4G92C

Ccaat-binding complex from aspergillus nidulans with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
b'GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription/dna
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g92C00
5B1LB 3AZMB 3MNNB 5CP6D 5BO0B 1P3FD 4Z2MH 1P3GD 1P3KB 5FUGB 1KX3B 2F8NK 3AZED 4H9SA 1M1AB 1P3KC 3WAAA 4YS3A 5E5AC 1P3AA 3WA9C 5BS7C 3REJC 2YFVB 5AVBB 1M1AC 2CV5A 1P3PB 3MGPA 3AZFA 1N1JA 5JA4B 1P3LA 2NZDB 1P3KD 5B0ZB 5E5AD 4AWLC 4ZUXA 3WA9D 5AVBC 3AN2A 5B31A 3TU4B 1M18A 3REJD 1P3PC 4KHAA 2NZDC 2F8NH 1F1EA 3UT9C 4QLCA 3TU4C 1Q9CA 3B6FC 5AVBD 3AZIB 4NE3A 1P3PD 2IO5B 3R45B 3X1UB 1HQ3B 4J8WA 2NZDD 1KX4A 5CPKB 1TZYC 4R8PA 3X1VA 5CPJA 3UT9D 3WTPA 3C1BB 3AZIC 1ID3B 3TU4D 3X1UC 1F66B 3B6FD 3O62A 2HIOB 3B0CT 4UUZB 4Z5TA 5CPKC 4XUJA 4KUDB 3AZHC 1TZYD 5AVCB 3VH5T 3UTAA 1BFMA 4NE5A 3KWQB 3RELA 1EQZB 4JJNA 3AZID 3AV1C 2HIOC 3MVDC 5BNVA 2AROA 3X1UD 1S32B 4WU9C 5CPKD 5AVCC 3AZHD 4G92C 1BH9B 1S32C 3AV1D 2CWEA 1P3OA 3MVDD 4WU9D 3MGQB 4DRAA 2NQBB 1KX5A 1HTAA 3WTPE 3LELA 3AV2A 3AZNB 3KXBD 5B33B 1S32D 3C1CC 5B1MB 4H9QA 3MGQC 4HGAC 1P34A 3AFAB 3KSYA 3W99A 5AV5C 3MGSB 4H9RA 5B1MC 5F99C 5GT3A 5B0YB 3C1CD 4J8XA 3MGQD 2F8NB 3AFAC 4H9NA 3VH6A 3X1SA 5B32A 4J8UA 5DNNB 5AV5D 5B0YC 5B1MD 5F99D 3V9RB 4KGCC 3AFAD 5B2JA 1H3OA 5DNMC 3NQUB 3AZGC 4X23B 4J8VA 2PYOA 1P3MB 3REKD 3LZ1C 4KGCD 4LD9A 1M19C 5B24B 3B6GA 5CP6B 5DNMD 3AZGD 3X1TC 3REIC 2BYKB 1P3FB 3KUYC 5CPIA 3LZ1D 3AZLC 1ZLAA 1P3GB 5KDMB 1M19D 3LJAD 1TAFA 1A7WA 3X1TD 3B0CW 3REID 3AZEB 5B2IC 5GT0A 3KUYD 5B1LA 4H9PB 3VH5W 5G49B 3W96C 3MNNA 3MGRC 3AZLD 3AZMA 4WU8C 1P3BC 5BO0A 3VH6T 3AZEC 5JRGC 5B2ID 5AV6C 3MGRD 5E5AB 1KX3A 4Z66D 3W96D 4WU8D 3AZJC 1P3BD 3WA9B 3W97B 3REJB 1U35B 4WV4B 1M1AA 5JRGD 5AV6D 4YM6B 2L5AA 2YFVA 4AWLB 5AY8B 3W97C 1U35C 3AZJD 3B0BA 5AV8C 3W98A 5JA4A 2NZDA 4XZQA 5B0ZA 4YM6C 5AY8C 3UT9B 3TU4A 4H9OB 3W97D 1U35D 3B6FB 5AV8D 5B40D 4YM6D 1TZYB 5AY8D 4YS3B 1HQ3A 5CPKA 4G91C 5AV9B 4H9SC 5BNXB 1AOIB 3C1BA 3LZ0B 3WAAC 3AZHB 4YS3C 1ID3A 1F66A 1P3AC 2HIOA 3AV1B 4UUZA 4NFTA 5AV9C 3MVDB 4KUDA 3B0DC 1AOIC 4WU9B 5AVCA 2CV5C 3LZ0C 3MGPC 3KWQA 1EQZA 3WAAD 4YS3D 4G92B 4ZUXC 1P3AD 3KXBB 3AN2C 5B31C 1M18C 1KU5A 5AV9D 1AOID 2CV5D 3LZ0D 3MGPD 1BH9A 5B31G 3KXBC 4QLCC 4ZUXD 3AYWA 3MGQA 3C1CB 3AN2D 3NQJA 5B31D 3AZKB 1M18D 2NQBA 2RVQC 4HGAB 2HUEB 4E45A 1KX4C 3X1VC 3AZNA 5CPJC 2FJ7B 5B33A 5B1MA 5AV5B 3WTPC 4QLCD 5F99B 3AZKC 4CSRB 2HUEC 3O62C 3AFAA 4JJNB 4Z5TC 2RVQD 4XUJC 2FJ7C 3MGSA 1KX4D 3UTAC 5CPJD 3X1VD 5B0YA 3WTPD 2F8NA 1BH8A 4JJNC 3AZKD 3REKB 2AROC 1P3IB 3O62D 4KGCB 5DNNA 4Z5TD 4XUJD 2FJ7D 5CHLB 3UTAD 5DNMB 3AZGB 3V9RA 3REKC 1P3IC 3A6NA 4JJND 1P3OC 2AROD 3LZ1B 3NQUA 1M19B 4CAYB 4X23A 3LJAB 1KX5C 3LELC 1P3MA 3AV2C 3X1TB 3REIB 1P3ID 5B24A 1P3OD 2BYMB 3KUYB 1P34C 5CP6A 3AZLB 3LJAC 3UTBB 1KX5D 2BYKA 3LELD 1P3FA 3AV2D 5B2IB 1P3GA 5KDMA 4J8XC 3MGRB 3UTBC 3W96B 1P34D 4Z66B 3X1SC 4EO5C 4WU8B 4J8UC 1P3BB 3AZEA 3W99D 4WNNB 4H9PA 5G49A 5JRGB 5B32G 4Z66C 4J8XD 5AV6B 5B2JC 3UTBD 3WKJB 3X1SD 4J8UD 3AZJB 5GXQB 4J8VC 1P3KA 2PYOC 5E5AA 5FUGA 3REHB 3WKJC 1JFIB 3WA9A 2LY8A 4LD9C 5CPIB 3W97A 5BS7A 5GSUB 5B2JD 3REJA 1U35A 4ZBJB 3B6GC 5GXQC 5AV8B 5B40B 5C3IB 3REHC 4YM6A 4J8VD 2PYOD 2YFWB 5CPIC 4M6BA 5GSUC 3WKJD 1ZLAC 4ZBJC 5AVBA 4LD9D 1P3PA 5B40C 5C3IC 3B6GD 5GXQD 3REHD 3UT9A 5GT0C 4H9OA 5B1LC 5CPID 3AZMC 5GSUD 3MNNC 1ZLAD 3B6FA 1TZYA 3VH5A 4G91B 5GT0D 3AZIA 3WAAB 5B1LD 3AZMD 3MNND 1KX3C 3R45A 3X1UA 1P3AB 5AV9A 5BNXA 1AOIA 3B0DB 3LZ0A 3AZHA 3W98B 2CV5B 3MGPB 3AZFB 1N1JB 1P3LB 4XZQB 3AV1A 1WWSA 3MVDA 1KX3D 4ZUXB 4WU9A 2JSSA 3AN2B 5B31B 3W98C 1M18B 3AZFC 1M1AD 1P3LC 4KHAB 4XZQC 5B0ZC 4NE6A 3KXBA 1S32A 4QLCB 1B6WA 3W98D 4J8WB 3AZFD 1P3LD 4XZQD 1KX4B 5B0ZD 4R8PB 3X1VB 5CPJB 3C1CA 4E44A 3WTPB 3AZKA 2IO5C 1HQ3C 4J8WC 3O62B 2FJ7A 4Z5TB 4R8PC 4XUJB 3VH6W 5AV5A 3C1BC 1ID3C 5F99A 3UTAB 1R4VA 4CSRA 1F66C 3RELB 4WZSB 1HQ3D 4KUDC 5BNVB 2AROB 4J8WD 4R8PD 3KWQC 1EQZC 3C1BD 3RELC 1ID3D 3REKA 1P3IA 1F66D 4KGCA 2HIOD 3AYWB 1P3OB 4KUDD 3NQJB 5AVCD 5DNMA 3AZGA 3KWQD 4Z2MG 1EQZD 3RELD 1KX5B 3LELB 3AV2B 3AYWC 3LZ1A 1M19A 4CAYA 4H9QB 2NQBC 3LJAA 1P34B 3X1TA 3AZNC 3REIA 3W99B 5B33C 4H9RB 2BYMA 3KUYA 3AYWD 3AZLA 5GT3B 4DRBA 1BH8B 4J8XB 3UTBA 2NQBD 1WWIA 5BT1C 4H9NB 3W99C 3X1SB 3MGSC 4EO5B 5B32B 4J8UB 3AZND 5B2IA 5B33D 5GT3C 1B67A 3MGRA 3W96A 4Z66A 3A6NB 4WU8A 1P3BA 5DNNC 5B32C 5BT1D 5B2JB 2F8NG 1H3OB 3MGSD 4WNNA 1ULYA 5JRGA 5B0YD 5GT3D 5AV6A 4J8VB 3A6NC 2F8ND 2PYOB 3WKJA 3AZJA 4LD9B 5DNND 5B32D 5GXQA 4X23C 3B6GB 1P3MC 3REHA 1JFIA 5B24C 3A6ND 5GSUA 5CP6C 1ZLAB 5AV8A 5B40A 4X23D 1TAFB 1P3FC 1P3MD 2YFWA 5AY8A 1P3GC 5B24D 5GT0B
chains in the Genus database with same CATH superfamily
5B1LB 3AZMB 3MNNB 5CP6D 5BO0B 2Y2NA 1P3FD 4Z2MH 1P3GD 1P3KB 5FUGB 1KX3B 2F8NK 3AZED 4H9SA 1M1AB 3H0LC 1P3KC 3WAAA 4YS3A 5E5AC 2ZY5A 1P3AA 3WA9C 5BS7C 3REJC 2YFVB 5AVBB 1M1AC 2CV5A 1P3PB 2Y2LA 3MGPA 1N1JA 5JA4B 3AZFA 1P3LA 2NZDB 1P3KD 5B0ZB 5E5AD 4AWLC 4ZUXA 3WA9D 5AVBC 2UWXA 3AN2A 5B31A 3TU4B 1M18A 3REJD 1P3PC 4KHAA 3EPKA 2NZDC 2F8NH 1F1EA 3UT9C 4QLCA 3TU4C 2ZY2A 1Q9CA 3B6FC 5AVBD 3AZIB 4NE3A 1P3PD 2IO5B 3R45B 3X1UB 1HQ3B 4J8WA 2NZDD 1KX4A 5CPKB 1TZYC 4R8PA 3X1VA 5CPJA 3UT9D 3WTPA 3C1BB 3AZIC 1ID3B 3TU4D 3X1UC 1F66B 3H0RC 3O62A 3B6FD 2HIOB 3B0CT 4UUZB 4Z5TA 5CPKC 4XUJA 4KUDB 3AZHC 1TZYD 5AVCB 3VH5T 3UTAA 1BFMA 4NE5A 3KWQB 3RELA 1EQZB 4JJNA 3AZID 3AV1C 2HIOC 3MVDC 5BNVA 2AROA 3X1UD 1S32B 4WU9C 5CPKD 5AVCC 3AZHD 4G92C 1BH9B 1S32C 3EPJA 3AV1D 2CWEA 1P3OA 3MVDD 4WU9D 2Y2GA 4DRAA 3MGQB 2Y2OA 2NQBB 1KX5A 1HTAA 3WTPE 3LELA 3AV2A 3AZNB 3KXBD 5B33B 1S32D 3C1CC 5B1MB 4H9QA 2Y2KA 3MGQC 4HGAC 1P34A 2Y2IA 3AFAB 3KSYA 3W99A 5AV5C 3MGSB 4H9RA 5B1MC 5F99C 5GT3A 5B0YB 2VQRA 3C1CD 4J8XA 3MGQD 2F8NB 3AFAC 2ZY3A 4H9NA 3VH6A 3X1SA 5B32A 4J8UA 3IP4C 5DNNB 2JE5A 1PZRA 5AV5D 5B0YC 5B1MD 5F99D 3V9RB 4KGCC 3AFAD 5B2JA 1H3OA 5DNMC 1W2EA 3NQUB 3AZGC 4X23B 4J8VA 2PYOA 1P3MB 3REKD 2Y2HA 3LZ1C 4KGCD 4LD9A 1M19C 5B24B 3B6GA 5CP6B 5DNMD 3AZGD 3X1TC 3REIC 2BYKB 2RIQA 1P3FB 3KUYC 5CPIA 3LZ1D 3AZLC 1ZLAA 1P3GB 5KDMB 1M19D 3LJAD 1TAFA 1A7WA 3X1TD 3B0CW 3REID 3AZEB 5B2IC 5GT0A 3KUYD 5B1LA 4H9PB 3VH5W 5G49B 3W96C 3MNNA 3MGRC 3AZLD 3AZMA 4WU8C 1P3BC 5BO0A 3VH6T 3AZEC 5JRGC 5B2ID 5AV6C 3MGRD 5E5AB 1KX3A 4Z66D 3W96D 4WU8D 3AZJC 1P3BD 3WA9B 3W97B 3REJB 1U35B 4WV4B 1M1AA 5JRGD 5AV6D 4YM6B 2L5AA 2Y2PA 2YFVA 4AWLB 5AY8B 3W97C 1U35C 3AZJD 3B0BA 5AV8C 3W98A 5JA4A 2NZDA 4XZQA 5B0ZA 4YM6C 5AY8C 3AL0C 3UT9B 3TU4A 2XD1A 4H9OB 3W97D 1U35D 3B6FB 5AV8D 5B40D 2Y2JA 4YM6D 1TZYB 5AY8D 4YS3B 1HQ3A 5CPKA 4G91C 5AV9B 4H9SC 5BNXB 1AOIB 3C1BA 3LZ0B 3WAAC 3AZHB 4YS3C 1ID3A 1F66A 1P3AC 2HIOA 3AV1B 4UUZA 4NFTA 5AV9C 3MVDB 4KUDA 3B0DC 1AOIC 4WU9B 5AVCA 2CV5C 3LZ0C 3MGPC 3KWQA 2FFFB 1EQZA 3WAAD 4YS3D 4G92B 4ZUXC 1P3AD 3KXBB 3AN2C 5B31C 1M18C 1KU5A 5AV9D 1AOID 2CV5D 3LZ0D 3MGPD 1BH9A 5B31G 3KXBC 4QLCC 4ZUXD 3AYWA 3MGQA 3C1CB 3AN2D 3NQJA 5B31D 3AZKB 1M18D 2NQBA 2RVQC 4HGAB 2HUEB 4E45A 1KX4C 3KFUG 3X1VC 3AZNA 5CPJC 2FJ7B 5B33A 5B1MA 5AV5B 3WTPC 4QLCD 5F99B 3AZKC 4CSRB 2HUEC 3O62C 3AFAA 4JJNB 4Z5TC 2RVQD 2G5IC 4XUJC 2FJ7C 3MGSA 1KX4D 2DQNC 3UTAC 5CPJD 2BG1A 3X1VD 5B0YA 3WTPD 2F8NA 1BH8A 4JJNC 3AZKD 3REKB 2AROC 1P3IB 3O62D 4KGCB 5DNNA 4Z5TD 4XUJD 2FJ7D 5CHLB 3UTAD 5DNMB 3AZGB 3V9RA 3REKC 1P3IC 2W8SA 3A6NA 4JJND 2Y2QA 1P3OC 2AROD 3LZ1B 3NQUA 2G5HC 1M19B 4CAYB 3F6TA 4X23A 3LJAB 1KX5C 3LELC 1P3MA 3AV2C 3X1TB 3REIB 1P3ID 5B24A 1P3OD 2BYMB 3KUYB 1P34C 5CP6A 3H0MC 3AZLB 3LJAC 3UTBB 3EPLA 1KX5D 2BYKA 3LELD 1P3FA 3AV2D 5B2IB 1P3GA 5KDMA 4J8XC 3MGRB 3UTBC 3W96B 1P34D 4Z66B 3X1SC 4EO5C 4WU8B 4J8UC 1P3BB 3FDDA 3AZEA 3W99D 4WNNB 4H9PA 5G49A 5JRGB 5B32G 4Z66C 4J8XD 5AV6B 5B2JC 3UTBD 3WKJB 3X1SD 4J8UD 3AZJB 5GXQB 4J8VC 1P3KA 2PYOC 5E5AA 5FUGA 3REHB 3WKJC 1JFIB 3WA9A 2LY8A 4LD9C 5CPIB 3W97A 5BS7A 5GSUB 5B2JD 3REJA 1U35A 4ZBJB 3B6GC 2ZY4A 5GXQC 5AV8B 5B40B 5C3IB 3REHC 4YM6A 4J8VD 2PYOD 2YFWB 5CPIC 4M6BA 5GSUC 3WKJD 1ZLAC 4ZBJC 5AVBA 4LD9D 1P3PA 5B40C 5C3IC 3B6GD 5GXQD 3REHD 3UT9A 5GT0C 4H9OA 5B1LC 5CPID 3AZMC 5GSUD 3MNNC 1ZLAD 3B6FA 1TZYA 3VH5A 4UPKA 4G91B 5GT0D 3AZIA 3WAAB 5B1LD 3AZMD 3MNND 1KX3C 3R45A 3X1UA 1P3AB 5AV9A 4WJ3C 5BNXA 1AOIA 3B0DB 3LZ0A 3AZHA 3W98B 2CV5B 3MGPB 3AZFB 1N1JB 1P3LB 4XZQB 3AV1A 1WWSA 3MVDA 1KX3D 4ZUXB 4WU9A 2JSSA 3AN2B 5B31B 3W98C 1M18B 3AZFC 1M1AD 1P3LC 4KHAB 4XZQC 5B0ZC 4NE6A 3KXBA 1S32A 4QLCB 1B6WA 2Y2MA 2F2AC 3W98D 4J8WB 3AZFD 1P3LD 4XZQD 1KX4B 5B0ZD 4R8PB 3X1VB 5CPJB 3C1CA 4E44A 3WTPB 3AZKA 2IO5C 1HQ3C 4J8WC 3O62B 2FJ7A 4Z5TB 4R8PC 4XUJB 3VH6W 5AV5A 3C1BC 1ID3C 5F99A 3UTAB 1R4VA 4CSRA 1F66C 3RELB 2XD5A 4WZSB 1HQ3D 4KUDC 5BNVB 2AROB 4J8WD 4DQYB 4R8PD 3KWQC 1EQZC 3C1BD 3RELC 1ID3D 3REKA 1P3IA 1F66D 4KGCA 2HIOD 3AYWB 1P3OB 4KUDD 1Z2CB 3NQJB 5AVCD 5DNMA 3AZGA 3KWQD 4Z2MG 1EQZD 3RELD 1KX5B 3LELB 3AV2B 3AYWC 3LZ1A 1M19A 4CAYA 4H9QB 2NQBC 1T3UA 3LJAA 1P34B 3X1TA 3AZNC 3REIA 3W99B 5B33C 4H9RB 2ZM5A 2BYMA 3KUYA 3AYWD 3AZLA 5GT3B 4DRBA 1BH8B 2J8PA 4J8XB 3UTBA 2NQBD 1WWIA 5BT1C 4H9NB 3W99C 3A1KA 3X1SB 3MGSC 4EO5B 5B32B 2JCHA 4J8UB 3AZND 5B2IA 5B33D 5GT3C 1B67A 3MGRA 3W96A 4Z66A 3A6NB 4WU8A 1P3BA 5DNNC 5B32C 5BT1D 5B2JB 2DF4C 2F8NG 1H3OB 3MGSD 3P5JB 4WNNA 1ULYA 5JRGA 5B0YD 5GT3D 5AV6A 4J8VB 3A6NC 2F8ND 2PYOB 3EPHA 3WKJA 3AZJA 4LD9B 5DNND 5B32D 5GXQA 4X23C 3B6GB 1P3MC 3REHA 3A1IA 1JFIA 5B24C 3A6ND 5GSUA 5CP6C 1ZLAB 5AV8A 5B40A 3EG5B 4X23D 1TAFB 1P3FC 1P3MD 2YFWA 5AY8A 1P3GC 5B24D 5GT0B
chains in the Genus database with same CATH topology
5B1LB 3AZMB 3MNNB 5CP6D 5BO0B 2Y2NA 1P3FD 4Z2MH 1P3GD 1P3KB 5FUGB 1KX3B 2F8NK 3AZED 4H9SA 1M1AB 3H0LC 1P3KC 3WAAA 4YS3A 5E5AC 2ZY5A 1P3AA 3WA9C 5BS7C 3REJC 2YFVB 5AVBB 1M1AC 2CV5A 1P3PB 2Y2LA 3MGPA 1N1JA 5JA4B 3AZFA 1P3LA 2NZDB 1P3KD 5B0ZB 5E5AD 4AWLC 4ZUXA 3WA9D 5AVBC 2UWXA 3AN2A 5B31A 3TU4B 1M18A 3REJD 1P3PC 4KHAA 3EPKA 2NZDC 2F8NH 1F1EA 3UT9C 4QLCA 3TU4C 2ZY2A 1Q9CA 3B6FC 5AVBD 3AZIB 4NE3A 1P3PD 2IO5B 3R45B 3X1UB 1HQ3B 4J8WA 2NZDD 1KX4A 5CPKB 1TZYC 4R8PA 3X1VA 5CPJA 3UT9D 3WTPA 3C1BB 3AZIC 1ID3B 3TU4D 3X1UC 1F66B 3H0RC 3O62A 3B6FD 2HIOB 3B0CT 4UUZB 4Z5TA 5CPKC 4XUJA 4KUDB 3AZHC 1TZYD 5AVCB 3VH5T 3UTAA 1BFMA 4NE5A 3KWQB 3RELA 1EQZB 4JJNA 3AZID 3AV1C 2HIOC 3MVDC 5BNVA 2AROA 3X1UD 1S32B 4WU9C 5CPKD 5AVCC 3AZHD 4G92C 1BH9B 1S32C 3EPJA 3AV1D 2CWEA 1P3OA 3MVDD 4WU9D 2Y2GA 4DRAA 3MGQB 2Y2OA 2NQBB 1KX5A 1HTAA 3WTPE 3LELA 3AV2A 3AZNB 3KXBD 5B33B 1S32D 3C1CC 5B1MB 4H9QA 2Y2KA 3MGQC 4HGAC 1P34A 2Y2IA 3AFAB 3KSYA 3W99A 5AV5C 3MGSB 4H9RA 5B1MC 5F99C 5GT3A 5B0YB 2VQRA 3C1CD 4J8XA 3MGQD 2F8NB 3AFAC 2ZY3A 4H9NA 3VH6A 3X1SA 5B32A 4J8UA 3IP4C 5DNNB 2JE5A 1PZRA 5AV5D 5B0YC 5B1MD 5F99D 3V9RB 4KGCC 3AFAD 5B2JA 1H3OA 5DNMC 1W2EA 3NQUB 3AZGC 4X23B 4J8VA 2PYOA 1P3MB 3REKD 2Y2HA 3LZ1C 4KGCD 4LD9A 1M19C 5B24B 3B6GA 5CP6B 5DNMD 3AZGD 3X1TC 3REIC 2BYKB 2RIQA 1P3FB 3KUYC 5CPIA 3LZ1D 3AZLC 1ZLAA 1P3GB 5KDMB 1M19D 3LJAD 1TAFA 1A7WA 3X1TD 3B0CW 3REID 3AZEB 5B2IC 5GT0A 3KUYD 5B1LA 4H9PB 3VH5W 5G49B 3W96C 3MNNA 3MGRC 3AZLD 3AZMA 4WU8C 1P3BC 5BO0A 3VH6T 3AZEC 5JRGC 5B2ID 5AV6C 3MGRD 5E5AB 1KX3A 4Z66D 3W96D 4WU8D 3AZJC 1P3BD 3WA9B 3W97B 3REJB 1U35B 4WV4B 1M1AA 5JRGD 5AV6D 4YM6B 2L5AA 2Y2PA 2YFVA 4AWLB 5AY8B 3W97C 1U35C 3AZJD 3B0BA 5AV8C 3W98A 5JA4A 2NZDA 4XZQA 5B0ZA 4YM6C 5AY8C 3AL0C 3UT9B 3TU4A 2XD1A 4H9OB 3W97D 1U35D 3B6FB 5AV8D 5B40D 2Y2JA 4YM6D 1TZYB 5AY8D 4YS3B 1HQ3A 5CPKA 4G91C 5AV9B 4H9SC 5BNXB 1AOIB 3C1BA 3LZ0B 3WAAC 3AZHB 4YS3C 1ID3A 1F66A 1P3AC 2HIOA 3AV1B 4UUZA 4NFTA 5AV9C 3MVDB 4KUDA 3B0DC 1AOIC 4WU9B 5AVCA 2CV5C 3LZ0C 3MGPC 3KWQA 2FFFB 1EQZA 3WAAD 4YS3D 4G92B 4ZUXC 1P3AD 3KXBB 3AN2C 5B31C 1M18C 1KU5A 5AV9D 1AOID 2CV5D 3LZ0D 3MGPD 1BH9A 5B31G 3KXBC 4QLCC 4ZUXD 3AYWA 3MGQA 3C1CB 3AN2D 3NQJA 5B31D 3AZKB 1M18D 2NQBA 2RVQC 4HGAB 2HUEB 4E45A 1KX4C 3KFUG 3X1VC 3AZNA 5CPJC 2FJ7B 5B33A 5B1MA 5AV5B 3WTPC 4QLCD 5F99B 3AZKC 4CSRB 2HUEC 3O62C 3AFAA 4JJNB 4Z5TC 2RVQD 2G5IC 4XUJC 2FJ7C 3MGSA 1KX4D 2DQNC 3UTAC 5CPJD 2BG1A 3X1VD 5B0YA 3WTPD 2F8NA 1BH8A 4JJNC 3AZKD 3REKB 2AROC 1P3IB 3O62D 4KGCB 5DNNA 4Z5TD 4XUJD 2FJ7D 5CHLB 3UTAD 5DNMB 3AZGB 3V9RA 3REKC 1P3IC 2W8SA 3A6NA 4JJND 2Y2QA 1P3OC 2AROD 3LZ1B 3NQUA 2G5HC 1M19B 4CAYB 3F6TA 4X23A 3LJAB 1KX5C 3LELC 1P3MA 3AV2C 3X1TB 3REIB 1P3ID 5B24A 1P3OD 2BYMB 3KUYB 1P34C 5CP6A 3H0MC 3AZLB 3LJAC 3UTBB 3EPLA 1KX5D 2BYKA 3LELD 1P3FA 3AV2D 5B2IB 1P3GA 5KDMA 4J8XC 3MGRB 3UTBC 3W96B 1P34D 4Z66B 3X1SC 4EO5C 4WU8B 4J8UC 1P3BB 3FDDA 3AZEA 3W99D 4WNNB 4H9PA 5G49A 5JRGB 5B32G 4Z66C 4J8XD 5AV6B 5B2JC 3UTBD 3WKJB 3X1SD 4J8UD 3AZJB 5GXQB 4J8VC 1P3KA 2PYOC 5E5AA 5FUGA 3REHB 3WKJC 1JFIB 3WA9A 2LY8A 4LD9C 5CPIB 3W97A 5BS7A 5GSUB 5B2JD 3REJA 1U35A 4ZBJB 3B6GC 2ZY4A 5GXQC 5AV8B 5B40B 5C3IB 3REHC 4YM6A 4J8VD 2PYOD 2YFWB 5CPIC 4M6BA 5GSUC 3WKJD 1ZLAC 4ZBJC 5AVBA 4LD9D 1P3PA 5B40C 5C3IC 3B6GD 5GXQD 3REHD 3UT9A 5GT0C 4H9OA 5B1LC 5CPID 3AZMC 5GSUD 3MNNC 1ZLAD 3B6FA 1TZYA 3VH5A 4UPKA 4G91B 5GT0D 3AZIA 3WAAB 5B1LD 3AZMD 3MNND 1KX3C 3R45A 3X1UA 1P3AB 5AV9A 4WJ3C 5BNXA 1AOIA 3B0DB 3LZ0A 3AZHA 3W98B 2CV5B 3MGPB 3AZFB 1N1JB 1P3LB 4XZQB 3AV1A 1WWSA 3MVDA 1KX3D 4ZUXB 4WU9A 2JSSA 3AN2B 5B31B 3W98C 1M18B 3AZFC 1M1AD 1P3LC 4KHAB 4XZQC 5B0ZC 4NE6A 3KXBA 1S32A 4QLCB 1B6WA 2Y2MA 2F2AC 3W98D 4J8WB 3AZFD 1P3LD 4XZQD 1KX4B 5B0ZD 4R8PB 3X1VB 5CPJB 3C1CA 4E44A 3WTPB 3AZKA 2IO5C 1HQ3C 4J8WC 3O62B 2FJ7A 4Z5TB 4R8PC 4XUJB 3VH6W 5AV5A 3C1BC 1ID3C 5F99A 3UTAB 1R4VA 4CSRA 1F66C 3RELB 2XD5A 4WZSB 1HQ3D 4KUDC 5BNVB 2AROB 4J8WD 4DQYB 4R8PD 3KWQC 1EQZC 3C1BD 3RELC 1ID3D 3REKA 1P3IA 1F66D 4KGCA 2HIOD 3AYWB 1P3OB 4KUDD 1Z2CB 3NQJB 5AVCD 5DNMA 3AZGA 3KWQD 4Z2MG 1EQZD 3RELD 1KX5B 3LELB 3AV2B 3AYWC 3LZ1A 1M19A 4CAYA 4H9QB 2NQBC 1T3UA 3LJAA 1P34B 3X1TA 3AZNC 3REIA 3W99B 5B33C 4H9RB 2ZM5A 2BYMA 3KUYA 3AYWD 3AZLA 5GT3B 4DRBA 1BH8B 2J8PA 4J8XB 3UTBA 2NQBD 1WWIA 5BT1C 4H9NB 3W99C 3A1KA 3X1SB 3MGSC 4EO5B 5B32B 2JCHA 4J8UB 3AZND 5B2IA 5B33D 5GT3C 1B67A 3MGRA 3W96A 4Z66A 3A6NB 4WU8A 1P3BA 5DNNC 5B32C 5BT1D 5B2JB 2DF4C 2F8NG 1H3OB 3MGSD 3P5JB 4WNNA 1ULYA 5JRGA 5B0YD 5GT3D 5AV6A 4J8VB 3A6NC 2F8ND 2PYOB 3EPHA 3WKJA 3AZJA 4LD9B 5DNND 5B32D 5GXQA 4X23C 3B6GB 1P3MC 3REHA 3A1IA 1JFIA 5B24C 3A6ND 5GSUA 5CP6C 1ZLAB 5AV8A 5B40A 3EG5B 4X23D 1TAFB 1P3FC 1P3MD 2YFWA 5AY8A 1P3GC 5B24D 5GT0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L B;  3AZM B;  3MNN B;  5CP6 D;  5BO0 B;  1P3F D;  4Z2M H;  1P3G D;  1P3K B;  5FUG B;  1KX3 B;  2F8N K;  3AZE D;  4H9S A;  1M1A B;  1P3K C;  3WAA A;  4YS3 A;  5E5A C;  1P3A A;  3WA9 C;  5BS7 C;  3REJ C;  2YFV B;  5AVB B;  1M1A C;  2CV5 A;  1P3P B;  3MGP A;  3AZF A;  1N1J A;  5JA4 B;  1P3L A;  2NZD B;  1P3K D;  5B0Z B;  5E5A D;  4AWL C;  4ZUX A;  3WA9 D;  5AVB C;  3AN2 A;  5B31 A;  3TU4 B;  1M18 A;  3REJ D;  1P3P C;  4KHA A;  2NZD C;  2F8N H;  1F1E A;  3UT9 C;  4QLC A;  3TU4 C;  1Q9C A;  3B6F C;  5AVB D;  3AZI B;  4NE3 A;  1P3P D;  2IO5 B;  3R45 B;  3X1U B;  1HQ3 B;  4J8W A;  2NZD D;  1KX4 A;  5CPK B;  1TZY C;  4R8P A;  3X1V A;  5CPJ A;  3UT9 D;  3WTP A;  3C1B B;  3AZI C;  1ID3 B;  3TU4 D;  3X1U C;  1F66 B;  3B6F D;  3O62 A;  2HIO B;  3B0C T;  4UUZ B;  4Z5T A;  5CPK C;  4XUJ A;  4KUD B;  3AZH C;  1TZY D;  5AVC B;  3VH5 T;  3UTA A;  1BFM A;  4NE5 A;  3KWQ B;  3REL A;  1EQZ B;  4JJN A;  3AZI D;  3AV1 C;  2HIO C;  3MVD C;  5BNV A;  2ARO A;  3X1U D;  1S32 B;  4WU9 C;  5CPK D;  5AVC C;  3AZH D;  4G92 C;  1BH9 B;  1S32 C;  3AV1 D;  2CWE A;  1P3O A;  3MVD D;  4WU9 D;  3MGQ B;  4DRA A;  2NQB B;  1KX5 A;  1HTA A;  3WTP E;  3LEL A;  3AV2 A;  3AZN B;  3KXB D;  5B33 B;  1S32 D;  3C1C C;  5B1M B;  4H9Q A;  3MGQ C;  4HGA C;  1P34 A;  3AFA B;  3KSY A;  3W99 A;  5AV5 C;  3MGS B;  4H9R A;  5B1M C;  5F99 C;  5GT3 A;  5B0Y B;  3C1C D;  4J8X A;  3MGQ D;  2F8N B;  3AFA C;  4H9N A;  3VH6 A;  3X1S A;  5B32 A;  4J8U A;  5DNN B;  5AV5 D;  5B0Y C;  5B1M D;  5F99 D;  3V9R B;  4KGC C;  3AFA D;  5B2J A;  1H3O A;  5DNM C;  3NQU B;  3AZG C;  4X23 B;  4J8V A;  2PYO A;  1P3M B;  3REK D;  3LZ1 C;  4KGC D;  4LD9 A;  1M19 C;  5B24 B;  3B6G A;  5CP6 B;  5DNM D;  3AZG D;  3X1T C;  3REI C;  2BYK B;  1P3F B;  3KUY C;  5CPI A;  3LZ1 D;  3AZL C;  1ZLA A;  1P3G B;  5KDM B;  1M19 D;  3LJA D;  1TAF A;  1A7W A;  3X1T D;  3B0C W;  3REI D;  3AZE B;  5B2I C;  5GT0 A;  3KUY D;  5B1L A;  4H9P B;  3VH5 W;  5G49 B;  3W96 C;  3MNN A;  3MGR C;  3AZL D;  3AZM A;  4WU8 C;  1P3B C;  5BO0 A;  3VH6 T;  3AZE C;  5JRG C;  5B2I D;  5AV6 C;  3MGR D;  5E5A B;  1KX3 A;  4Z66 D;  3W96 D;  4WU8 D;  3AZJ C;  1P3B D;  3WA9 B;  3W97 B;  3REJ B;  1U35 B;  4WV4 B;  1M1A A;  5JRG D;  5AV6 D;  4YM6 B;  2L5A A;  2YFV A;  4AWL B;  5AY8 B;  3W97 C;  1U35 C;  3AZJ D;  3B0B A;  5AV8 C;  3W98 A;  5JA4 A;  2NZD A;  4XZQ A;  5B0Z A;  4YM6 C;  5AY8 C;  3UT9 B;  3TU4 A;  4H9O B;  3W97 D;  1U35 D;  3B6F B;  5AV8 D;  5B40 D;  4YM6 D;  1TZY B;  5AY8 D;  4YS3 B;  1HQ3 A;  5CPK A;  4G91 C;  5AV9 B;  4H9S C;  5BNX B;  1AOI B;  3C1B A;  3LZ0 B;  3WAA C;  3AZH B;  4YS3 C;  1ID3 A;  1F66 A;  1P3A C;  2HIO A;  3AV1 B;  4UUZ A;  4NFT A;  5AV9 C;  3MVD B;  4KUD A;  3B0D C;  1AOI C;  4WU9 B;  5AVC A;  2CV5 C;  3LZ0 C;  3MGP C;  3KWQ A;  1EQZ A;  3WAA D;  4YS3 D;  4G92 B;  4ZUX C;  1P3A D;  3KXB B;  3AN2 C;  5B31 C;  1M18 C;  1KU5 A;  5AV9 D;  1AOI D;  2CV5 D;  3LZ0 D;  3MGP D;  1BH9 A;  5B31 G;  3KXB C;  4QLC C;  4ZUX D;  3AYW A;  3MGQ A;  3C1C B;  3AN2 D;  3NQJ A;  5B31 D;  3AZK B;  1M18 D;  2NQB A;  2RVQ C;  4HGA B;  2HUE B;  4E45 A;  1KX4 C;  3X1V C;  3AZN A;  5CPJ C;  2FJ7 B;  5B33 A;  5B1M A;  5AV5 B;  3WTP C;  4QLC D;  5F99 B;  3AZK C;  4CSR B;  2HUE C;  3O62 C;  3AFA A;  4JJN B;  4Z5T C;  2RVQ D;  4XUJ C;  2FJ7 C;  3MGS A;  1KX4 D;  3UTA C;  5CPJ D;  3X1V D;  5B0Y A;  3WTP D;  2F8N A;  1BH8 A;  4JJN C;  3AZK D;  3REK B;  2ARO C;  1P3I B;  3O62 D;  4KGC B;  5DNN A;  4Z5T D;  4XUJ D;  2FJ7 D;  5CHL B;  3UTA D;  5DNM B;  3AZG B;  3V9R A;  3REK C;  1P3I C;  3A6N A;  4JJN D;  1P3O C;  2ARO D;  3LZ1 B;  3NQU A;  1M19 B;  4CAY B;  4X23 A;  3LJA B;  1KX5 C;  3LEL C;  1P3M A;  3AV2 C;  3X1T B;  3REI B;  1P3I D;  5B24 A;  1P3O D;  2BYM B;  3KUY B;  1P34 C;  5CP6 A;  3AZL B;  3LJA C;  3UTB B;  1KX5 D;  2BYK A;  3LEL D;  1P3F A;  3AV2 D;  5B2I B;  1P3G A;  5KDM A;  4J8X C;  3MGR B;  3UTB C;  3W96 B;  1P34 D;  4Z66 B;  3X1S C;  4EO5 C;  4WU8 B;  4J8U C;  1P3B B;  3AZE A;  3W99 D;  4WNN B;  4H9P A;  5G49 A;  5JRG B;  5B32 G;  4Z66 C;  4J8X D;  5AV6 B;  5B2J C;  3UTB D;  3WKJ B;  3X1S D;  4J8U D;  3AZJ B;  5GXQ B;  4J8V C;  1P3K A;  2PYO C;  5E5A A;  5FUG A;  3REH B;  3WKJ C;  1JFI B;  3WA9 A;  2LY8 A;  4LD9 C;  5CPI B;  3W97 A;  5BS7 A;  5GSU B;  5B2J D;  3REJ A;  1U35 A;  4ZBJ B;  3B6G C;  5GXQ C;  5AV8 B;  5B40 B;  5C3I B;  3REH C;  4YM6 A;  4J8V D;  2PYO D;  2YFW B;  5CPI C;  4M6B A;  5GSU C;  3WKJ D;  1ZLA C;  4ZBJ C;  5AVB A;  4LD9 D;  1P3P A;  5B40 C;  5C3I C;  3B6G D;  5GXQ D;  3REH D;  3UT9 A;  5GT0 C;  4H9O A;  5B1L C;  5CPI D;  3AZM C;  5GSU D;  3MNN C;  1ZLA D;  3B6F A;  1TZY A;  3VH5 A;  4G91 B;  5GT0 D;  3AZI A;  3WAA B;  5B1L D;  3AZM D;  3MNN D;  1KX3 C;  3R45 A;  3X1U A;  1P3A B;  5AV9 A;  5BNX A;  1AOI A;  3B0D B;  3LZ0 A;  3AZH A;  3W98 B;  2CV5 B;  3MGP B;  3AZF B;  1N1J B;  1P3L B;  4XZQ B;  3AV1 A;  1WWS A;  3MVD A;  1KX3 D;  4ZUX B;  4WU9 A;  2JSS A;  3AN2 B;  5B31 B;  3W98 C;  1M18 B;  3AZF C;  1M1A D;  1P3L C;  4KHA B;  4XZQ C;  5B0Z C;  4NE6 A;  3KXB A;  1S32 A;  4QLC B;  1B6W A;  3W98 D;  4J8W B;  3AZF D;  1P3L D;  4XZQ D;  1KX4 B;  5B0Z D;  4R8P B;  3X1V B;  5CPJ B;  3C1C A;  4E44 A;  3WTP B;  3AZK A;  2IO5 C;  1HQ3 C;  4J8W C;  3O62 B;  2FJ7 A;  4Z5T B;  4R8P C;  4XUJ B;  3VH6 W;  5AV5 A;  3C1B C;  1ID3 C;  5F99 A;  3UTA B;  1R4V A;  4CSR A;  1F66 C;  3REL B;  4WZS B;  1HQ3 D;  4KUD C;  5BNV B;  2ARO B;  4J8W D;  4R8P D;  3KWQ C;  1EQZ C;  3C1B D;  3REL C;  1ID3 D;  3REK A;  1P3I A;  1F66 D;  4KGC A;  2HIO D;  3AYW B;  1P3O B;  4KUD D;  3NQJ B;  5AVC D;  5DNM A;  3AZG A;  3KWQ D;  4Z2M G;  1EQZ D;  3REL D;  1KX5 B;  3LEL B;  3AV2 B;  3AYW C;  3LZ1 A;  1M19 A;  4CAY A;  4H9Q B;  2NQB C;  3LJA A;  1P34 B;  3X1T A;  3AZN C;  3REI A;  3W99 B;  5B33 C;  4H9R B;  2BYM A;  3KUY A;  3AYW D;  3AZL A;  5GT3 B;  4DRB A;  1BH8 B;  4J8X B;  3UTB A;  2NQB D;  1WWI A;  5BT1 C;  4H9N B;  3W99 C;  3X1S B;  3MGS C;  4EO5 B;  5B32 B;  4J8U B;  3AZN D;  5B2I A;  5B33 D;  5GT3 C;  1B67 A;  3MGR A;  3W96 A;  4Z66 A;  3A6N B;  4WU8 A;  1P3B A;  5DNN C;  5B32 C;  5BT1 D;  5B2J B;  2F8N G;  1H3O B;  3MGS D;  4WNN A;  1ULY A;  5JRG A;  5B0Y D;  5GT3 D;  5AV6 A;  4J8V B;  3A6N C;  2F8N D;  2PYO B;  3WKJ A;  3AZJ A;  4LD9 B;  5DNN D;  5B32 D;  5GXQ A;  4X23 C;  3B6G B;  1P3M C;  3REH A;  1JFI A;  5B24 C;  3A6N D;  5GSU A;  5CP6 C;  1ZLA B;  5AV8 A;  5B40 A;  4X23 D;  1TAF B;  1P3F C;  1P3M D;  2YFW A;  5AY8 A;  1P3G C;  5B24 D;  5GT0 B; 
#chains in the Genus database with same CATH topology
 5B1L B;  3AZM B;  3MNN B;  5CP6 D;  5BO0 B;  2Y2N A;  1P3F D;  4Z2M H;  1P3G D;  1P3K B;  5FUG B;  1KX3 B;  2F8N K;  3AZE D;  4H9S A;  1M1A B;  3H0L C;  1P3K C;  3WAA A;  4YS3 A;  5E5A C;  2ZY5 A;  1P3A A;  3WA9 C;  5BS7 C;  3REJ C;  2YFV B;  5AVB B;  1M1A C;  2CV5 A;  1P3P B;  2Y2L A;  3MGP A;  1N1J A;  5JA4 B;  3AZF A;  1P3L A;  2NZD B;  1P3K D;  5B0Z B;  5E5A D;  4AWL C;  4ZUX A;  3WA9 D;  5AVB C;  2UWX A;  3AN2 A;  5B31 A;  3TU4 B;  1M18 A;  3REJ D;  1P3P C;  4KHA A;  3EPK A;  2NZD C;  2F8N H;  1F1E A;  3UT9 C;  4QLC A;  3TU4 C;  2ZY2 A;  1Q9C A;  3B6F C;  5AVB D;  3AZI B;  4NE3 A;  1P3P D;  2IO5 B;  3R45 B;  3X1U B;  1HQ3 B;  4J8W A;  2NZD D;  1KX4 A;  5CPK B;  1TZY C;  4R8P A;  3X1V A;  5CPJ A;  3UT9 D;  3WTP A;  3C1B B;  3AZI C;  1ID3 B;  3TU4 D;  3X1U C;  1F66 B;  3H0R C;  3O62 A;  3B6F D;  2HIO B;  3B0C T;  4UUZ B;  4Z5T A;  5CPK C;  4XUJ A;  4KUD B;  3AZH C;  1TZY D;  5AVC B;  3VH5 T;  3UTA A;  1BFM A;  4NE5 A;  3KWQ B;  3REL A;  1EQZ B;  4JJN A;  3AZI D;  3AV1 C;  2HIO C;  3MVD C;  5BNV A;  2ARO A;  3X1U D;  1S32 B;  4WU9 C;  5CPK D;  5AVC C;  3AZH D;  4G92 C;  1BH9 B;  1S32 C;  3EPJ A;  3AV1 D;  2CWE A;  1P3O A;  3MVD D;  4WU9 D;  2Y2G A;  4DRA A;  3MGQ B;  2Y2O A;  2NQB B;  1KX5 A;  1HTA A;  3WTP E;  3LEL A;  3AV2 A;  3AZN B;  3KXB D;  5B33 B;  1S32 D;  3C1C C;  5B1M B;  4H9Q A;  2Y2K A;  3MGQ C;  4HGA C;  1P34 A;  2Y2I A;  3AFA B;  3KSY A;  3W99 A;  5AV5 C;  3MGS B;  4H9R A;  5B1M C;  5F99 C;  5GT3 A;  5B0Y B;  2VQR A;  3C1C D;  4J8X A;  3MGQ D;  2F8N B;  3AFA C;  2ZY3 A;  4H9N A;  3VH6 A;  3X1S A;  5B32 A;  4J8U A;  3IP4 C;  5DNN B;  2JE5 A;  1PZR A;  5AV5 D;  5B0Y C;  5B1M D;  5F99 D;  3V9R B;  4KGC C;  3AFA D;  5B2J A;  1H3O A;  5DNM C;  1W2E A;  3NQU B;  3AZG C;  4X23 B;  4J8V A;  2PYO A;  1P3M B;  3REK D;  2Y2H A;  3LZ1 C;  4KGC D;  4LD9 A;  1M19 C;  5B24 B;  3B6G A;  5CP6 B;  5DNM D;  3AZG D;  3X1T C;  3REI C;  2BYK B;  2RIQ A;  1P3F B;  3KUY C;  5CPI A;  3LZ1 D;  3AZL C;  1ZLA A;  1P3G B;  5KDM B;  1M19 D;  3LJA D;  1TAF A;  1A7W A;  3X1T D;  3B0C W;  3REI D;  3AZE B;  5B2I C;  5GT0 A;  3KUY D;  5B1L A;  4H9P B;  3VH5 W;  5G49 B;  3W96 C;  3MNN A;  3MGR C;  3AZL D;  3AZM A;  4WU8 C;  1P3B C;  5BO0 A;  3VH6 T;  3AZE C;  5JRG C;  5B2I D;  5AV6 C;  3MGR D;  5E5A B;  1KX3 A;  4Z66 D;  3W96 D;  4WU8 D;  3AZJ C;  1P3B D;  3WA9 B;  3W97 B;  3REJ B;  1U35 B;  4WV4 B;  1M1A A;  5JRG D;  5AV6 D;  4YM6 B;  2L5A A;  2Y2P A;  2YFV A;  4AWL B;  5AY8 B;  3W97 C;  1U35 C;  3AZJ D;  3B0B A;  5AV8 C;  3W98 A;  5JA4 A;  2NZD A;  4XZQ A;  5B0Z A;  4YM6 C;  5AY8 C;  3AL0 C;  3UT9 B;  3TU4 A;  2XD1 A;  4H9O B;  3W97 D;  1U35 D;  3B6F B;  5AV8 D;  5B40 D;  2Y2J A;  4YM6 D;  1TZY B;  5AY8 D;  4YS3 B;  1HQ3 A;  5CPK A;  4G91 C;  5AV9 B;  4H9S C;  5BNX B;  1AOI B;  3C1B A;  3LZ0 B;  3WAA C;  3AZH B;  4YS3 C;  1ID3 A;  1F66 A;  1P3A C;  2HIO A;  3AV1 B;  4UUZ A;  4NFT A;  5AV9 C;  3MVD B;  4KUD A;  3B0D C;  1AOI C;  4WU9 B;  5AVC A;  2CV5 C;  3LZ0 C;  3MGP C;  3KWQ A;  2FFF B;  1EQZ A;  3WAA D;  4YS3 D;  4G92 B;  4ZUX C;  1P3A D;  3KXB B;  3AN2 C;  5B31 C;  1M18 C;  1KU5 A;  5AV9 D;  1AOI D;  2CV5 D;  3LZ0 D;  3MGP D;  1BH9 A;  5B31 G;  3KXB C;  4QLC C;  4ZUX D;  3AYW A;  3MGQ A;  3C1C B;  3AN2 D;  3NQJ A;  5B31 D;  3AZK B;  1M18 D;  2NQB A;  2RVQ C;  4HGA B;  2HUE B;  4E45 A;  1KX4 C;  3KFU G;  3X1V C;  3AZN A;  5CPJ C;  2FJ7 B;  5B33 A;  5B1M A;  5AV5 B;  3WTP C;  4QLC D;  5F99 B;  3AZK C;  4CSR B;  2HUE C;  3O62 C;  3AFA A;  4JJN B;  4Z5T C;  2RVQ D;  2G5I C;  4XUJ C;  2FJ7 C;  3MGS A;  1KX4 D;  2DQN C;  3UTA C;  5CPJ D;  2BG1 A;  3X1V D;  5B0Y A;  3WTP D;  2F8N A;  1BH8 A;  4JJN C;  3AZK D;  3REK B;  2ARO C;  1P3I B;  3O62 D;  4KGC B;  5DNN A;  4Z5T D;  4XUJ D;  2FJ7 D;  5CHL B;  3UTA D;  5DNM B;  3AZG B;  3V9R A;  3REK C;  1P3I C;  2W8S A;  3A6N A;  4JJN D;  2Y2Q A;  1P3O C;  2ARO D;  3LZ1 B;  3NQU A;  2G5H C;  1M19 B;  4CAY B;  3F6T A;  4X23 A;  3LJA B;  1KX5 C;  3LEL C;  1P3M A;  3AV2 C;  3X1T B;  3REI B;  1P3I D;  5B24 A;  1P3O D;  2BYM B;  3KUY B;  1P34 C;  5CP6 A;  3H0M C;  3AZL B;  3LJA C;  3UTB B;  3EPL A;  1KX5 D;  2BYK A;  3LEL D;  1P3F A;  3AV2 D;  5B2I B;  1P3G A;  5KDM A;  4J8X C;  3MGR B;  3UTB C;  3W96 B;  1P34 D;  4Z66 B;  3X1S C;  4EO5 C;  4WU8 B;  4J8U C;  1P3B B;  3FDD A;  3AZE A;  3W99 D;  4WNN B;  4H9P A;  5G49 A;  5JRG B;  5B32 G;  4Z66 C;  4J8X D;  5AV6 B;  5B2J C;  3UTB D;  3WKJ B;  3X1S D;  4J8U D;  3AZJ B;  5GXQ B;  4J8V C;  1P3K A;  2PYO C;  5E5A A;  5FUG A;  3REH B;  3WKJ C;  1JFI B;  3WA9 A;  2LY8 A;  4LD9 C;  5CPI B;  3W97 A;  5BS7 A;  5GSU B;  5B2J D;  3REJ A;  1U35 A;  4ZBJ B;  3B6G C;  2ZY4 A;  5GXQ C;  5AV8 B;  5B40 B;  5C3I B;  3REH C;  4YM6 A;  4J8V D;  2PYO D;  2YFW B;  5CPI C;  4M6B A;  5GSU C;  3WKJ D;  1ZLA C;  4ZBJ C;  5AVB A;  4LD9 D;  1P3P A;  5B40 C;  5C3I C;  3B6G D;  5GXQ D;  3REH D;  3UT9 A;  5GT0 C;  4H9O A;  5B1L C;  5CPI D;  3AZM C;  5GSU D;  3MNN C;  1ZLA D;  3B6F A;  1TZY A;  3VH5 A;  4UPK A;  4G91 B;  5GT0 D;  3AZI A;  3WAA B;  5B1L D;  3AZM D;  3MNN D;  1KX3 C;  3R45 A;  3X1U A;  1P3A B;  5AV9 A;  4WJ3 C;  5BNX A;  1AOI A;  3B0D B;  3LZ0 A;  3AZH A;  3W98 B;  2CV5 B;  3MGP B;  3AZF B;  1N1J B;  1P3L B;  4XZQ B;  3AV1 A;  1WWS A;  3MVD A;  1KX3 D;  4ZUX B;  4WU9 A;  2JSS A;  3AN2 B;  5B31 B;  3W98 C;  1M18 B;  3AZF C;  1M1A D;  1P3L C;  4KHA B;  4XZQ C;  5B0Z C;  4NE6 A;  3KXB A;  1S32 A;  4QLC B;  1B6W A;  2Y2M A;  2F2A C;  3W98 D;  4J8W B;  3AZF D;  1P3L D;  4XZQ D;  1KX4 B;  5B0Z D;  4R8P B;  3X1V B;  5CPJ B;  3C1C A;  4E44 A;  3WTP B;  3AZK A;  2IO5 C;  1HQ3 C;  4J8W C;  3O62 B;  2FJ7 A;  4Z5T B;  4R8P C;  4XUJ B;  3VH6 W;  5AV5 A;  3C1B C;  1ID3 C;  5F99 A;  3UTA B;  1R4V A;  4CSR A;  1F66 C;  3REL B;  2XD5 A;  4WZS B;  1HQ3 D;  4KUD C;  5BNV B;  2ARO B;  4J8W D;  4DQY B;  4R8P D;  3KWQ C;  1EQZ C;  3C1B D;  3REL C;  1ID3 D;  3REK A;  1P3I A;  1F66 D;  4KGC A;  2HIO D;  3AYW B;  1P3O B;  4KUD D;  1Z2C B;  3NQJ B;  5AVC D;  5DNM A;  3AZG A;  3KWQ D;  4Z2M G;  1EQZ D;  3REL D;  1KX5 B;  3LEL B;  3AV2 B;  3AYW C;  3LZ1 A;  1M19 A;  4CAY A;  4H9Q B;  2NQB C;  1T3U A;  3LJA A;  1P34 B;  3X1T A;  3AZN C;  3REI A;  3W99 B;  5B33 C;  4H9R B;  2ZM5 A;  2BYM A;  3KUY A;  3AYW D;  3AZL A;  5GT3 B;  4DRB A;  1BH8 B;  2J8P A;  4J8X B;  3UTB A;  2NQB D;  1WWI A;  5BT1 C;  4H9N B;  3W99 C;  3A1K A;  3X1S B;  3MGS C;  4EO5 B;  5B32 B;  2JCH A;  4J8U B;  3AZN D;  5B2I A;  5B33 D;  5GT3 C;  1B67 A;  3MGR A;  3W96 A;  4Z66 A;  3A6N B;  4WU8 A;  1P3B A;  5DNN C;  5B32 C;  5BT1 D;  5B2J B;  2DF4 C;  2F8N G;  1H3O B;  3MGS D;  3P5J B;  4WNN A;  1ULY A;  5JRG A;  5B0Y D;  5GT3 D;  5AV6 A;  4J8V B;  3A6N C;  2F8N D;  2PYO B;  3EPH A;  3WKJ A;  3AZJ A;  4LD9 B;  5DNN D;  5B32 D;  5GXQ A;  4X23 C;  3B6G B;  1P3M C;  3REH A;  3A1I A;  1JFI A;  5B24 C;  3A6N D;  5GSU A;  5CP6 C;  1ZLA B;  5AV8 A;  5B40 A;  3EG5 B;  4X23 D;  1TAF B;  1P3F C;  1P3M D;  2YFW A;  5AY8 A;  1P3G C;  5B24 D;  5GT0 B; 
#chains in the Genus database with same CATH homology
 5B1L B;  3AZM B;  3MNN B;  5CP6 D;  5BO0 B;  2Y2N A;  1P3F D;  4Z2M H;  1P3G D;  1P3K B;  5FUG B;  1KX3 B;  2F8N K;  3AZE D;  4H9S A;  1M1A B;  3H0L C;  1P3K C;  3WAA A;  4YS3 A;  5E5A C;  2ZY5 A;  1P3A A;  3WA9 C;  5BS7 C;  3REJ C;  2YFV B;  5AVB B;  1M1A C;  2CV5 A;  1P3P B;  2Y2L A;  3MGP A;  1N1J A;  5JA4 B;  3AZF A;  1P3L A;  2NZD B;  1P3K D;  5B0Z B;  5E5A D;  4AWL C;  4ZUX A;  3WA9 D;  5AVB C;  2UWX A;  3AN2 A;  5B31 A;  3TU4 B;  1M18 A;  3REJ D;  1P3P C;  4KHA A;  3EPK A;  2NZD C;  2F8N H;  1F1E A;  3UT9 C;  4QLC A;  3TU4 C;  2ZY2 A;  1Q9C A;  3B6F C;  5AVB D;  3AZI B;  4NE3 A;  1P3P D;  2IO5 B;  3R45 B;  3X1U B;  1HQ3 B;  4J8W A;  2NZD D;  1KX4 A;  5CPK B;  1TZY C;  4R8P A;  3X1V A;  5CPJ A;  3UT9 D;  3WTP A;  3C1B B;  3AZI C;  1ID3 B;  3TU4 D;  3X1U C;  1F66 B;  3H0R C;  3O62 A;  3B6F D;  2HIO B;  3B0C T;  4UUZ B;  4Z5T A;  5CPK C;  4XUJ A;  4KUD B;  3AZH C;  1TZY D;  5AVC B;  3VH5 T;  3UTA A;  1BFM A;  4NE5 A;  3KWQ B;  3REL A;  1EQZ B;  4JJN A;  3AZI D;  3AV1 C;  2HIO C;  3MVD C;  5BNV A;  2ARO A;  3X1U D;  1S32 B;  4WU9 C;  5CPK D;  5AVC C;  3AZH D;  4G92 C;  1BH9 B;  1S32 C;  3EPJ A;  3AV1 D;  2CWE A;  1P3O A;  3MVD D;  4WU9 D;  2Y2G A;  4DRA A;  3MGQ B;  2Y2O A;  2NQB B;  1KX5 A;  1HTA A;  3WTP E;  3LEL A;  3AV2 A;  3AZN B;  3KXB D;  5B33 B;  1S32 D;  3C1C C;  5B1M B;  4H9Q A;  2Y2K A;  3MGQ C;  4HGA C;  1P34 A;  2Y2I A;  3AFA B;  3KSY A;  3W99 A;  5AV5 C;  3MGS B;  4H9R A;  5B1M C;  5F99 C;  5GT3 A;  5B0Y B;  2VQR A;  3C1C D;  4J8X A;  3MGQ D;  2F8N B;  3AFA C;  2ZY3 A;  4H9N A;  3VH6 A;  3X1S A;  5B32 A;  4J8U A;  3IP4 C;  5DNN B;  2JE5 A;  1PZR A;  5AV5 D;  5B0Y C;  5B1M D;  5F99 D;  3V9R B;  4KGC C;  3AFA D;  5B2J A;  1H3O A;  5DNM C;  1W2E A;  3NQU B;  3AZG C;  4X23 B;  4J8V A;  2PYO A;  1P3M B;  3REK D;  2Y2H A;  3LZ1 C;  4KGC D;  4LD9 A;  1M19 C;  5B24 B;  3B6G A;  5CP6 B;  5DNM D;  3AZG D;  3X1T C;  3REI C;  2BYK B;  2RIQ A;  1P3F B;  3KUY C;  5CPI A;  3LZ1 D;  3AZL C;  1ZLA A;  1P3G B;  5KDM B;  1M19 D;  3LJA D;  1TAF A;  1A7W A;  3X1T D;  3B0C W;  3REI D;  3AZE B;  5B2I C;  5GT0 A;  3KUY D;  5B1L A;  4H9P B;  3VH5 W;  5G49 B;  3W96 C;  3MNN A;  3MGR C;  3AZL D;  3AZM A;  4WU8 C;  1P3B C;  5BO0 A;  3VH6 T;  3AZE C;  5JRG C;  5B2I D;  5AV6 C;  3MGR D;  5E5A B;  1KX3 A;  4Z66 D;  3W96 D;  4WU8 D;  3AZJ C;  1P3B D;  3WA9 B;  3W97 B;  3REJ B;  1U35 B;  4WV4 B;  1M1A A;  5JRG D;  5AV6 D;  4YM6 B;  2L5A A;  2Y2P A;  2YFV A;  4AWL B;  5AY8 B;  3W97 C;  1U35 C;  3AZJ D;  3B0B A;  5AV8 C;  3W98 A;  5JA4 A;  2NZD A;  4XZQ A;  5B0Z A;  4YM6 C;  5AY8 C;  3AL0 C;  3UT9 B;  3TU4 A;  2XD1 A;  4H9O B;  3W97 D;  1U35 D;  3B6F B;  5AV8 D;  5B40 D;  2Y2J A;  4YM6 D;  1TZY B;  5AY8 D;  4YS3 B;  1HQ3 A;  5CPK A;  4G91 C;  5AV9 B;  4H9S C;  5BNX B;  1AOI B;  3C1B A;  3LZ0 B;  3WAA C;  3AZH B;  4YS3 C;  1ID3 A;  1F66 A;  1P3A C;  2HIO A;  3AV1 B;  4UUZ A;  4NFT A;  5AV9 C;  3MVD B;  4KUD A;  3B0D C;  1AOI C;  4WU9 B;  5AVC A;  2CV5 C;  3LZ0 C;  3MGP C;  3KWQ A;  2FFF B;  1EQZ A;  3WAA D;  4YS3 D;  4G92 B;  4ZUX C;  1P3A D;  3KXB B;  3AN2 C;  5B31 C;  1M18 C;  1KU5 A;  5AV9 D;  1AOI D;  2CV5 D;  3LZ0 D;  3MGP D;  1BH9 A;  5B31 G;  3KXB C;  4QLC C;  4ZUX D;  3AYW A;  3MGQ A;  3C1C B;  3AN2 D;  3NQJ A;  5B31 D;  3AZK B;  1M18 D;  2NQB A;  2RVQ C;  4HGA B;  2HUE B;  4E45 A;  1KX4 C;  3KFU G;  3X1V C;  3AZN A;  5CPJ C;  2FJ7 B;  5B33 A;  5B1M A;  5AV5 B;  3WTP C;  4QLC D;  5F99 B;  3AZK C;  4CSR B;  2HUE C;  3O62 C;  3AFA A;  4JJN B;  4Z5T C;  2RVQ D;  2G5I C;  4XUJ C;  2FJ7 C;  3MGS A;  1KX4 D;  2DQN C;  3UTA C;  5CPJ D;  2BG1 A;  3X1V D;  5B0Y A;  3WTP D;  2F8N A;  1BH8 A;  4JJN C;  3AZK D;  3REK B;  2ARO C;  1P3I B;  3O62 D;  4KGC B;  5DNN A;  4Z5T D;  4XUJ D;  2FJ7 D;  5CHL B;  3UTA D;  5DNM B;  3AZG B;  3V9R A;  3REK C;  1P3I C;  2W8S A;  3A6N A;  4JJN D;  2Y2Q A;  1P3O C;  2ARO D;  3LZ1 B;  3NQU A;  2G5H C;  1M19 B;  4CAY B;  3F6T A;  4X23 A;  3LJA B;  1KX5 C;  3LEL C;  1P3M A;  3AV2 C;  3X1T B;  3REI B;  1P3I D;  5B24 A;  1P3O D;  2BYM B;  3KUY B;  1P34 C;  5CP6 A;  3H0M C;  3AZL B;  3LJA C;  3UTB B;  3EPL A;  1KX5 D;  2BYK A;  3LEL D;  1P3F A;  3AV2 D;  5B2I B;  1P3G A;  5KDM A;  4J8X C;  3MGR B;  3UTB C;  3W96 B;  1P34 D;  4Z66 B;  3X1S C;  4EO5 C;  4WU8 B;  4J8U C;  1P3B B;  3FDD A;  3AZE A;  3W99 D;  4WNN B;  4H9P A;  5G49 A;  5JRG B;  5B32 G;  4Z66 C;  4J8X D;  5AV6 B;  5B2J C;  3UTB D;  3WKJ B;  3X1S D;  4J8U D;  3AZJ B;  5GXQ B;  4J8V C;  1P3K A;  2PYO C;  5E5A A;  5FUG A;  3REH B;  3WKJ C;  1JFI B;  3WA9 A;  2LY8 A;  4LD9 C;  5CPI B;  3W97 A;  5BS7 A;  5GSU B;  5B2J D;  3REJ A;  1U35 A;  4ZBJ B;  3B6G C;  2ZY4 A;  5GXQ C;  5AV8 B;  5B40 B;  5C3I B;  3REH C;  4YM6 A;  4J8V D;  2PYO D;  2YFW B;  5CPI C;  4M6B A;  5GSU C;  3WKJ D;  1ZLA C;  4ZBJ C;  5AVB A;  4LD9 D;  1P3P A;  5B40 C;  5C3I C;  3B6G D;  5GXQ D;  3REH D;  3UT9 A;  5GT0 C;  4H9O A;  5B1L C;  5CPI D;  3AZM C;  5GSU D;  3MNN C;  1ZLA D;  3B6F A;  1TZY A;  3VH5 A;  4UPK A;  4G91 B;  5GT0 D;  3AZI A;  3WAA B;  5B1L D;  3AZM D;  3MNN D;  1KX3 C;  3R45 A;  3X1U A;  1P3A B;  5AV9 A;  4WJ3 C;  5BNX A;  1AOI A;  3B0D B;  3LZ0 A;  3AZH A;  3W98 B;  2CV5 B;  3MGP B;  3AZF B;  1N1J B;  1P3L B;  4XZQ B;  3AV1 A;  1WWS A;  3MVD A;  1KX3 D;  4ZUX B;  4WU9 A;  2JSS A;  3AN2 B;  5B31 B;  3W98 C;  1M18 B;  3AZF C;  1M1A D;  1P3L C;  4KHA B;  4XZQ C;  5B0Z C;  4NE6 A;  3KXB A;  1S32 A;  4QLC B;  1B6W A;  2Y2M A;  2F2A C;  3W98 D;  4J8W B;  3AZF D;  1P3L D;  4XZQ D;  1KX4 B;  5B0Z D;  4R8P B;  3X1V B;  5CPJ B;  3C1C A;  4E44 A;  3WTP B;  3AZK A;  2IO5 C;  1HQ3 C;  4J8W C;  3O62 B;  2FJ7 A;  4Z5T B;  4R8P C;  4XUJ B;  3VH6 W;  5AV5 A;  3C1B C;  1ID3 C;  5F99 A;  3UTA B;  1R4V A;  4CSR A;  1F66 C;  3REL B;  2XD5 A;  4WZS B;  1HQ3 D;  4KUD C;  5BNV B;  2ARO B;  4J8W D;  4DQY B;  4R8P D;  3KWQ C;  1EQZ C;  3C1B D;  3REL C;  1ID3 D;  3REK A;  1P3I A;  1F66 D;  4KGC A;  2HIO D;  3AYW B;  1P3O B;  4KUD D;  1Z2C B;  3NQJ B;  5AVC D;  5DNM A;  3AZG A;  3KWQ D;  4Z2M G;  1EQZ D;  3REL D;  1KX5 B;  3LEL B;  3AV2 B;  3AYW C;  3LZ1 A;  1M19 A;  4CAY A;  4H9Q B;  2NQB C;  1T3U A;  3LJA A;  1P34 B;  3X1T A;  3AZN C;  3REI A;  3W99 B;  5B33 C;  4H9R B;  2ZM5 A;  2BYM A;  3KUY A;  3AYW D;  3AZL A;  5GT3 B;  4DRB A;  1BH8 B;  2J8P A;  4J8X B;  3UTB A;  2NQB D;  1WWI A;  5BT1 C;  4H9N B;  3W99 C;  3A1K A;  3X1S B;  3MGS C;  4EO5 B;  5B32 B;  2JCH A;  4J8U B;  3AZN D;  5B2I A;  5B33 D;  5GT3 C;  1B67 A;  3MGR A;  3W96 A;  4Z66 A;  3A6N B;  4WU8 A;  1P3B A;  5DNN C;  5B32 C;  5BT1 D;  5B2J B;  2DF4 C;  2F8N G;  1H3O B;  3MGS D;  3P5J B;  4WNN A;  1ULY A;  5JRG A;  5B0Y D;  5GT3 D;  5AV6 A;  4J8V B;  3A6N C;  2F8N D;  2PYO B;  3EPH A;  3WKJ A;  3AZJ A;  4LD9 B;  5DNN D;  5B32 D;  5GXQ A;  4X23 C;  3B6G B;  1P3M C;  3REH A;  3A1I A;  1JFI A;  5B24 C;  3A6N D;  5GSU A;  5CP6 C;  1ZLA B;  5AV8 A;  5B40 A;  3EG5 B;  4X23 D;  1TAF B;  1P3F C;  1P3M D;  2YFW A;  5AY8 A;  1P3G C;  5B24 D;  5GT0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...