1M18A 3AZLB 3AN2B 5AV6C 2NZDA 4WJ3C 4H9RB 5B24B 3AYWC 5CPKC 3V9RB 3AZEA 5B32B 1KX4B 3WKJD 4HGAB 3AZNA 2HIOD 4E45A 3AZFD 3KXBA 3AZKC 5B33C 5AV9B 1ZLAD 3W96D 5B1LD 1P3AD 2PYOB 4X23D 5CP6B 5F99A 1ID3A 3AZHD 3A6ND 3B6FA 5E5AA 4WU9D 1B6WA 4NE3A 5B32G 3AZMC 2CV5B 5DNNA 3AZGB 3TU4C 4Z2MH 1KX5C 1F66C 3WKJA 3X1TB 3UTBB 1P3PB 1U35C 1P34B 3AZFA 5B40C 3WAAD 3NQUB 2HUEC 3W97A 3WTPC 3X1UB 3MGQB 3W96A 5B2IB 5B1LA 4J8VD 1W2EA 4WZSB 4X23A 2Y2LA 3AV1B 1P3AA 1P3FC 1P3BC 3A6NA 4WU9A 5AVCC 5GSUC 2AROA 1TZYC 3LJAB 4JJNB 1P3KB 1P3LC 5B0ZD 1TAFB 4H9OB 1P3GD 5B1MA 5B0YC 3REKC 5FUGA 3REHB 4WU8D 4J8VA 1HTAA 4J8WD 3UTAB 3AFAC 4J8UD 4ZUXB 1PZRA 3C1BA 3B6GC 2NQBD 5JRGD 3KFUG 5B2JC 3AZIC 2F8NH 3X1SC 5GXQC 3AN2D 1P3MB 1F1EA 4CSRA 2XD5A 4YM6B 3KUYB 3C1CB 4WU8A 1M1AB 3WTPE 1M19D 5GT0B 5BT1C 4J8UA 3W98C 4H9NB 2F8NK 4QLCC 3LZ1B 3MNNB 5AV5A 3AZJD 4R8PC 2L5AA 5AVBC 3LELB 3AZLA 3AN2A 3EPKA 5C3IC 5AV6B 4H9RA 1N1JA 2F8ND 3H0RC 5B24A 3A1IA 2Y2IA 4KUDD 2YFWB 3V9RA 5AY8D 4H9SC 3AYWB 3MGRD 5CPKB 5B32A 3O62C 5BS7A 4KGCD 4ZBJB 2BYKA 5B33B 3LZ0D 3MGQD 3AZKB 3W99C 3AV1D 3WA9D 2PYOA 3REJD 1KX3D 5CP6A 3UT9D 1S32D 3X1VC 4JJND 2CV5A 2IO5C 4LD9B 5CPJB 3AZMB 1P3KD 1P3OD 3MVDC 1HQ3D 4M6BA 2ZY3A 4Z5TC 4KHAB 5CPIC 4YS3C 3MGRA 3TU4B 1KX5B 5DNMD 3MGSC 1P34A 3REIC 3REHD 2NZDD 3NQUA 1U35B 5B40B 3X1UA 3MGQA 2HUEB 5B2IA 3WTPB 3AV1A 1M18C 3REJA 4ZUXD 1KX3A 2FJ7C 5AV8D 1P3FB 3AZED 3VH5T 3AZND 4JJNA 3KXBD 5GSUB 4WV4B 1TZYB 1P3KA 3VH5W 2RVQD 1P3LB 1TAFA 4H9OA 2Y2GA 3B6FD 1P3IB 5E5AD 5DNMA 5B0YB 3EPJA 3REHA 2ZY5A 3KUYD 5F99C 5CHLB 5DNND 1ID3C 3UTAA 5JA4B 4ZUXA 5AV8A 3B6GB 3AFAB 3B0CT 3LZ1D 5B2JB 2LY8A 3B0CW 3AZIB 3W97D 5GXQB 3WKJC 2HIOC 3AZFC 4NE6A 3W96C 4YM6A 5B1LC 1P3AC 1ZLAC 2AROD 4X23C 3KUYA 3C1CA 1M1AA 3AZHC 3A6NC 1BH9A 5GT0A 4WU9C 1H3OB 5B1MD 3W98B 3AL0C 4H9NA 3EPLA 3LZ1A 3MNNA 4QLCB 4R8PB 5AVBB 5G49A 1ULYA 2Y2PA 3AV2B 2J8PA 3C1BD 2Y2MA 4XUJB 4LD9D 3WAAC 5CPJD 5C3IB 2Y2OA 5BO0B 4J8VC 3KWQC 2YFWA 3AYWA 5CPKA 1KX5D 3MGPD 3B0BA 3O62B 2BYMA 5B0ZC 3EPHA 3W99B 4J8XB 1P3FD 1P3GC 1JFIB 1BH8B 3X1VB 4LD9A 5GT3D 1AOIB 5GSUD 5CPJA 2IO5B 3NQJB 4WU8C 5AV5D 4J8WC 4J8UC 3MVDB 3VH5A 3TU4A 4KHAA 1P3ID 2NQBC 5CPIB 5JRGC 3AZLD 4YS3B 1KX5A 2Y2NA 4CAYA 3MGPA 3MGSB 1U35A 3REIB 4NE5A 2XD1A 3WTPA 3AN2C 5B24D 1P3FA 2FJ7B 4UPKA 5B32D 1KX4D 5GT3A 4Z66B 5GSUA 3RELB 2Y2KA 5AV9D 1R4VA 1P3LA 2PYOD 2W8SA 5CP6D 1M19C 1P3IA 1KU5A 2YFVB 5B0YA 3AZJC 2CV5D 4AWLC 4G91C 4G92C 5F99B 1ID3B 3AZGD 3AFAA 2ZY2A 1T3UA 1KX4A 3X1TD 3UTBD 1P3PD 1P34D 5B2JA 3AZIA 4KUDC 5AY8C 5AV9A 3X1UD 5B2ID 5GXQA 3MGRC 3AV2D 1EQZC 4XUJD 3WKJB 4DRAA 2HIOB 3AZFB 4KGCC 3WA9C 3LZ0C 3AV1C 5BNXB 4H9QB 3LJAD 3REJC 1KX3C 1ZLAB 5B1LB 3UT9C 1S32C 1P3AB 4XZQC 3AZHB 3A6NB 3AZGA 1H3OA 4JJNC 1P3KC 3VH6T 3UTBA 3X1TA 1P3OC 1P3PA 5B31C 4J8XD 1F66B 1HQ3C 4R8PA 3VH6W 3AV2A 3UTAD 5DNMC 2DF4C 4XUJA 1AOID 2NZDC 1P3BB 3WAAB 1WWIA 3LJAA
chains in the Genus database with same CATH topology
5AVCB 4ZUXC 3KWQB 5AV8C 4DRBA 3AZEC 5KDMB 1P3MD 3P5JB 3AZNC 3KXBC 3O62A 2ZM5A 5BNVB 4YM6D 3REKB 4J8XA 5B0ZB 1JFIA 1BH8A 4WNNB 3C1CD 1P3GB 1M1AD 3B6FC 5E5AC 5GT0D 1AOIA 4Z66D 3KUYC 3RELD 3EG5B 3NQJA 3MNND 5DNNC 4E44A 3B0DC 4WU8B 3MVDA 4J8WB 3LELD 4J8UB 3X1SB 4YS3A 3LZ1C 1P3MA 2Y2HA 2NQBB 5JRGB 3MGSA 5AV6D 3W97C 4NFTA 4H9PB 2FJ7A 2BG1A 2CWEA 3AYWD 3A1KA 4Z2MG 5CPKD 1N1JB 2AROC 4Z66A 3RELA 4EO5C 3AZKD 5B33D 5B1MC 1M19B 3LELA 3IP4C 4UUZB 2YFVA 4ZBJC 4DQYB 2BYKB 5AV6A 3AZJB 3AZMD 4AWLB 4G91B 4G92B 2G5IC 3C1BC 3TU4D 4LD9C 3FDDA 5CPJC 1F66D 2F8NB 1U35D 5B40D 3AZKA 5B33A 3WTPD 4KUDB 1BFMA 5AY8B 2F2AC 3MGRB 3MGPC 3H0MC 3VH6A 1EQZB 2HIOA 1P3BD 4KGCB 5BNXA 4H9QA 3LZ0B 5AVCD 1ZLAA 3KWQD 3WA9B 2VQRA 1TZYD 3REJB 3AZMA 1KX3B 3UT9B 1S32B 2F8NG 1P3LD 4XZQB 3AZHA 3R45B 5GT3C 4Z5TB 5B0YD 1Q9CA 1F66A 5AV5C 3REKD 1P3OB 1Z2CB 5B31B 5B40A 1P3IC 1HQ3B 3AZLC 1M18B 3B6GD 5DNMB 3AFAD 2NZDB 1P3BA 3WAAA 5B2JD 5B24C 5AVCA 3KWQA 3AZID 1TZYA 5AV8B 3X1SD 2DQNC 5GXQD 5KDMA 5B31G 5B32C 1KX4C 3AZEB 4HGAC 3AZNB 5BS7C 3KXBB 5BNVA 5AV9C 3REKA 2PYOC 5B0ZA 5CP6C 4WNNA 1P3GA 3B6FB 5JA4A 1WWSA 2JE5A 5E5AB 3B6GA 5BT1D 2CV5C 3W98D 4QLCD 5DNNB 3AZGC 3B0DB 1BH9B 4J8WA 4R8PD 5AVBD 3KSYA 3X1SA 2NQBA 5JRGA 3UTBC 3X1TC 1P34C 1P3PC 3H0LC 3X1UC 3MGQC 2UWXA 4H9PA 5B2IC 3AV2C 5G49B 3W97B 3W96B 4XUJC 4X23B 3LJAC 4WU9B 3W98A 3O62D 2AROB 2ZY4A 4EO5B 4QLCA 3W99D 1M19A 1EQZD 2Y2JA 4UUZA 5B1MB 5AVBA 3X1VD 2BYMB 2G5HC 4J8XC 3REHC 3AZJA 5FUGB 5BO0A 4XZQD 3UTAC 2RIQA 4J8VB 3MVDD 1AOIC 3C1BB 4Z5TD 5CPID 4YS3D 4H9SA 3MGSD 2F8NA 1A7WA 3REID 5B31D 4KUDA 2RVQC 5AY8A 1P3MC 1M18D 3W99A 2FJ7D 2JCHA 2FFFB 4CAYB 1EQZA 3F6TA 3MGPB 3X1VA 4KGCA 1B67A 4YM6C 3LZ0A 3WA9A 4CSRB 3UT9A 3C1CC 1S32A 1M1AC 2JSSA 4XZQA 3R45A 5GT0C 4Z66C 3RELC 4Z5TA 5CPIA 5GT3B 3MNNC 1P3OA 2Y2QA 3REIA 5B31A 5AV5B 5F99D 3LELC 1HQ3A 1ID3D 1M18A 3AZLB 3AN2B 5AV6C 2NZDA 4WJ3C 4H9RB 5B24B 3AYWC 5CPKC 3V9RB 3AZEA 5B32B 1KX4B 3WKJD 4HGAB 3AZNA 2HIOD 4E45A 3AZFD 3KXBA 3AZKC 5B33C 5AV9B 1ZLAD 3W96D 5B1LD 1P3AD 2PYOB 4X23D 5CP6B 5F99A 1ID3A 3AZHD 3A6ND 3B6FA 5E5AA 4WU9D 1B6WA 4NE3A 5B32G 3AZMC 2CV5B 5DNNA 3AZGB 3TU4C 4Z2MH 1KX5C 1F66C 3WKJA 3X1TB 3UTBB 1P3PB 1U35C 1P34B 3AZFA 5B40C 3WAAD 3NQUB 2HUEC 3W97A 3WTPC 3X1UB 3MGQB 3W96A 5B2IB 5B1LA 4J8VD 1W2EA 4WZSB 4X23A 2Y2LA 3AV1B 1P3AA 1P3FC 1P3BC 3A6NA 4WU9A 5AVCC 5GSUC 2AROA 1TZYC 3LJAB 4JJNB 1P3KB 1P3LC 5B0ZD 1TAFB 4H9OB 1P3GD 5B1MA 5B0YC 3REKC 5FUGA 3REHB 4WU8D 4J8VA 1HTAA 4J8WD 3UTAB 3AFAC 4J8UD 4ZUXB 1PZRA 3C1BA 3B6GC 2NQBD 5JRGD 3KFUG 5B2JC 3AZIC 2F8NH 3X1SC 5GXQC 3AN2D 1P3MB 1F1EA 4CSRA 2XD5A 4YM6B 3KUYB 3C1CB 4WU8A 1M1AB 3WTPE 1M19D 5GT0B 5BT1C 4J8UA 3W98C 4H9NB 2F8NK 4QLCC 3LZ1B 3MNNB 5AV5A 3AZJD 4R8PC 2L5AA 5AVBC 3LELB 3AZLA 3AN2A 3EPKA 5C3IC 5AV6B 4H9RA 1N1JA 2F8ND 3H0RC 5B24A 3A1IA 2Y2IA 4KUDD 2YFWB 3V9RA 5AY8D 4H9SC 3AYWB 3MGRD 5CPKB 5B32A 3O62C 5BS7A 4KGCD 4ZBJB 2BYKA 5B33B 3LZ0D 3MGQD 3AZKB 3W99C 3AV1D 3WA9D 2PYOA 3REJD 1KX3D 5CP6A 3UT9D 1S32D 3X1VC 4JJND 2CV5A 2IO5C 4LD9B 5CPJB 3AZMB 1P3KD 1P3OD 3MVDC 1HQ3D 4M6BA 2ZY3A 4Z5TC 4KHAB 5CPIC 4YS3C 3MGRA 3TU4B 1KX5B 5DNMD 3MGSC 1P34A 3REIC 3REHD 2NZDD 3NQUA 1U35B 5B40B 3X1UA 3MGQA 2HUEB 5B2IA 3WTPB 3AV1A 1M18C 3REJA 4ZUXD 1KX3A 2FJ7C 5AV8D 1P3FB 3AZED 3VH5T 3AZND 4JJNA 3KXBD 5GSUB 4WV4B 1TZYB 1P3KA 3VH5W 2RVQD 1P3LB 1TAFA 4H9OA 2Y2GA 3B6FD 1P3IB 5E5AD 5DNMA 5B0YB 3EPJA 3REHA 2ZY5A 3KUYD 5F99C 5CHLB 5DNND 1ID3C 3UTAA 5JA4B 4ZUXA 5AV8A 3B6GB 3AFAB 3B0CT 3LZ1D 5B2JB 2LY8A 3B0CW 3AZIB 3W97D 5GXQB 3WKJC 2HIOC 3AZFC 4NE6A 3W96C 4YM6A 5B1LC 1P3AC 1ZLAC 2AROD 4X23C 3KUYA 3C1CA 1M1AA 3AZHC 3A6NC 1BH9A 5GT0A 4WU9C 1H3OB 5B1MD 3W98B 3AL0C 4H9NA 3EPLA 3LZ1A 3MNNA 4QLCB 4R8PB 5AVBB 5G49A 1ULYA 2Y2PA 3AV2B 2J8PA 3C1BD 2Y2MA 4XUJB 4LD9D 3WAAC 5CPJD 5C3IB 2Y2OA 5BO0B 4J8VC 3KWQC 2YFWA 3AYWA 5CPKA 1KX5D 3MGPD 3B0BA 3O62B 2BYMA 5B0ZC 3EPHA 3W99B 4J8XB 1P3FD 1P3GC 1JFIB 1BH8B 3X1VB 4LD9A 5GT3D 1AOIB 5GSUD 5CPJA 2IO5B 3NQJB 4WU8C 5AV5D 4J8WC 4J8UC 3MVDB 3VH5A 3TU4A 4KHAA 1P3ID 2NQBC 5CPIB 5JRGC 3AZLD 4YS3B 1KX5A 2Y2NA 4CAYA 3MGPA 3MGSB 1U35A 3REIB 4NE5A 2XD1A 3WTPA 3AN2C 5B24D 1P3FA 2FJ7B 4UPKA 5B32D 1KX4D 5GT3A 4Z66B 5GSUA 3RELB 2Y2KA 5AV9D 1R4VA 1P3LA 2PYOD 2W8SA 5CP6D 1M19C 1P3IA 1KU5A 2YFVB 5B0YA 3AZJC 2CV5D 4AWLC 4G91C 4G92C 5F99B 1ID3B 3AZGD 3AFAA 2ZY2A 1T3UA 1KX4A 3X1TD 3UTBD 1P3PD 1P34D 5B2JA 3AZIA 4KUDC 5AY8C 5AV9A 3X1UD 5B2ID 5GXQA 3MGRC 3AV2D 1EQZC 4XUJD 3WKJB 4DRAA 2HIOB 3AZFB 4KGCC 3WA9C 3LZ0C 3AV1C 5BNXB 4H9QB 3LJAD 3REJC 1KX3C 1ZLAB 5B1LB 3UT9C 1S32C 1P3AB 4XZQC 3AZHB 3A6NB 3AZGA 1H3OA 4JJNC 1P3KC 3VH6T 3UTBA 3X1TA 1P3OC 1P3PA 5B31C 4J8XD 1F66B 1HQ3C 4R8PA 3VH6W 3AV2A 3UTAD 5DNMC 2DF4C 4XUJA 1AOID 2NZDC 1P3BB 3WAAB 1WWIA 3LJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC B;  4ZUX C;  3KWQ B;  5AV8 C;  4DRB A;  3AZE C;  5KDM B;  1P3M D;  3AZN C;  3KXB C;  3O62 A;  5BNV B;  4YM6 D;  3REK B;  4J8X A;  5B0Z B;  1JFI A;  1BH8 A;  4WNN B;  3C1C D;  1P3G B;  1M1A D;  3B6F C;  5E5A C;  5GT0 D;  1AOI A;  4Z66 D;  3KUY C;  3REL D;  3NQJ A;  3MNN D;  5DNN C;  4E44 A;  3B0D C;  4WU8 B;  3MVD A;  4J8W B;  3LEL D;  4J8U B;  3X1S B;  4YS3 A;  3LZ1 C;  1P3M A;  2NQB B;  5JRG B;  3MGS A;  5AV6 D;  3W97 C;  4NFT A;  4H9P B;  2FJ7 A;  2CWE A;  3AYW D;  5CPK D;  4Z2M G;  1N1J B;  2ARO C;  4Z66 A;  3REL A;  4EO5 C;  3AZK D;  5B33 D;  5B1M C;  1M19 B;  3LEL A;  4UUZ B;  2YFV A;  4ZBJ C;  2BYK B;  5AV6 A;  3AZJ B;  3AZM D;  4AWL B;  4G91 B;  4G92 B;  3C1B C;  3TU4 D;  4LD9 C;  5CPJ C;  1F66 D;  2F8N B;  1U35 D;  5B40 D;  3AZK A;  5B33 A;  3WTP D;  4KUD B;  1BFM A;  5AY8 B;  3MGR B;  3MGP C;  3VH6 A;  1EQZ B;  2HIO A;  1P3B D;  4KGC B;  5BNX A;  4H9Q A;  3LZ0 B;  5AVC D;  1ZLA A;  3KWQ D;  3WA9 B;  1TZY D;  3REJ B;  3AZM A;  1KX3 B;  3UT9 B;  1S32 B;  2F8N G;  1P3L D;  4XZQ B;  3AZH A;  3R45 B;  5GT3 C;  4Z5T B;  5B0Y D;  1Q9C A;  1F66 A;  5AV5 C;  3REK D;  1P3O B;  5B31 B;  5B40 A;  1P3I C;  1HQ3 B;  3AZL C;  1M18 B;  3B6G D;  5DNM B;  3AFA D;  2NZD B;  1P3B A;  3WAA A;  5B2J D;  5B24 C;  5AVC A;  3KWQ A;  3AZI D;  1TZY A;  5AV8 B;  3X1S D;  5GXQ D;  5KDM A;  5B31 G;  5B32 C;  1KX4 C;  3AZE B;  4HGA C;  3AZN B;  5BS7 C;  3KXB B;  5BNV A;  5AV9 C;  3REK A;  2PYO C;  5B0Z A;  5CP6 C;  4WNN A;  1P3G A;  3B6F B;  5JA4 A;  1WWS A;  5E5A B;  3B6G A;  5BT1 D;  2CV5 C;  3W98 D;  4QLC D;  5DNN B;  3AZG C;  3B0D B;  1BH9 B;  4J8W A;  4R8P D;  5AVB D;  3KSY A;  3X1S A;  2NQB A;  5JRG A;  3UTB C;  3X1T C;  1P34 C;  1P3P C;  3X1U C;  3MGQ C;  4H9P A;  5B2I C;  3AV2 C;  3W97 B;  5G49 B;  3W96 B;  4XUJ C;  4X23 B;  3LJA C;  4WU9 B;  3W98 A;  3O62 D;  2ARO B;  4EO5 B;  4QLC A;  3W99 D;  1M19 A;  1EQZ D;  4UUZ A;  5B1M B;  5AVB A;  3X1V D;  2BYM B;  4J8X C;  3REH C;  3AZJ A;  5FUG B;  5BO0 A;  4XZQ D;  3UTA C;  4J8V B;  3MVD D;  1AOI C;  3C1B B;  4Z5T D;  5CPI D;  4YS3 D;  4H9S A;  3MGS D;  2F8N A;  1A7W A;  3REI D;  5B31 D;  4KUD A;  2RVQ C;  5AY8 A;  1P3M C;  1M18 D;  3W99 A;  2FJ7 D;  4CAY B;  1EQZ A;  3MGP B;  3X1V A;  4KGC A;  1B67 A;  4YM6 C;  3LZ0 A;  3WA9 A;  4CSR B;  3UT9 A;  3C1C C;  1S32 A;  1M1A C;  2JSS A;  4XZQ A;  3R45 A;  5GT0 C;  4Z66 C;  3REL C;  4Z5T A;  5CPI A;  5GT3 B;  3MNN C;  1P3O A;  3REI A;  5B31 A;  5AV5 B;  5F99 D;  3LEL C;  1HQ3 A;  1ID3 D;  1M18 A;  3AZL B;  3AN2 B;  5AV6 C;  2NZD A;  4H9R B;  5B24 B;  3AYW C;  5CPK C;  3V9R B;  3AZE A;  5B32 B;  1KX4 B;  3WKJ D;  4HGA B;  3AZN A;  2HIO D;  4E45 A;  3AZF D;  3KXB A;  3AZK C;  5B33 C;  5AV9 B;  1ZLA D;  3W96 D;  5B1L D;  1P3A D;  2PYO B;  4X23 D;  5CP6 B;  5F99 A;  1ID3 A;  3AZH D;  3A6N D;  3B6F A;  5E5A A;  4WU9 D;  1B6W A;  4NE3 A;  5B32 G;  3AZM C;  2CV5 B;  5DNN A;  3AZG B;  3TU4 C;  4Z2M H;  1KX5 C;  1F66 C;  3WKJ A;  3X1T B;  3UTB B;  1P3P B;  1U35 C;  1P34 B;  3AZF A;  5B40 C;  3WAA D;  3NQU B;  2HUE C;  3W97 A;  3WTP C;  3X1U B;  3MGQ B;  3W96 A;  5B2I B;  5B1L A;  4J8V D;  4WZS B;  3AV1 B;  4X23 A;  1P3A A;  1P3F C;  1P3B C;  3A6N A;  4WU9 A;  5AVC C;  5GSU C;  2ARO A;  1TZY C;  3LJA B;  4JJN B;  1P3K B;  1P3L C;  5B0Z D;  1TAF B;  4H9O B;  1P3G D;  5B1M A;  5B0Y C;  3REK C;  5FUG A;  3REH B;  4WU8 D;  4J8V A;  1HTA A;  4J8W D;  3UTA B;  3AFA C;  4J8U D;  4ZUX B;  3C1B A;  3B6G C;  2NQB D;  5JRG D;  5B2J C;  3AZI C;  2F8N H;  3X1S C;  5GXQ C;  3AN2 D;  1P3M B;  1F1E A;  4CSR A;  4YM6 B;  3KUY B;  3C1C B;  4WU8 A;  1M1A B;  3WTP E;  1M19 D;  5GT0 B;  5BT1 C;  4J8U A;  3W98 C;  4H9N B;  2F8N K;  4QLC C;  3LZ1 B;  3MNN B;  5AV5 A;  3AZJ D;  4R8P C;  2L5A A;  5AVB C;  3LEL B;  3AZL A;  3AN2 A;  5C3I C;  5AV6 B;  4H9R A;  1N1J A;  2F8N D;  5B24 A;  4KUD D;  2YFW B;  3V9R A;  5AY8 D;  4H9S C;  3AYW B;  3MGR D;  5CPK B;  5B32 A;  3O62 C;  5BS7 A;  4KGC D;  4ZBJ B;  2BYK A;  5B33 B;  3LZ0 D;  3MGQ D;  3AZK B;  3W99 C;  3AV1 D;  3WA9 D;  2PYO A;  3REJ D;  1KX3 D;  5CP6 A;  3UT9 D;  1S32 D;  3X1V C;  4JJN D;  2CV5 A;  2IO5 C;  4LD9 B;  5CPJ B;  3AZM B;  1P3K D;  1P3O D;  3MVD C;  1HQ3 D;  4M6B A;  4Z5T C;  5CPI C;  4KHA B;  4YS3 C;  3TU4 B;  3MGR A;  1KX5 B;  5DNM D;  3MGS C;  1P34 A;  3REI C;  3REH D;  2NZD D;  3NQU A;  1U35 B;  5B40 B;  3X1U A;  3MGQ A;  2HUE B;  5B2I A;  3WTP B;  3AV1 A;  1M18 C;  3REJ A;  4ZUX D;  1KX3 A;  2FJ7 C;  5AV8 D;  1P3F B;  3AZE D;  3VH5 T;  3AZN D;  4JJN A;  3KXB D;  5GSU B;  4WV4 B;  1TZY B;  1P3K A;  3VH5 W;  2RVQ D;  1P3L B;  1TAF A;  4H9O A;  3B6F D;  1P3I B;  5E5A D;  5DNM A;  5B0Y B;  3REH A;  3KUY D;  5F99 C;  5CHL B;  5DNN D;  1ID3 C;  3UTA A;  5JA4 B;  4ZUX A;  5AV8 A;  3B6G B;  3AFA B;  3B0C T;  3LZ1 D;  5B2J B;  2LY8 A;  3B0C W;  3AZI B;  3W97 D;  5GXQ B;  3WKJ C;  2HIO C;  3AZF C;  4NE6 A;  3W96 C;  4YM6 A;  5B1L C;  1P3A C;  1ZLA C;  2ARO D;  4X23 C;  3KUY A;  3C1C A;  1M1A A;  3AZH C;  3A6N C;  1BH9 A;  5GT0 A;  4WU9 C;  1H3O B;  5B1M D;  3W98 B;  4H9N A;  3LZ1 A;  3MNN A;  4QLC B;  4R8P B;  5AVB B;  5G49 A;  1ULY A;  3AV2 B;  3C1B D;  4XUJ B;  4LD9 D;  3WAA C;  5CPJ D;  5C3I B;  5BO0 B;  4J8V C;  3KWQ C;  2YFW A;  3AYW A;  5CPK A;  1KX5 D;  3MGP D;  3B0B A;  3O62 B;  2BYM A;  5B0Z C;  3W99 B;  4J8X B;  1P3F D;  1P3G C;  1JFI B;  1BH8 B;  3X1V B;  4LD9 A;  5GT3 D;  1AOI B;  5GSU D;  5CPJ A;  2IO5 B;  3NQJ B;  4WU8 C;  5AV5 D;  4J8W C;  4J8U C;  3MVD B;  3VH5 A;  3TU4 A;  4KHA A;  1P3I D;  2NQB C;  5CPI B;  5JRG C;  3AZL D;  4YS3 B;  1KX5 A;  4CAY A;  3MGP A;  3MGS B;  1U35 A;  3REI B;  4NE5 A;  3WTP A;  3AN2 C;  5B24 D;  1P3F A;  2FJ7 B;  5B32 D;  1KX4 D;  5GT3 A;  4Z66 B;  5GSU A;  3REL B;  5AV9 D;  1R4V A;  1P3L A;  2PYO D;  5CP6 D;  1M19 C;  1P3I A;  1KU5 A;  2YFV B;  5B0Y A;  3AZJ C;  2CV5 D;  4AWL C;  4G91 C;  4G92 C;  5F99 B;  1ID3 B;  3AZG D;  3AFA A;  1KX4 A;  3X1T D;  3UTB D;  1P3P D;  1P34 D;  5B2J A;  3AZI A;  4KUD C;  5AY8 C;  5AV9 A;  3X1U D;  5GXQ A;  5B2I D;  3MGR C;  3AV2 D;  1EQZ C;  4XUJ D;  3WKJ B;  4DRA A;  2HIO B;  3AZF B;  4KGC C;  3WA9 C;  3LZ0 C;  3AV1 C;  5BNX B;  4H9Q B;  3LJA D;  3REJ C;  1KX3 C;  1ZLA B;  5B1L B;  3UT9 C;  1S32 C;  1P3A B;  4XZQ C;  3AZH B;  3A6N B;  3AZG A;  1H3O A;  4JJN C;  1P3K C;  3VH6 T;  3UTB A;  3X1T A;  1P3O C;  1P3P A;  5B31 C;  4J8X D;  1F66 B;  1HQ3 C;  4R8P A;  3VH6 W;  3AV2 A;  3UTA D;  5DNM C;  4XUJ A;  1AOI D;  2NZD C;  1P3B B;  3WAA B;  1WWI A;  3LJA A; 
#chains in the Genus database with same CATH topology
 5AVC B;  4ZUX C;  3KWQ B;  5AV8 C;  4DRB A;  3AZE C;  5KDM B;  1P3M D;  3P5J B;  3AZN C;  3KXB C;  3O62 A;  2ZM5 A;  5BNV B;  4YM6 D;  3REK B;  4J8X A;  5B0Z B;  1JFI A;  1BH8 A;  4WNN B;  3C1C D;  1P3G B;  1M1A D;  3B6F C;  5E5A C;  5GT0 D;  1AOI A;  4Z66 D;  3KUY C;  3REL D;  3EG5 B;  3NQJ A;  3MNN D;  5DNN C;  4E44 A;  3B0D C;  4WU8 B;  3MVD A;  4J8W B;  3LEL D;  4J8U B;  3X1S B;  4YS3 A;  3LZ1 C;  1P3M A;  2Y2H A;  2NQB B;  5JRG B;  3MGS A;  5AV6 D;  3W97 C;  4NFT A;  4H9P B;  2FJ7 A;  2BG1 A;  2CWE A;  3AYW D;  3A1K A;  4Z2M G;  5CPK D;  1N1J B;  2ARO C;  4Z66 A;  3REL A;  4EO5 C;  3AZK D;  5B33 D;  5B1M C;  1M19 B;  3LEL A;  3IP4 C;  4UUZ B;  2YFV A;  4ZBJ C;  4DQY B;  2BYK B;  5AV6 A;  3AZJ B;  3AZM D;  4AWL B;  4G91 B;  4G92 B;  2G5I C;  3C1B C;  3TU4 D;  4LD9 C;  3FDD A;  5CPJ C;  1F66 D;  2F8N B;  1U35 D;  5B40 D;  3AZK A;  5B33 A;  3WTP D;  4KUD B;  1BFM A;  5AY8 B;  2F2A C;  3MGR B;  3MGP C;  3H0M C;  3VH6 A;  1EQZ B;  2HIO A;  1P3B D;  4KGC B;  5BNX A;  4H9Q A;  3LZ0 B;  5AVC D;  1ZLA A;  3KWQ D;  3WA9 B;  2VQR A;  1TZY D;  3REJ B;  3AZM A;  1KX3 B;  3UT9 B;  1S32 B;  2F8N G;  1P3L D;  4XZQ B;  3AZH A;  3R45 B;  5GT3 C;  4Z5T B;  5B0Y D;  1Q9C A;  1F66 A;  5AV5 C;  3REK D;  1P3O B;  1Z2C B;  5B31 B;  5B40 A;  1P3I C;  1HQ3 B;  3AZL C;  1M18 B;  3B6G D;  5DNM B;  3AFA D;  2NZD B;  1P3B A;  3WAA A;  5B2J D;  5B24 C;  5AVC A;  3KWQ A;  3AZI D;  1TZY A;  5AV8 B;  3X1S D;  2DQN C;  5GXQ D;  5KDM A;  5B31 G;  5B32 C;  1KX4 C;  3AZE B;  4HGA C;  3AZN B;  5BS7 C;  3KXB B;  5BNV A;  5AV9 C;  3REK A;  2PYO C;  5B0Z A;  5CP6 C;  4WNN A;  1P3G A;  3B6F B;  5JA4 A;  1WWS A;  2JE5 A;  5E5A B;  3B6G A;  5BT1 D;  2CV5 C;  3W98 D;  4QLC D;  5DNN B;  3AZG C;  3B0D B;  1BH9 B;  4J8W A;  4R8P D;  5AVB D;  3KSY A;  3X1S A;  2NQB A;  5JRG A;  3UTB C;  3X1T C;  1P34 C;  1P3P C;  3H0L C;  3X1U C;  3MGQ C;  2UWX A;  4H9P A;  5B2I C;  3AV2 C;  5G49 B;  3W97 B;  3W96 B;  4XUJ C;  4X23 B;  3LJA C;  4WU9 B;  3W98 A;  3O62 D;  2ARO B;  2ZY4 A;  4EO5 B;  4QLC A;  3W99 D;  1M19 A;  1EQZ D;  2Y2J A;  4UUZ A;  5B1M B;  5AVB A;  3X1V D;  2BYM B;  2G5H C;  4J8X C;  3REH C;  3AZJ A;  5FUG B;  5BO0 A;  4XZQ D;  3UTA C;  2RIQ A;  4J8V B;  3MVD D;  1AOI C;  3C1B B;  4Z5T D;  5CPI D;  4YS3 D;  4H9S A;  3MGS D;  2F8N A;  1A7W A;  3REI D;  5B31 D;  4KUD A;  2RVQ C;  5AY8 A;  1P3M C;  1M18 D;  3W99 A;  2FJ7 D;  2JCH A;  2FFF B;  4CAY B;  1EQZ A;  3F6T A;  3MGP B;  3X1V A;  4KGC A;  1B67 A;  4YM6 C;  3LZ0 A;  3WA9 A;  4CSR B;  3UT9 A;  3C1C C;  1S32 A;  1M1A C;  2JSS A;  4XZQ A;  3R45 A;  5GT0 C;  4Z66 C;  3REL C;  4Z5T A;  5CPI A;  5GT3 B;  3MNN C;  1P3O A;  2Y2Q A;  3REI A;  5B31 A;  5AV5 B;  5F99 D;  3LEL C;  1HQ3 A;  1ID3 D;  1M18 A;  3AZL B;  3AN2 B;  5AV6 C;  2NZD A;  4WJ3 C;  4H9R B;  5B24 B;  3AYW C;  5CPK C;  3V9R B;  3AZE A;  5B32 B;  1KX4 B;  3WKJ D;  4HGA B;  3AZN A;  2HIO D;  4E45 A;  3AZF D;  3KXB A;  3AZK C;  5B33 C;  5AV9 B;  1ZLA D;  3W96 D;  5B1L D;  1P3A D;  2PYO B;  4X23 D;  5CP6 B;  5F99 A;  1ID3 A;  3AZH D;  3A6N D;  3B6F A;  5E5A A;  4WU9 D;  1B6W A;  4NE3 A;  5B32 G;  3AZM C;  2CV5 B;  5DNN A;  3AZG B;  3TU4 C;  4Z2M H;  1KX5 C;  1F66 C;  3WKJ A;  3X1T B;  3UTB B;  1P3P B;  1U35 C;  1P34 B;  3AZF A;  5B40 C;  3WAA D;  3NQU B;  2HUE C;  3W97 A;  3WTP C;  3X1U B;  3MGQ B;  3W96 A;  5B2I B;  5B1L A;  4J8V D;  1W2E A;  4WZS B;  4X23 A;  2Y2L A;  3AV1 B;  1P3A A;  1P3F C;  1P3B C;  3A6N A;  4WU9 A;  5AVC C;  5GSU C;  2ARO A;  1TZY C;  3LJA B;  4JJN B;  1P3K B;  1P3L C;  5B0Z D;  1TAF B;  4H9O B;  1P3G D;  5B1M A;  5B0Y C;  3REK C;  5FUG A;  3REH B;  4WU8 D;  4J8V A;  1HTA A;  4J8W D;  3UTA B;  3AFA C;  4J8U D;  4ZUX B;  1PZR A;  3C1B A;  3B6G C;  2NQB D;  5JRG D;  3KFU G;  5B2J C;  3AZI C;  2F8N H;  3X1S C;  5GXQ C;  3AN2 D;  1P3M B;  1F1E A;  4CSR A;  2XD5 A;  4YM6 B;  3KUY B;  3C1C B;  4WU8 A;  1M1A B;  3WTP E;  1M19 D;  5GT0 B;  5BT1 C;  4J8U A;  3W98 C;  4H9N B;  2F8N K;  4QLC C;  3LZ1 B;  3MNN B;  5AV5 A;  3AZJ D;  4R8P C;  2L5A A;  5AVB C;  3LEL B;  3AZL A;  3AN2 A;  3EPK A;  5C3I C;  5AV6 B;  4H9R A;  1N1J A;  2F8N D;  3H0R C;  5B24 A;  3A1I A;  2Y2I A;  4KUD D;  2YFW B;  3V9R A;  5AY8 D;  4H9S C;  3AYW B;  3MGR D;  5CPK B;  5B32 A;  3O62 C;  5BS7 A;  4KGC D;  4ZBJ B;  2BYK A;  5B33 B;  3LZ0 D;  3MGQ D;  3AZK B;  3W99 C;  3AV1 D;  3WA9 D;  2PYO A;  3REJ D;  1KX3 D;  5CP6 A;  3UT9 D;  1S32 D;  3X1V C;  4JJN D;  2CV5 A;  2IO5 C;  4LD9 B;  5CPJ B;  3AZM B;  1P3K D;  1P3O D;  3MVD C;  1HQ3 D;  4M6B A;  2ZY3 A;  4Z5T C;  4KHA B;  5CPI C;  4YS3 C;  3MGR A;  3TU4 B;  1KX5 B;  5DNM D;  3MGS C;  1P34 A;  3REI C;  3REH D;  2NZD D;  3NQU A;  1U35 B;  5B40 B;  3X1U A;  3MGQ A;  2HUE B;  5B2I A;  3WTP B;  3AV1 A;  1M18 C;  3REJ A;  4ZUX D;  1KX3 A;  2FJ7 C;  5AV8 D;  1P3F B;  3AZE D;  3VH5 T;  3AZN D;  4JJN A;  3KXB D;  5GSU B;  4WV4 B;  1TZY B;  1P3K A;  3VH5 W;  2RVQ D;  1P3L B;  1TAF A;  4H9O A;  2Y2G A;  3B6F D;  1P3I B;  5E5A D;  5DNM A;  5B0Y B;  3EPJ A;  3REH A;  2ZY5 A;  3KUY D;  5F99 C;  5CHL B;  5DNN D;  1ID3 C;  3UTA A;  5JA4 B;  4ZUX A;  5AV8 A;  3B6G B;  3AFA B;  3B0C T;  3LZ1 D;  5B2J B;  2LY8 A;  3B0C W;  3AZI B;  3W97 D;  5GXQ B;  3WKJ C;  2HIO C;  3AZF C;  4NE6 A;  3W96 C;  4YM6 A;  5B1L C;  1P3A C;  1ZLA C;  2ARO D;  4X23 C;  3KUY A;  3C1C A;  1M1A A;  3AZH C;  3A6N C;  1BH9 A;  5GT0 A;  4WU9 C;  1H3O B;  5B1M D;  3W98 B;  3AL0 C;  4H9N A;  3EPL A;  3LZ1 A;  3MNN A;  4QLC B;  4R8P B;  5AVB B;  5G49 A;  1ULY A;  2Y2P A;  3AV2 B;  2J8P A;  3C1B D;  2Y2M A;  4XUJ B;  4LD9 D;  3WAA C;  5CPJ D;  5C3I B;  2Y2O A;  5BO0 B;  4J8V C;  3KWQ C;  2YFW A;  3AYW A;  5CPK A;  1KX5 D;  3MGP D;  3B0B A;  3O62 B;  2BYM A;  5B0Z C;  3EPH A;  3W99 B;  4J8X B;  1P3F D;  1P3G C;  1JFI B;  1BH8 B;  3X1V B;  4LD9 A;  5GT3 D;  1AOI B;  5GSU D;  5CPJ A;  2IO5 B;  3NQJ B;  4WU8 C;  5AV5 D;  4J8W C;  4J8U C;  3MVD B;  3VH5 A;  3TU4 A;  4KHA A;  1P3I D;  2NQB C;  5CPI B;  5JRG C;  3AZL D;  4YS3 B;  1KX5 A;  2Y2N A;  4CAY A;  3MGP A;  3MGS B;  1U35 A;  3REI B;  4NE5 A;  2XD1 A;  3WTP A;  3AN2 C;  5B24 D;  1P3F A;  2FJ7 B;  4UPK A;  5B32 D;  1KX4 D;  5GT3 A;  4Z66 B;  5GSU A;  3REL B;  2Y2K A;  5AV9 D;  1R4V A;  1P3L A;  2PYO D;  2W8S A;  5CP6 D;  1M19 C;  1P3I A;  1KU5 A;  2YFV B;  5B0Y A;  3AZJ C;  2CV5 D;  4AWL C;  4G91 C;  4G92 C;  5F99 B;  1ID3 B;  3AZG D;  3AFA A;  2ZY2 A;  1T3U A;  1KX4 A;  3X1T D;  3UTB D;  1P3P D;  1P34 D;  5B2J A;  3AZI A;  4KUD C;  5AY8 C;  5AV9 A;  3X1U D;  5B2I D;  5GXQ A;  3MGR C;  3AV2 D;  1EQZ C;  4XUJ D;  3WKJ B;  4DRA A;  2HIO B;  3AZF B;  4KGC C;  3WA9 C;  3LZ0 C;  3AV1 C;  5BNX B;  4H9Q B;  3LJA D;  3REJ C;  1KX3 C;  1ZLA B;  5B1L B;  3UT9 C;  1S32 C;  1P3A B;  4XZQ C;  3AZH B;  3A6N B;  3AZG A;  1H3O A;  4JJN C;  1P3K C;  3VH6 T;  3UTB A;  3X1T A;  1P3O C;  1P3P A;  5B31 C;  4J8X D;  1F66 B;  1HQ3 C;  4R8P A;  3VH6 W;  3AV2 A;  3UTA D;  5DNM C;  2DF4 C;  4XUJ A;  1AOI D;  2NZD C;  1P3B B;  3WAA B;  1WWI A;  3LJA A; 
#chains in the Genus database with same CATH homology
 5AVC B;  4ZUX C;  3KWQ B;  5AV8 C;  4DRB A;  3AZE C;  5KDM B;  1P3M D;  3P5J B;  3AZN C;  3KXB C;  3O62 A;  2ZM5 A;  5BNV B;  4YM6 D;  3REK B;  4J8X A;  5B0Z B;  1JFI A;  1BH8 A;  4WNN B;  3C1C D;  1P3G B;  1M1A D;  3B6F C;  5E5A C;  5GT0 D;  1AOI A;  4Z66 D;  3KUY C;  3REL D;  3EG5 B;  3NQJ A;  3MNN D;  5DNN C;  4E44 A;  3B0D C;  4WU8 B;  3MVD A;  4J8W B;  3LEL D;  4J8U B;  3X1S B;  4YS3 A;  3LZ1 C;  1P3M A;  2Y2H A;  2NQB B;  5JRG B;  3MGS A;  5AV6 D;  3W97 C;  4NFT A;  4H9P B;  2FJ7 A;  2BG1 A;  2CWE A;  3AYW D;  3A1K A;  4Z2M G;  5CPK D;  1N1J B;  2ARO C;  4Z66 A;  3REL A;  4EO5 C;  3AZK D;  5B33 D;  5B1M C;  1M19 B;  3LEL A;  3IP4 C;  4UUZ B;  2YFV A;  4ZBJ C;  4DQY B;  2BYK B;  5AV6 A;  3AZJ B;  3AZM D;  4AWL B;  4G91 B;  4G92 B;  2G5I C;  3C1B C;  3TU4 D;  4LD9 C;  3FDD A;  5CPJ C;  1F66 D;  2F8N B;  1U35 D;  5B40 D;  3AZK A;  5B33 A;  3WTP D;  4KUD B;  1BFM A;  5AY8 B;  2F2A C;  3MGR B;  3MGP C;  3H0M C;  3VH6 A;  1EQZ B;  2HIO A;  1P3B D;  4KGC B;  5BNX A;  4H9Q A;  3LZ0 B;  5AVC D;  1ZLA A;  3KWQ D;  3WA9 B;  2VQR A;  1TZY D;  3REJ B;  3AZM A;  1KX3 B;  3UT9 B;  1S32 B;  2F8N G;  1P3L D;  4XZQ B;  3AZH A;  3R45 B;  5GT3 C;  4Z5T B;  5B0Y D;  1Q9C A;  1F66 A;  5AV5 C;  3REK D;  1P3O B;  1Z2C B;  5B31 B;  5B40 A;  1P3I C;  1HQ3 B;  3AZL C;  1M18 B;  3B6G D;  5DNM B;  3AFA D;  2NZD B;  1P3B A;  3WAA A;  5B2J D;  5B24 C;  5AVC A;  3KWQ A;  3AZI D;  1TZY A;  5AV8 B;  3X1S D;  2DQN C;  5GXQ D;  5KDM A;  5B31 G;  5B32 C;  1KX4 C;  3AZE B;  4HGA C;  3AZN B;  5BS7 C;  3KXB B;  5BNV A;  5AV9 C;  3REK A;  2PYO C;  5B0Z A;  5CP6 C;  4WNN A;  1P3G A;  3B6F B;  5JA4 A;  1WWS A;  2JE5 A;  5E5A B;  3B6G A;  5BT1 D;  2CV5 C;  3W98 D;  4QLC D;  5DNN B;  3AZG C;  3B0D B;  1BH9 B;  4J8W A;  4R8P D;  5AVB D;  3KSY A;  3X1S A;  2NQB A;  5JRG A;  3UTB C;  3X1T C;  1P34 C;  1P3P C;  3H0L C;  3X1U C;  3MGQ C;  2UWX A;  4H9P A;  5B2I C;  3AV2 C;  5G49 B;  3W97 B;  3W96 B;  4XUJ C;  4X23 B;  3LJA C;  4WU9 B;  3W98 A;  3O62 D;  2ARO B;  2ZY4 A;  4EO5 B;  4QLC A;  3W99 D;  1M19 A;  1EQZ D;  2Y2J A;  4UUZ A;  5B1M B;  5AVB A;  3X1V D;  2BYM B;  2G5H C;  4J8X C;  3REH C;  3AZJ A;  5FUG B;  5BO0 A;  4XZQ D;  3UTA C;  2RIQ A;  4J8V B;  3MVD D;  1AOI C;  3C1B B;  4Z5T D;  5CPI D;  4YS3 D;  4H9S A;  3MGS D;  2F8N A;  1A7W A;  3REI D;  5B31 D;  4KUD A;  2RVQ C;  5AY8 A;  1P3M C;  1M18 D;  3W99 A;  2FJ7 D;  2JCH A;  2FFF B;  4CAY B;  1EQZ A;  3F6T A;  3MGP B;  3X1V A;  4KGC A;  1B67 A;  4YM6 C;  3LZ0 A;  3WA9 A;  4CSR B;  3UT9 A;  3C1C C;  1S32 A;  1M1A C;  2JSS A;  4XZQ A;  3R45 A;  5GT0 C;  4Z66 C;  3REL C;  4Z5T A;  5CPI A;  5GT3 B;  3MNN C;  1P3O A;  2Y2Q A;  3REI A;  5B31 A;  5AV5 B;  5F99 D;  3LEL C;  1HQ3 A;  1ID3 D;  1M18 A;  3AZL B;  3AN2 B;  5AV6 C;  2NZD A;  4WJ3 C;  4H9R B;  5B24 B;  3AYW C;  5CPK C;  3V9R B;  3AZE A;  5B32 B;  1KX4 B;  3WKJ D;  4HGA B;  3AZN A;  2HIO D;  4E45 A;  3AZF D;  3KXB A;  3AZK C;  5B33 C;  5AV9 B;  1ZLA D;  3W96 D;  5B1L D;  1P3A D;  2PYO B;  4X23 D;  5CP6 B;  5F99 A;  1ID3 A;  3AZH D;  3A6N D;  3B6F A;  5E5A A;  4WU9 D;  1B6W A;  4NE3 A;  5B32 G;  3AZM C;  2CV5 B;  5DNN A;  3AZG B;  3TU4 C;  4Z2M H;  1KX5 C;  1F66 C;  3WKJ A;  3X1T B;  3UTB B;  1P3P B;  1U35 C;  1P34 B;  3AZF A;  5B40 C;  3WAA D;  3NQU B;  2HUE C;  3W97 A;  3WTP C;  3X1U B;  3MGQ B;  3W96 A;  5B2I B;  5B1L A;  4J8V D;  1W2E A;  4WZS B;  4X23 A;  2Y2L A;  3AV1 B;  1P3A A;  1P3F C;  1P3B C;  3A6N A;  4WU9 A;  5AVC C;  5GSU C;  2ARO A;  1TZY C;  3LJA B;  4JJN B;  1P3K B;  1P3L C;  5B0Z D;  1TAF B;  4H9O B;  1P3G D;  5B1M A;  5B0Y C;  3REK C;  5FUG A;  3REH B;  4WU8 D;  4J8V A;  1HTA A;  4J8W D;  3UTA B;  3AFA C;  4J8U D;  4ZUX B;  1PZR A;  3C1B A;  3B6G C;  2NQB D;  5JRG D;  3KFU G;  5B2J C;  3AZI C;  2F8N H;  3X1S C;  5GXQ C;  3AN2 D;  1P3M B;  1F1E A;  4CSR A;  2XD5 A;  4YM6 B;  3KUY B;  3C1C B;  4WU8 A;  1M1A B;  3WTP E;  1M19 D;  5GT0 B;  5BT1 C;  4J8U A;  3W98 C;  4H9N B;  2F8N K;  4QLC C;  3LZ1 B;  3MNN B;  5AV5 A;  3AZJ D;  4R8P C;  2L5A A;  5AVB C;  3LEL B;  3AZL A;  3AN2 A;  3EPK A;  5C3I C;  5AV6 B;  4H9R A;  1N1J A;  2F8N D;  3H0R C;  5B24 A;  3A1I A;  2Y2I A;  4KUD D;  2YFW B;  3V9R A;  5AY8 D;  4H9S C;  3AYW B;  3MGR D;  5CPK B;  5B32 A;  3O62 C;  5BS7 A;  4KGC D;  4ZBJ B;  2BYK A;  5B33 B;  3LZ0 D;  3MGQ D;  3AZK B;  3W99 C;  3AV1 D;  3WA9 D;  2PYO A;  3REJ D;  1KX3 D;  5CP6 A;  3UT9 D;  1S32 D;  3X1V C;  4JJN D;  2CV5 A;  2IO5 C;  4LD9 B;  5CPJ B;  3AZM B;  1P3K D;  1P3O D;  3MVD C;  1HQ3 D;  4M6B A;  2ZY3 A;  4Z5T C;  4KHA B;  5CPI C;  4YS3 C;  3MGR A;  3TU4 B;  1KX5 B;  5DNM D;  3MGS C;  1P34 A;  3REI C;  3REH D;  2NZD D;  3NQU A;  1U35 B;  5B40 B;  3X1U A;  3MGQ A;  2HUE B;  5B2I A;  3WTP B;  3AV1 A;  1M18 C;  3REJ A;  4ZUX D;  1KX3 A;  2FJ7 C;  5AV8 D;  1P3F B;  3AZE D;  3VH5 T;  3AZN D;  4JJN A;  3KXB D;  5GSU B;  4WV4 B;  1TZY B;  1P3K A;  3VH5 W;  2RVQ D;  1P3L B;  1TAF A;  4H9O A;  2Y2G A;  3B6F D;  1P3I B;  5E5A D;  5DNM A;  5B0Y B;  3EPJ A;  3REH A;  2ZY5 A;  3KUY D;  5F99 C;  5CHL B;  5DNN D;  1ID3 C;  3UTA A;  5JA4 B;  4ZUX A;  5AV8 A;  3B6G B;  3AFA B;  3B0C T;  3LZ1 D;  5B2J B;  2LY8 A;  3B0C W;  3AZI B;  3W97 D;  5GXQ B;  3WKJ C;  2HIO C;  3AZF C;  4NE6 A;  3W96 C;  4YM6 A;  5B1L C;  1P3A C;  1ZLA C;  2ARO D;  4X23 C;  3KUY A;  3C1C A;  1M1A A;  3AZH C;  3A6N C;  1BH9 A;  5GT0 A;  4WU9 C;  1H3O B;  5B1M D;  3W98 B;  3AL0 C;  4H9N A;  3EPL A;  3LZ1 A;  3MNN A;  4QLC B;  4R8P B;  5AVB B;  5G49 A;  1ULY A;  2Y2P A;  3AV2 B;  2J8P A;  3C1B D;  2Y2M A;  4XUJ B;  4LD9 D;  3WAA C;  5CPJ D;  5C3I B;  2Y2O A;  5BO0 B;  4J8V C;  3KWQ C;  2YFW A;  3AYW A;  5CPK A;  1KX5 D;  3MGP D;  3B0B A;  3O62 B;  2BYM A;  5B0Z C;  3EPH A;  3W99 B;  4J8X B;  1P3F D;  1P3G C;  1JFI B;  1BH8 B;  3X1V B;  4LD9 A;  5GT3 D;  1AOI B;  5GSU D;  5CPJ A;  2IO5 B;  3NQJ B;  4WU8 C;  5AV5 D;  4J8W C;  4J8U C;  3MVD B;  3VH5 A;  3TU4 A;  4KHA A;  1P3I D;  2NQB C;  5CPI B;  5JRG C;  3AZL D;  4YS3 B;  1KX5 A;  2Y2N A;  4CAY A;  3MGP A;  3MGS B;  1U35 A;  3REI B;  4NE5 A;  2XD1 A;  3WTP A;  3AN2 C;  5B24 D;  1P3F A;  2FJ7 B;  4UPK A;  5B32 D;  1KX4 D;  5GT3 A;  4Z66 B;  5GSU A;  3REL B;  2Y2K A;  5AV9 D;  1R4V A;  1P3L A;  2PYO D;  2W8S A;  5CP6 D;  1M19 C;  1P3I A;  1KU5 A;  2YFV B;  5B0Y A;  3AZJ C;  2CV5 D;  4AWL C;  4G91 C;  4G92 C;  5F99 B;  1ID3 B;  3AZG D;  3AFA A;  2ZY2 A;  1T3U A;  1KX4 A;  3X1T D;  3UTB D;  1P3P D;  1P34 D;  5B2J A;  3AZI A;  4KUD C;  5AY8 C;  5AV9 A;  3X1U D;  5B2I D;  5GXQ A;  3MGR C;  3AV2 D;  1EQZ C;  4XUJ D;  3WKJ B;  4DRA A;  2HIO B;  3AZF B;  4KGC C;  3WA9 C;  3LZ0 C;  3AV1 C;  5BNX B;  4H9Q B;  3LJA D;  3REJ C;  1KX3 C;  1ZLA B;  5B1L B;  3UT9 C;  1S32 C;  1P3A B;  4XZQ C;  3AZH B;  3A6N B;  3AZG A;  1H3O A;  4JJN C;  1P3K C;  3VH6 T;  3UTB A;  3X1T A;  1P3O C;  1P3P A;  5B31 C;  4J8X D;  1F66 B;  1HQ3 C;  4R8P A;  3VH6 W;  3AV2 A;  3UTA D;  5DNM C;  2DF4 C;  4XUJ A;  1AOI D;  2NZD C;  1P3B B;  3WAA B;  1WWI A;  3LJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...