4G92C

Ccaat-binding complex from aspergillus nidulans with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription/dna
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g92C00
3O62C 3C1CC 4Z5TA 4JJNC 3AZKC 5B0YC 1P3LB 5B1LD 1ULYA 5AV9A 3O62B 2PYOD 3C1CB 3AV2C 3UTAA 4CAYA 5GT0D 5CPKD 3AZKB 5KDMA 4J8WC 4H9SC 1HQ3D 3X1VD 5B40D 4J8UD 4KHAB 4J8WB 3UT9B 3WKJB 3VH6W 5GSUA 3AZMD 5C3IC 3KUYD 5CHLB 1M19C 4KGCC 1WWSA 5CPIA 4H9NB 4H9QB 3W97A 3AZLC 1BH8A 1KX3B 4DRBA 2FJ7A 4H9OA 1P3IC 4AWLC 5C3IB 3AZGC 1M19B 3MGQD 1ZLAA 3AZLB 3R45B 5AVBD 5B24D 3W98D 4AWLB 3MGRD 3AZND 1H3OB 5E5AA 3B6GA 3X1SC 4WU9A 5B31G 5DNMC 3AV1D 3MGSD 5AV6B 4WZSB 1P3OC 3W96C 4XUJA 4YM6C 5B33A 4EO5C 5DNMB 1KX5A 4QLCD 1P3OB 4YM6B 3AZIA 5B0ZB 1F66A 4EO5B 1P3GD 5FUGA 5AV5C 5B31A 1M18B 1AOIB 3AZFD 3REKC 5F99A 3MGPC 3LZ0A 3C1BA 5AV5B 1P34C 3KXBD 3AZHD 2AROA 1P3KB 5B2IC 3REIC 4Z5TC 1P3LD 1P3BA 2IO5C 3O62D 3KWQC 3C1CD 5B2IB 3REIB 5B32B 3UTAC 3V9RB 3X1UA 2NZDB 1TAFB 3LZ1A 4XZQB 5B1MC 4J8VA 3KWQB 5CPJC 3AZEA 1JFIB 4J8WD 2RVQC 5GSUC 3UT9D 3WKJD 5GXQA 5B1MB 5CPIC 3AYWA 5CPJB 1P3PA 4R8PC 5GT3C 2FJ7C 1KX3D 3B6FB 5GSUB 3AN2B 4KUDA 3A6NA 3VH5A 4LD9C 1M19D 4YS3B 3MNNA 3AZLD 1BH8B 4R8PB 3LJAC 5GT3B 2FJ7B 5AV8B 4LD9B 1TZYB 2NQBA 5AY8A 5E5AC 3MVDA 4G92C 3LJAB 4WU9C 4WV4B 2HUEB 2CV5C 1P3AB 3WTPA 5AV6D 2F8NK 4X23B 1U35B 4G92B 1KX5C 2CV5B 2BYMB 5BO0B 3AZIC 1P3OD 4YM6D 1WWIA 5B0ZD 4Z66A 3X1TA 3KSYA 5B31C 1KX5B 1M18D 1AOID 2HIOA 5BS7A 4UUZB 3W99A 5B2JA 2F8NA 4M6BA 3C1BC 1P3MA 5B31B 5AV5D 4ZUXA 3WAAC 2AROC 4H9PA 1P3KD 3UTBA 1M1AA 3WAAB 3REJC 5B2ID 3REID 3B0DC 5B32D 5JRGA 2NZDD 3LZ1C 4XZQD 4JJNB 3TU4D 5B0YB 3REJB 3KWQD 5DNNA 3AZEC 1P3FA 1ID3A 5JA4B 3B0DB 3LELC 4H9RA 5GXQC 3AV2B 1EQZD 1KX4A 1BFMA 5B1MD 1P3PC 5CPJD 3RELC 3NQUB 3LELB 4WU8A 3B6FD 5GSUD 3AN2D 4KUDC 3A6NC 2BYKB 5B1LA 3VH6T 4YS3D 3RELB 5CPKA 5GT0A 4R8PD 5BT1C 4KGCB 3NQJA 5GT3D 2FJ7D 5AV8D 1HQ3A 4LD9D 1TZYD 2NQBC 5B40A 4J8UA 1P3IB 3MVDC 1BH9A 3AZGB 3LJAD 3AZJC 4WNNA 3KUYA 3WTPC 1P3AD 3MVDB 3REHC 4X23D 1U35D 3AZJB 2CV5D 5G49B 3X1SB 5CP6C 3MGQA 3REHB 5AVCC 4Z66C 5AVBA 3W96B 2YFWA 3AFAC 3X1TC 1KX5D 5B24A 3W98A 2HIOC 5CP6B 3MGRA 3AZNA 2YFVB 3W99C 5B2JC 5AVCB 3AFAB 3X1TB 3AV1A 1P3MC 5B31D 3MGSA 5BNVA 3REKB 3MGPB 3WAAD 3B0BA 1P34B 5JRGC 5AV9C 1P3GA 4Z5TB 4JJND 3AZKD 5B0YD 4Z2MG 3REJD 1P3FC 1ID3C 5AV9B 2IO5B 3AV2D 3UTAB 4CAYB 3KXBA 3AZHA 3WTPE 5KDMB 1P3FB 3LELD 4WU8C 3W97C 5B1LC 3O62A 3C1CA 3RELD 5CPKC 1ZLAC 4KGCD 5CPIB 4WU8B 4Z2MH 1HQ3C 3W97B 4H9OB 1P3ID 3AZGD 1ZLAB 5BT1D 4J8WA 3UT9A 3WKJA 3B6GC 4H9SA 3MVDD 1BH9B 1B6WA 4H9NA 4XUJC 3AZJD 1KX3A 5E5AB 4WNNB 2F8NG 3B6GB 5B33C 4WU9B 3X1SD 1M19A 5DNMD 3REHD 3AZLA 4XUJB 3W96D 1N1JA 1F66C 3W98C 5B33B 5CP6D 3AZNC 1H3OA 3VH6A 5AVCD 3AZIB 3AFAD 5F99C 1F66B 3LZ0C 4G91C 5AV6A 5FUGB 5BNXA 2F8NH 5F99B 3REKD 3MGPD 3LZ0B 4G91B 3C1BB 4YM6A 1P3OA 5B0ZA 1P34D 2AROB 1P3BC 1M18A 4Z5TD 1AOIA 3X1UC 5AV9D 4J8VC 1P3BB 3WA9A 5AV5A 3UTAD 3X1UB 3VH5W 4DRAA 3LZ1B 1P3KA 4J8XA 1P3FD 1S32A 4J8VB 3AYWC 3AZEB 3VH5T 2RVQD 5GXQB 5B2IA 3REIA 5B32A 3V9RA 5CPID 3MNNC 3AYWB 4WU8D 1TAFA 1P3PB 2PYOA 2NZDA 4XZQA 3W97D 3TU4A 3KWQA 1JFIA 3A6NB 4KUDB 3X1VA 1ZLAD 3MNNB 5AY8C 3UT9C 3WKJC 1EQZA 5B1MA 3AZMA 5CPJA 2NQBB 1KX3C 4HGAC 5AY8B 3B6FA 5E5AD 1B67A 3AN2A 3B6GD 4WU9D 4YS3A 3WTPB 1Q9CA 4XUJD 4R8PA 5GT3A 4HGAB 5AV8A 5B33D 4LD9A 1TZYA 4CSRA 5BS7C 3LJAA 3AZID 1N1JB 1F66D 4Z66B 4NE6A 1P3AA 5AV6C 4ZUXC 4X23A 2HIOB 1U35A 5F99D 3W99B 5B2JB 2CV5A 2BYMA 3LZ0D 2F8NB 5BO0A 3C1BD 1P3MB 3UTBC 1KU5A 5BNXB 4ZUXB 5B0ZC 1M1AC 4QLCA 4NE5A 2AROD 4H9PB 1M18C 1AOIC 1KX4D 4UUZA 3UTBB 1A7WA 1M1AB 3AZFA 1P3BD 3WA9C 5DNNC 5JRGB 3X1UD 3B0CW 1P3KC 3LZ1D 4J8XC 1KX4C 1S32C 4J8VD 3WA9B 5DNNB 3AZED 1ID3B 4E45A 2L5AA 3B0CT 1HTAA 3WAAA 4H9RB 4J8XB 5GXQD 1P3LA 1KX4B 5B32C 1S32B 2NZDC 3AYWD 2PYOC 1P3PD 4XZQC 5GT0C 4JJNA 3TU4C 3AZKA 5B0YA 3REJA 4E44A 4KUDD 3A6ND 5JA4A 3X1VC 5B1LB 5B40C 4J8UC 3MNND 2PYOB 1EQZC 4KHAA 3AV2A 5CPKB 5GT0B 3TU4B 3NQJB 3AZMC 3KUYC 1HQ3B 3X1VB 3NQUA 2NQBD 5B40B 3LELA 4J8UB 2LY8A 3B6FC 5AY8D 1EQZB 3AN2C 4H9QA 2BYKA 4YS3C 3AZMB 3KUYB 3WTPD 3RELA 3MGQC 4KGCA 4ZBJC 5AV8C 1TZYC 3R45A 5AVBC 5B24C 1P3IA 3AZGA 3MGQB 3MGRC 4ZBJB 2HUEC 1P3AC 4Z66D 5AVBB 2YFWB 3X1TD 3AV1C 4CSRB 5B24B 3MGSC 4X23C 3W98B 1U35C 1F1EA 2HIOD 2JSSA 3MGRB 3AZNB 3AZJA 1R4VA 3W99D 5B2JD 5G49A 2F8ND 3X1SA 3AV1B 1P3MD 2CWEA 5DNMA 3MGSB 4ZUXD 3REHA 4QLCC 3W96A 5BNVB 5CP6A 1P3GC 2YFVA 3UTBD 1M1AD 4QLCB 5AVCA 3AZFC 3AFAA 5B32G 5JRGD 1P3GB 3KXBC 3AZHC 3AZFB 3WA9D 5DNND 4NE3A 3REKA 1ID3D 3MGPA 4NFTA 4J8XD 1P3LC 3KXBB 1P34A 3AZHB 1S32D
chains in the Genus database with same CATH superfamily
3O62C 3C1CC 2Y2IA 4Z5TA 4JJNC 3AZKC 5B0YC 4WJ3C 1P3LB 5B1LD 1ULYA 5AV9A 2J8PA 3O62B 3C1CB 2PYOD 3AV2C 3UTAA 4CAYA 5GT0D 5CPKD 3AZKB 5KDMA 4J8WC 4H9SC 1HQ3D 3X1VD 5B40D 4J8UD 1Z2CB 4KHAB 4J8WB 3UT9B 3WKJB 3VH6W 5GSUA 3AZMD 5C3IC 3KUYD 5CHLB 1M19C 4KGCC 1WWSA 5CPIA 4H9NB 4H9QB 3W97A 3AZLC 1BH8A 1KX3B 4DRBA 2FJ7A 4H9OA 1P3IC 2FFFB 4AWLC 5C3IB 3AZGC 1M19B 3MGQD 1ZLAA 3AZLB 3R45B 5AVBD 5B24D 3W98D 4AWLB 2F2AC 3MGRD 1H3OB 3AZND 5E5AA 2VQRA 3B6GA 3X1SC 4WU9A 2JE5A 5B31G 5DNMC 3AV1D 3MGSD 1T3UA 5AV6B 4WZSB 1P3OC 3W96C 4XUJA 4YM6C 5B33A 4EO5C 2BG1A 5DNMB 1KX5A 4QLCD 1P3OB 4YM6B 3AZIA 5B0ZB 1F66A 4EO5B 1P3GD 5FUGA 5AV5C 5B31A 1M18B 1AOIB 3AZFD 3REKC 5F99A 3MGPC 3LZ0A 3C1BA 5AV5B 1P34C 3KXBD 3AZHD 2AROA 2RIQA 1P3KB 5B2IC 3REIC 4Z5TC 2DQNC 1P3LD 1P3BA 2IO5C 3O62D 3KWQC 3C1CD 5B2IB 3REIB 5B32B 3UTAC 3V9RB 3X1UA 2NZDB 1TAFB 3LZ1A 4XZQB 3FDDA 2Y2GA 5B1MC 4J8VA 3KWQB 5CPJC 3AZEA 1JFIB 3IP4C 4J8WD 2RVQC 5GSUC 3UT9D 3WKJD 5GXQA 5B1MB 5CPIC 3AYWA 5CPJB 1P3PA 4R8PC 5GT3C 3F6TA 1KX3D 2FJ7C 5GSUB 3B6FB 3AN2B 4KUDA 3A6NA 3VH5A 4LD9C 1M19D 4YS3B 3MNNA 3AZLD 1BH8B 4R8PB 3LJAC 5GT3B 2FJ7B 5AV8B 4LD9B 1TZYB 2NQBA 5AY8A 5E5AC 3MVDA 4G92C 3LJAB 4WU9C 4WV4B 2HUEB 2CV5C 1P3AB 3WTPA 5AV6D 2F8NK 4X23B 1U35B 4G92B 1KX5C 2CV5B 2BYMB 5BO0B 3AZIC 1P3OD 4YM6D 1WWIA 5B0ZD 4Z66A 3X1TA 3KSYA 5B31C 1KX5B 1M18D 1AOID 2HIOA 5BS7A 4UUZB 3W99A 5B2JA 2F8NA 4M6BA 3C1BC 1P3MA 5B31B 5AV5D 4ZUXA 3WAAC 2AROC 4H9PA 1P3KD 2ZY2A 2G5IC 3UTBA 1M1AA 3WAAB 3REJC 5B2ID 3REID 3B0DC 5B32D 5JRGA 2NZDD 3LZ1C 4XZQD 4JJNB 3TU4D 5B0YB 3REJB 3KWQD 5DNNA 3AZEC 1P3FA 1ID3A 5JA4B 3B0DB 3LELC 2Y2MA 4H9RA 5GXQC 3AV2B 1EQZD 3EG5B 1KX4A 1BFMA 5B1MD 1P3PC 5CPJD 3RELC 3NQUB 2Y2HA 3LELB 4WU8A 3B6FD 5GSUD 3AN2D 4KUDC 2DF4C 2BYKB 3A6NC 5B1LA 3VH6T 4YS3D 3RELB 5CPKA 5GT0A 4R8PD 5BT1C 4KGCB 3NQJA 5GT3D 2FJ7D 5AV8D 1HQ3A 4LD9D 1TZYD 2NQBC 5B40A 4J8UA 1P3IB 3MVDC 1BH9A 3AZGB 3LJAD 3AZJC 4WNNA 3KUYA 1PZRA 3WTPC 1P3AD 3MVDB 3REHC 4X23D 1U35D 3AZJB 2G5HC 2CV5D 2ZY4A 5G49B 3X1SB 5CP6C 3MGQA 3REHB 5AVCC 2JCHA 4Z66C 5AVBA 3W96B 2YFWA 3AFAC 3X1TC 1KX5D 5B24A 3W98A 2HIOC 5CP6B 3MGRA 3AZNA 2YFVB 3H0LC 3W99C 5B2JC 5AVCB 3AFAB 3X1TB 3AV1A 1P3MC 5B31D 3MGSA 5BNVA 3REKB 3MGPB 3WAAD 3H0RC 3B0BA 1P34B 5JRGC 5AV9C 1P3GA 4Z5TB 4JJND 3AZKD 5B0YD 4Z2MG 3REJD 1P3FC 1ID3C 3A1IA 5AV9B 2IO5B 3KFUG 3AV2D 3UTAB 4CAYB 3KXBA 2ZM5A 3WTPE 3AZHA 5KDMB 1P3FB 3LELD 4WU8C 3W97C 5B1LC 3O62A 3C1CA 2ZY5A 3RELD 5CPKC 1ZLAC 4KGCD 5CPIB 4WU8B 4Z2MH 1HQ3C 3W97B 2W8SA 4H9OB 1P3ID 2Y2OA 3AZGD 1ZLAB 5BT1D 4J8WA 3UT9A 3WKJA 3B6GC 4H9SA 3P5JB 3MVDD 1BH9B 1B6WA 4H9NA 4XUJC 3AZJD 1KX3A 5E5AB 4WNNB 2F8NG 3B6GB 5B33C 4WU9B 3X1SD 1M19A 5DNMD 3REHD 3AZLA 4XUJB 3W96D 1N1JA 1F66C 3W98C 5B33B 5CP6D 3AZNC 1H3OA 3VH6A 5AVCD 3AZIB 3AFAD 5F99C 1F66B 3LZ0C 4G91C 5AV6A 4UPKA 5FUGB 5BNXA 2XD5A 2F8NH 2Y2PA 5F99B 3REKD 3MGPD 3LZ0B 4G91B 3C1BB 4YM6A 1P3OA 5B0ZA 1P34D 2AROB 1P3BC 1M18A 4Z5TD 1AOIA 3X1UC 2UWXA 5AV9D 4J8VC 1P3BB 3WA9A 5AV5A 3UTAD 3X1UB 3VH5W 4DRAA 3LZ1B 1P3KA 4J8XA 1P3FD 1S32A 3H0MC 4J8VB 3AYWC 3AZEB 3VH5T 2RVQD 5GXQB 5B2IA 3REIA 5B32A 3V9RA 5CPID 3MNNC 3AYWB 4WU8D 1TAFA 1P3PB 2PYOA 3AL0C 2NZDA 4XZQA 3W97D 3TU4A 3KWQA 1JFIA 3A6NB 4KUDB 3X1VA 2Y2NA 1ZLAD 3MNNB 5AY8C 3UT9C 3WKJC 1EQZA 5B1MA 3AZMA 5CPJA 2NQBB 1KX3C 4HGAC 5AY8B 3B6FA 5E5AD 1B67A 3AN2A 3B6GD 4WU9D 4YS3A 3WTPB 1Q9CA 4XUJD 4R8PA 5GT3A 4HGAB 5AV8A 5B33D 4LD9A 1TZYA 4CSRA 5BS7C 3LJAA 3AZID 1N1JB 2Y2KA 1F66D 4Z66B 4NE6A 1P3AA 5AV6C 4ZUXC 4X23A 2HIOB 3A1KA 2XD1A 1U35A 5F99D 3W99B 5B2JB 2CV5A 2BYMA 3LZ0D 2F8NB 5BO0A 3C1BD 1P3MB 3UTBC 1KU5A 5BNXB 4ZUXB 5B0ZC 1M1AC 4QLCA 4NE5A 2AROD 4H9PB 3EPJA 1M18C 1AOIC 4DQYB 1KX4D 4UUZA 3UTBB 1A7WA 1M1AB 3AZFA 1P3BD 3WA9C 5DNNC 5JRGB 3X1UD 3B0CW 1P3KC 3LZ1D 4J8XC 1KX4C 1S32C 4J8VD 3WA9B 5DNNB 3AZED 1ID3B 4E45A 2L5AA 3B0CT 1HTAA 3WAAA 4H9RB 4J8XB 5GXQD 1P3LA 1KX4B 5B32C 1S32B 2NZDC 3AYWD 2PYOC 1P3PD 4XZQC 5GT0C 4JJNA 3TU4C 3AZKA 5B0YA 3REJA 4E44A 4KUDD 3A6ND 5JA4A 3X1VC 5B1LB 5B40C 4J8UC 3MNND 2PYOB 1EQZC 4KHAA 3AV2A 5CPKB 5GT0B 3TU4B 3NQJB 2Y2JA 3AZMC 3KUYC 1HQ3B 3X1VB 3NQUA 2NQBD 5B40B 2ZY3A 3LELA 4J8UB 2LY8A 3B6FC 5AY8D 1EQZB 3AN2C 4H9QA 2BYKA 4YS3C 3EPLA 3AZMB 3KUYB 3WTPD 3RELA 3MGQC 4KGCA 4ZBJC 5AV8C 1TZYC 3R45A 5AVBC 5B24C 1P3IA 1W2EA 3MGQB 3MGRC 3AZGA 4ZBJB 3EPKA 2HUEC 1P3AC 4Z66D 5AVBB 2YFWB 3X1TD 3AV1C 4CSRB 5B24B 2Y2QA 4X23C 3MGSC 1U35C 3W98B 1F1EA 2HIOD 3EPHA 2JSSA 3MGRB 3AZNB 3AZJA 1R4VA 3W99D 5B2JD 5G49A 2F8ND 3X1SA 3AV1B 1P3MD 2CWEA 2Y2LA 5DNMA 4ZUXD 3MGSB 3REHA 4QLCC 3W96A 5BNVB 5CP6A 1P3GC 2YFVA 3UTBD 1M1AD 4QLCB 5AVCA 3AZFC 3AFAA 5B32G 5JRGD 1P3GB 3KXBC 3AZHC 3AZFB 3WA9D 5DNND 4NE3A 3REKA 1ID3D 3MGPA 4NFTA 4J8XD 1P3LC 3KXBB 1P34A 3AZHB 1S32D
chains in the Genus database with same CATH topology
3O62C 3C1CC 2Y2IA 4Z5TA 4JJNC 3AZKC 5B0YC 4WJ3C 1P3LB 5B1LD 1ULYA 5AV9A 2J8PA 3O62B 3C1CB 2PYOD 3AV2C 3UTAA 4CAYA 5GT0D 5CPKD 3AZKB 5KDMA 4J8WC 4H9SC 1HQ3D 3X1VD 5B40D 4J8UD 1Z2CB 4KHAB 4J8WB 3UT9B 3WKJB 3VH6W 5GSUA 3AZMD 5C3IC 3KUYD 5CHLB 1M19C 4KGCC 1WWSA 5CPIA 4H9NB 4H9QB 3W97A 3AZLC 1BH8A 1KX3B 4DRBA 2FJ7A 4H9OA 1P3IC 2FFFB 4AWLC 5C3IB 3AZGC 1M19B 3MGQD 1ZLAA 3AZLB 3R45B 5AVBD 5B24D 3W98D 4AWLB 2F2AC 3MGRD 1H3OB 3AZND 5E5AA 2VQRA 3B6GA 3X1SC 4WU9A 2JE5A 5B31G 5DNMC 3AV1D 3MGSD 1T3UA 5AV6B 4WZSB 1P3OC 3W96C 4XUJA 4YM6C 5B33A 4EO5C 2BG1A 5DNMB 1KX5A 4QLCD 1P3OB 4YM6B 3AZIA 5B0ZB 1F66A 4EO5B 1P3GD 5FUGA 5AV5C 5B31A 1M18B 1AOIB 3AZFD 3REKC 5F99A 3MGPC 3LZ0A 3C1BA 5AV5B 1P34C 3KXBD 3AZHD 2AROA 2RIQA 1P3KB 5B2IC 3REIC 4Z5TC 2DQNC 1P3LD 1P3BA 2IO5C 3O62D 3KWQC 3C1CD 5B2IB 3REIB 5B32B 3UTAC 3V9RB 3X1UA 2NZDB 1TAFB 3LZ1A 4XZQB 3FDDA 2Y2GA 5B1MC 4J8VA 3KWQB 5CPJC 3AZEA 1JFIB 3IP4C 4J8WD 2RVQC 5GSUC 3UT9D 3WKJD 5GXQA 5B1MB 5CPIC 3AYWA 5CPJB 1P3PA 4R8PC 5GT3C 3F6TA 1KX3D 2FJ7C 5GSUB 3B6FB 3AN2B 4KUDA 3A6NA 3VH5A 4LD9C 1M19D 4YS3B 3MNNA 3AZLD 1BH8B 4R8PB 3LJAC 5GT3B 2FJ7B 5AV8B 4LD9B 1TZYB 2NQBA 5AY8A 5E5AC 3MVDA 4G92C 3LJAB 4WU9C 4WV4B 2HUEB 2CV5C 1P3AB 3WTPA 5AV6D 2F8NK 4X23B 1U35B 4G92B 1KX5C 2CV5B 2BYMB 5BO0B 3AZIC 1P3OD 4YM6D 1WWIA 5B0ZD 4Z66A 3X1TA 3KSYA 5B31C 1KX5B 1M18D 1AOID 2HIOA 5BS7A 4UUZB 3W99A 5B2JA 2F8NA 4M6BA 3C1BC 1P3MA 5B31B 5AV5D 4ZUXA 3WAAC 2AROC 4H9PA 1P3KD 2ZY2A 2G5IC 3UTBA 1M1AA 3WAAB 3REJC 5B2ID 3REID 3B0DC 5B32D 5JRGA 2NZDD 3LZ1C 4XZQD 4JJNB 3TU4D 5B0YB 3REJB 3KWQD 5DNNA 3AZEC 1P3FA 1ID3A 5JA4B 3B0DB 3LELC 2Y2MA 4H9RA 5GXQC 3AV2B 1EQZD 3EG5B 1KX4A 1BFMA 5B1MD 1P3PC 5CPJD 3RELC 3NQUB 2Y2HA 3LELB 4WU8A 3B6FD 5GSUD 3AN2D 4KUDC 2DF4C 2BYKB 3A6NC 5B1LA 3VH6T 4YS3D 3RELB 5CPKA 5GT0A 4R8PD 5BT1C 4KGCB 3NQJA 5GT3D 2FJ7D 5AV8D 1HQ3A 4LD9D 1TZYD 2NQBC 5B40A 4J8UA 1P3IB 3MVDC 1BH9A 3AZGB 3LJAD 3AZJC 4WNNA 3KUYA 1PZRA 3WTPC 1P3AD 3MVDB 3REHC 4X23D 1U35D 3AZJB 2G5HC 2CV5D 2ZY4A 5G49B 3X1SB 5CP6C 3MGQA 3REHB 5AVCC 2JCHA 4Z66C 5AVBA 3W96B 2YFWA 3AFAC 3X1TC 1KX5D 5B24A 3W98A 2HIOC 5CP6B 3MGRA 3AZNA 2YFVB 3H0LC 3W99C 5B2JC 5AVCB 3AFAB 3X1TB 3AV1A 1P3MC 5B31D 3MGSA 5BNVA 3REKB 3MGPB 3WAAD 3H0RC 3B0BA 1P34B 5JRGC 5AV9C 1P3GA 4Z5TB 4JJND 3AZKD 5B0YD 4Z2MG 3REJD 1P3FC 1ID3C 3A1IA 5AV9B 2IO5B 3KFUG 3AV2D 3UTAB 4CAYB 3KXBA 2ZM5A 3WTPE 3AZHA 5KDMB 1P3FB 3LELD 4WU8C 3W97C 5B1LC 3O62A 3C1CA 2ZY5A 3RELD 5CPKC 1ZLAC 4KGCD 5CPIB 4WU8B 4Z2MH 1HQ3C 3W97B 2W8SA 4H9OB 1P3ID 2Y2OA 3AZGD 1ZLAB 5BT1D 4J8WA 3UT9A 3WKJA 3B6GC 4H9SA 3P5JB 3MVDD 1BH9B 1B6WA 4H9NA 4XUJC 3AZJD 1KX3A 5E5AB 4WNNB 2F8NG 3B6GB 5B33C 4WU9B 3X1SD 1M19A 5DNMD 3REHD 3AZLA 4XUJB 3W96D 1N1JA 1F66C 3W98C 5B33B 5CP6D 3AZNC 1H3OA 3VH6A 5AVCD 3AZIB 3AFAD 5F99C 1F66B 3LZ0C 4G91C 5AV6A 4UPKA 5FUGB 5BNXA 2XD5A 2F8NH 2Y2PA 5F99B 3REKD 3MGPD 3LZ0B 4G91B 3C1BB 4YM6A 1P3OA 5B0ZA 1P34D 2AROB 1P3BC 1M18A 4Z5TD 1AOIA 3X1UC 2UWXA 5AV9D 4J8VC 1P3BB 3WA9A 5AV5A 3UTAD 3X1UB 3VH5W 4DRAA 3LZ1B 1P3KA 4J8XA 1P3FD 1S32A 3H0MC 4J8VB 3AYWC 3AZEB 3VH5T 2RVQD 5GXQB 5B2IA 3REIA 5B32A 3V9RA 5CPID 3MNNC 3AYWB 4WU8D 1TAFA 1P3PB 2PYOA 3AL0C 2NZDA 4XZQA 3W97D 3TU4A 3KWQA 1JFIA 3A6NB 4KUDB 3X1VA 2Y2NA 1ZLAD 3MNNB 5AY8C 3UT9C 3WKJC 1EQZA 5B1MA 3AZMA 5CPJA 2NQBB 1KX3C 4HGAC 5AY8B 3B6FA 5E5AD 1B67A 3AN2A 3B6GD 4WU9D 4YS3A 3WTPB 1Q9CA 4XUJD 4R8PA 5GT3A 4HGAB 5AV8A 5B33D 4LD9A 1TZYA 4CSRA 5BS7C 3LJAA 3AZID 1N1JB 2Y2KA 1F66D 4Z66B 4NE6A 1P3AA 5AV6C 4ZUXC 4X23A 2HIOB 3A1KA 2XD1A 1U35A 5F99D 3W99B 5B2JB 2CV5A 2BYMA 3LZ0D 2F8NB 5BO0A 3C1BD 1P3MB 3UTBC 1KU5A 5BNXB 4ZUXB 5B0ZC 1M1AC 4QLCA 4NE5A 2AROD 4H9PB 3EPJA 1M18C 1AOIC 4DQYB 1KX4D 4UUZA 3UTBB 1A7WA 1M1AB 3AZFA 1P3BD 3WA9C 5DNNC 5JRGB 3X1UD 3B0CW 1P3KC 3LZ1D 4J8XC 1KX4C 1S32C 4J8VD 3WA9B 5DNNB 3AZED 1ID3B 4E45A 2L5AA 3B0CT 1HTAA 3WAAA 4H9RB 4J8XB 5GXQD 1P3LA 1KX4B 5B32C 1S32B 2NZDC 3AYWD 2PYOC 1P3PD 4XZQC 5GT0C 4JJNA 3TU4C 3AZKA 5B0YA 3REJA 4E44A 4KUDD 3A6ND 5JA4A 3X1VC 5B1LB 5B40C 4J8UC 3MNND 2PYOB 1EQZC 4KHAA 3AV2A 5CPKB 5GT0B 3TU4B 3NQJB 2Y2JA 3AZMC 3KUYC 1HQ3B 3X1VB 3NQUA 2NQBD 5B40B 2ZY3A 3LELA 4J8UB 2LY8A 3B6FC 5AY8D 1EQZB 3AN2C 4H9QA 2BYKA 4YS3C 3EPLA 3AZMB 3KUYB 3WTPD 3RELA 3MGQC 4KGCA 4ZBJC 5AV8C 1TZYC 3R45A 5AVBC 5B24C 1P3IA 1W2EA 3MGQB 3MGRC 3AZGA 4ZBJB 3EPKA 2HUEC 1P3AC 4Z66D 5AVBB 2YFWB 3X1TD 3AV1C 4CSRB 5B24B 2Y2QA 4X23C 3MGSC 1U35C 3W98B 1F1EA 2HIOD 3EPHA 2JSSA 3MGRB 3AZNB 3AZJA 1R4VA 3W99D 5B2JD 5G49A 2F8ND 3X1SA 3AV1B 1P3MD 2CWEA 2Y2LA 5DNMA 4ZUXD 3MGSB 3REHA 4QLCC 3W96A 5BNVB 5CP6A 1P3GC 2YFVA 3UTBD 1M1AD 4QLCB 5AVCA 3AZFC 3AFAA 5B32G 5JRGD 1P3GB 3KXBC 3AZHC 3AZFB 3WA9D 5DNND 4NE3A 3REKA 1ID3D 3MGPA 4NFTA 4J8XD 1P3LC 3KXBB 1P34A 3AZHB 1S32D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 C;  3C1C C;  4Z5T A;  4JJN C;  3AZK C;  5B0Y C;  1P3L B;  5B1L D;  1ULY A;  5AV9 A;  3O62 B;  2PYO D;  3C1C B;  3AV2 C;  3UTA A;  4CAY A;  5GT0 D;  5CPK D;  3AZK B;  5KDM A;  4J8W C;  4H9S C;  1HQ3 D;  3X1V D;  5B40 D;  4J8U D;  4KHA B;  4J8W B;  3UT9 B;  3WKJ B;  3VH6 W;  5GSU A;  3AZM D;  5C3I C;  3KUY D;  5CHL B;  1M19 C;  4KGC C;  1WWS A;  5CPI A;  4H9N B;  4H9Q B;  3W97 A;  3AZL C;  1BH8 A;  1KX3 B;  4DRB A;  2FJ7 A;  4H9O A;  1P3I C;  4AWL C;  5C3I B;  3AZG C;  1M19 B;  3MGQ D;  1ZLA A;  3AZL B;  3R45 B;  5AVB D;  5B24 D;  3W98 D;  4AWL B;  3MGR D;  3AZN D;  1H3O B;  5E5A A;  3B6G A;  3X1S C;  4WU9 A;  5B31 G;  5DNM C;  3AV1 D;  3MGS D;  5AV6 B;  4WZS B;  1P3O C;  3W96 C;  4XUJ A;  4YM6 C;  5B33 A;  4EO5 C;  5DNM B;  1KX5 A;  4QLC D;  1P3O B;  4YM6 B;  3AZI A;  5B0Z B;  1F66 A;  4EO5 B;  1P3G D;  5FUG A;  5AV5 C;  5B31 A;  1M18 B;  1AOI B;  3AZF D;  3REK C;  5F99 A;  3MGP C;  3LZ0 A;  3C1B A;  5AV5 B;  1P34 C;  3KXB D;  3AZH D;  2ARO A;  1P3K B;  5B2I C;  3REI C;  4Z5T C;  1P3L D;  1P3B A;  2IO5 C;  3O62 D;  3KWQ C;  3C1C D;  5B2I B;  3REI B;  5B32 B;  3UTA C;  3V9R B;  3X1U A;  2NZD B;  1TAF B;  3LZ1 A;  4XZQ B;  5B1M C;  4J8V A;  3KWQ B;  5CPJ C;  3AZE A;  1JFI B;  4J8W D;  2RVQ C;  5GSU C;  3UT9 D;  3WKJ D;  5GXQ A;  5B1M B;  5CPI C;  3AYW A;  5CPJ B;  1P3P A;  4R8P C;  5GT3 C;  2FJ7 C;  1KX3 D;  3B6F B;  5GSU B;  3AN2 B;  4KUD A;  3A6N A;  3VH5 A;  4LD9 C;  1M19 D;  4YS3 B;  3MNN A;  3AZL D;  1BH8 B;  4R8P B;  3LJA C;  5GT3 B;  2FJ7 B;  5AV8 B;  4LD9 B;  1TZY B;  2NQB A;  5AY8 A;  5E5A C;  3MVD A;  4G92 C;  3LJA B;  4WU9 C;  4WV4 B;  2HUE B;  2CV5 C;  1P3A B;  3WTP A;  5AV6 D;  2F8N K;  4X23 B;  1U35 B;  4G92 B;  1KX5 C;  2CV5 B;  2BYM B;  5BO0 B;  3AZI C;  1P3O D;  4YM6 D;  1WWI A;  5B0Z D;  4Z66 A;  3X1T A;  3KSY A;  5B31 C;  1KX5 B;  1M18 D;  1AOI D;  2HIO A;  5BS7 A;  4UUZ B;  3W99 A;  5B2J A;  2F8N A;  4M6B A;  3C1B C;  1P3M A;  5B31 B;  5AV5 D;  4ZUX A;  3WAA C;  2ARO C;  4H9P A;  1P3K D;  3UTB A;  1M1A A;  3WAA B;  3REJ C;  5B2I D;  3REI D;  3B0D C;  5B32 D;  5JRG A;  2NZD D;  3LZ1 C;  4XZQ D;  4JJN B;  3TU4 D;  5B0Y B;  3REJ B;  3KWQ D;  5DNN A;  3AZE C;  1P3F A;  1ID3 A;  5JA4 B;  3B0D B;  3LEL C;  4H9R A;  5GXQ C;  3AV2 B;  1EQZ D;  1KX4 A;  1BFM A;  5B1M D;  1P3P C;  5CPJ D;  3REL C;  3NQU B;  3LEL B;  4WU8 A;  3B6F D;  5GSU D;  3AN2 D;  4KUD C;  3A6N C;  2BYK B;  5B1L A;  3VH6 T;  4YS3 D;  3REL B;  5CPK A;  5GT0 A;  4R8P D;  5BT1 C;  4KGC B;  3NQJ A;  5GT3 D;  2FJ7 D;  5AV8 D;  1HQ3 A;  4LD9 D;  1TZY D;  2NQB C;  5B40 A;  4J8U A;  1P3I B;  3MVD C;  1BH9 A;  3AZG B;  3LJA D;  3AZJ C;  4WNN A;  3KUY A;  3WTP C;  1P3A D;  3MVD B;  3REH C;  4X23 D;  1U35 D;  3AZJ B;  2CV5 D;  5G49 B;  3X1S B;  5CP6 C;  3MGQ A;  3REH B;  5AVC C;  4Z66 C;  5AVB A;  3W96 B;  2YFW A;  3AFA C;  3X1T C;  1KX5 D;  5B24 A;  3W98 A;  2HIO C;  5CP6 B;  3MGR A;  3AZN A;  2YFV B;  3W99 C;  5B2J C;  5AVC B;  3AFA B;  3X1T B;  3AV1 A;  1P3M C;  5B31 D;  3MGS A;  5BNV A;  3REK B;  3MGP B;  3WAA D;  3B0B A;  1P34 B;  5JRG C;  5AV9 C;  1P3G A;  4Z5T B;  4JJN D;  3AZK D;  5B0Y D;  4Z2M G;  3REJ D;  1P3F C;  1ID3 C;  5AV9 B;  2IO5 B;  3AV2 D;  3UTA B;  4CAY B;  3KXB A;  3AZH A;  3WTP E;  5KDM B;  1P3F B;  3LEL D;  4WU8 C;  3W97 C;  5B1L C;  3O62 A;  3C1C A;  3REL D;  5CPK C;  1ZLA C;  4KGC D;  5CPI B;  4WU8 B;  4Z2M H;  1HQ3 C;  3W97 B;  4H9O B;  1P3I D;  3AZG D;  1ZLA B;  5BT1 D;  4J8W A;  3UT9 A;  3WKJ A;  3B6G C;  4H9S A;  3MVD D;  1BH9 B;  1B6W A;  4H9N A;  4XUJ C;  3AZJ D;  1KX3 A;  5E5A B;  4WNN B;  2F8N G;  3B6G B;  5B33 C;  4WU9 B;  3X1S D;  1M19 A;  5DNM D;  3REH D;  3AZL A;  4XUJ B;  3W96 D;  1N1J A;  1F66 C;  3W98 C;  5B33 B;  5CP6 D;  3AZN C;  1H3O A;  3VH6 A;  5AVC D;  3AZI B;  3AFA D;  5F99 C;  1F66 B;  3LZ0 C;  4G91 C;  5AV6 A;  5FUG B;  5BNX A;  2F8N H;  5F99 B;  3REK D;  3MGP D;  3LZ0 B;  4G91 B;  3C1B B;  4YM6 A;  1P3O A;  5B0Z A;  1P34 D;  2ARO B;  1P3B C;  1M18 A;  4Z5T D;  1AOI A;  3X1U C;  5AV9 D;  4J8V C;  1P3B B;  3WA9 A;  5AV5 A;  3UTA D;  3X1U B;  3VH5 W;  4DRA A;  3LZ1 B;  1P3K A;  4J8X A;  1P3F D;  1S32 A;  4J8V B;  3AYW C;  3AZE B;  3VH5 T;  2RVQ D;  5GXQ B;  5B2I A;  3REI A;  5B32 A;  3V9R A;  5CPI D;  3MNN C;  3AYW B;  4WU8 D;  1TAF A;  1P3P B;  2PYO A;  2NZD A;  4XZQ A;  3W97 D;  3TU4 A;  3KWQ A;  1JFI A;  3A6N B;  4KUD B;  3X1V A;  1ZLA D;  3MNN B;  5AY8 C;  3UT9 C;  3WKJ C;  1EQZ A;  5B1M A;  3AZM A;  5CPJ A;  2NQB B;  1KX3 C;  4HGA C;  5AY8 B;  3B6F A;  5E5A D;  1B67 A;  3AN2 A;  3B6G D;  4WU9 D;  4YS3 A;  3WTP B;  1Q9C A;  4XUJ D;  4R8P A;  5GT3 A;  4HGA B;  5AV8 A;  5B33 D;  4LD9 A;  1TZY A;  4CSR A;  5BS7 C;  3LJA A;  3AZI D;  1N1J B;  1F66 D;  4Z66 B;  4NE6 A;  1P3A A;  5AV6 C;  4ZUX C;  4X23 A;  2HIO B;  1U35 A;  5F99 D;  3W99 B;  5B2J B;  2CV5 A;  2BYM A;  3LZ0 D;  2F8N B;  5BO0 A;  3C1B D;  1P3M B;  3UTB C;  1KU5 A;  5BNX B;  4ZUX B;  5B0Z C;  1M1A C;  4QLC A;  4NE5 A;  2ARO D;  4H9P B;  1M18 C;  1AOI C;  1KX4 D;  4UUZ A;  3UTB B;  1A7W A;  1M1A B;  3AZF A;  1P3B D;  3WA9 C;  5DNN C;  5JRG B;  3X1U D;  3B0C W;  1P3K C;  3LZ1 D;  4J8X C;  1KX4 C;  1S32 C;  4J8V D;  3WA9 B;  5DNN B;  3AZE D;  1ID3 B;  4E45 A;  2L5A A;  3B0C T;  1HTA A;  3WAA A;  4H9R B;  4J8X B;  5GXQ D;  1P3L A;  1KX4 B;  5B32 C;  1S32 B;  2NZD C;  3AYW D;  2PYO C;  1P3P D;  4XZQ C;  5GT0 C;  4JJN A;  3TU4 C;  3AZK A;  5B0Y A;  3REJ A;  4E44 A;  4KUD D;  3A6N D;  5JA4 A;  3X1V C;  5B1L B;  5B40 C;  4J8U C;  3MNN D;  2PYO B;  1EQZ C;  4KHA A;  3AV2 A;  5CPK B;  5GT0 B;  3TU4 B;  3NQJ B;  3AZM C;  3KUY C;  1HQ3 B;  3X1V B;  3NQU A;  2NQB D;  5B40 B;  3LEL A;  4J8U B;  2LY8 A;  3B6F C;  5AY8 D;  1EQZ B;  3AN2 C;  4H9Q A;  2BYK A;  4YS3 C;  3AZM B;  3KUY B;  3WTP D;  3REL A;  3MGQ C;  4KGC A;  4ZBJ C;  5AV8 C;  1TZY C;  3R45 A;  5AVB C;  5B24 C;  1P3I A;  3AZG A;  3MGQ B;  3MGR C;  4ZBJ B;  2HUE C;  1P3A C;  4Z66 D;  5AVB B;  2YFW B;  3X1T D;  3AV1 C;  4CSR B;  5B24 B;  3MGS C;  4X23 C;  3W98 B;  1U35 C;  1F1E A;  2HIO D;  2JSS A;  3MGR B;  3AZN B;  3AZJ A;  1R4V A;  3W99 D;  5B2J D;  5G49 A;  2F8N D;  3X1S A;  3AV1 B;  1P3M D;  2CWE A;  5DNM A;  3MGS B;  4ZUX D;  3REH A;  4QLC C;  3W96 A;  5BNV B;  5CP6 A;  1P3G C;  2YFV A;  3UTB D;  1M1A D;  4QLC B;  5AVC A;  3AZF C;  3AFA A;  5B32 G;  5JRG D;  1P3G B;  3KXB C;  3AZH C;  3AZF B;  3WA9 D;  5DNN D;  4NE3 A;  3REK A;  1ID3 D;  3MGP A;  4NFT A;  4J8X D;  1P3L C;  3KXB B;  1P34 A;  3AZH B;  1S32 D; 
#chains in the Genus database with same CATH topology
 3O62 C;  3C1C C;  2Y2I A;  4Z5T A;  4JJN C;  3AZK C;  5B0Y C;  4WJ3 C;  1P3L B;  5B1L D;  1ULY A;  5AV9 A;  2J8P A;  3O62 B;  3C1C B;  2PYO D;  3AV2 C;  3UTA A;  4CAY A;  5GT0 D;  5CPK D;  3AZK B;  5KDM A;  4J8W C;  4H9S C;  1HQ3 D;  3X1V D;  5B40 D;  4J8U D;  1Z2C B;  4KHA B;  4J8W B;  3UT9 B;  3WKJ B;  3VH6 W;  5GSU A;  3AZM D;  5C3I C;  3KUY D;  5CHL B;  1M19 C;  4KGC C;  1WWS A;  5CPI A;  4H9N B;  4H9Q B;  3W97 A;  3AZL C;  1BH8 A;  1KX3 B;  4DRB A;  2FJ7 A;  4H9O A;  1P3I C;  2FFF B;  4AWL C;  5C3I B;  3AZG C;  1M19 B;  3MGQ D;  1ZLA A;  3AZL B;  3R45 B;  5AVB D;  5B24 D;  3W98 D;  4AWL B;  2F2A C;  3MGR D;  1H3O B;  3AZN D;  5E5A A;  2VQR A;  3B6G A;  3X1S C;  4WU9 A;  2JE5 A;  5B31 G;  5DNM C;  3AV1 D;  3MGS D;  1T3U A;  5AV6 B;  4WZS B;  1P3O C;  3W96 C;  4XUJ A;  4YM6 C;  5B33 A;  4EO5 C;  2BG1 A;  5DNM B;  1KX5 A;  4QLC D;  1P3O B;  4YM6 B;  3AZI A;  5B0Z B;  1F66 A;  4EO5 B;  1P3G D;  5FUG A;  5AV5 C;  5B31 A;  1M18 B;  1AOI B;  3AZF D;  3REK C;  5F99 A;  3MGP C;  3LZ0 A;  3C1B A;  5AV5 B;  1P34 C;  3KXB D;  3AZH D;  2ARO A;  2RIQ A;  1P3K B;  5B2I C;  3REI C;  4Z5T C;  2DQN C;  1P3L D;  1P3B A;  2IO5 C;  3O62 D;  3KWQ C;  3C1C D;  5B2I B;  3REI B;  5B32 B;  3UTA C;  3V9R B;  3X1U A;  2NZD B;  1TAF B;  3LZ1 A;  4XZQ B;  3FDD A;  2Y2G A;  5B1M C;  4J8V A;  3KWQ B;  5CPJ C;  3AZE A;  1JFI B;  3IP4 C;  4J8W D;  2RVQ C;  5GSU C;  3UT9 D;  3WKJ D;  5GXQ A;  5B1M B;  5CPI C;  3AYW A;  5CPJ B;  1P3P A;  4R8P C;  5GT3 C;  3F6T A;  1KX3 D;  2FJ7 C;  5GSU B;  3B6F B;  3AN2 B;  4KUD A;  3A6N A;  3VH5 A;  4LD9 C;  1M19 D;  4YS3 B;  3MNN A;  3AZL D;  1BH8 B;  4R8P B;  3LJA C;  5GT3 B;  2FJ7 B;  5AV8 B;  4LD9 B;  1TZY B;  2NQB A;  5AY8 A;  5E5A C;  3MVD A;  4G92 C;  3LJA B;  4WU9 C;  4WV4 B;  2HUE B;  2CV5 C;  1P3A B;  3WTP A;  5AV6 D;  2F8N K;  4X23 B;  1U35 B;  4G92 B;  1KX5 C;  2CV5 B;  2BYM B;  5BO0 B;  3AZI C;  1P3O D;  4YM6 D;  1WWI A;  5B0Z D;  4Z66 A;  3X1T A;  3KSY A;  5B31 C;  1KX5 B;  1M18 D;  1AOI D;  2HIO A;  5BS7 A;  4UUZ B;  3W99 A;  5B2J A;  2F8N A;  4M6B A;  3C1B C;  1P3M A;  5B31 B;  5AV5 D;  4ZUX A;  3WAA C;  2ARO C;  4H9P A;  1P3K D;  2ZY2 A;  2G5I C;  3UTB A;  1M1A A;  3WAA B;  3REJ C;  5B2I D;  3REI D;  3B0D C;  5B32 D;  5JRG A;  2NZD D;  3LZ1 C;  4XZQ D;  4JJN B;  3TU4 D;  5B0Y B;  3REJ B;  3KWQ D;  5DNN A;  3AZE C;  1P3F A;  1ID3 A;  5JA4 B;  3B0D B;  3LEL C;  2Y2M A;  4H9R A;  5GXQ C;  3AV2 B;  1EQZ D;  3EG5 B;  1KX4 A;  1BFM A;  5B1M D;  1P3P C;  5CPJ D;  3REL C;  3NQU B;  2Y2H A;  3LEL B;  4WU8 A;  3B6F D;  5GSU D;  3AN2 D;  4KUD C;  2DF4 C;  2BYK B;  3A6N C;  5B1L A;  3VH6 T;  4YS3 D;  3REL B;  5CPK A;  5GT0 A;  4R8P D;  5BT1 C;  4KGC B;  3NQJ A;  5GT3 D;  2FJ7 D;  5AV8 D;  1HQ3 A;  4LD9 D;  1TZY D;  2NQB C;  5B40 A;  4J8U A;  1P3I B;  3MVD C;  1BH9 A;  3AZG B;  3LJA D;  3AZJ C;  4WNN A;  3KUY A;  1PZR A;  3WTP C;  1P3A D;  3MVD B;  3REH C;  4X23 D;  1U35 D;  3AZJ B;  2G5H C;  2CV5 D;  2ZY4 A;  5G49 B;  3X1S B;  5CP6 C;  3MGQ A;  3REH B;  5AVC C;  2JCH A;  4Z66 C;  5AVB A;  3W96 B;  2YFW A;  3AFA C;  3X1T C;  1KX5 D;  5B24 A;  3W98 A;  2HIO C;  5CP6 B;  3MGR A;  3AZN A;  2YFV B;  3H0L C;  3W99 C;  5B2J C;  5AVC B;  3AFA B;  3X1T B;  3AV1 A;  1P3M C;  5B31 D;  3MGS A;  5BNV A;  3REK B;  3MGP B;  3WAA D;  3H0R C;  3B0B A;  1P34 B;  5JRG C;  5AV9 C;  1P3G A;  4Z5T B;  4JJN D;  3AZK D;  5B0Y D;  4Z2M G;  3REJ D;  1P3F C;  1ID3 C;  3A1I A;  5AV9 B;  2IO5 B;  3KFU G;  3AV2 D;  3UTA B;  4CAY B;  3KXB A;  2ZM5 A;  3WTP E;  3AZH A;  5KDM B;  1P3F B;  3LEL D;  4WU8 C;  3W97 C;  5B1L C;  3O62 A;  3C1C A;  2ZY5 A;  3REL D;  5CPK C;  1ZLA C;  4KGC D;  5CPI B;  4WU8 B;  4Z2M H;  1HQ3 C;  3W97 B;  2W8S A;  4H9O B;  1P3I D;  2Y2O A;  3AZG D;  1ZLA B;  5BT1 D;  4J8W A;  3UT9 A;  3WKJ A;  3B6G C;  4H9S A;  3P5J B;  3MVD D;  1BH9 B;  1B6W A;  4H9N A;  4XUJ C;  3AZJ D;  1KX3 A;  5E5A B;  4WNN B;  2F8N G;  3B6G B;  5B33 C;  4WU9 B;  3X1S D;  1M19 A;  5DNM D;  3REH D;  3AZL A;  4XUJ B;  3W96 D;  1N1J A;  1F66 C;  3W98 C;  5B33 B;  5CP6 D;  3AZN C;  1H3O A;  3VH6 A;  5AVC D;  3AZI B;  3AFA D;  5F99 C;  1F66 B;  3LZ0 C;  4G91 C;  5AV6 A;  4UPK A;  5FUG B;  5BNX A;  2XD5 A;  2F8N H;  2Y2P A;  5F99 B;  3REK D;  3MGP D;  3LZ0 B;  4G91 B;  3C1B B;  4YM6 A;  1P3O A;  5B0Z A;  1P34 D;  2ARO B;  1P3B C;  1M18 A;  4Z5T D;  1AOI A;  3X1U C;  2UWX A;  5AV9 D;  4J8V C;  1P3B B;  3WA9 A;  5AV5 A;  3UTA D;  3X1U B;  3VH5 W;  4DRA A;  3LZ1 B;  1P3K A;  4J8X A;  1P3F D;  1S32 A;  3H0M C;  4J8V B;  3AYW C;  3AZE B;  3VH5 T;  2RVQ D;  5GXQ B;  5B2I A;  3REI A;  5B32 A;  3V9R A;  5CPI D;  3MNN C;  3AYW B;  4WU8 D;  1TAF A;  1P3P B;  2PYO A;  3AL0 C;  2NZD A;  4XZQ A;  3W97 D;  3TU4 A;  3KWQ A;  1JFI A;  3A6N B;  4KUD B;  3X1V A;  2Y2N A;  1ZLA D;  3MNN B;  5AY8 C;  3UT9 C;  3WKJ C;  1EQZ A;  5B1M A;  3AZM A;  5CPJ A;  2NQB B;  1KX3 C;  4HGA C;  5AY8 B;  3B6F A;  5E5A D;  1B67 A;  3AN2 A;  3B6G D;  4WU9 D;  4YS3 A;  3WTP B;  1Q9C A;  4XUJ D;  4R8P A;  5GT3 A;  4HGA B;  5AV8 A;  5B33 D;  4LD9 A;  1TZY A;  4CSR A;  5BS7 C;  3LJA A;  3AZI D;  1N1J B;  2Y2K A;  1F66 D;  4Z66 B;  4NE6 A;  1P3A A;  5AV6 C;  4ZUX C;  4X23 A;  2HIO B;  3A1K A;  2XD1 A;  1U35 A;  5F99 D;  3W99 B;  5B2J B;  2CV5 A;  2BYM A;  3LZ0 D;  2F8N B;  5BO0 A;  3C1B D;  1P3M B;  3UTB C;  1KU5 A;  5BNX B;  4ZUX B;  5B0Z C;  1M1A C;  4QLC A;  4NE5 A;  2ARO D;  4H9P B;  3EPJ A;  1M18 C;  1AOI C;  4DQY B;  1KX4 D;  4UUZ A;  3UTB B;  1A7W A;  1M1A B;  3AZF A;  1P3B D;  3WA9 C;  5DNN C;  5JRG B;  3X1U D;  3B0C W;  1P3K C;  3LZ1 D;  4J8X C;  1KX4 C;  1S32 C;  4J8V D;  3WA9 B;  5DNN B;  3AZE D;  1ID3 B;  4E45 A;  2L5A A;  3B0C T;  1HTA A;  3WAA A;  4H9R B;  4J8X B;  5GXQ D;  1P3L A;  1KX4 B;  5B32 C;  1S32 B;  2NZD C;  3AYW D;  2PYO C;  1P3P D;  4XZQ C;  5GT0 C;  4JJN A;  3TU4 C;  3AZK A;  5B0Y A;  3REJ A;  4E44 A;  4KUD D;  3A6N D;  5JA4 A;  3X1V C;  5B1L B;  5B40 C;  4J8U C;  3MNN D;  2PYO B;  1EQZ C;  4KHA A;  3AV2 A;  5CPK B;  5GT0 B;  3TU4 B;  3NQJ B;  2Y2J A;  3AZM C;  3KUY C;  1HQ3 B;  3X1V B;  3NQU A;  2NQB D;  5B40 B;  2ZY3 A;  3LEL A;  4J8U B;  2LY8 A;  3B6F C;  5AY8 D;  1EQZ B;  3AN2 C;  4H9Q A;  2BYK A;  4YS3 C;  3EPL A;  3AZM B;  3KUY B;  3WTP D;  3REL A;  3MGQ C;  4KGC A;  4ZBJ C;  5AV8 C;  1TZY C;  3R45 A;  5AVB C;  5B24 C;  1P3I A;  1W2E A;  3MGQ B;  3MGR C;  3AZG A;  4ZBJ B;  3EPK A;  2HUE C;  1P3A C;  4Z66 D;  5AVB B;  2YFW B;  3X1T D;  3AV1 C;  4CSR B;  5B24 B;  2Y2Q A;  4X23 C;  3MGS C;  1U35 C;  3W98 B;  1F1E A;  2HIO D;  3EPH A;  2JSS A;  3MGR B;  3AZN B;  3AZJ A;  1R4V A;  3W99 D;  5B2J D;  5G49 A;  2F8N D;  3X1S A;  3AV1 B;  1P3M D;  2CWE A;  2Y2L A;  5DNM A;  4ZUX D;  3MGS B;  3REH A;  4QLC C;  3W96 A;  5BNV B;  5CP6 A;  1P3G C;  2YFV A;  3UTB D;  1M1A D;  4QLC B;  5AVC A;  3AZF C;  3AFA A;  5B32 G;  5JRG D;  1P3G B;  3KXB C;  3AZH C;  3AZF B;  3WA9 D;  5DNN D;  4NE3 A;  3REK A;  1ID3 D;  3MGP A;  4NFT A;  4J8X D;  1P3L C;  3KXB B;  1P34 A;  3AZH B;  1S32 D; 
#chains in the Genus database with same CATH homology
 3O62 C;  3C1C C;  2Y2I A;  4Z5T A;  4JJN C;  3AZK C;  5B0Y C;  4WJ3 C;  1P3L B;  5B1L D;  1ULY A;  5AV9 A;  2J8P A;  3O62 B;  3C1C B;  2PYO D;  3AV2 C;  3UTA A;  4CAY A;  5GT0 D;  5CPK D;  3AZK B;  5KDM A;  4J8W C;  4H9S C;  1HQ3 D;  3X1V D;  5B40 D;  4J8U D;  1Z2C B;  4KHA B;  4J8W B;  3UT9 B;  3WKJ B;  3VH6 W;  5GSU A;  3AZM D;  5C3I C;  3KUY D;  5CHL B;  1M19 C;  4KGC C;  1WWS A;  5CPI A;  4H9N B;  4H9Q B;  3W97 A;  3AZL C;  1BH8 A;  1KX3 B;  4DRB A;  2FJ7 A;  4H9O A;  1P3I C;  2FFF B;  4AWL C;  5C3I B;  3AZG C;  1M19 B;  3MGQ D;  1ZLA A;  3AZL B;  3R45 B;  5AVB D;  5B24 D;  3W98 D;  4AWL B;  2F2A C;  3MGR D;  1H3O B;  3AZN D;  5E5A A;  2VQR A;  3B6G A;  3X1S C;  4WU9 A;  2JE5 A;  5B31 G;  5DNM C;  3AV1 D;  3MGS D;  1T3U A;  5AV6 B;  4WZS B;  1P3O C;  3W96 C;  4XUJ A;  4YM6 C;  5B33 A;  4EO5 C;  2BG1 A;  5DNM B;  1KX5 A;  4QLC D;  1P3O B;  4YM6 B;  3AZI A;  5B0Z B;  1F66 A;  4EO5 B;  1P3G D;  5FUG A;  5AV5 C;  5B31 A;  1M18 B;  1AOI B;  3AZF D;  3REK C;  5F99 A;  3MGP C;  3LZ0 A;  3C1B A;  5AV5 B;  1P34 C;  3KXB D;  3AZH D;  2ARO A;  2RIQ A;  1P3K B;  5B2I C;  3REI C;  4Z5T C;  2DQN C;  1P3L D;  1P3B A;  2IO5 C;  3O62 D;  3KWQ C;  3C1C D;  5B2I B;  3REI B;  5B32 B;  3UTA C;  3V9R B;  3X1U A;  2NZD B;  1TAF B;  3LZ1 A;  4XZQ B;  3FDD A;  2Y2G A;  5B1M C;  4J8V A;  3KWQ B;  5CPJ C;  3AZE A;  1JFI B;  3IP4 C;  4J8W D;  2RVQ C;  5GSU C;  3UT9 D;  3WKJ D;  5GXQ A;  5B1M B;  5CPI C;  3AYW A;  5CPJ B;  1P3P A;  4R8P C;  5GT3 C;  3F6T A;  1KX3 D;  2FJ7 C;  5GSU B;  3B6F B;  3AN2 B;  4KUD A;  3A6N A;  3VH5 A;  4LD9 C;  1M19 D;  4YS3 B;  3MNN A;  3AZL D;  1BH8 B;  4R8P B;  3LJA C;  5GT3 B;  2FJ7 B;  5AV8 B;  4LD9 B;  1TZY B;  2NQB A;  5AY8 A;  5E5A C;  3MVD A;  4G92 C;  3LJA B;  4WU9 C;  4WV4 B;  2HUE B;  2CV5 C;  1P3A B;  3WTP A;  5AV6 D;  2F8N K;  4X23 B;  1U35 B;  4G92 B;  1KX5 C;  2CV5 B;  2BYM B;  5BO0 B;  3AZI C;  1P3O D;  4YM6 D;  1WWI A;  5B0Z D;  4Z66 A;  3X1T A;  3KSY A;  5B31 C;  1KX5 B;  1M18 D;  1AOI D;  2HIO A;  5BS7 A;  4UUZ B;  3W99 A;  5B2J A;  2F8N A;  4M6B A;  3C1B C;  1P3M A;  5B31 B;  5AV5 D;  4ZUX A;  3WAA C;  2ARO C;  4H9P A;  1P3K D;  2ZY2 A;  2G5I C;  3UTB A;  1M1A A;  3WAA B;  3REJ C;  5B2I D;  3REI D;  3B0D C;  5B32 D;  5JRG A;  2NZD D;  3LZ1 C;  4XZQ D;  4JJN B;  3TU4 D;  5B0Y B;  3REJ B;  3KWQ D;  5DNN A;  3AZE C;  1P3F A;  1ID3 A;  5JA4 B;  3B0D B;  3LEL C;  2Y2M A;  4H9R A;  5GXQ C;  3AV2 B;  1EQZ D;  3EG5 B;  1KX4 A;  1BFM A;  5B1M D;  1P3P C;  5CPJ D;  3REL C;  3NQU B;  2Y2H A;  3LEL B;  4WU8 A;  3B6F D;  5GSU D;  3AN2 D;  4KUD C;  2DF4 C;  2BYK B;  3A6N C;  5B1L A;  3VH6 T;  4YS3 D;  3REL B;  5CPK A;  5GT0 A;  4R8P D;  5BT1 C;  4KGC B;  3NQJ A;  5GT3 D;  2FJ7 D;  5AV8 D;  1HQ3 A;  4LD9 D;  1TZY D;  2NQB C;  5B40 A;  4J8U A;  1P3I B;  3MVD C;  1BH9 A;  3AZG B;  3LJA D;  3AZJ C;  4WNN A;  3KUY A;  1PZR A;  3WTP C;  1P3A D;  3MVD B;  3REH C;  4X23 D;  1U35 D;  3AZJ B;  2G5H C;  2CV5 D;  2ZY4 A;  5G49 B;  3X1S B;  5CP6 C;  3MGQ A;  3REH B;  5AVC C;  2JCH A;  4Z66 C;  5AVB A;  3W96 B;  2YFW A;  3AFA C;  3X1T C;  1KX5 D;  5B24 A;  3W98 A;  2HIO C;  5CP6 B;  3MGR A;  3AZN A;  2YFV B;  3H0L C;  3W99 C;  5B2J C;  5AVC B;  3AFA B;  3X1T B;  3AV1 A;  1P3M C;  5B31 D;  3MGS A;  5BNV A;  3REK B;  3MGP B;  3WAA D;  3H0R C;  3B0B A;  1P34 B;  5JRG C;  5AV9 C;  1P3G A;  4Z5T B;  4JJN D;  3AZK D;  5B0Y D;  4Z2M G;  3REJ D;  1P3F C;  1ID3 C;  3A1I A;  5AV9 B;  2IO5 B;  3KFU G;  3AV2 D;  3UTA B;  4CAY B;  3KXB A;  2ZM5 A;  3WTP E;  3AZH A;  5KDM B;  1P3F B;  3LEL D;  4WU8 C;  3W97 C;  5B1L C;  3O62 A;  3C1C A;  2ZY5 A;  3REL D;  5CPK C;  1ZLA C;  4KGC D;  5CPI B;  4WU8 B;  4Z2M H;  1HQ3 C;  3W97 B;  2W8S A;  4H9O B;  1P3I D;  2Y2O A;  3AZG D;  1ZLA B;  5BT1 D;  4J8W A;  3UT9 A;  3WKJ A;  3B6G C;  4H9S A;  3P5J B;  3MVD D;  1BH9 B;  1B6W A;  4H9N A;  4XUJ C;  3AZJ D;  1KX3 A;  5E5A B;  4WNN B;  2F8N G;  3B6G B;  5B33 C;  4WU9 B;  3X1S D;  1M19 A;  5DNM D;  3REH D;  3AZL A;  4XUJ B;  3W96 D;  1N1J A;  1F66 C;  3W98 C;  5B33 B;  5CP6 D;  3AZN C;  1H3O A;  3VH6 A;  5AVC D;  3AZI B;  3AFA D;  5F99 C;  1F66 B;  3LZ0 C;  4G91 C;  5AV6 A;  4UPK A;  5FUG B;  5BNX A;  2XD5 A;  2F8N H;  2Y2P A;  5F99 B;  3REK D;  3MGP D;  3LZ0 B;  4G91 B;  3C1B B;  4YM6 A;  1P3O A;  5B0Z A;  1P34 D;  2ARO B;  1P3B C;  1M18 A;  4Z5T D;  1AOI A;  3X1U C;  2UWX A;  5AV9 D;  4J8V C;  1P3B B;  3WA9 A;  5AV5 A;  3UTA D;  3X1U B;  3VH5 W;  4DRA A;  3LZ1 B;  1P3K A;  4J8X A;  1P3F D;  1S32 A;  3H0M C;  4J8V B;  3AYW C;  3AZE B;  3VH5 T;  2RVQ D;  5GXQ B;  5B2I A;  3REI A;  5B32 A;  3V9R A;  5CPI D;  3MNN C;  3AYW B;  4WU8 D;  1TAF A;  1P3P B;  2PYO A;  3AL0 C;  2NZD A;  4XZQ A;  3W97 D;  3TU4 A;  3KWQ A;  1JFI A;  3A6N B;  4KUD B;  3X1V A;  2Y2N A;  1ZLA D;  3MNN B;  5AY8 C;  3UT9 C;  3WKJ C;  1EQZ A;  5B1M A;  3AZM A;  5CPJ A;  2NQB B;  1KX3 C;  4HGA C;  5AY8 B;  3B6F A;  5E5A D;  1B67 A;  3AN2 A;  3B6G D;  4WU9 D;  4YS3 A;  3WTP B;  1Q9C A;  4XUJ D;  4R8P A;  5GT3 A;  4HGA B;  5AV8 A;  5B33 D;  4LD9 A;  1TZY A;  4CSR A;  5BS7 C;  3LJA A;  3AZI D;  1N1J B;  2Y2K A;  1F66 D;  4Z66 B;  4NE6 A;  1P3A A;  5AV6 C;  4ZUX C;  4X23 A;  2HIO B;  3A1K A;  2XD1 A;  1U35 A;  5F99 D;  3W99 B;  5B2J B;  2CV5 A;  2BYM A;  3LZ0 D;  2F8N B;  5BO0 A;  3C1B D;  1P3M B;  3UTB C;  1KU5 A;  5BNX B;  4ZUX B;  5B0Z C;  1M1A C;  4QLC A;  4NE5 A;  2ARO D;  4H9P B;  3EPJ A;  1M18 C;  1AOI C;  4DQY B;  1KX4 D;  4UUZ A;  3UTB B;  1A7W A;  1M1A B;  3AZF A;  1P3B D;  3WA9 C;  5DNN C;  5JRG B;  3X1U D;  3B0C W;  1P3K C;  3LZ1 D;  4J8X C;  1KX4 C;  1S32 C;  4J8V D;  3WA9 B;  5DNN B;  3AZE D;  1ID3 B;  4E45 A;  2L5A A;  3B0C T;  1HTA A;  3WAA A;  4H9R B;  4J8X B;  5GXQ D;  1P3L A;  1KX4 B;  5B32 C;  1S32 B;  2NZD C;  3AYW D;  2PYO C;  1P3P D;  4XZQ C;  5GT0 C;  4JJN A;  3TU4 C;  3AZK A;  5B0Y A;  3REJ A;  4E44 A;  4KUD D;  3A6N D;  5JA4 A;  3X1V C;  5B1L B;  5B40 C;  4J8U C;  3MNN D;  2PYO B;  1EQZ C;  4KHA A;  3AV2 A;  5CPK B;  5GT0 B;  3TU4 B;  3NQJ B;  2Y2J A;  3AZM C;  3KUY C;  1HQ3 B;  3X1V B;  3NQU A;  2NQB D;  5B40 B;  2ZY3 A;  3LEL A;  4J8U B;  2LY8 A;  3B6F C;  5AY8 D;  1EQZ B;  3AN2 C;  4H9Q A;  2BYK A;  4YS3 C;  3EPL A;  3AZM B;  3KUY B;  3WTP D;  3REL A;  3MGQ C;  4KGC A;  4ZBJ C;  5AV8 C;  1TZY C;  3R45 A;  5AVB C;  5B24 C;  1P3I A;  1W2E A;  3MGQ B;  3MGR C;  3AZG A;  4ZBJ B;  3EPK A;  2HUE C;  1P3A C;  4Z66 D;  5AVB B;  2YFW B;  3X1T D;  3AV1 C;  4CSR B;  5B24 B;  2Y2Q A;  4X23 C;  3MGS C;  1U35 C;  3W98 B;  1F1E A;  2HIO D;  3EPH A;  2JSS A;  3MGR B;  3AZN B;  3AZJ A;  1R4V A;  3W99 D;  5B2J D;  5G49 A;  2F8N D;  3X1S A;  3AV1 B;  1P3M D;  2CWE A;  2Y2L A;  5DNM A;  4ZUX D;  3MGS B;  3REH A;  4QLC C;  3W96 A;  5BNV B;  5CP6 A;  1P3G C;  2YFV A;  3UTB D;  1M1A D;  4QLC B;  5AVC A;  3AZF C;  3AFA A;  5B32 G;  5JRG D;  1P3G B;  3KXB C;  3AZH C;  3AZF B;  3WA9 D;  5DNN D;  4NE3 A;  3REK A;  1ID3 D;  3MGP A;  4NFT A;  4J8X D;  1P3L C;  3KXB B;  1P34 A;  3AZH B;  1S32 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...