4G92C

Ccaat-binding complex from aspergillus nidulans with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g92C00
4WU9D 1BH8B 2FJ7B 4LD9B 3REHD 3X1TD 3AZHA 4YM6D 5AV8A 1EQZB 1F66A 3W97D 3C1CD 5GT3B 3MGSD 3AZMA 4AWLC 3AZEC 1AOIB 2F8NA 5B31B 3REID 1P3MC 1P3KA 1M19C 5DNNC 3C1BB 5JA4B 3MGRB 5G49A 3W97C 3C1CC 3AZFB 2HIOA 3REIC 4J8WC 3TU4B 1ID3B 3KSYA 2NQBB 3NQUB 5GSUD 5CP6D 4H9QB 3LZ0A 5B0ZA 3VH6W 4XZQC 3AV2B 3A6NA 2AROD 5AV6D 5BNVB 3REJD 5DNMB 1ZLAD 3X1SA 3X1VA 4H9RA 3RELC 5GT0A 4UUZB 4J8UB 1M1AD 3KXBC 4CAYB 5CP6C 4XUJD 5AVCB 5JA4A 3MGQA 4WU9A 5BS7C 4Z5TD 2BYKA 3REHA 5B24B 3B0CT 3AYWC 3X1TA 4YM6A 3AZLC 1KX5D 5AV6C 3REJC 1ZLAC 3AV1A 5E5AD 3MGSA 4J8XB 4JJNB 3V9RB 5B2JD 1M18B 3W99A 1H3OA 4ZUXD 1HQ3C 4Z2MH 5AY8B 3KWQA 1P34C 1KX5C 3MNNC 2BYMB 3AZKD 1P3OC 1KX4C 3AZIA 3WA9B 4ZUXC 5GSUA 1TZYB 5JRGB 3UTBA 2JSSA 1P3GD 2CV5C 3B6GC 1BH9B 5AVCA 3LZ1D 5CPIA 3WAAD 5B40D 5B32D 1P3IB 3WTPD 1P3LB 3UTAD 1P3BA 1P3FB 2F8NK 3W98B 5AVBD 3REKB 3AZGC 1M1AA 5B1LD 3B6FC 5B33D 4ZBJB 1JFIA 4H9PA 4XUJA 3X1UB 4YS3B 4Z5TA 4R8PA 5B0YB 5CPKB 3LJAD 5F99D 5BO0A 3MVDD 3WAAC 1U35B 4WZSB 4J8VD 3WTPC 5E5AA 3UTAC 5AVBC 4KUDC 5B2JA 5CHLB 2YFVA 5B33C 4WU8C 4Z66D 1N1JA 1WWSA 1P3PC 3WTPE 3AZJB 5AV5A 2L5AA 4J8VC 3UT9D 4X23B 3AZKA 1P3LA 5CPJD 3AZHB 5AV9D 5AV8B 2PYOC 3AFAC 1F66B 3AZMB 1P3GA 3LZ1A 3LELC 2F8NB 5B40A 5B1MC 1P3AD 1P3KB 1WWIA 2HUEC 3AN2C 3WKJB 5BT1D 5GXQD 3W96A 3MGPD 5CPJC 5B1LA 3B0CW 2NZDA 5G49B 4QLCC 3KUYC 3AZNC 3LJAA 5F99A 2HIOB 3MVDA 3AZED 1S32D 1P3AC 3O62D 1P3MD 1M19D 5BT1C 5GXQC 5DNND 3LZ0B 5B0ZB 5C3IB 4H9SC 3A6NB 1KX3C 4Z66A 3X1SB 3X1VB 3NQJB 4H9RB 1S32C 5GT0B 3B0BA 3O62C 3UT9A 4J8WD 2FJ7D 4LD9D 5B2IC 3WKJA 3MGQB 4WU9B 2BYKB 3REHB 3X1TB 5AV9A 4YM6B 4XZQD 5KDMA 3AV1B 1AOID 3MGSB 5B31D 4E45A 2IO5B 4KGCA 3RELD 3W99B 1H3OB 2FJ7C 4LD9C 3KXBD 3KWQB 4G91B 3MGPA 1EQZC 5GT3C 3AYWD 3AZLD 5B32G 4E44A 1AOIC 5B31C 5BNXA 1ID3D 3C1BC 3AZIB 4H9OB 3NQJA 1P3MA 5GSUB 3MGRC 1M19A 5DNNA 3UTBB 3AV2D 1HQ3D 1ULYA 5CPIB 4EO5B 1P34D 2AROB 4WNNA 3MNND 3AZFC 3W97A 3TU4C 3C1CA 1P3BB 1ID3C 2NQBC 1P3OD 1M1AB 1KX4D 3REIA 4J8WA 1JFIB 4H9PB 4KHAA 4XUJB 5B24D 4DRAA 3AV2C 4Z5TB 4R8PB 2F8NH 5BO0B 5DNMC 2CV5D 3B6GD 4XZQA 4DRBA 5E5AB 4J8XD 4JJND 1B6WA 4J8UC 5B2JB 2LY8A 2YFVB 3RELA 3AZGD 4H9OA 5AVCC 3B6FD 3KXBA 1N1JB 5CP6A 5B24C 3VH5T 5AV5B 5BS7A 3AYWA 4J8XC 4JJNC 2AROA 5AV6A 3REJA 1TAFA 3B0DB 3AZKB 1ZLAA 3WA9D 1M18C 4KUDD 5AY8C 1F1EA 4WU8D 4Z2MG 1P3GB 1HQ3A 1P3ID 3LZ1B 1P3PD 2YFWA 1P34A 5B32B 5B40B 1KX5A 1P3FD 3MNNA 3WA9C 3W96B 1P3OA 1TZYC 5JRGC 5B1LB 1KX4A 2NZDB 5CPKD 4ZUXA 2PYOD 3AFAD 1P3IC 3VH5A 4NE3A 5F99B 3MVDB 3LJAB 3B6GA 1P3LC 3LELD 3W98C 1P3FC 5B1MD 3REKC 3AN2D 4ZBJC 3X1UC 3AZGA 3B6FA 4YS3C 4Z66B 5B0YC 4QLCD 5CPKC 3KUYD 1BFMA 1U35C 3AZND 5B31G 4HGAB 3UT9B 3WAAA 5B32A 3WTPA 3AZHD 3UTAA 5AV8D 5AVBA 4G92B 1F66D 5AV9B 2RVQD 4KUDA 3AZMD 3AZJC 5B33A 5KDMB 4WU8A 1KX3D 4M6BA 2F8ND 1P3KD 1P3PA 4KGCB 4CSRA 4X23C 4J8VA 1KU5A 3AZHC 5B2ID 3MGPB 5AV8C 1F66C 2RVQC 3AZMC 3R45A 2PYOA 1P3KC 5BNXB 4AWLB 3AZEB 3LELA 3WKJC 4NE6A 5B1MA 1P3MB 1M19B 5DNNB 3AN2A 3VH5W 5CPJA 4NFTA 4H9NA 1EQZD 5GT3D 4WNNB 4QLCA 3KUYA 2HIOC 3W97B 5GT0D 3C1CB 3AZNA 3C1BD 3REIB 4J8WB 5FUGA 5B0ZC 3LZ0C 4KHAB 3MGQD 1P3AA 3MGRD 5C3IC 5GXQA 3A6NC 1B67A 3AV1D 3X1SC 4XZQB 4H9SA 3X1VC 1KX3A 5GT0C 3AZFD 1A7WA 3TU4D 3W99D 2NQBD 3AZEA 3RELB 1S32A 3KWQD 3MGQC 4WU9C 3O62A 3KXBB 3REHC 5CP6B 3X1TC 5B2IA 4YM6C 3AV1C 3MGSC 3AYWB 5DNMD 3AZLB 2IO5C 5AV6B 3REJB 1TAFB 1ZLAB 3AZID 4J8UD 3W99C 1Q9CA 3UTBD 3KWQC 4G91C 5AVCD 5CPID 1BH8A 2FJ7A 4LD9A 1HQ3B 2YFWB 1P34B 1EQZA 1P3BD 5GT3A 1KX5B 3MNNB 3AZIC 1AOIA 5B31A 1P3OB 5GSUC 1M18D 3UTBC 3C1BA 1KX4B 5AY8D 5CPIC 4R8PD 4ZUXB 4EO5C 3MGRA 2AROC 2CV5B 3B6GB 1P3BC 1R4VA 3AZLA 4WV4B 3AZFA 1M1AC 3TU4A 1ID3A 2NQBA 4XUJC 3NQUA 3AZGB 1TZYD 5JRGD 3B6FB 4H9QA 4Z5TC 4R8PC 5AV5D 3AV2A 2F8NG 5E5AC 5BNVA 5DNMA 1P3LD 3WAAB 3W98D 5B2JC 3WTPB 4J8UA 4UUZA 3REKD 3UTAB 5AVBB 4KUDB 4CAYA 3X1UD 5B33B 4WU8B 5AV5C 4YS3D 5B0YD 5B24A 1P3PB 1U35D 4CSRB 3B0DC 3AZKC 2CV5A 3W96D 4NE5A 4J8VB 4J8XA 4JJNA 3V9RA 2NZDD 1M18A 2CWEA 1P3GC 5AY8A 3R45B 3LZ1C 3AZJD 2PYOB 3AFAB 3VH6T 5B32C 5B40C 3LELB 4X23D 2BYMA 3W96C 5B1MB 2HUEB 3AN2B 5B1LC 3WA9A 2NZDC 5CPJB 4H9NB 1TZYA 5JRGA 1HTAA 4QLCB 3LJAC 5F99C 3MVDC 3KUYB 1BH9A 3AZNB 1P3IA 3WKJD 5FUGB 1P3AB 3W98A 1P3FA 3REKA 5GXQB 4Z66C 3X1UA 1KX3B 4YS3A 4KGCD 5B0YA 5CPKA 4HGAC 3VH6A 2HIOD 3AFAA 3UT9C 1U35A 1S32B 3O62B 3LZ0D 5B0ZD 4G92C 5AV9C 5B2IB 3A6ND 3X1SD 3AZJA 4KGCC 3X1VD 4X23A 3MGPC
chains in the Genus database with same CATH superfamily
4WU9D 1BH8B 2FJ7B 4LD9B 3REHD 3X1TD 3AZHA 4YM6D 5AV8A 1EQZB 2W8SA 3A1KA 1F66A 3C1CD 5GT3B 3MGSD 3AZMA 4AWLC 3W97D 3AZEC 1AOIB 2F8NA 5B31B 3REID 1P3MC 1P3KA 1M19C 5DNNC 3C1BB 5JA4B 3MGRB 2XD1A 5G49A 3W97C 3C1CC 2VQRA 3P5JB 2Y2KA 3AZFB 2HIOA 3REIC 4J8WC 3TU4B 1ID3B 3KSYA 2NQBB 3NQUB 5GSUD 5CP6D 4H9QB 3LZ0A 5B0ZA 3VH6W 4XZQC 2DQNC 3A6NA 3AV2B 2AROD 5AV6D 5BNVB 3REJD 5DNMB 1ZLAD 2Y2QA 3X1SA 2JE5A 2Y2PA 3X1VA 4H9RA 3RELC 5GT0A 4UUZB 4J8UB 1M1AD 3KXBC 4CAYB 5CP6C 4XUJD 5AVCB 5JA4A 3MGQA 4WU9A 5BS7C 4Z5TD 2BYKA 3REHA 5B24B 3B0CT 3AYWC 3X1TA 4YM6A 3AZLC 1KX5D 5AV6C 3REJC 1ZLAC 3AV1A 5E5AD 3MGSA 4J8XB 4JJNB 3V9RB 5B2JD 1M18B 3W99A 1H3OA 4ZUXD 1HQ3C 4Z2MH 5AY8B 3KWQA 1P34C 1KX5C 3MNNC 2BYMB 3AZKD 1P3OC 3H0MC 1KX4C 3AZIA 3WA9B 2DF4C 4WJ3C 4ZUXC 5GSUA 1TZYB 5JRGB 3UTBA 2JSSA 1P3GD 2CV5C 3B6GC 1BH9B 5AVCA 3LZ1D 5CPIA 3WAAD 5B40D 5B32D 1P3IB 3WTPD 1P3LB 3UTAD 1P3BA 1P3FB 2F8NK 3W98B 5AVBD 3REKB 3AZGC 1M1AA 5B1LD 3B6FC 5B33D 4ZBJB 1JFIA 4H9PA 4XUJA 3X1UB 4YS3B 4Z5TA 4R8PA 5B0YB 2F2AC 3LJAD 5CPKB 5F99D 5BO0A 3MVDD 3WAAC 1U35B 4WZSB 4J8VD 3WTPC 5E5AA 3UTAC 5AVBC 4KUDC 5B2JA 5CHLB 2ZY5A 2YFVA 5B33C 4WU8C 2G5HC 4Z66D 1N1JA 1WWSA 1P3PC 3WTPE 3AZJB 3AL0C 5AV5A 2L5AA 4J8VC 3UT9D 4X23B 3AZKA 1P3LA 5CPJD 3AZHB 5AV9D 5AV8B 2PYOC 3AFAC 1F66B 3AZMB 1P3GA 3LZ1A 3LELC 2F8NB 2ZY2A 5B40A 5B1MC 1P3AD 1P3KB 1WWIA 2HUEC 3AN2C 3WKJB 5BT1D 5GXQD 3W96A 3MGPD 5CPJC 5B1LA 3B0CW 2NZDA 5G49B 4QLCC 3KUYC 3AZNC 3LJAA 5F99A 2HIOB 3MVDA 3AZED 1S32D 1P3AC 3O62D 1P3MD 1M19D 5BT1C 5GXQC 5DNND 3LZ0B 5B0ZB 5C3IB 4H9SC 3A6NB 1KX3C 3H0LC 4Z66A 3X1SB 3EPLA 3X1VB 3NQJB 4H9RB 1S32C 5GT0B 3B0BA 3O62C 3UT9A 4J8WD 2FJ7D 4LD9D 5B2IC 3WKJA 3MGQB 4WU9B 2BYKB 3REHB 3X1TB 5AV9A 4YM6B 2Y2OA 4XZQD 5KDMA 3AV1B 1AOID 3MGSB 5B31D 4E45A 2IO5B 4KGCA 3RELD 3W99B 1H3OB 2FJ7C 4LD9C 3KXBD 3KWQB 4G91B 3MGPA 1W2EA 1EQZC 2Y2JA 5GT3C 3AYWD 3AZLD 5B32G 4E44A 1AOIC 5B31C 5BNXA 1ID3D 3C1BC 3AZIB 4H9OB 3NQJA 1P3MA 5GSUB 3MGRC 1M19A 5DNNA 3UTBB 3AV2D 1HQ3D 1ULYA 5CPIB 4EO5B 1P34D 2AROB 4WNNA 3MNND 3AZFC 3W97A 3TU4C 3C1CA 1P3BB 1ID3C 2NQBC 1P3OD 1M1AB 1KX4D 3REIA 4J8WA 1JFIB 4H9PB 4KHAA 4XUJB 5B24D 4DRAA 3AV2C 4Z5TB 4R8PB 2F8NH 5BO0B 5DNMC 2CV5D 3B6GD 4XZQA 4DRBA 5E5AB 4J8XD 4JJND 1B6WA 4J8UC 5B2JB 4DQYB 2LY8A 2YFVB 3RELA 3AZGD 4H9OA 5AVCC 3B6FD 3KXBA 1N1JB 5CP6A 5B24C 3VH5T 5AV5B 5BS7A 2ZY4A 3AYWA 4J8XC 4JJNC 2AROA 5AV6A 3REJA 1TAFA 3B0DB 3AZKB 1ZLAA 3WA9D 1M18C 4KUDD 5AY8C 1F1EA 4WU8D 4Z2MG 1P3GB 1HQ3A 1P3ID 3LZ1B 1P3PD 2YFWA 1P34A 5B32B 5B40B 1KX5A 1P3FD 3MNNA 3WA9C 3W96B 1P3OA 1TZYC 5JRGC 5B1LB 1KX4A 2NZDB 5CPKD 4ZUXA 2PYOD 3AFAD 1P3IC 3VH5A 4NE3A 5F99B 3MVDB 3LJAB 3B6GA 1P3LC 3LELD 3W98C 2Y2NA 1P3FC 5B1MD 3REKC 3AN2D 2G5IC 4ZBJC 3X1UC 3AZGA 3B6FA 4YS3C 4Z66B 5B0YC 4QLCD 5CPKC 3KUYD 1BFMA 1U35C 3AZND 5B31G 3H0RC 4HGAB 3UT9B 3WAAA 5B32A 3WTPA 3AZHD 3UTAA 5AV8D 3IP4C 5AVBA 4G92B 1F66D 5AV9B 2RVQD 4KUDA 3AZMD 3AZJC 5B33A 5KDMB 4WU8A 1KX3D 4M6BA 2F8ND 1P3KD 1Z2CB 1P3PA 4KGCB 4CSRA 4X23C 3EPHA 4J8VA 1KU5A 3AZHC 5B2ID 3MGPB 5AV8C 1F66C 2RVQC 3AZMC 3R45A 2PYOA 1P3KC 5BNXB 4AWLB 3AZEB 3LELA 3WKJC 4NE6A 5B1MA 1P3MB 1M19B 5DNNB 3AN2A 3VH5W 5CPJA 4NFTA 4H9NA 1EQZD 5GT3D 4WNNB 4QLCA 3KUYA 2HIOC 3W97B 5GT0D 3C1CB 3AZNA 3C1BD 3REIB 4J8WB 5FUGA 5B0ZC 3LZ0C 4KHAB 3MGQD 1P3AA 3MGRD 5C3IC 5GXQA 3A6NC 1B67A 3EPJA 3AV1D 3X1SC 4XZQB 4H9SA 3EG5B 3X1VC 1KX3A 3F6TA 5GT0C 3AZFD 1A7WA 2Y2LA 3TU4D 3W99D 2NQBD 3AZEA 3RELB 1S32A 3KWQD 3MGQC 4WU9C 3O62A 3KXBB 3REHC 5CP6B 3X1TC 5B2IA 4YM6C 3AV1C 3MGSC 3AYWB 5DNMD 3AZLB 2IO5C 5AV6B 3REJB 1TAFB 1ZLAB 3AZID 4J8UD 3W99C 1Q9CA 3UTBD 3KWQC 4G91C 5AVCD 5CPID 1BH8A 2FJ7A 1T3UA 4LD9A 1HQ3B 2YFWB 1P34B 1EQZA 1P3BD 5GT3A 1KX5B 2JCHA 3MNNB 3AZIC 1AOIA 2ZM5A 5B31A 1P3OB 5GSUC 1M18D 3UTBC 3C1BA 1KX4B 5AY8D 5CPIC 2Y2IA 4ZUXB 4EO5C 4R8PD 3MGRA 2AROC 2CV5B 3B6GB 1P3BC 2RIQA 1R4VA 3AZLA 4WV4B 3AZFA 1M1AC 3TU4A 1ID3A 2NQBA 4XUJC 3NQUA 3AZGB 1TZYD 5JRGD 3B6FB 2Y2GA 4H9QA 4R8PC 4Z5TC 4UPKA 5AV5D 3AV2A 2F8NG 5E5AC 5BNVA 5DNMA 1P3LD 3WAAB 3W98D 5B2JC 3WTPB 2XD5A 2ZY3A 4J8UA 4UUZA 3REKD 3UTAB 5AVBB 4KUDB 4CAYA 5B33B 3X1UD 4WU8B 5AV5C 2FFFB 4YS3D 2UWXA 5B0YD 3FDDA 5B24A 1P3PB 1U35D 4CSRB 3B0DC 3AZKC 2CV5A 3W96D 4NE5A 4J8VB 4J8XA 4JJNA 3V9RA 2NZDD 1M18A 2CWEA 1P3GC 5AY8A 3R45B 3LZ1C 3AZJD 2PYOB 3AFAB 3VH6T 5B32C 5B40C 3LELB 4X23D 2BYMA 3W96C 3KFUG 5B1MB 2HUEB 3AN2B 5B1LC 3WA9A 2NZDC 5CPJB 4H9NB 1TZYA 5JRGA 1HTAA 4QLCB 3LJAC 5F99C 3MVDC 3KUYB 1BH9A 3AZNB 1P3IA 3A1IA 3WKJD 5FUGB 1P3AB 3W98A 1P3FA 3REKA 5GXQB 4Z66C 3X1UA 1KX3B 4YS3A 4KGCD 5B0YA 5CPKA 4HGAC 3VH6A 2HIOD 3AFAA 3UT9C 1U35A 1S32B 3O62B 3LZ0D 5B0ZD 4G92C 5AV9C 5B2IB 3A6ND 3X1SD 1PZRA 3AZJA 4KGCC 3X1VD 2Y2HA 2J8PA 2Y2MA 2BG1A 3EPKA 4X23A 3MGPC
chains in the Genus database with same CATH topology
4WU9D 1BH8B 2FJ7B 4LD9B 3REHD 3X1TD 3AZHA 4YM6D 5AV8A 1EQZB 2W8SA 3A1KA 1F66A 3C1CD 5GT3B 3MGSD 3AZMA 4AWLC 3W97D 3AZEC 1AOIB 2F8NA 5B31B 3REID 1P3MC 1P3KA 1M19C 5DNNC 3C1BB 5JA4B 3MGRB 2XD1A 5G49A 3W97C 3C1CC 2VQRA 3P5JB 2Y2KA 3AZFB 2HIOA 3REIC 4J8WC 3TU4B 1ID3B 3KSYA 2NQBB 3NQUB 5GSUD 5CP6D 4H9QB 3LZ0A 5B0ZA 3VH6W 4XZQC 2DQNC 3A6NA 3AV2B 2AROD 5AV6D 5BNVB 3REJD 5DNMB 1ZLAD 2Y2QA 3X1SA 2JE5A 2Y2PA 3X1VA 4H9RA 3RELC 5GT0A 4UUZB 4J8UB 1M1AD 3KXBC 4CAYB 5CP6C 4XUJD 5AVCB 5JA4A 3MGQA 4WU9A 5BS7C 4Z5TD 2BYKA 3REHA 5B24B 3B0CT 3AYWC 3X1TA 4YM6A 3AZLC 1KX5D 5AV6C 3REJC 1ZLAC 3AV1A 5E5AD 3MGSA 4J8XB 4JJNB 3V9RB 5B2JD 1M18B 3W99A 1H3OA 4ZUXD 1HQ3C 4Z2MH 5AY8B 3KWQA 1P34C 1KX5C 3MNNC 2BYMB 3AZKD 1P3OC 3H0MC 1KX4C 3AZIA 3WA9B 2DF4C 4WJ3C 4ZUXC 5GSUA 1TZYB 5JRGB 3UTBA 2JSSA 1P3GD 2CV5C 3B6GC 1BH9B 5AVCA 3LZ1D 5CPIA 3WAAD 5B40D 5B32D 1P3IB 3WTPD 1P3LB 3UTAD 1P3BA 1P3FB 2F8NK 3W98B 5AVBD 3REKB 3AZGC 1M1AA 5B1LD 3B6FC 5B33D 4ZBJB 1JFIA 4H9PA 4XUJA 3X1UB 4YS3B 4Z5TA 4R8PA 5B0YB 2F2AC 3LJAD 5CPKB 5F99D 5BO0A 3MVDD 3WAAC 1U35B 4WZSB 4J8VD 3WTPC 5E5AA 3UTAC 5AVBC 4KUDC 5B2JA 5CHLB 2ZY5A 2YFVA 5B33C 4WU8C 2G5HC 4Z66D 1N1JA 1WWSA 1P3PC 3WTPE 3AZJB 3AL0C 5AV5A 2L5AA 4J8VC 3UT9D 4X23B 3AZKA 1P3LA 5CPJD 3AZHB 5AV9D 5AV8B 2PYOC 3AFAC 1F66B 3AZMB 1P3GA 3LZ1A 3LELC 2F8NB 2ZY2A 5B40A 5B1MC 1P3AD 1P3KB 1WWIA 2HUEC 3AN2C 3WKJB 5BT1D 5GXQD 3W96A 3MGPD 5CPJC 5B1LA 3B0CW 2NZDA 5G49B 4QLCC 3KUYC 3AZNC 3LJAA 5F99A 2HIOB 3MVDA 3AZED 1S32D 1P3AC 3O62D 1P3MD 1M19D 5BT1C 5GXQC 5DNND 3LZ0B 5B0ZB 5C3IB 4H9SC 3A6NB 1KX3C 3H0LC 4Z66A 3X1SB 3EPLA 3X1VB 3NQJB 4H9RB 1S32C 5GT0B 3B0BA 3O62C 3UT9A 4J8WD 2FJ7D 4LD9D 5B2IC 3WKJA 3MGQB 4WU9B 2BYKB 3REHB 3X1TB 5AV9A 4YM6B 2Y2OA 4XZQD 5KDMA 3AV1B 1AOID 3MGSB 5B31D 4E45A 2IO5B 4KGCA 3RELD 3W99B 1H3OB 2FJ7C 4LD9C 3KXBD 3KWQB 4G91B 3MGPA 1W2EA 1EQZC 2Y2JA 5GT3C 3AYWD 3AZLD 5B32G 4E44A 1AOIC 5B31C 5BNXA 1ID3D 3C1BC 3AZIB 4H9OB 3NQJA 1P3MA 5GSUB 3MGRC 1M19A 5DNNA 3UTBB 3AV2D 1HQ3D 1ULYA 5CPIB 4EO5B 1P34D 2AROB 4WNNA 3MNND 3AZFC 3W97A 3TU4C 3C1CA 1P3BB 1ID3C 2NQBC 1P3OD 1M1AB 1KX4D 3REIA 4J8WA 1JFIB 4H9PB 4KHAA 4XUJB 5B24D 4DRAA 3AV2C 4Z5TB 4R8PB 2F8NH 5BO0B 5DNMC 2CV5D 3B6GD 4XZQA 4DRBA 5E5AB 4J8XD 4JJND 1B6WA 4J8UC 5B2JB 4DQYB 2LY8A 2YFVB 3RELA 3AZGD 4H9OA 5AVCC 3B6FD 3KXBA 1N1JB 5CP6A 5B24C 3VH5T 5AV5B 5BS7A 2ZY4A 3AYWA 4J8XC 4JJNC 2AROA 5AV6A 3REJA 1TAFA 3B0DB 3AZKB 1ZLAA 3WA9D 1M18C 4KUDD 5AY8C 1F1EA 4WU8D 4Z2MG 1P3GB 1HQ3A 1P3ID 3LZ1B 1P3PD 2YFWA 1P34A 5B32B 5B40B 1KX5A 1P3FD 3MNNA 3WA9C 3W96B 1P3OA 1TZYC 5JRGC 5B1LB 1KX4A 2NZDB 5CPKD 4ZUXA 2PYOD 3AFAD 1P3IC 3VH5A 4NE3A 5F99B 3MVDB 3LJAB 3B6GA 1P3LC 3LELD 3W98C 2Y2NA 1P3FC 5B1MD 3REKC 3AN2D 2G5IC 4ZBJC 3X1UC 3AZGA 3B6FA 4YS3C 4Z66B 5B0YC 4QLCD 5CPKC 3KUYD 1BFMA 1U35C 3AZND 5B31G 3H0RC 4HGAB 3UT9B 3WAAA 5B32A 3WTPA 3AZHD 3UTAA 5AV8D 3IP4C 5AVBA 4G92B 1F66D 5AV9B 2RVQD 4KUDA 3AZMD 3AZJC 5B33A 5KDMB 4WU8A 1KX3D 4M6BA 2F8ND 1P3KD 1Z2CB 1P3PA 4KGCB 4CSRA 4X23C 3EPHA 4J8VA 1KU5A 3AZHC 5B2ID 3MGPB 5AV8C 1F66C 2RVQC 3AZMC 3R45A 2PYOA 1P3KC 5BNXB 4AWLB 3AZEB 3LELA 3WKJC 4NE6A 5B1MA 1P3MB 1M19B 5DNNB 3AN2A 3VH5W 5CPJA 4NFTA 4H9NA 1EQZD 5GT3D 4WNNB 4QLCA 3KUYA 2HIOC 3W97B 5GT0D 3C1CB 3AZNA 3C1BD 3REIB 4J8WB 5FUGA 5B0ZC 3LZ0C 4KHAB 3MGQD 1P3AA 3MGRD 5C3IC 5GXQA 3A6NC 1B67A 3EPJA 3AV1D 3X1SC 4XZQB 4H9SA 3EG5B 3X1VC 1KX3A 3F6TA 5GT0C 3AZFD 1A7WA 2Y2LA 3TU4D 3W99D 2NQBD 3AZEA 3RELB 1S32A 3KWQD 3MGQC 4WU9C 3O62A 3KXBB 3REHC 5CP6B 3X1TC 5B2IA 4YM6C 3AV1C 3MGSC 3AYWB 5DNMD 3AZLB 2IO5C 5AV6B 3REJB 1TAFB 1ZLAB 3AZID 4J8UD 3W99C 1Q9CA 3UTBD 3KWQC 4G91C 5AVCD 5CPID 1BH8A 2FJ7A 1T3UA 4LD9A 1HQ3B 2YFWB 1P34B 1EQZA 1P3BD 5GT3A 1KX5B 2JCHA 3MNNB 3AZIC 1AOIA 2ZM5A 5B31A 1P3OB 5GSUC 1M18D 3UTBC 3C1BA 1KX4B 5AY8D 5CPIC 2Y2IA 4ZUXB 4EO5C 4R8PD 3MGRA 2AROC 2CV5B 3B6GB 1P3BC 2RIQA 1R4VA 3AZLA 4WV4B 3AZFA 1M1AC 3TU4A 1ID3A 2NQBA 4XUJC 3NQUA 3AZGB 1TZYD 5JRGD 3B6FB 2Y2GA 4H9QA 4R8PC 4Z5TC 4UPKA 5AV5D 3AV2A 2F8NG 5E5AC 5BNVA 5DNMA 1P3LD 3WAAB 3W98D 5B2JC 3WTPB 2XD5A 2ZY3A 4J8UA 4UUZA 3REKD 3UTAB 5AVBB 4KUDB 4CAYA 5B33B 3X1UD 4WU8B 5AV5C 2FFFB 4YS3D 2UWXA 5B0YD 3FDDA 5B24A 1P3PB 1U35D 4CSRB 3B0DC 3AZKC 2CV5A 3W96D 4NE5A 4J8VB 4J8XA 4JJNA 3V9RA 2NZDD 1M18A 2CWEA 1P3GC 5AY8A 3R45B 3LZ1C 3AZJD 2PYOB 3AFAB 3VH6T 5B32C 5B40C 3LELB 4X23D 2BYMA 3W96C 3KFUG 5B1MB 2HUEB 3AN2B 5B1LC 3WA9A 2NZDC 5CPJB 4H9NB 1TZYA 5JRGA 1HTAA 4QLCB 3LJAC 5F99C 3MVDC 3KUYB 1BH9A 3AZNB 1P3IA 3A1IA 3WKJD 5FUGB 1P3AB 3W98A 1P3FA 3REKA 5GXQB 4Z66C 3X1UA 1KX3B 4YS3A 4KGCD 5B0YA 5CPKA 4HGAC 3VH6A 2HIOD 3AFAA 3UT9C 1U35A 1S32B 3O62B 3LZ0D 5B0ZD 4G92C 5AV9C 5B2IB 3A6ND 3X1SD 1PZRA 3AZJA 4KGCC 3X1VD 2Y2HA 2J8PA 2Y2MA 2BG1A 3EPKA 4X23A 3MGPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 D;  1BH8 B;  2FJ7 B;  4LD9 B;  3REH D;  3X1T D;  3AZH A;  4YM6 D;  5AV8 A;  1EQZ B;  1F66 A;  3W97 D;  3C1C D;  5GT3 B;  3MGS D;  3AZM A;  4AWL C;  3AZE C;  1AOI B;  2F8N A;  5B31 B;  3REI D;  1P3M C;  1P3K A;  1M19 C;  5DNN C;  3C1B B;  5JA4 B;  3MGR B;  5G49 A;  3W97 C;  3C1C C;  3AZF B;  2HIO A;  3REI C;  4J8W C;  3TU4 B;  1ID3 B;  3KSY A;  2NQB B;  3NQU B;  5GSU D;  5CP6 D;  4H9Q B;  3LZ0 A;  5B0Z A;  3VH6 W;  4XZQ C;  3AV2 B;  3A6N A;  2ARO D;  5AV6 D;  5BNV B;  3REJ D;  5DNM B;  1ZLA D;  3X1S A;  3X1V A;  4H9R A;  3REL C;  5GT0 A;  4UUZ B;  4J8U B;  1M1A D;  3KXB C;  4CAY B;  5CP6 C;  4XUJ D;  5AVC B;  5JA4 A;  3MGQ A;  4WU9 A;  5BS7 C;  4Z5T D;  2BYK A;  3REH A;  5B24 B;  3B0C T;  3AYW C;  3X1T A;  4YM6 A;  3AZL C;  1KX5 D;  5AV6 C;  3REJ C;  1ZLA C;  3AV1 A;  5E5A D;  3MGS A;  4J8X B;  4JJN B;  3V9R B;  5B2J D;  1M18 B;  3W99 A;  1H3O A;  4ZUX D;  1HQ3 C;  4Z2M H;  5AY8 B;  3KWQ A;  1P34 C;  1KX5 C;  3MNN C;  2BYM B;  3AZK D;  1P3O C;  1KX4 C;  3AZI A;  3WA9 B;  4ZUX C;  5GSU A;  1TZY B;  5JRG B;  3UTB A;  2JSS A;  1P3G D;  2CV5 C;  3B6G C;  1BH9 B;  5AVC A;  3LZ1 D;  5CPI A;  3WAA D;  5B40 D;  5B32 D;  1P3I B;  3WTP D;  1P3L B;  3UTA D;  1P3B A;  1P3F B;  2F8N K;  3W98 B;  5AVB D;  3REK B;  3AZG C;  1M1A A;  5B1L D;  3B6F C;  5B33 D;  4ZBJ B;  1JFI A;  4H9P A;  4XUJ A;  3X1U B;  4YS3 B;  4Z5T A;  4R8P A;  5B0Y B;  5CPK B;  3LJA D;  5F99 D;  5BO0 A;  3MVD D;  3WAA C;  1U35 B;  4WZS B;  4J8V D;  3WTP C;  5E5A A;  3UTA C;  5AVB C;  4KUD C;  5B2J A;  5CHL B;  2YFV A;  5B33 C;  4WU8 C;  4Z66 D;  1N1J A;  1WWS A;  1P3P C;  3WTP E;  3AZJ B;  5AV5 A;  2L5A A;  4J8V C;  3UT9 D;  4X23 B;  3AZK A;  1P3L A;  5CPJ D;  3AZH B;  5AV9 D;  5AV8 B;  2PYO C;  3AFA C;  1F66 B;  3AZM B;  1P3G A;  3LZ1 A;  3LEL C;  2F8N B;  5B40 A;  5B1M C;  1P3A D;  1P3K B;  1WWI A;  2HUE C;  3AN2 C;  3WKJ B;  5BT1 D;  5GXQ D;  3W96 A;  3MGP D;  5CPJ C;  5B1L A;  3B0C W;  2NZD A;  5G49 B;  4QLC C;  3KUY C;  3AZN C;  3LJA A;  5F99 A;  2HIO B;  3MVD A;  3AZE D;  1S32 D;  1P3A C;  3O62 D;  1P3M D;  1M19 D;  5BT1 C;  5GXQ C;  5DNN D;  3LZ0 B;  5B0Z B;  5C3I B;  4H9S C;  3A6N B;  1KX3 C;  4Z66 A;  3X1S B;  3X1V B;  3NQJ B;  4H9R B;  1S32 C;  5GT0 B;  3B0B A;  3O62 C;  3UT9 A;  4J8W D;  2FJ7 D;  4LD9 D;  5B2I C;  3WKJ A;  3MGQ B;  4WU9 B;  2BYK B;  3REH B;  3X1T B;  5AV9 A;  4YM6 B;  4XZQ D;  5KDM A;  3AV1 B;  1AOI D;  3MGS B;  5B31 D;  4E45 A;  2IO5 B;  4KGC A;  3REL D;  3W99 B;  1H3O B;  2FJ7 C;  4LD9 C;  3KXB D;  3KWQ B;  4G91 B;  3MGP A;  1EQZ C;  5GT3 C;  3AYW D;  3AZL D;  5B32 G;  4E44 A;  1AOI C;  5B31 C;  5BNX A;  1ID3 D;  3C1B C;  3AZI B;  4H9O B;  3NQJ A;  1P3M A;  5GSU B;  3MGR C;  1M19 A;  5DNN A;  3UTB B;  3AV2 D;  1HQ3 D;  1ULY A;  5CPI B;  4EO5 B;  1P34 D;  2ARO B;  4WNN A;  3MNN D;  3AZF C;  3W97 A;  3TU4 C;  3C1C A;  1P3B B;  1ID3 C;  2NQB C;  1P3O D;  1M1A B;  1KX4 D;  3REI A;  4J8W A;  1JFI B;  4H9P B;  4KHA A;  4XUJ B;  5B24 D;  4DRA A;  3AV2 C;  4Z5T B;  4R8P B;  2F8N H;  5BO0 B;  5DNM C;  2CV5 D;  3B6G D;  4XZQ A;  4DRB A;  5E5A B;  4J8X D;  4JJN D;  1B6W A;  4J8U C;  5B2J B;  2LY8 A;  2YFV B;  3REL A;  3AZG D;  4H9O A;  5AVC C;  3B6F D;  3KXB A;  1N1J B;  5CP6 A;  5B24 C;  3VH5 T;  5AV5 B;  5BS7 A;  3AYW A;  4J8X C;  4JJN C;  2ARO A;  5AV6 A;  3REJ A;  1TAF A;  3B0D B;  3AZK B;  1ZLA A;  3WA9 D;  1M18 C;  4KUD D;  5AY8 C;  1F1E A;  4WU8 D;  4Z2M G;  1P3G B;  1HQ3 A;  1P3I D;  3LZ1 B;  1P3P D;  2YFW A;  1P34 A;  5B32 B;  5B40 B;  1KX5 A;  1P3F D;  3MNN A;  3WA9 C;  3W96 B;  1P3O A;  1TZY C;  5JRG C;  5B1L B;  1KX4 A;  2NZD B;  5CPK D;  4ZUX A;  2PYO D;  3AFA D;  1P3I C;  3VH5 A;  4NE3 A;  5F99 B;  3MVD B;  3LJA B;  3B6G A;  1P3L C;  3LEL D;  3W98 C;  1P3F C;  5B1M D;  3REK C;  3AN2 D;  4ZBJ C;  3X1U C;  3AZG A;  3B6F A;  4YS3 C;  4Z66 B;  5B0Y C;  4QLC D;  5CPK C;  3KUY D;  1BFM A;  1U35 C;  3AZN D;  5B31 G;  4HGA B;  3UT9 B;  3WAA A;  5B32 A;  3WTP A;  3AZH D;  3UTA A;  5AV8 D;  5AVB A;  4G92 B;  1F66 D;  5AV9 B;  2RVQ D;  4KUD A;  3AZM D;  3AZJ C;  5B33 A;  5KDM B;  4WU8 A;  1KX3 D;  4M6B A;  2F8N D;  1P3K D;  1P3P A;  4KGC B;  4CSR A;  4X23 C;  4J8V A;  1KU5 A;  3AZH C;  5B2I D;  3MGP B;  5AV8 C;  1F66 C;  2RVQ C;  3AZM C;  3R45 A;  2PYO A;  1P3K C;  5BNX B;  4AWL B;  3AZE B;  3LEL A;  3WKJ C;  4NE6 A;  5B1M A;  1P3M B;  1M19 B;  5DNN B;  3AN2 A;  3VH5 W;  5CPJ A;  4NFT A;  4H9N A;  1EQZ D;  5GT3 D;  4WNN B;  4QLC A;  3KUY A;  2HIO C;  3W97 B;  5GT0 D;  3C1C B;  3AZN A;  3C1B D;  3REI B;  4J8W B;  5FUG A;  5B0Z C;  3LZ0 C;  4KHA B;  3MGQ D;  1P3A A;  3MGR D;  5C3I C;  5GXQ A;  3A6N C;  1B67 A;  3AV1 D;  3X1S C;  4XZQ B;  4H9S A;  3X1V C;  1KX3 A;  5GT0 C;  3AZF D;  1A7W A;  3TU4 D;  3W99 D;  2NQB D;  3AZE A;  3REL B;  1S32 A;  3KWQ D;  3MGQ C;  4WU9 C;  3O62 A;  3KXB B;  3REH C;  5CP6 B;  3X1T C;  5B2I A;  4YM6 C;  3AV1 C;  3MGS C;  3AYW B;  5DNM D;  3AZL B;  2IO5 C;  5AV6 B;  3REJ B;  1TAF B;  1ZLA B;  3AZI D;  4J8U D;  3W99 C;  1Q9C A;  3UTB D;  3KWQ C;  4G91 C;  5AVC D;  5CPI D;  1BH8 A;  2FJ7 A;  4LD9 A;  1HQ3 B;  2YFW B;  1P34 B;  1EQZ A;  1P3B D;  5GT3 A;  1KX5 B;  3MNN B;  3AZI C;  1AOI A;  5B31 A;  1P3O B;  5GSU C;  1M18 D;  3UTB C;  3C1B A;  1KX4 B;  5AY8 D;  5CPI C;  4R8P D;  4ZUX B;  4EO5 C;  3MGR A;  2ARO C;  2CV5 B;  3B6G B;  1P3B C;  1R4V A;  3AZL A;  4WV4 B;  3AZF A;  1M1A C;  3TU4 A;  1ID3 A;  2NQB A;  4XUJ C;  3NQU A;  3AZG B;  1TZY D;  5JRG D;  3B6F B;  4H9Q A;  4Z5T C;  4R8P C;  5AV5 D;  3AV2 A;  2F8N G;  5E5A C;  5BNV A;  5DNM A;  1P3L D;  3WAA B;  3W98 D;  5B2J C;  3WTP B;  4J8U A;  4UUZ A;  3REK D;  3UTA B;  5AVB B;  4KUD B;  4CAY A;  3X1U D;  5B33 B;  4WU8 B;  5AV5 C;  4YS3 D;  5B0Y D;  5B24 A;  1P3P B;  1U35 D;  4CSR B;  3B0D C;  3AZK C;  2CV5 A;  3W96 D;  4NE5 A;  4J8V B;  4J8X A;  4JJN A;  3V9R A;  2NZD D;  1M18 A;  2CWE A;  1P3G C;  5AY8 A;  3R45 B;  3LZ1 C;  3AZJ D;  2PYO B;  3AFA B;  3VH6 T;  5B32 C;  5B40 C;  3LEL B;  4X23 D;  2BYM A;  3W96 C;  5B1M B;  2HUE B;  3AN2 B;  5B1L C;  3WA9 A;  2NZD C;  5CPJ B;  4H9N B;  1TZY A;  5JRG A;  1HTA A;  4QLC B;  3LJA C;  5F99 C;  3MVD C;  3KUY B;  1BH9 A;  3AZN B;  1P3I A;  3WKJ D;  5FUG B;  1P3A B;  3W98 A;  1P3F A;  3REK A;  5GXQ B;  4Z66 C;  3X1U A;  1KX3 B;  4YS3 A;  4KGC D;  5B0Y A;  5CPK A;  4HGA C;  3VH6 A;  2HIO D;  3AFA A;  3UT9 C;  1U35 A;  1S32 B;  3O62 B;  3LZ0 D;  5B0Z D;  4G92 C;  5AV9 C;  5B2I B;  3A6N D;  3X1S D;  3AZJ A;  4KGC C;  3X1V D;  4X23 A;  3MGP C; 
#chains in the Genus database with same CATH topology
 4WU9 D;  1BH8 B;  2FJ7 B;  4LD9 B;  3REH D;  3X1T D;  3AZH A;  4YM6 D;  5AV8 A;  1EQZ B;  2W8S A;  3A1K A;  1F66 A;  3C1C D;  5GT3 B;  3MGS D;  3AZM A;  4AWL C;  3W97 D;  3AZE C;  1AOI B;  2F8N A;  5B31 B;  3REI D;  1P3M C;  1P3K A;  1M19 C;  5DNN C;  3C1B B;  5JA4 B;  3MGR B;  2XD1 A;  5G49 A;  3W97 C;  3C1C C;  2VQR A;  3P5J B;  2Y2K A;  3AZF B;  2HIO A;  3REI C;  4J8W C;  3TU4 B;  1ID3 B;  3KSY A;  2NQB B;  3NQU B;  5GSU D;  5CP6 D;  4H9Q B;  3LZ0 A;  5B0Z A;  3VH6 W;  4XZQ C;  2DQN C;  3A6N A;  3AV2 B;  2ARO D;  5AV6 D;  5BNV B;  3REJ D;  5DNM B;  1ZLA D;  2Y2Q A;  3X1S A;  2JE5 A;  2Y2P A;  3X1V A;  4H9R A;  3REL C;  5GT0 A;  4UUZ B;  4J8U B;  1M1A D;  3KXB C;  4CAY B;  5CP6 C;  4XUJ D;  5AVC B;  5JA4 A;  3MGQ A;  4WU9 A;  5BS7 C;  4Z5T D;  2BYK A;  3REH A;  5B24 B;  3B0C T;  3AYW C;  3X1T A;  4YM6 A;  3AZL C;  1KX5 D;  5AV6 C;  3REJ C;  1ZLA C;  3AV1 A;  5E5A D;  3MGS A;  4J8X B;  4JJN B;  3V9R B;  5B2J D;  1M18 B;  3W99 A;  1H3O A;  4ZUX D;  1HQ3 C;  4Z2M H;  5AY8 B;  3KWQ A;  1P34 C;  1KX5 C;  3MNN C;  2BYM B;  3AZK D;  1P3O C;  3H0M C;  1KX4 C;  3AZI A;  3WA9 B;  2DF4 C;  4WJ3 C;  4ZUX C;  5GSU A;  1TZY B;  5JRG B;  3UTB A;  2JSS A;  1P3G D;  2CV5 C;  3B6G C;  1BH9 B;  5AVC A;  3LZ1 D;  5CPI A;  3WAA D;  5B40 D;  5B32 D;  1P3I B;  3WTP D;  1P3L B;  3UTA D;  1P3B A;  1P3F B;  2F8N K;  3W98 B;  5AVB D;  3REK B;  3AZG C;  1M1A A;  5B1L D;  3B6F C;  5B33 D;  4ZBJ B;  1JFI A;  4H9P A;  4XUJ A;  3X1U B;  4YS3 B;  4Z5T A;  4R8P A;  5B0Y B;  2F2A C;  3LJA D;  5CPK B;  5F99 D;  5BO0 A;  3MVD D;  3WAA C;  1U35 B;  4WZS B;  4J8V D;  3WTP C;  5E5A A;  3UTA C;  5AVB C;  4KUD C;  5B2J A;  5CHL B;  2ZY5 A;  2YFV A;  5B33 C;  4WU8 C;  2G5H C;  4Z66 D;  1N1J A;  1WWS A;  1P3P C;  3WTP E;  3AZJ B;  3AL0 C;  5AV5 A;  2L5A A;  4J8V C;  3UT9 D;  4X23 B;  3AZK A;  1P3L A;  5CPJ D;  3AZH B;  5AV9 D;  5AV8 B;  2PYO C;  3AFA C;  1F66 B;  3AZM B;  1P3G A;  3LZ1 A;  3LEL C;  2F8N B;  2ZY2 A;  5B40 A;  5B1M C;  1P3A D;  1P3K B;  1WWI A;  2HUE C;  3AN2 C;  3WKJ B;  5BT1 D;  5GXQ D;  3W96 A;  3MGP D;  5CPJ C;  5B1L A;  3B0C W;  2NZD A;  5G49 B;  4QLC C;  3KUY C;  3AZN C;  3LJA A;  5F99 A;  2HIO B;  3MVD A;  3AZE D;  1S32 D;  1P3A C;  3O62 D;  1P3M D;  1M19 D;  5BT1 C;  5GXQ C;  5DNN D;  3LZ0 B;  5B0Z B;  5C3I B;  4H9S C;  3A6N B;  1KX3 C;  3H0L C;  4Z66 A;  3X1S B;  3EPL A;  3X1V B;  3NQJ B;  4H9R B;  1S32 C;  5GT0 B;  3B0B A;  3O62 C;  3UT9 A;  4J8W D;  2FJ7 D;  4LD9 D;  5B2I C;  3WKJ A;  3MGQ B;  4WU9 B;  2BYK B;  3REH B;  3X1T B;  5AV9 A;  4YM6 B;  2Y2O A;  4XZQ D;  5KDM A;  3AV1 B;  1AOI D;  3MGS B;  5B31 D;  4E45 A;  2IO5 B;  4KGC A;  3REL D;  3W99 B;  1H3O B;  2FJ7 C;  4LD9 C;  3KXB D;  3KWQ B;  4G91 B;  3MGP A;  1W2E A;  1EQZ C;  2Y2J A;  5GT3 C;  3AYW D;  3AZL D;  5B32 G;  4E44 A;  1AOI C;  5B31 C;  5BNX A;  1ID3 D;  3C1B C;  3AZI B;  4H9O B;  3NQJ A;  1P3M A;  5GSU B;  3MGR C;  1M19 A;  5DNN A;  3UTB B;  3AV2 D;  1HQ3 D;  1ULY A;  5CPI B;  4EO5 B;  1P34 D;  2ARO B;  4WNN A;  3MNN D;  3AZF C;  3W97 A;  3TU4 C;  3C1C A;  1P3B B;  1ID3 C;  2NQB C;  1P3O D;  1M1A B;  1KX4 D;  3REI A;  4J8W A;  1JFI B;  4H9P B;  4KHA A;  4XUJ B;  5B24 D;  4DRA A;  3AV2 C;  4Z5T B;  4R8P B;  2F8N H;  5BO0 B;  5DNM C;  2CV5 D;  3B6G D;  4XZQ A;  4DRB A;  5E5A B;  4J8X D;  4JJN D;  1B6W A;  4J8U C;  5B2J B;  4DQY B;  2LY8 A;  2YFV B;  3REL A;  3AZG D;  4H9O A;  5AVC C;  3B6F D;  3KXB A;  1N1J B;  5CP6 A;  5B24 C;  3VH5 T;  5AV5 B;  5BS7 A;  2ZY4 A;  3AYW A;  4J8X C;  4JJN C;  2ARO A;  5AV6 A;  3REJ A;  1TAF A;  3B0D B;  3AZK B;  1ZLA A;  3WA9 D;  1M18 C;  4KUD D;  5AY8 C;  1F1E A;  4WU8 D;  4Z2M G;  1P3G B;  1HQ3 A;  1P3I D;  3LZ1 B;  1P3P D;  2YFW A;  1P34 A;  5B32 B;  5B40 B;  1KX5 A;  1P3F D;  3MNN A;  3WA9 C;  3W96 B;  1P3O A;  1TZY C;  5JRG C;  5B1L B;  1KX4 A;  2NZD B;  5CPK D;  4ZUX A;  2PYO D;  3AFA D;  1P3I C;  3VH5 A;  4NE3 A;  5F99 B;  3MVD B;  3LJA B;  3B6G A;  1P3L C;  3LEL D;  3W98 C;  2Y2N A;  1P3F C;  5B1M D;  3REK C;  3AN2 D;  2G5I C;  4ZBJ C;  3X1U C;  3AZG A;  3B6F A;  4YS3 C;  4Z66 B;  5B0Y C;  4QLC D;  5CPK C;  3KUY D;  1BFM A;  1U35 C;  3AZN D;  5B31 G;  3H0R C;  4HGA B;  3UT9 B;  3WAA A;  5B32 A;  3WTP A;  3AZH D;  3UTA A;  5AV8 D;  3IP4 C;  5AVB A;  4G92 B;  1F66 D;  5AV9 B;  2RVQ D;  4KUD A;  3AZM D;  3AZJ C;  5B33 A;  5KDM B;  4WU8 A;  1KX3 D;  4M6B A;  2F8N D;  1P3K D;  1Z2C B;  1P3P A;  4KGC B;  4CSR A;  4X23 C;  3EPH A;  4J8V A;  1KU5 A;  3AZH C;  5B2I D;  3MGP B;  5AV8 C;  1F66 C;  2RVQ C;  3AZM C;  3R45 A;  2PYO A;  1P3K C;  5BNX B;  4AWL B;  3AZE B;  3LEL A;  3WKJ C;  4NE6 A;  5B1M A;  1P3M B;  1M19 B;  5DNN B;  3AN2 A;  3VH5 W;  5CPJ A;  4NFT A;  4H9N A;  1EQZ D;  5GT3 D;  4WNN B;  4QLC A;  3KUY A;  2HIO C;  3W97 B;  5GT0 D;  3C1C B;  3AZN A;  3C1B D;  3REI B;  4J8W B;  5FUG A;  5B0Z C;  3LZ0 C;  4KHA B;  3MGQ D;  1P3A A;  3MGR D;  5C3I C;  5GXQ A;  3A6N C;  1B67 A;  3EPJ A;  3AV1 D;  3X1S C;  4XZQ B;  4H9S A;  3EG5 B;  3X1V C;  1KX3 A;  3F6T A;  5GT0 C;  3AZF D;  1A7W A;  2Y2L A;  3TU4 D;  3W99 D;  2NQB D;  3AZE A;  3REL B;  1S32 A;  3KWQ D;  3MGQ C;  4WU9 C;  3O62 A;  3KXB B;  3REH C;  5CP6 B;  3X1T C;  5B2I A;  4YM6 C;  3AV1 C;  3MGS C;  3AYW B;  5DNM D;  3AZL B;  2IO5 C;  5AV6 B;  3REJ B;  1TAF B;  1ZLA B;  3AZI D;  4J8U D;  3W99 C;  1Q9C A;  3UTB D;  3KWQ C;  4G91 C;  5AVC D;  5CPI D;  1BH8 A;  2FJ7 A;  1T3U A;  4LD9 A;  1HQ3 B;  2YFW B;  1P34 B;  1EQZ A;  1P3B D;  5GT3 A;  1KX5 B;  2JCH A;  3MNN B;  3AZI C;  1AOI A;  2ZM5 A;  5B31 A;  1P3O B;  5GSU C;  1M18 D;  3UTB C;  3C1B A;  1KX4 B;  5AY8 D;  5CPI C;  2Y2I A;  4ZUX B;  4EO5 C;  4R8P D;  3MGR A;  2ARO C;  2CV5 B;  3B6G B;  1P3B C;  2RIQ A;  1R4V A;  3AZL A;  4WV4 B;  3AZF A;  1M1A C;  3TU4 A;  1ID3 A;  2NQB A;  4XUJ C;  3NQU A;  3AZG B;  1TZY D;  5JRG D;  3B6F B;  2Y2G A;  4H9Q A;  4R8P C;  4Z5T C;  4UPK A;  5AV5 D;  3AV2 A;  2F8N G;  5E5A C;  5BNV A;  5DNM A;  1P3L D;  3WAA B;  3W98 D;  5B2J C;  3WTP B;  2XD5 A;  2ZY3 A;  4J8U A;  4UUZ A;  3REK D;  3UTA B;  5AVB B;  4KUD B;  4CAY A;  5B33 B;  3X1U D;  4WU8 B;  5AV5 C;  2FFF B;  4YS3 D;  2UWX A;  5B0Y D;  3FDD A;  5B24 A;  1P3P B;  1U35 D;  4CSR B;  3B0D C;  3AZK C;  2CV5 A;  3W96 D;  4NE5 A;  4J8V B;  4J8X A;  4JJN A;  3V9R A;  2NZD D;  1M18 A;  2CWE A;  1P3G C;  5AY8 A;  3R45 B;  3LZ1 C;  3AZJ D;  2PYO B;  3AFA B;  3VH6 T;  5B32 C;  5B40 C;  3LEL B;  4X23 D;  2BYM A;  3W96 C;  3KFU G;  5B1M B;  2HUE B;  3AN2 B;  5B1L C;  3WA9 A;  2NZD C;  5CPJ B;  4H9N B;  1TZY A;  5JRG A;  1HTA A;  4QLC B;  3LJA C;  5F99 C;  3MVD C;  3KUY B;  1BH9 A;  3AZN B;  1P3I A;  3A1I A;  3WKJ D;  5FUG B;  1P3A B;  3W98 A;  1P3F A;  3REK A;  5GXQ B;  4Z66 C;  3X1U A;  1KX3 B;  4YS3 A;  4KGC D;  5B0Y A;  5CPK A;  4HGA C;  3VH6 A;  2HIO D;  3AFA A;  3UT9 C;  1U35 A;  1S32 B;  3O62 B;  3LZ0 D;  5B0Z D;  4G92 C;  5AV9 C;  5B2I B;  3A6N D;  3X1S D;  1PZR A;  3AZJ A;  4KGC C;  3X1V D;  2Y2H A;  2J8P A;  2Y2M A;  2BG1 A;  3EPK A;  4X23 A;  3MGP C; 
#chains in the Genus database with same CATH homology
 4WU9 D;  1BH8 B;  2FJ7 B;  4LD9 B;  3REH D;  3X1T D;  3AZH A;  4YM6 D;  5AV8 A;  1EQZ B;  2W8S A;  3A1K A;  1F66 A;  3C1C D;  5GT3 B;  3MGS D;  3AZM A;  4AWL C;  3W97 D;  3AZE C;  1AOI B;  2F8N A;  5B31 B;  3REI D;  1P3M C;  1P3K A;  1M19 C;  5DNN C;  3C1B B;  5JA4 B;  3MGR B;  2XD1 A;  5G49 A;  3W97 C;  3C1C C;  2VQR A;  3P5J B;  2Y2K A;  3AZF B;  2HIO A;  3REI C;  4J8W C;  3TU4 B;  1ID3 B;  3KSY A;  2NQB B;  3NQU B;  5GSU D;  5CP6 D;  4H9Q B;  3LZ0 A;  5B0Z A;  3VH6 W;  4XZQ C;  2DQN C;  3A6N A;  3AV2 B;  2ARO D;  5AV6 D;  5BNV B;  3REJ D;  5DNM B;  1ZLA D;  2Y2Q A;  3X1S A;  2JE5 A;  2Y2P A;  3X1V A;  4H9R A;  3REL C;  5GT0 A;  4UUZ B;  4J8U B;  1M1A D;  3KXB C;  4CAY B;  5CP6 C;  4XUJ D;  5AVC B;  5JA4 A;  3MGQ A;  4WU9 A;  5BS7 C;  4Z5T D;  2BYK A;  3REH A;  5B24 B;  3B0C T;  3AYW C;  3X1T A;  4YM6 A;  3AZL C;  1KX5 D;  5AV6 C;  3REJ C;  1ZLA C;  3AV1 A;  5E5A D;  3MGS A;  4J8X B;  4JJN B;  3V9R B;  5B2J D;  1M18 B;  3W99 A;  1H3O A;  4ZUX D;  1HQ3 C;  4Z2M H;  5AY8 B;  3KWQ A;  1P34 C;  1KX5 C;  3MNN C;  2BYM B;  3AZK D;  1P3O C;  3H0M C;  1KX4 C;  3AZI A;  3WA9 B;  2DF4 C;  4WJ3 C;  4ZUX C;  5GSU A;  1TZY B;  5JRG B;  3UTB A;  2JSS A;  1P3G D;  2CV5 C;  3B6G C;  1BH9 B;  5AVC A;  3LZ1 D;  5CPI A;  3WAA D;  5B40 D;  5B32 D;  1P3I B;  3WTP D;  1P3L B;  3UTA D;  1P3B A;  1P3F B;  2F8N K;  3W98 B;  5AVB D;  3REK B;  3AZG C;  1M1A A;  5B1L D;  3B6F C;  5B33 D;  4ZBJ B;  1JFI A;  4H9P A;  4XUJ A;  3X1U B;  4YS3 B;  4Z5T A;  4R8P A;  5B0Y B;  2F2A C;  3LJA D;  5CPK B;  5F99 D;  5BO0 A;  3MVD D;  3WAA C;  1U35 B;  4WZS B;  4J8V D;  3WTP C;  5E5A A;  3UTA C;  5AVB C;  4KUD C;  5B2J A;  5CHL B;  2ZY5 A;  2YFV A;  5B33 C;  4WU8 C;  2G5H C;  4Z66 D;  1N1J A;  1WWS A;  1P3P C;  3WTP E;  3AZJ B;  3AL0 C;  5AV5 A;  2L5A A;  4J8V C;  3UT9 D;  4X23 B;  3AZK A;  1P3L A;  5CPJ D;  3AZH B;  5AV9 D;  5AV8 B;  2PYO C;  3AFA C;  1F66 B;  3AZM B;  1P3G A;  3LZ1 A;  3LEL C;  2F8N B;  2ZY2 A;  5B40 A;  5B1M C;  1P3A D;  1P3K B;  1WWI A;  2HUE C;  3AN2 C;  3WKJ B;  5BT1 D;  5GXQ D;  3W96 A;  3MGP D;  5CPJ C;  5B1L A;  3B0C W;  2NZD A;  5G49 B;  4QLC C;  3KUY C;  3AZN C;  3LJA A;  5F99 A;  2HIO B;  3MVD A;  3AZE D;  1S32 D;  1P3A C;  3O62 D;  1P3M D;  1M19 D;  5BT1 C;  5GXQ C;  5DNN D;  3LZ0 B;  5B0Z B;  5C3I B;  4H9S C;  3A6N B;  1KX3 C;  3H0L C;  4Z66 A;  3X1S B;  3EPL A;  3X1V B;  3NQJ B;  4H9R B;  1S32 C;  5GT0 B;  3B0B A;  3O62 C;  3UT9 A;  4J8W D;  2FJ7 D;  4LD9 D;  5B2I C;  3WKJ A;  3MGQ B;  4WU9 B;  2BYK B;  3REH B;  3X1T B;  5AV9 A;  4YM6 B;  2Y2O A;  4XZQ D;  5KDM A;  3AV1 B;  1AOI D;  3MGS B;  5B31 D;  4E45 A;  2IO5 B;  4KGC A;  3REL D;  3W99 B;  1H3O B;  2FJ7 C;  4LD9 C;  3KXB D;  3KWQ B;  4G91 B;  3MGP A;  1W2E A;  1EQZ C;  2Y2J A;  5GT3 C;  3AYW D;  3AZL D;  5B32 G;  4E44 A;  1AOI C;  5B31 C;  5BNX A;  1ID3 D;  3C1B C;  3AZI B;  4H9O B;  3NQJ A;  1P3M A;  5GSU B;  3MGR C;  1M19 A;  5DNN A;  3UTB B;  3AV2 D;  1HQ3 D;  1ULY A;  5CPI B;  4EO5 B;  1P34 D;  2ARO B;  4WNN A;  3MNN D;  3AZF C;  3W97 A;  3TU4 C;  3C1C A;  1P3B B;  1ID3 C;  2NQB C;  1P3O D;  1M1A B;  1KX4 D;  3REI A;  4J8W A;  1JFI B;  4H9P B;  4KHA A;  4XUJ B;  5B24 D;  4DRA A;  3AV2 C;  4Z5T B;  4R8P B;  2F8N H;  5BO0 B;  5DNM C;  2CV5 D;  3B6G D;  4XZQ A;  4DRB A;  5E5A B;  4J8X D;  4JJN D;  1B6W A;  4J8U C;  5B2J B;  4DQY B;  2LY8 A;  2YFV B;  3REL A;  3AZG D;  4H9O A;  5AVC C;  3B6F D;  3KXB A;  1N1J B;  5CP6 A;  5B24 C;  3VH5 T;  5AV5 B;  5BS7 A;  2ZY4 A;  3AYW A;  4J8X C;  4JJN C;  2ARO A;  5AV6 A;  3REJ A;  1TAF A;  3B0D B;  3AZK B;  1ZLA A;  3WA9 D;  1M18 C;  4KUD D;  5AY8 C;  1F1E A;  4WU8 D;  4Z2M G;  1P3G B;  1HQ3 A;  1P3I D;  3LZ1 B;  1P3P D;  2YFW A;  1P34 A;  5B32 B;  5B40 B;  1KX5 A;  1P3F D;  3MNN A;  3WA9 C;  3W96 B;  1P3O A;  1TZY C;  5JRG C;  5B1L B;  1KX4 A;  2NZD B;  5CPK D;  4ZUX A;  2PYO D;  3AFA D;  1P3I C;  3VH5 A;  4NE3 A;  5F99 B;  3MVD B;  3LJA B;  3B6G A;  1P3L C;  3LEL D;  3W98 C;  2Y2N A;  1P3F C;  5B1M D;  3REK C;  3AN2 D;  2G5I C;  4ZBJ C;  3X1U C;  3AZG A;  3B6F A;  4YS3 C;  4Z66 B;  5B0Y C;  4QLC D;  5CPK C;  3KUY D;  1BFM A;  1U35 C;  3AZN D;  5B31 G;  3H0R C;  4HGA B;  3UT9 B;  3WAA A;  5B32 A;  3WTP A;  3AZH D;  3UTA A;  5AV8 D;  3IP4 C;  5AVB A;  4G92 B;  1F66 D;  5AV9 B;  2RVQ D;  4KUD A;  3AZM D;  3AZJ C;  5B33 A;  5KDM B;  4WU8 A;  1KX3 D;  4M6B A;  2F8N D;  1P3K D;  1Z2C B;  1P3P A;  4KGC B;  4CSR A;  4X23 C;  3EPH A;  4J8V A;  1KU5 A;  3AZH C;  5B2I D;  3MGP B;  5AV8 C;  1F66 C;  2RVQ C;  3AZM C;  3R45 A;  2PYO A;  1P3K C;  5BNX B;  4AWL B;  3AZE B;  3LEL A;  3WKJ C;  4NE6 A;  5B1M A;  1P3M B;  1M19 B;  5DNN B;  3AN2 A;  3VH5 W;  5CPJ A;  4NFT A;  4H9N A;  1EQZ D;  5GT3 D;  4WNN B;  4QLC A;  3KUY A;  2HIO C;  3W97 B;  5GT0 D;  3C1C B;  3AZN A;  3C1B D;  3REI B;  4J8W B;  5FUG A;  5B0Z C;  3LZ0 C;  4KHA B;  3MGQ D;  1P3A A;  3MGR D;  5C3I C;  5GXQ A;  3A6N C;  1B67 A;  3EPJ A;  3AV1 D;  3X1S C;  4XZQ B;  4H9S A;  3EG5 B;  3X1V C;  1KX3 A;  3F6T A;  5GT0 C;  3AZF D;  1A7W A;  2Y2L A;  3TU4 D;  3W99 D;  2NQB D;  3AZE A;  3REL B;  1S32 A;  3KWQ D;  3MGQ C;  4WU9 C;  3O62 A;  3KXB B;  3REH C;  5CP6 B;  3X1T C;  5B2I A;  4YM6 C;  3AV1 C;  3MGS C;  3AYW B;  5DNM D;  3AZL B;  2IO5 C;  5AV6 B;  3REJ B;  1TAF B;  1ZLA B;  3AZI D;  4J8U D;  3W99 C;  1Q9C A;  3UTB D;  3KWQ C;  4G91 C;  5AVC D;  5CPI D;  1BH8 A;  2FJ7 A;  1T3U A;  4LD9 A;  1HQ3 B;  2YFW B;  1P34 B;  1EQZ A;  1P3B D;  5GT3 A;  1KX5 B;  2JCH A;  3MNN B;  3AZI C;  1AOI A;  2ZM5 A;  5B31 A;  1P3O B;  5GSU C;  1M18 D;  3UTB C;  3C1B A;  1KX4 B;  5AY8 D;  5CPI C;  2Y2I A;  4ZUX B;  4EO5 C;  4R8P D;  3MGR A;  2ARO C;  2CV5 B;  3B6G B;  1P3B C;  2RIQ A;  1R4V A;  3AZL A;  4WV4 B;  3AZF A;  1M1A C;  3TU4 A;  1ID3 A;  2NQB A;  4XUJ C;  3NQU A;  3AZG B;  1TZY D;  5JRG D;  3B6F B;  2Y2G A;  4H9Q A;  4R8P C;  4Z5T C;  4UPK A;  5AV5 D;  3AV2 A;  2F8N G;  5E5A C;  5BNV A;  5DNM A;  1P3L D;  3WAA B;  3W98 D;  5B2J C;  3WTP B;  2XD5 A;  2ZY3 A;  4J8U A;  4UUZ A;  3REK D;  3UTA B;  5AVB B;  4KUD B;  4CAY A;  5B33 B;  3X1U D;  4WU8 B;  5AV5 C;  2FFF B;  4YS3 D;  2UWX A;  5B0Y D;  3FDD A;  5B24 A;  1P3P B;  1U35 D;  4CSR B;  3B0D C;  3AZK C;  2CV5 A;  3W96 D;  4NE5 A;  4J8V B;  4J8X A;  4JJN A;  3V9R A;  2NZD D;  1M18 A;  2CWE A;  1P3G C;  5AY8 A;  3R45 B;  3LZ1 C;  3AZJ D;  2PYO B;  3AFA B;  3VH6 T;  5B32 C;  5B40 C;  3LEL B;  4X23 D;  2BYM A;  3W96 C;  3KFU G;  5B1M B;  2HUE B;  3AN2 B;  5B1L C;  3WA9 A;  2NZD C;  5CPJ B;  4H9N B;  1TZY A;  5JRG A;  1HTA A;  4QLC B;  3LJA C;  5F99 C;  3MVD C;  3KUY B;  1BH9 A;  3AZN B;  1P3I A;  3A1I A;  3WKJ D;  5FUG B;  1P3A B;  3W98 A;  1P3F A;  3REK A;  5GXQ B;  4Z66 C;  3X1U A;  1KX3 B;  4YS3 A;  4KGC D;  5B0Y A;  5CPK A;  4HGA C;  3VH6 A;  2HIO D;  3AFA A;  3UT9 C;  1U35 A;  1S32 B;  3O62 B;  3LZ0 D;  5B0Z D;  4G92 C;  5AV9 C;  5B2I B;  3A6N D;  3X1S D;  1PZR A;  3AZJ A;  4KGC C;  3X1V D;  2Y2H A;  2J8P A;  2Y2M A;  2BG1 A;  3EPK A;  4X23 A;  3MGP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...