4G92C

Ccaat-binding complex from aspergillus nidulans with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAPB protein
publication title DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Transcription/dna
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4g92C00
4EO5B 4WU8B 1ZLAB 3W97D 5AY8A 4ZUXD 5GT0A 4Z66B 5BT1C 3B6FC 5AV5B 5AV9D 1P3PC 5CPIA 3AFAB 3REJC 4M6BA 4Z2MG 3REKC 2NQBD 5B0ZC 2NZDB 3MGPC 4Z5TA 3KWQA 5GT3B 3AZLA 1P3AB 3MGSC 2FJ7A 5AVCD 3MGRC 3AZFC 2RVQC 2CV5A 3WTPC 1N1JB 2BYKA 4XUJC 5JRGB 5B0YB 3A6NB 4YM6C 1P3IC 3C1CD 1HQ3B 4NE3A 3REIB 4J8VA 1S32D 2YFWA 3W97C 3B0DC 3AZMD 3KSYA 2YFVB 4LD9C 1TZYA 1H3OA 5AV9C 4QLCB 1P34B 3B6FA 5JRGD 5B0YD 1P3PA 2HUEC 4R8PB 3REJA 1P3BB 3LELD 5AVCC 5B0ZA 3KUYB 3REKA 3VH5A 3MGPA 5KDMA 5DNNB 3UT9C 5CPKC 3MGSA 3VH5W 3AZGB 4HGAC 3C1CC 3AYWD 3MVDD 3MGRA 1S32C 3AZFA 3AZMC 3WTPA 4XUJA 4WU9D 1KX4B 3REHB 4YM6A 1P3IA 1F66D 3TU4D 3AN2B 3X1VD 1M1AB 3W97A 3WA9B 5DNMD 4G92C 4NE6A 5B33B 3LJAD 4X23B 3UTAB 4LD9A 3VH6A 5AV9A 5AV8C 3B6GC 3LELC 1KX5D 3W99B 3VH5T 5BNXB 5AVCA 4JJNB 3AYWC 3MNNB 3UT9A 4H9NB 5CPKA 4WU9C 3X1TB 3NQJA 3C1CA 1F66C 1JFIB 3W98D 3TU4C 1P3KD 3KWQB 3X1VC 1TAFA 1S32A 5E5AD 3RELB 3AZMA 5AVBD 5DNMC 3AV2B 3LJAC 2IO5B 1P3GD 1M18B 3VH6T 5B2IB 3AV1D 2F8ND 5FUGB 3X1SB 1M19B 4YS3D 5AV8A 5AV6B 4UUZA 4J8VB 3B6GA 3LELA 4J8XD 4J8WD 5C3IC 1EQZD 5B31B 4KGCD 1TZYB 1H3OB 4KHAA 3AZND 5B1LB 3NQUA 1P3FC 3O62B 3W98C 3AYWA 5F99B 1P3KC 3B6FB 3MGQB 5E5AC 3LZ0D 4WU9A 5AVBC 5AV6D 3W96B 4H9PA 1P3GC 2AROB 1F66A 3TU4A 3AZHD 5KDMB 3X1VA 3WAAB 3AV1C 3UTBD 5CPJD 5DNMA 5B1MB 4CAYB 3LJAA 3AZJC 3MGQD 3WKJD 4XZQC 4J8WC 1EQZC 5B40B 3AZKC 4YM6B 1A7WA 3B0DB 4LD9B 3LZ1D 1U35B 3LZ0C 1AOID 1BH9B 1P3FA 4CSRA 4WU8D 1ZLAD 5GXQB 3W98A 1P3KA 5B40D 3AZHC 4Z66D 5E5AA 3UTBC 5JA4B 5AV5D 2HUEB 5CPJC 5AVBA 1P3LB 2F8NG 5B2JB 4J8UC 3AFAD 1P3GA 5B32B 2JSSA 5BNVA 2NZDD 3AV1A 5GT3D 2F8NA 1P3MB 3WKJC 4ZUXC 1BH8A 1P3AD 4NE5A 3AZJA 4H9QB 2HIOB 5GSUB 4XZQA 4J8WA 1EQZA 3AZKA 2NQBC 5BO0A 3LZ1C 3X1UB 1P3OB 3A6ND 1HQ3D 3REID 2PYOB 4EO5C 1ZLAC 4G92B 4Z66C 2BYMB 3LZ0A 5AV8B 5AV5C 5CHLB 2HIOD 4WNNB 4QLCD 3AFAC 3C1BB 3AZHA 1P34D 4KUDB 2NZDC 1KX3B 3KXBB 1ID3B 3UTBA 5CPJA 1P3OD 4J8UA 1P3AC 4R8PD 1P3BD 2PYOD 3KUYD 3WKJA 4ZUXA 5DNND 4H9RB 5JRGC 5B24B 3AZEB 3AZGD 5B0YC 3A6NC 4G91B 1HQ3C 5CP6B 3KXBD 5G49B 2NQBA 3LZ1A 1KX4D 4Z2MH 3REHD 3AZIB 3AN2D 4QLCC 1B6WA 1M1AD 1ZLAA 3WA9D 4E45A 5AY8B 5GT0B 4Z66A 1P34C 3MVDC 5B33D 4X23D 5AV5A 3UTAD 5CPIB 4R8PC 3AFAA 5CP6D 1P3BC 2NZDA 2F8NH 3KUYC 4Z5TB 3W99D 3AZLB 5DNNC 1P3AA 3AZID 1P3FB 2FJ7B 5AY8D 3AZGC 1R4VA 4JJND 3MNND 5B32G 2CV5B 1KX5C 1N1JA 2BYKB 5JRGA 3X1TD 1KX4C 3REHC 5B0YA 3A6NA 1HQ3A 3AN2C 3KWQD 1M1AC 2YFWB 3WA9C 4ZBJB 3RELD 4AWLB 3AV2D 2YFVA 5B33C 3AZJB 4X23C 2FJ7D 1M18D 4QLCA 4XZQB 5B2ID 3X1SD 2CV5D 1P34A 2LY8A 1M19D 3MVDA 3W99C 1P3PB 4R8PA 3REJB 1P3BA 4J8VD 1WWSA 3REKB 5B0ZB 3KUYA 3MGPB 4JJNC 5B31D 3MNNC 5DNNA 1TZYD 2L5AA 5B1LD 3MGSB 3X1TC 4YS3C 3AZGA 3O62D 4E44A 5F99D 3B6FD 3MGRB 3AZFB 4J8XC 3RELC 3WTPB 1KX5A 4XUJB 3AV2C 3W96D 1KX4A 4KGCC 3REHA 2IO5C 1P3IB 2AROD 4NFTA 3MGPD 3AN2A 3AZNC 1M18C 5B2IC 1M1AA 3WAAD 3W97B 3WA9A 3X1SC 1M19C 5B1MD 5B33A 4X23A 5AV9B 5AV6C 2NQBB 4XUJD 5B31C 3W99A 5BNXA 4YM6D 5B1LC 5AVCB 3O62C 4JJNA 3MNNA 5F99C 4LD9D 4H9OA 3MGQC 1U35D 3UT9B 4H9NA 4WZSB 5CPKB 3W96C 3X1TA 4YS3A 3NQJB 4HGAB 2AROC 3C1CB 1JFIA 5GXQD 1TAFB 3WAAC 1S32B 4J8XA 3RELA 3AZMB 1P3LD 3AV2A 5B1MC 5B2JD 4KGCA 1M18A 3AZNA 5B32D 5B2IA 1AOIC 1BFMA 1B67A 3UT9D 5FUGA 3X1SA 4WU8C 1P3MD 1M19A 5CPKD 5B40C 5B31G 5AV6A 4UUZB 3V9RA 5GSUD 1KU5A 3B6GB 3LELB 3R45A 2CWEA 5B31A 3B0BA 1U35C 5GT3C 3X1UD 4KHAB 2F8NK 5B1LA 3NQUB 3O62A 3AYWB 5GXQC 5F99A 3MVDB 3MGQA 5AV8D 4WU9B 1P3LC 3W96A 4H9PB 5B2JC 3B6GD 2AROA 1F66B 3C1BD 3TU4B 5B32C 3X1VB 4KUDD 3WAAA 3REIC 1WWIA 1KX3D 4H9SC 1ID3D 1P3MC 5DNMB 5B1MA 4CAYA 3LJAB 1AOIA 2HIOC 5GSUC 4WU8A 1KX5B 5B40A 5B24D 3X1UC 3AZED 1P3OC 1ULYA 2PYOC 5C3IB 1U35A 5GT3A 1BH9A 4CSRB 3W98B 3C1BC 5GXQA 5GT0D 1P3KB 3VH6W 4KUDC 5E5AB 1KX3C 3KXBC 1ID3C 5JA4A 5AVBB 1P3LA 5B2JA 5CPID 1P3GB 4DRBA 5B32A 5BNVB 5BS7C 3REIA 4H9OB 4Z5TD 4H9SA 4DRAA 3AV1B 2F8NB 1P3MA 3AZLD 1F1EA 1BH8B 4YS3B 1P3FD 3UTAC 5B24C 3AZEC 4H9QA 4G91C 2HIOA 5GSUA 5CP6C 4J8XB 4J8WB 1EQZB 3AZKB 3B0CW 4KGCB 5BO0B 3X1UA 1P3OA 3AZNB 3AZIC 2PYOA 5AY8C 5GT0C 2BYMA 3LZ0B 3AZJD 3V9RB 5CPIC 4WNNA 4XZQD 3R45B 3C1BA 3AZHB 3AZKD 4KUDA 5BT1D 4WV4B 1KX3A 4Z5TC 3KXBA 3KWQC 3UTBB 5CPJB 1ID3A 3AZLC 1HTAA 1P3PD 4J8UB 3REJD 2FJ7C 3REKD 3B0CT 5B0ZD 5BS7A 3WKJB 4ZUXB 4H9RA 2CV5C 3MGSD 3UTAA 5B24A 3AZEA 5CP6A 3WTPE 3MGRD 4J8VC 5G49A 3AZFD 1Q9CA 2RVQD 4ZBJC 3WTPD 4AWLC 3LZ1B 4J8UD 1AOIB 1TZYC 1P3ID 3AZIA
chains in the Genus database with same CATH superfamily
4EO5B 4WU8B 1ZLAB 3W97D 5AY8A 4ZUXD 5GT0A 4Z66B 5BT1C 3B6FC 5AV5B 5AV9D 1P3PC 5CPIA 3AFAB 3REJC 4M6BA 4Z2MG 3REKC 2NQBD 5B0ZC 2NZDB 3MGPC 4Z5TA 3KWQA 5GT3B 3AZLA 1P3AB 3MGSC 2FJ7A 5AVCD 3MGRC 3AZFC 2RVQC 2CV5A 3WTPC 1N1JB 2BYKA 4XUJC 5JRGB 2JE5A 5B0YB 3A6NB 4YM6C 1P3IC 3C1CD 1HQ3B 4NE3A 3REIB 4J8VA 1S32D 2YFWA 3W97C 3B0DC 3AZMD 3KSYA 2YFVB 4LD9C 1TZYA 1H3OA 5AV9C 4QLCB 1P34B 3B6FA 5JRGD 5B0YD 1P3PA 2HUEC 4R8PB 3REJA 1P3BB 3LELD 5AVCC 5B0ZA 3KUYB 3REKA 3VH5A 3MGPA 5KDMA 5DNNB 2W8SA 3UT9C 5CPKC 3MGSA 3VH5W 3AZGB 4HGAC 3C1CC 3AYWD 3MVDD 3MGRA 1S32C 3AZFA 3AZMC 3WTPA 4XUJA 4WU9D 1KX4B 3REHB 4YM6A 1P3IA 1F66D 3TU4D 3AN2B 3X1VD 1M1AB 3W97A 3WA9B 5DNMD 4G92C 4NE6A 5B33B 3LJAD 4X23B 3EPLA 3H0RC 3UTAB 3VH6A 5AV9A 4LD9A 5AV8C 3B6GC 3LELC 1KX5D 3W99B 3VH5T 5BNXB 4DQYB 5AVCA 4JJNB 3AYWC 3MNNB 3UT9A 4H9NB 5CPKA 4WU9C 3X1TB 3NQJA 3EPJA 3C1CA 1F66C 1JFIB 3W98D 3TU4C 1P3KD 3KWQB 3X1VC 1TAFA 1S32A 5E5AD 3RELB 3AZMA 5AVBD 5DNMC 3AV2B 3LJAC 2IO5B 1P3GD 1M18B 3VH6T 5B2IB 3AV1D 2F8ND 5FUGB 3X1SB 1M19B 2ZY4A 4YS3D 5AV8A 5AV6B 4UUZA 4J8VB 3B6GA 3LELA 4J8XD 4J8WD 5C3IC 1EQZD 2JCHA 5B31B 4KGCD 1TZYB 1H3OB 4KHAA 3AZND 5B1LB 3NQUA 1P3FC 3O62B 3W98C 3AYWA 3A1IA 5F99B 1P3KC 3B6FB 3MGQB 5E5AC 3LZ0D 3AL0C 4WU9A 5AVBC 5AV6D 3W96B 2Y2KA 4H9PA 1P3GC 2AROB 1F66A 3TU4A 3AZHD 5KDMB 3X1VA 3WAAB 3AV1C 3UTBD 5CPJD 5DNMA 2F2AC 5B1MB 4CAYB 3LJAA 3AZJC 3MGQD 3WKJD 4XZQC 2UWXA 4J8WC 1EQZC 5B40B 3AZKC 4YM6B 1A7WA 3B0DB 4LD9B 3LZ1D 1U35B 3LZ0C 1AOID 1BH9B 1P3FA 4CSRA 2Y2IA 4WU8D 5GXQB 1ZLAD 1P3KA 3W98A 5B40D 3AZHC 4Z66D 5E5AA 3UTBC 2ZY2A 5AV5D 2HUEB 5JA4B 5AVBA 5CPJC 1P3LB 2F8NG 5B2JB 4J8UC 3AFAD 1P3GA 5B32B 2JSSA 5BNVA 2NZDD 3AV1A 5GT3D 2F8NA 1P3MB 3WKJC 4ZUXC 2Y2GA 1BH8A 1P3AD 4NE5A 3AZJA 2RIQA 4H9QB 2HIOB 2Y2MA 5GSUB 4XZQA 3EPKA 4J8WA 2BG1A 1EQZA 3AZKA 2NQBC 5BO0A 3LZ1C 3X1UB 1P3OB 3A6ND 1HQ3D 3REID 2PYOB 4EO5C 1ZLAC 4G92B 1PZRA 4Z66C 2BYMB 3LZ0A 5AV8B 5AV5C 5CHLB 2HIOD 4WNNB 4QLCD 3AFAC 3C1BB 2Y2LA 3AZHA 1P34D 4KUDB 2NZDC 2XD1A 1KX3B 3KXBB 1ID3B 3UTBA 5CPJA 1P3OD 4J8UA 1P3AC 4R8PD 1P3BD 2PYOD 3KUYD 3WKJA 4ZUXA 5DNND 4H9RB 5JRGC 5B24B 3AZEB 3AZGD 5B0YC 3A6NC 4G91B 3EG5B 1HQ3C 5CP6B 3KXBD 5G49B 2Y2NA 2NQBA 3LZ1A 1W2EA 1KX4D 4Z2MH 3REHD 2G5IC 3AZIB 3AN2D 4QLCC 1B6WA 1M1AD 1ZLAA 3WA9D 4E45A 5AY8B 5GT0B 4Z66A 1P34C 3MVDC 5B33D 4X23D 5AV5A 3UTAD 5CPIB 4R8PC 3AFAA 5CP6D 1P3BC 2NZDA 2F8NH 3KUYC 4Z5TB 3W99D 3AZLB 5DNNC 1P3AA 2ZM5A 3AZID 1P3FB 2FJ7B 5AY8D 3AZGC 1R4VA 4JJND 3MNND 5B32G 2CV5B 1KX5C 1N1JA 2BYKB 5JRGA 3X1TD 1KX4C 3REHC 5B0YA 3A6NA 1HQ3A 2Y2JA 3AN2C 3KWQD 1M1AC 2YFWB 3WA9C 4ZBJB 3RELD 4AWLB 3AV2D 2YFVA 5B33C 3AZJB 4X23C 2FJ7D 1M18D 3H0LC 4QLCA 4XZQB 5B2ID 3X1SD 2CV5D 1P34A 2LY8A 1M19D 3MVDA 3W99C 1P3PB 4R8PA 3REJB 1P3BA 4J8VD 1WWSA 3REKB 5B0ZB 3KUYA 3MGPB 4JJNC 5B31D 3MNNC 5DNNA 1TZYD 2L5AA 5B1LD 3MGSB 3X1TC 4YS3C 3AZGA 3O62D 4E44A 2FFFB 5F99D 3B6FD 3MGRB 3AZFB 4J8XC 3RELC 3WTPB 1KX5A 4XUJB 3AV2C 3W96D 1KX4A 4KGCC 3REHA 2IO5C 1P3IB 2AROD 2DF4C 4NFTA 3MGPD 3AN2A 3AZNC 1M18C 5B2IC 1M1AA 3WAAD 3W97B 3WA9A 3X1SC 1M19C 5B1MD 5B33A 4X23A 5AV9B 5AV6C 2NQBB 4XUJD 5B31C 3W99A 5BNXA 4YM6D 5B1LC 5AVCB 3O62C 4JJNA 3MNNA 5F99C 4LD9D 4H9OA 3MGQC 1U35D 3UT9B 4H9NA 4WZSB 5CPKB 3W96C 3X1TA 4YS3A 3NQJB 4HGAB 2AROC 3C1CB 1JFIA 5GXQD 1TAFB 3WAAC 1S32B 4J8XA 3RELA 3AZMB 1P3LD 3AV2A 5B1MC 5B2JD 4KGCA 3EPHA 2XD5A 4UPKA 1M18A 3AZNA 2Y2PA 5B32D 5B2IA 1AOIC 1BFMA 1B67A 3UT9D 5FUGA 3X1SA 4WU8C 1P3MD 1M19A 5CPKD 3A1KA 5B40C 1T3UA 5B31G 5AV6A 4UUZB 3V9RA 5GSUD 1KU5A 3B6GB 3LELB 3P5JB 3R45A 2CWEA 5B31A 3IP4C 3B0BA 2Y2OA 1U35C 5GT3C 3X1UD 4KHAB 2F8NK 5B1LA 3NQUB 3O62A 3AYWB 5GXQC 5F99A 3MVDB 3MGQA 5AV8D 4WU9B 1P3LC 3W96A 4H9PB 5B2JC 3B6GD 2AROA 1F66B 3C1BD 3TU4B 5B32C 3X1VB 3H0MC 3WAAA 4KUDD 3REIC 1WWIA 1KX3D 4H9SC 1ID3D 1P3MC 5DNMB 5B1MA 4CAYA 3LJAB 1AOIA 2VQRA 2HIOC 5GSUC 4WU8A 1KX5B 5B40A 5B24D 3X1UC 3AZED 1P3OC 1ULYA 2PYOC 5C3IB 2ZY3A 1U35A 5GT3A 2ZY5A 1BH9A 4CSRB 3W98B 2Y2HA 5GXQA 3C1BC 5GT0D 1P3KB 3VH6W 4KUDC 5E5AB 1KX3C 3KXBC 1ID3C 5JA4A 5AVBB 1P3LA 5B2JA 5CPID 1P3GB 4DRBA 5B32A 5BNVB 5BS7C 3REIA 4H9OB 4Z5TD 4H9SA 4DRAA 3AV1B 2F8NB 1P3MA 3AZLD 1F1EA 1BH8B 4YS3B 1P3FD 3UTAC 5B24C 3AZEC 3F6TA 4H9QA 4G91C 2HIOA 5GSUA 5CP6C 4J8XB 4J8WB 1EQZB 3AZKB 3B0CW 4KGCB 5BO0B 4WJ3C 1Z2CB 3X1UA 1P3OA 3AZNB 3AZIC 2PYOA 2Y2QA 5AY8C 5GT0C 2G5HC 2BYMA 3LZ0B 3AZJD 2J8PA 3V9RB 5CPIC 4WNNA 4XZQD 3R45B 3C1BA 3AZHB 3AZKD 4KUDA 5BT1D 4WV4B 1KX3A 4Z5TC 3KXBA 3KWQC 3UTBB 5CPJB 1ID3A 3AZLC 1HTAA 1P3PD 4J8UB 3REJD 3FDDA 2FJ7C 3REKD 3B0CT 5B0ZD 5BS7A 3WKJB 4ZUXB 4H9RA 3KFUG 2CV5C 2DQNC 3MGSD 3UTAA 5B24A 3AZEA 5CP6A 3WTPE 3MGRD 4J8VC 5G49A 3AZFD 1Q9CA 2RVQD 4ZBJC 3WTPD 4AWLC 3LZ1B 4J8UD 1AOIB 1TZYC 1P3ID 3AZIA
chains in the Genus database with same CATH topology
4EO5B 4WU8B 1ZLAB 3W97D 5AY8A 4ZUXD 5GT0A 4Z66B 5BT1C 3B6FC 5AV5B 5AV9D 1P3PC 5CPIA 3AFAB 3REJC 4M6BA 4Z2MG 3REKC 2NQBD 5B0ZC 2NZDB 3MGPC 4Z5TA 3KWQA 5GT3B 3AZLA 1P3AB 3MGSC 2FJ7A 5AVCD 3MGRC 3AZFC 2RVQC 2CV5A 3WTPC 1N1JB 2BYKA 4XUJC 5JRGB 2JE5A 5B0YB 3A6NB 4YM6C 1P3IC 3C1CD 1HQ3B 4NE3A 3REIB 4J8VA 1S32D 2YFWA 3W97C 3B0DC 3AZMD 3KSYA 2YFVB 4LD9C 1TZYA 1H3OA 5AV9C 4QLCB 1P34B 3B6FA 5JRGD 5B0YD 1P3PA 2HUEC 4R8PB 3REJA 1P3BB 3LELD 5AVCC 5B0ZA 3KUYB 3REKA 3VH5A 3MGPA 5KDMA 5DNNB 2W8SA 3UT9C 5CPKC 3MGSA 3VH5W 3AZGB 4HGAC 3C1CC 3AYWD 3MVDD 3MGRA 1S32C 3AZFA 3AZMC 3WTPA 4XUJA 4WU9D 1KX4B 3REHB 4YM6A 1P3IA 1F66D 3TU4D 3AN2B 3X1VD 1M1AB 3W97A 3WA9B 5DNMD 4G92C 4NE6A 5B33B 3LJAD 4X23B 3EPLA 3H0RC 3UTAB 3VH6A 5AV9A 4LD9A 5AV8C 3B6GC 3LELC 1KX5D 3W99B 3VH5T 5BNXB 4DQYB 5AVCA 4JJNB 3AYWC 3MNNB 3UT9A 4H9NB 5CPKA 4WU9C 3X1TB 3NQJA 3EPJA 3C1CA 1F66C 1JFIB 3W98D 3TU4C 1P3KD 3KWQB 3X1VC 1TAFA 1S32A 5E5AD 3RELB 3AZMA 5AVBD 5DNMC 3AV2B 3LJAC 2IO5B 1P3GD 1M18B 3VH6T 5B2IB 3AV1D 2F8ND 5FUGB 3X1SB 1M19B 2ZY4A 4YS3D 5AV8A 5AV6B 4UUZA 4J8VB 3B6GA 3LELA 4J8XD 4J8WD 5C3IC 1EQZD 2JCHA 5B31B 4KGCD 1TZYB 1H3OB 4KHAA 3AZND 5B1LB 3NQUA 1P3FC 3O62B 3W98C 3AYWA 3A1IA 5F99B 1P3KC 3B6FB 3MGQB 5E5AC 3LZ0D 3AL0C 4WU9A 5AVBC 5AV6D 3W96B 2Y2KA 4H9PA 1P3GC 2AROB 1F66A 3TU4A 3AZHD 5KDMB 3X1VA 3WAAB 3AV1C 3UTBD 5CPJD 5DNMA 2F2AC 5B1MB 4CAYB 3LJAA 3AZJC 3MGQD 3WKJD 4XZQC 2UWXA 4J8WC 1EQZC 5B40B 3AZKC 4YM6B 1A7WA 3B0DB 4LD9B 3LZ1D 1U35B 3LZ0C 1AOID 1BH9B 1P3FA 4CSRA 2Y2IA 4WU8D 5GXQB 1ZLAD 1P3KA 3W98A 5B40D 3AZHC 4Z66D 5E5AA 3UTBC 2ZY2A 5AV5D 2HUEB 5JA4B 5AVBA 5CPJC 1P3LB 2F8NG 5B2JB 4J8UC 3AFAD 1P3GA 5B32B 2JSSA 5BNVA 2NZDD 3AV1A 5GT3D 2F8NA 1P3MB 3WKJC 4ZUXC 2Y2GA 1BH8A 1P3AD 4NE5A 3AZJA 2RIQA 4H9QB 2HIOB 2Y2MA 5GSUB 4XZQA 3EPKA 4J8WA 2BG1A 1EQZA 3AZKA 2NQBC 5BO0A 3LZ1C 3X1UB 1P3OB 3A6ND 1HQ3D 3REID 2PYOB 4EO5C 1ZLAC 4G92B 1PZRA 4Z66C 2BYMB 3LZ0A 5AV8B 5AV5C 5CHLB 2HIOD 4WNNB 4QLCD 3AFAC 3C1BB 2Y2LA 3AZHA 1P34D 4KUDB 2NZDC 2XD1A 1KX3B 3KXBB 1ID3B 3UTBA 5CPJA 1P3OD 4J8UA 1P3AC 4R8PD 1P3BD 2PYOD 3KUYD 3WKJA 4ZUXA 5DNND 4H9RB 5JRGC 5B24B 3AZEB 3AZGD 5B0YC 3A6NC 4G91B 3EG5B 1HQ3C 5CP6B 3KXBD 5G49B 2Y2NA 2NQBA 3LZ1A 1W2EA 1KX4D 4Z2MH 3REHD 2G5IC 3AZIB 3AN2D 4QLCC 1B6WA 1M1AD 1ZLAA 3WA9D 4E45A 5AY8B 5GT0B 4Z66A 1P34C 3MVDC 5B33D 4X23D 5AV5A 3UTAD 5CPIB 4R8PC 3AFAA 5CP6D 1P3BC 2NZDA 2F8NH 3KUYC 4Z5TB 3W99D 3AZLB 5DNNC 1P3AA 2ZM5A 3AZID 1P3FB 2FJ7B 5AY8D 3AZGC 1R4VA 4JJND 3MNND 5B32G 2CV5B 1KX5C 1N1JA 2BYKB 5JRGA 3X1TD 1KX4C 3REHC 5B0YA 3A6NA 1HQ3A 2Y2JA 3AN2C 3KWQD 1M1AC 2YFWB 3WA9C 4ZBJB 3RELD 4AWLB 3AV2D 2YFVA 5B33C 3AZJB 4X23C 2FJ7D 1M18D 3H0LC 4QLCA 4XZQB 5B2ID 3X1SD 2CV5D 1P34A 2LY8A 1M19D 3MVDA 3W99C 1P3PB 4R8PA 3REJB 1P3BA 4J8VD 1WWSA 3REKB 5B0ZB 3KUYA 3MGPB 4JJNC 5B31D 3MNNC 5DNNA 1TZYD 2L5AA 5B1LD 3MGSB 3X1TC 4YS3C 3AZGA 3O62D 4E44A 2FFFB 5F99D 3B6FD 3MGRB 3AZFB 4J8XC 3RELC 3WTPB 1KX5A 4XUJB 3AV2C 3W96D 1KX4A 4KGCC 3REHA 2IO5C 1P3IB 2AROD 2DF4C 4NFTA 3MGPD 3AN2A 3AZNC 1M18C 5B2IC 1M1AA 3WAAD 3W97B 3WA9A 3X1SC 1M19C 5B1MD 5B33A 4X23A 5AV9B 5AV6C 2NQBB 4XUJD 5B31C 3W99A 5BNXA 4YM6D 5B1LC 5AVCB 3O62C 4JJNA 3MNNA 5F99C 4LD9D 4H9OA 3MGQC 1U35D 3UT9B 4H9NA 4WZSB 5CPKB 3W96C 3X1TA 4YS3A 3NQJB 4HGAB 2AROC 3C1CB 1JFIA 5GXQD 1TAFB 3WAAC 1S32B 4J8XA 3RELA 3AZMB 1P3LD 3AV2A 5B1MC 5B2JD 4KGCA 3EPHA 2XD5A 4UPKA 1M18A 3AZNA 2Y2PA 5B32D 5B2IA 1AOIC 1BFMA 1B67A 3UT9D 5FUGA 3X1SA 4WU8C 1P3MD 1M19A 5CPKD 3A1KA 5B40C 1T3UA 5B31G 5AV6A 4UUZB 3V9RA 5GSUD 1KU5A 3B6GB 3LELB 3P5JB 3R45A 2CWEA 5B31A 3IP4C 3B0BA 2Y2OA 1U35C 5GT3C 3X1UD 4KHAB 2F8NK 5B1LA 3NQUB 3O62A 3AYWB 5GXQC 5F99A 3MVDB 3MGQA 5AV8D 4WU9B 1P3LC 3W96A 4H9PB 5B2JC 3B6GD 2AROA 1F66B 3C1BD 3TU4B 5B32C 3X1VB 3H0MC 3WAAA 4KUDD 3REIC 1WWIA 1KX3D 4H9SC 1ID3D 1P3MC 5DNMB 5B1MA 4CAYA 3LJAB 1AOIA 2VQRA 2HIOC 5GSUC 4WU8A 1KX5B 5B40A 5B24D 3X1UC 3AZED 1P3OC 1ULYA 2PYOC 5C3IB 2ZY3A 1U35A 5GT3A 2ZY5A 1BH9A 4CSRB 3W98B 2Y2HA 5GXQA 3C1BC 5GT0D 1P3KB 3VH6W 4KUDC 5E5AB 1KX3C 3KXBC 1ID3C 5JA4A 5AVBB 1P3LA 5B2JA 5CPID 1P3GB 4DRBA 5B32A 5BNVB 5BS7C 3REIA 4H9OB 4Z5TD 4H9SA 4DRAA 3AV1B 2F8NB 1P3MA 3AZLD 1F1EA 1BH8B 4YS3B 1P3FD 3UTAC 5B24C 3AZEC 3F6TA 4H9QA 4G91C 2HIOA 5GSUA 5CP6C 4J8XB 4J8WB 1EQZB 3AZKB 3B0CW 4KGCB 5BO0B 4WJ3C 1Z2CB 3X1UA 1P3OA 3AZNB 3AZIC 2PYOA 2Y2QA 5AY8C 5GT0C 2G5HC 2BYMA 3LZ0B 3AZJD 2J8PA 3V9RB 5CPIC 4WNNA 4XZQD 3R45B 3C1BA 3AZHB 3AZKD 4KUDA 5BT1D 4WV4B 1KX3A 4Z5TC 3KXBA 3KWQC 3UTBB 5CPJB 1ID3A 3AZLC 1HTAA 1P3PD 4J8UB 3REJD 3FDDA 2FJ7C 3REKD 3B0CT 5B0ZD 5BS7A 3WKJB 4ZUXB 4H9RA 3KFUG 2CV5C 2DQNC 3MGSD 3UTAA 5B24A 3AZEA 5CP6A 3WTPE 3MGRD 4J8VC 5G49A 3AZFD 1Q9CA 2RVQD 4ZBJC 3WTPD 4AWLC 3LZ1B 4J8UD 1AOIB 1TZYC 1P3ID 3AZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO5 B;  4WU8 B;  1ZLA B;  3W97 D;  5AY8 A;  4ZUX D;  5GT0 A;  4Z66 B;  5BT1 C;  3B6F C;  5AV5 B;  5AV9 D;  1P3P C;  5CPI A;  3AFA B;  3REJ C;  4M6B A;  4Z2M G;  3REK C;  2NQB D;  5B0Z C;  2NZD B;  3MGP C;  4Z5T A;  3KWQ A;  5GT3 B;  3AZL A;  1P3A B;  3MGS C;  2FJ7 A;  5AVC D;  3MGR C;  3AZF C;  2RVQ C;  2CV5 A;  3WTP C;  1N1J B;  2BYK A;  4XUJ C;  5JRG B;  5B0Y B;  3A6N B;  4YM6 C;  1P3I C;  3C1C D;  1HQ3 B;  4NE3 A;  3REI B;  4J8V A;  1S32 D;  2YFW A;  3W97 C;  3B0D C;  3AZM D;  3KSY A;  2YFV B;  4LD9 C;  1TZY A;  1H3O A;  5AV9 C;  4QLC B;  1P34 B;  3B6F A;  5JRG D;  5B0Y D;  1P3P A;  2HUE C;  4R8P B;  3REJ A;  1P3B B;  3LEL D;  5AVC C;  5B0Z A;  3KUY B;  3REK A;  3VH5 A;  3MGP A;  5KDM A;  5DNN B;  3UT9 C;  5CPK C;  3MGS A;  3VH5 W;  3AZG B;  4HGA C;  3C1C C;  3AYW D;  3MVD D;  3MGR A;  1S32 C;  3AZF A;  3AZM C;  3WTP A;  4XUJ A;  4WU9 D;  1KX4 B;  3REH B;  4YM6 A;  1P3I A;  1F66 D;  3TU4 D;  3AN2 B;  3X1V D;  1M1A B;  3W97 A;  3WA9 B;  5DNM D;  4G92 C;  4NE6 A;  5B33 B;  3LJA D;  4X23 B;  3UTA B;  4LD9 A;  3VH6 A;  5AV9 A;  5AV8 C;  3B6G C;  3LEL C;  1KX5 D;  3W99 B;  3VH5 T;  5BNX B;  5AVC A;  4JJN B;  3AYW C;  3MNN B;  3UT9 A;  4H9N B;  5CPK A;  4WU9 C;  3X1T B;  3NQJ A;  3C1C A;  1F66 C;  1JFI B;  3W98 D;  3TU4 C;  1P3K D;  3KWQ B;  3X1V C;  1TAF A;  1S32 A;  5E5A D;  3REL B;  3AZM A;  5AVB D;  5DNM C;  3AV2 B;  3LJA C;  2IO5 B;  1P3G D;  1M18 B;  3VH6 T;  5B2I B;  3AV1 D;  2F8N D;  5FUG B;  3X1S B;  1M19 B;  4YS3 D;  5AV8 A;  5AV6 B;  4UUZ A;  4J8V B;  3B6G A;  3LEL A;  4J8X D;  4J8W D;  5C3I C;  1EQZ D;  5B31 B;  4KGC D;  1TZY B;  1H3O B;  4KHA A;  3AZN D;  5B1L B;  3NQU A;  1P3F C;  3O62 B;  3W98 C;  3AYW A;  5F99 B;  1P3K C;  3B6F B;  3MGQ B;  5E5A C;  3LZ0 D;  4WU9 A;  5AVB C;  5AV6 D;  3W96 B;  4H9P A;  1P3G C;  2ARO B;  1F66 A;  3TU4 A;  3AZH D;  5KDM B;  3X1V A;  3WAA B;  3AV1 C;  3UTB D;  5CPJ D;  5DNM A;  5B1M B;  4CAY B;  3LJA A;  3AZJ C;  3MGQ D;  3WKJ D;  4XZQ C;  4J8W C;  1EQZ C;  5B40 B;  3AZK C;  4YM6 B;  1A7W A;  3B0D B;  4LD9 B;  3LZ1 D;  1U35 B;  3LZ0 C;  1AOI D;  1BH9 B;  1P3F A;  4CSR A;  4WU8 D;  1ZLA D;  5GXQ B;  3W98 A;  1P3K A;  5B40 D;  3AZH C;  4Z66 D;  5E5A A;  3UTB C;  5JA4 B;  5AV5 D;  2HUE B;  5CPJ C;  5AVB A;  1P3L B;  2F8N G;  5B2J B;  4J8U C;  3AFA D;  1P3G A;  5B32 B;  2JSS A;  5BNV A;  2NZD D;  3AV1 A;  5GT3 D;  2F8N A;  1P3M B;  3WKJ C;  4ZUX C;  1BH8 A;  1P3A D;  4NE5 A;  3AZJ A;  4H9Q B;  2HIO B;  5GSU B;  4XZQ A;  4J8W A;  1EQZ A;  3AZK A;  2NQB C;  5BO0 A;  3LZ1 C;  3X1U B;  1P3O B;  3A6N D;  1HQ3 D;  3REI D;  2PYO B;  4EO5 C;  1ZLA C;  4G92 B;  4Z66 C;  2BYM B;  3LZ0 A;  5AV8 B;  5AV5 C;  5CHL B;  2HIO D;  4WNN B;  4QLC D;  3AFA C;  3C1B B;  3AZH A;  1P34 D;  4KUD B;  2NZD C;  1KX3 B;  3KXB B;  1ID3 B;  3UTB A;  5CPJ A;  1P3O D;  4J8U A;  1P3A C;  4R8P D;  1P3B D;  2PYO D;  3KUY D;  3WKJ A;  4ZUX A;  5DNN D;  4H9R B;  5JRG C;  5B24 B;  3AZE B;  3AZG D;  5B0Y C;  3A6N C;  4G91 B;  1HQ3 C;  5CP6 B;  3KXB D;  5G49 B;  2NQB A;  3LZ1 A;  1KX4 D;  4Z2M H;  3REH D;  3AZI B;  3AN2 D;  4QLC C;  1B6W A;  1M1A D;  1ZLA A;  3WA9 D;  4E45 A;  5AY8 B;  5GT0 B;  4Z66 A;  1P34 C;  3MVD C;  5B33 D;  4X23 D;  5AV5 A;  3UTA D;  5CPI B;  4R8P C;  3AFA A;  5CP6 D;  1P3B C;  2NZD A;  2F8N H;  3KUY C;  4Z5T B;  3W99 D;  3AZL B;  5DNN C;  1P3A A;  3AZI D;  1P3F B;  2FJ7 B;  5AY8 D;  3AZG C;  1R4V A;  4JJN D;  3MNN D;  5B32 G;  2CV5 B;  1KX5 C;  1N1J A;  2BYK B;  5JRG A;  3X1T D;  1KX4 C;  3REH C;  5B0Y A;  3A6N A;  1HQ3 A;  3AN2 C;  3KWQ D;  1M1A C;  2YFW B;  3WA9 C;  4ZBJ B;  3REL D;  4AWL B;  3AV2 D;  2YFV A;  5B33 C;  3AZJ B;  4X23 C;  2FJ7 D;  1M18 D;  4QLC A;  4XZQ B;  5B2I D;  3X1S D;  2CV5 D;  1P34 A;  2LY8 A;  1M19 D;  3MVD A;  3W99 C;  1P3P B;  4R8P A;  3REJ B;  1P3B A;  4J8V D;  1WWS A;  3REK B;  5B0Z B;  3KUY A;  3MGP B;  4JJN C;  5B31 D;  3MNN C;  5DNN A;  1TZY D;  2L5A A;  5B1L D;  3MGS B;  3X1T C;  4YS3 C;  3AZG A;  3O62 D;  4E44 A;  5F99 D;  3B6F D;  3MGR B;  3AZF B;  4J8X C;  3REL C;  3WTP B;  1KX5 A;  4XUJ B;  3AV2 C;  3W96 D;  1KX4 A;  4KGC C;  3REH A;  2IO5 C;  1P3I B;  2ARO D;  4NFT A;  3MGP D;  3AN2 A;  3AZN C;  1M18 C;  5B2I C;  1M1A A;  3WAA D;  3W97 B;  3WA9 A;  3X1S C;  1M19 C;  5B1M D;  5B33 A;  4X23 A;  5AV9 B;  5AV6 C;  2NQB B;  4XUJ D;  5B31 C;  3W99 A;  5BNX A;  4YM6 D;  5B1L C;  5AVC B;  3O62 C;  4JJN A;  3MNN A;  5F99 C;  4LD9 D;  4H9O A;  3MGQ C;  1U35 D;  3UT9 B;  4H9N A;  4WZS B;  5CPK B;  3W96 C;  3X1T A;  4YS3 A;  3NQJ B;  4HGA B;  2ARO C;  3C1C B;  1JFI A;  5GXQ D;  1TAF B;  3WAA C;  1S32 B;  4J8X A;  3REL A;  3AZM B;  1P3L D;  3AV2 A;  5B1M C;  5B2J D;  4KGC A;  1M18 A;  3AZN A;  5B32 D;  5B2I A;  1AOI C;  1BFM A;  1B67 A;  3UT9 D;  5FUG A;  3X1S A;  4WU8 C;  1P3M D;  1M19 A;  5CPK D;  5B40 C;  5B31 G;  5AV6 A;  4UUZ B;  3V9R A;  5GSU D;  1KU5 A;  3B6G B;  3LEL B;  3R45 A;  2CWE A;  5B31 A;  3B0B A;  1U35 C;  5GT3 C;  3X1U D;  4KHA B;  2F8N K;  5B1L A;  3NQU B;  3O62 A;  3AYW B;  5GXQ C;  5F99 A;  3MVD B;  3MGQ A;  5AV8 D;  4WU9 B;  1P3L C;  3W96 A;  4H9P B;  5B2J C;  3B6G D;  2ARO A;  1F66 B;  3C1B D;  3TU4 B;  5B32 C;  3X1V B;  4KUD D;  3WAA A;  3REI C;  1WWI A;  1KX3 D;  4H9S C;  1ID3 D;  1P3M C;  5DNM B;  5B1M A;  4CAY A;  3LJA B;  1AOI A;  2HIO C;  5GSU C;  4WU8 A;  1KX5 B;  5B40 A;  5B24 D;  3X1U C;  3AZE D;  1P3O C;  1ULY A;  2PYO C;  5C3I B;  1U35 A;  5GT3 A;  1BH9 A;  4CSR B;  3W98 B;  3C1B C;  5GXQ A;  5GT0 D;  1P3K B;  3VH6 W;  4KUD C;  5E5A B;  1KX3 C;  3KXB C;  1ID3 C;  5JA4 A;  5AVB B;  1P3L A;  5B2J A;  5CPI D;  1P3G B;  4DRB A;  5B32 A;  5BNV B;  5BS7 C;  3REI A;  4H9O B;  4Z5T D;  4H9S A;  4DRA A;  3AV1 B;  2F8N B;  1P3M A;  3AZL D;  1F1E A;  1BH8 B;  4YS3 B;  1P3F D;  3UTA C;  5B24 C;  3AZE C;  4H9Q A;  4G91 C;  2HIO A;  5GSU A;  5CP6 C;  4J8X B;  4J8W B;  1EQZ B;  3AZK B;  3B0C W;  4KGC B;  5BO0 B;  3X1U A;  1P3O A;  3AZN B;  3AZI C;  2PYO A;  5AY8 C;  5GT0 C;  2BYM A;  3LZ0 B;  3AZJ D;  3V9R B;  5CPI C;  4WNN A;  4XZQ D;  3R45 B;  3C1B A;  3AZH B;  3AZK D;  4KUD A;  5BT1 D;  4WV4 B;  1KX3 A;  4Z5T C;  3KXB A;  3KWQ C;  3UTB B;  5CPJ B;  1ID3 A;  3AZL C;  1HTA A;  1P3P D;  4J8U B;  3REJ D;  2FJ7 C;  3REK D;  3B0C T;  5B0Z D;  5BS7 A;  3WKJ B;  4ZUX B;  4H9R A;  2CV5 C;  3MGS D;  3UTA A;  5B24 A;  3AZE A;  5CP6 A;  3WTP E;  3MGR D;  4J8V C;  5G49 A;  3AZF D;  1Q9C A;  2RVQ D;  4ZBJ C;  3WTP D;  4AWL C;  3LZ1 B;  4J8U D;  1AOI B;  1TZY C;  1P3I D;  3AZI A; 
#chains in the Genus database with same CATH topology
 4EO5 B;  4WU8 B;  1ZLA B;  3W97 D;  5AY8 A;  4ZUX D;  5GT0 A;  4Z66 B;  5BT1 C;  3B6F C;  5AV5 B;  5AV9 D;  1P3P C;  5CPI A;  3AFA B;  3REJ C;  4M6B A;  4Z2M G;  3REK C;  2NQB D;  5B0Z C;  2NZD B;  3MGP C;  4Z5T A;  3KWQ A;  5GT3 B;  3AZL A;  1P3A B;  3MGS C;  2FJ7 A;  5AVC D;  3MGR C;  3AZF C;  2RVQ C;  2CV5 A;  3WTP C;  1N1J B;  2BYK A;  4XUJ C;  5JRG B;  2JE5 A;  5B0Y B;  3A6N B;  4YM6 C;  1P3I C;  3C1C D;  1HQ3 B;  4NE3 A;  3REI B;  4J8V A;  1S32 D;  2YFW A;  3W97 C;  3B0D C;  3AZM D;  3KSY A;  2YFV B;  4LD9 C;  1TZY A;  1H3O A;  5AV9 C;  4QLC B;  1P34 B;  3B6F A;  5JRG D;  5B0Y D;  1P3P A;  2HUE C;  4R8P B;  3REJ A;  1P3B B;  3LEL D;  5AVC C;  5B0Z A;  3KUY B;  3REK A;  3VH5 A;  3MGP A;  5KDM A;  5DNN B;  2W8S A;  3UT9 C;  5CPK C;  3MGS A;  3VH5 W;  3AZG B;  4HGA C;  3C1C C;  3AYW D;  3MVD D;  3MGR A;  1S32 C;  3AZF A;  3AZM C;  3WTP A;  4XUJ A;  4WU9 D;  1KX4 B;  3REH B;  4YM6 A;  1P3I A;  1F66 D;  3TU4 D;  3AN2 B;  3X1V D;  1M1A B;  3W97 A;  3WA9 B;  5DNM D;  4G92 C;  4NE6 A;  5B33 B;  3LJA D;  4X23 B;  3EPL A;  3H0R C;  3UTA B;  3VH6 A;  5AV9 A;  4LD9 A;  5AV8 C;  3B6G C;  3LEL C;  1KX5 D;  3W99 B;  3VH5 T;  5BNX B;  4DQY B;  5AVC A;  4JJN B;  3AYW C;  3MNN B;  3UT9 A;  4H9N B;  5CPK A;  4WU9 C;  3X1T B;  3NQJ A;  3EPJ A;  3C1C A;  1F66 C;  1JFI B;  3W98 D;  3TU4 C;  1P3K D;  3KWQ B;  3X1V C;  1TAF A;  1S32 A;  5E5A D;  3REL B;  3AZM A;  5AVB D;  5DNM C;  3AV2 B;  3LJA C;  2IO5 B;  1P3G D;  1M18 B;  3VH6 T;  5B2I B;  3AV1 D;  2F8N D;  5FUG B;  3X1S B;  1M19 B;  2ZY4 A;  4YS3 D;  5AV8 A;  5AV6 B;  4UUZ A;  4J8V B;  3B6G A;  3LEL A;  4J8X D;  4J8W D;  5C3I C;  1EQZ D;  2JCH A;  5B31 B;  4KGC D;  1TZY B;  1H3O B;  4KHA A;  3AZN D;  5B1L B;  3NQU A;  1P3F C;  3O62 B;  3W98 C;  3AYW A;  3A1I A;  5F99 B;  1P3K C;  3B6F B;  3MGQ B;  5E5A C;  3LZ0 D;  3AL0 C;  4WU9 A;  5AVB C;  5AV6 D;  3W96 B;  2Y2K A;  4H9P A;  1P3G C;  2ARO B;  1F66 A;  3TU4 A;  3AZH D;  5KDM B;  3X1V A;  3WAA B;  3AV1 C;  3UTB D;  5CPJ D;  5DNM A;  2F2A C;  5B1M B;  4CAY B;  3LJA A;  3AZJ C;  3MGQ D;  3WKJ D;  4XZQ C;  2UWX A;  4J8W C;  1EQZ C;  5B40 B;  3AZK C;  4YM6 B;  1A7W A;  3B0D B;  4LD9 B;  3LZ1 D;  1U35 B;  3LZ0 C;  1AOI D;  1BH9 B;  1P3F A;  4CSR A;  2Y2I A;  4WU8 D;  5GXQ B;  1ZLA D;  1P3K A;  3W98 A;  5B40 D;  3AZH C;  4Z66 D;  5E5A A;  3UTB C;  2ZY2 A;  5AV5 D;  2HUE B;  5JA4 B;  5AVB A;  5CPJ C;  1P3L B;  2F8N G;  5B2J B;  4J8U C;  3AFA D;  1P3G A;  5B32 B;  2JSS A;  5BNV A;  2NZD D;  3AV1 A;  5GT3 D;  2F8N A;  1P3M B;  3WKJ C;  4ZUX C;  2Y2G A;  1BH8 A;  1P3A D;  4NE5 A;  3AZJ A;  2RIQ A;  4H9Q B;  2HIO B;  2Y2M A;  5GSU B;  4XZQ A;  3EPK A;  4J8W A;  2BG1 A;  1EQZ A;  3AZK A;  2NQB C;  5BO0 A;  3LZ1 C;  3X1U B;  1P3O B;  3A6N D;  1HQ3 D;  3REI D;  2PYO B;  4EO5 C;  1ZLA C;  4G92 B;  1PZR A;  4Z66 C;  2BYM B;  3LZ0 A;  5AV8 B;  5AV5 C;  5CHL B;  2HIO D;  4WNN B;  4QLC D;  3AFA C;  3C1B B;  2Y2L A;  3AZH A;  1P34 D;  4KUD B;  2NZD C;  2XD1 A;  1KX3 B;  3KXB B;  1ID3 B;  3UTB A;  5CPJ A;  1P3O D;  4J8U A;  1P3A C;  4R8P D;  1P3B D;  2PYO D;  3KUY D;  3WKJ A;  4ZUX A;  5DNN D;  4H9R B;  5JRG C;  5B24 B;  3AZE B;  3AZG D;  5B0Y C;  3A6N C;  4G91 B;  3EG5 B;  1HQ3 C;  5CP6 B;  3KXB D;  5G49 B;  2Y2N A;  2NQB A;  3LZ1 A;  1W2E A;  1KX4 D;  4Z2M H;  3REH D;  2G5I C;  3AZI B;  3AN2 D;  4QLC C;  1B6W A;  1M1A D;  1ZLA A;  3WA9 D;  4E45 A;  5AY8 B;  5GT0 B;  4Z66 A;  1P34 C;  3MVD C;  5B33 D;  4X23 D;  5AV5 A;  3UTA D;  5CPI B;  4R8P C;  3AFA A;  5CP6 D;  1P3B C;  2NZD A;  2F8N H;  3KUY C;  4Z5T B;  3W99 D;  3AZL B;  5DNN C;  1P3A A;  2ZM5 A;  3AZI D;  1P3F B;  2FJ7 B;  5AY8 D;  3AZG C;  1R4V A;  4JJN D;  3MNN D;  5B32 G;  2CV5 B;  1KX5 C;  1N1J A;  2BYK B;  5JRG A;  3X1T D;  1KX4 C;  3REH C;  5B0Y A;  3A6N A;  1HQ3 A;  2Y2J A;  3AN2 C;  3KWQ D;  1M1A C;  2YFW B;  3WA9 C;  4ZBJ B;  3REL D;  4AWL B;  3AV2 D;  2YFV A;  5B33 C;  3AZJ B;  4X23 C;  2FJ7 D;  1M18 D;  3H0L C;  4QLC A;  4XZQ B;  5B2I D;  3X1S D;  2CV5 D;  1P34 A;  2LY8 A;  1M19 D;  3MVD A;  3W99 C;  1P3P B;  4R8P A;  3REJ B;  1P3B A;  4J8V D;  1WWS A;  3REK B;  5B0Z B;  3KUY A;  3MGP B;  4JJN C;  5B31 D;  3MNN C;  5DNN A;  1TZY D;  2L5A A;  5B1L D;  3MGS B;  3X1T C;  4YS3 C;  3AZG A;  3O62 D;  4E44 A;  2FFF B;  5F99 D;  3B6F D;  3MGR B;  3AZF B;  4J8X C;  3REL C;  3WTP B;  1KX5 A;  4XUJ B;  3AV2 C;  3W96 D;  1KX4 A;  4KGC C;  3REH A;  2IO5 C;  1P3I B;  2ARO D;  2DF4 C;  4NFT A;  3MGP D;  3AN2 A;  3AZN C;  1M18 C;  5B2I C;  1M1A A;  3WAA D;  3W97 B;  3WA9 A;  3X1S C;  1M19 C;  5B1M D;  5B33 A;  4X23 A;  5AV9 B;  5AV6 C;  2NQB B;  4XUJ D;  5B31 C;  3W99 A;  5BNX A;  4YM6 D;  5B1L C;  5AVC B;  3O62 C;  4JJN A;  3MNN A;  5F99 C;  4LD9 D;  4H9O A;  3MGQ C;  1U35 D;  3UT9 B;  4H9N A;  4WZS B;  5CPK B;  3W96 C;  3X1T A;  4YS3 A;  3NQJ B;  4HGA B;  2ARO C;  3C1C B;  1JFI A;  5GXQ D;  1TAF B;  3WAA C;  1S32 B;  4J8X A;  3REL A;  3AZM B;  1P3L D;  3AV2 A;  5B1M C;  5B2J D;  4KGC A;  3EPH A;  2XD5 A;  4UPK A;  1M18 A;  3AZN A;  2Y2P A;  5B32 D;  5B2I A;  1AOI C;  1BFM A;  1B67 A;  3UT9 D;  5FUG A;  3X1S A;  4WU8 C;  1P3M D;  1M19 A;  5CPK D;  3A1K A;  5B40 C;  1T3U A;  5B31 G;  5AV6 A;  4UUZ B;  3V9R A;  5GSU D;  1KU5 A;  3B6G B;  3LEL B;  3P5J B;  3R45 A;  2CWE A;  5B31 A;  3IP4 C;  3B0B A;  2Y2O A;  1U35 C;  5GT3 C;  3X1U D;  4KHA B;  2F8N K;  5B1L A;  3NQU B;  3O62 A;  3AYW B;  5GXQ C;  5F99 A;  3MVD B;  3MGQ A;  5AV8 D;  4WU9 B;  1P3L C;  3W96 A;  4H9P B;  5B2J C;  3B6G D;  2ARO A;  1F66 B;  3C1B D;  3TU4 B;  5B32 C;  3X1V B;  3H0M C;  3WAA A;  4KUD D;  3REI C;  1WWI A;  1KX3 D;  4H9S C;  1ID3 D;  1P3M C;  5DNM B;  5B1M A;  4CAY A;  3LJA B;  1AOI A;  2VQR A;  2HIO C;  5GSU C;  4WU8 A;  1KX5 B;  5B40 A;  5B24 D;  3X1U C;  3AZE D;  1P3O C;  1ULY A;  2PYO C;  5C3I B;  2ZY3 A;  1U35 A;  5GT3 A;  2ZY5 A;  1BH9 A;  4CSR B;  3W98 B;  2Y2H A;  5GXQ A;  3C1B C;  5GT0 D;  1P3K B;  3VH6 W;  4KUD C;  5E5A B;  1KX3 C;  3KXB C;  1ID3 C;  5JA4 A;  5AVB B;  1P3L A;  5B2J A;  5CPI D;  1P3G B;  4DRB A;  5B32 A;  5BNV B;  5BS7 C;  3REI A;  4H9O B;  4Z5T D;  4H9S A;  4DRA A;  3AV1 B;  2F8N B;  1P3M A;  3AZL D;  1F1E A;  1BH8 B;  4YS3 B;  1P3F D;  3UTA C;  5B24 C;  3AZE C;  3F6T A;  4H9Q A;  4G91 C;  2HIO A;  5GSU A;  5CP6 C;  4J8X B;  4J8W B;  1EQZ B;  3AZK B;  3B0C W;  4KGC B;  5BO0 B;  4WJ3 C;  1Z2C B;  3X1U A;  1P3O A;  3AZN B;  3AZI C;  2PYO A;  2Y2Q A;  5AY8 C;  5GT0 C;  2G5H C;  2BYM A;  3LZ0 B;  3AZJ D;  2J8P A;  3V9R B;  5CPI C;  4WNN A;  4XZQ D;  3R45 B;  3C1B A;  3AZH B;  3AZK D;  4KUD A;  5BT1 D;  4WV4 B;  1KX3 A;  4Z5T C;  3KXB A;  3KWQ C;  3UTB B;  5CPJ B;  1ID3 A;  3AZL C;  1HTA A;  1P3P D;  4J8U B;  3REJ D;  3FDD A;  2FJ7 C;  3REK D;  3B0C T;  5B0Z D;  5BS7 A;  3WKJ B;  4ZUX B;  4H9R A;  3KFU G;  2CV5 C;  2DQN C;  3MGS D;  3UTA A;  5B24 A;  3AZE A;  5CP6 A;  3WTP E;  3MGR D;  4J8V C;  5G49 A;  3AZF D;  1Q9C A;  2RVQ D;  4ZBJ C;  3WTP D;  4AWL C;  3LZ1 B;  4J8U D;  1AOI B;  1TZY C;  1P3I D;  3AZI A; 
#chains in the Genus database with same CATH homology
 4EO5 B;  4WU8 B;  1ZLA B;  3W97 D;  5AY8 A;  4ZUX D;  5GT0 A;  4Z66 B;  5BT1 C;  3B6F C;  5AV5 B;  5AV9 D;  1P3P C;  5CPI A;  3AFA B;  3REJ C;  4M6B A;  4Z2M G;  3REK C;  2NQB D;  5B0Z C;  2NZD B;  3MGP C;  4Z5T A;  3KWQ A;  5GT3 B;  3AZL A;  1P3A B;  3MGS C;  2FJ7 A;  5AVC D;  3MGR C;  3AZF C;  2RVQ C;  2CV5 A;  3WTP C;  1N1J B;  2BYK A;  4XUJ C;  5JRG B;  2JE5 A;  5B0Y B;  3A6N B;  4YM6 C;  1P3I C;  3C1C D;  1HQ3 B;  4NE3 A;  3REI B;  4J8V A;  1S32 D;  2YFW A;  3W97 C;  3B0D C;  3AZM D;  3KSY A;  2YFV B;  4LD9 C;  1TZY A;  1H3O A;  5AV9 C;  4QLC B;  1P34 B;  3B6F A;  5JRG D;  5B0Y D;  1P3P A;  2HUE C;  4R8P B;  3REJ A;  1P3B B;  3LEL D;  5AVC C;  5B0Z A;  3KUY B;  3REK A;  3VH5 A;  3MGP A;  5KDM A;  5DNN B;  2W8S A;  3UT9 C;  5CPK C;  3MGS A;  3VH5 W;  3AZG B;  4HGA C;  3C1C C;  3AYW D;  3MVD D;  3MGR A;  1S32 C;  3AZF A;  3AZM C;  3WTP A;  4XUJ A;  4WU9 D;  1KX4 B;  3REH B;  4YM6 A;  1P3I A;  1F66 D;  3TU4 D;  3AN2 B;  3X1V D;  1M1A B;  3W97 A;  3WA9 B;  5DNM D;  4G92 C;  4NE6 A;  5B33 B;  3LJA D;  4X23 B;  3EPL A;  3H0R C;  3UTA B;  3VH6 A;  5AV9 A;  4LD9 A;  5AV8 C;  3B6G C;  3LEL C;  1KX5 D;  3W99 B;  3VH5 T;  5BNX B;  4DQY B;  5AVC A;  4JJN B;  3AYW C;  3MNN B;  3UT9 A;  4H9N B;  5CPK A;  4WU9 C;  3X1T B;  3NQJ A;  3EPJ A;  3C1C A;  1F66 C;  1JFI B;  3W98 D;  3TU4 C;  1P3K D;  3KWQ B;  3X1V C;  1TAF A;  1S32 A;  5E5A D;  3REL B;  3AZM A;  5AVB D;  5DNM C;  3AV2 B;  3LJA C;  2IO5 B;  1P3G D;  1M18 B;  3VH6 T;  5B2I B;  3AV1 D;  2F8N D;  5FUG B;  3X1S B;  1M19 B;  2ZY4 A;  4YS3 D;  5AV8 A;  5AV6 B;  4UUZ A;  4J8V B;  3B6G A;  3LEL A;  4J8X D;  4J8W D;  5C3I C;  1EQZ D;  2JCH A;  5B31 B;  4KGC D;  1TZY B;  1H3O B;  4KHA A;  3AZN D;  5B1L B;  3NQU A;  1P3F C;  3O62 B;  3W98 C;  3AYW A;  3A1I A;  5F99 B;  1P3K C;  3B6F B;  3MGQ B;  5E5A C;  3LZ0 D;  3AL0 C;  4WU9 A;  5AVB C;  5AV6 D;  3W96 B;  2Y2K A;  4H9P A;  1P3G C;  2ARO B;  1F66 A;  3TU4 A;  3AZH D;  5KDM B;  3X1V A;  3WAA B;  3AV1 C;  3UTB D;  5CPJ D;  5DNM A;  2F2A C;  5B1M B;  4CAY B;  3LJA A;  3AZJ C;  3MGQ D;  3WKJ D;  4XZQ C;  2UWX A;  4J8W C;  1EQZ C;  5B40 B;  3AZK C;  4YM6 B;  1A7W A;  3B0D B;  4LD9 B;  3LZ1 D;  1U35 B;  3LZ0 C;  1AOI D;  1BH9 B;  1P3F A;  4CSR A;  2Y2I A;  4WU8 D;  5GXQ B;  1ZLA D;  1P3K A;  3W98 A;  5B40 D;  3AZH C;  4Z66 D;  5E5A A;  3UTB C;  2ZY2 A;  5AV5 D;  2HUE B;  5JA4 B;  5AVB A;  5CPJ C;  1P3L B;  2F8N G;  5B2J B;  4J8U C;  3AFA D;  1P3G A;  5B32 B;  2JSS A;  5BNV A;  2NZD D;  3AV1 A;  5GT3 D;  2F8N A;  1P3M B;  3WKJ C;  4ZUX C;  2Y2G A;  1BH8 A;  1P3A D;  4NE5 A;  3AZJ A;  2RIQ A;  4H9Q B;  2HIO B;  2Y2M A;  5GSU B;  4XZQ A;  3EPK A;  4J8W A;  2BG1 A;  1EQZ A;  3AZK A;  2NQB C;  5BO0 A;  3LZ1 C;  3X1U B;  1P3O B;  3A6N D;  1HQ3 D;  3REI D;  2PYO B;  4EO5 C;  1ZLA C;  4G92 B;  1PZR A;  4Z66 C;  2BYM B;  3LZ0 A;  5AV8 B;  5AV5 C;  5CHL B;  2HIO D;  4WNN B;  4QLC D;  3AFA C;  3C1B B;  2Y2L A;  3AZH A;  1P34 D;  4KUD B;  2NZD C;  2XD1 A;  1KX3 B;  3KXB B;  1ID3 B;  3UTB A;  5CPJ A;  1P3O D;  4J8U A;  1P3A C;  4R8P D;  1P3B D;  2PYO D;  3KUY D;  3WKJ A;  4ZUX A;  5DNN D;  4H9R B;  5JRG C;  5B24 B;  3AZE B;  3AZG D;  5B0Y C;  3A6N C;  4G91 B;  3EG5 B;  1HQ3 C;  5CP6 B;  3KXB D;  5G49 B;  2Y2N A;  2NQB A;  3LZ1 A;  1W2E A;  1KX4 D;  4Z2M H;  3REH D;  2G5I C;  3AZI B;  3AN2 D;  4QLC C;  1B6W A;  1M1A D;  1ZLA A;  3WA9 D;  4E45 A;  5AY8 B;  5GT0 B;  4Z66 A;  1P34 C;  3MVD C;  5B33 D;  4X23 D;  5AV5 A;  3UTA D;  5CPI B;  4R8P C;  3AFA A;  5CP6 D;  1P3B C;  2NZD A;  2F8N H;  3KUY C;  4Z5T B;  3W99 D;  3AZL B;  5DNN C;  1P3A A;  2ZM5 A;  3AZI D;  1P3F B;  2FJ7 B;  5AY8 D;  3AZG C;  1R4V A;  4JJN D;  3MNN D;  5B32 G;  2CV5 B;  1KX5 C;  1N1J A;  2BYK B;  5JRG A;  3X1T D;  1KX4 C;  3REH C;  5B0Y A;  3A6N A;  1HQ3 A;  2Y2J A;  3AN2 C;  3KWQ D;  1M1A C;  2YFW B;  3WA9 C;  4ZBJ B;  3REL D;  4AWL B;  3AV2 D;  2YFV A;  5B33 C;  3AZJ B;  4X23 C;  2FJ7 D;  1M18 D;  3H0L C;  4QLC A;  4XZQ B;  5B2I D;  3X1S D;  2CV5 D;  1P34 A;  2LY8 A;  1M19 D;  3MVD A;  3W99 C;  1P3P B;  4R8P A;  3REJ B;  1P3B A;  4J8V D;  1WWS A;  3REK B;  5B0Z B;  3KUY A;  3MGP B;  4JJN C;  5B31 D;  3MNN C;  5DNN A;  1TZY D;  2L5A A;  5B1L D;  3MGS B;  3X1T C;  4YS3 C;  3AZG A;  3O62 D;  4E44 A;  2FFF B;  5F99 D;  3B6F D;  3MGR B;  3AZF B;  4J8X C;  3REL C;  3WTP B;  1KX5 A;  4XUJ B;  3AV2 C;  3W96 D;  1KX4 A;  4KGC C;  3REH A;  2IO5 C;  1P3I B;  2ARO D;  2DF4 C;  4NFT A;  3MGP D;  3AN2 A;  3AZN C;  1M18 C;  5B2I C;  1M1A A;  3WAA D;  3W97 B;  3WA9 A;  3X1S C;  1M19 C;  5B1M D;  5B33 A;  4X23 A;  5AV9 B;  5AV6 C;  2NQB B;  4XUJ D;  5B31 C;  3W99 A;  5BNX A;  4YM6 D;  5B1L C;  5AVC B;  3O62 C;  4JJN A;  3MNN A;  5F99 C;  4LD9 D;  4H9O A;  3MGQ C;  1U35 D;  3UT9 B;  4H9N A;  4WZS B;  5CPK B;  3W96 C;  3X1T A;  4YS3 A;  3NQJ B;  4HGA B;  2ARO C;  3C1C B;  1JFI A;  5GXQ D;  1TAF B;  3WAA C;  1S32 B;  4J8X A;  3REL A;  3AZM B;  1P3L D;  3AV2 A;  5B1M C;  5B2J D;  4KGC A;  3EPH A;  2XD5 A;  4UPK A;  1M18 A;  3AZN A;  2Y2P A;  5B32 D;  5B2I A;  1AOI C;  1BFM A;  1B67 A;  3UT9 D;  5FUG A;  3X1S A;  4WU8 C;  1P3M D;  1M19 A;  5CPK D;  3A1K A;  5B40 C;  1T3U A;  5B31 G;  5AV6 A;  4UUZ B;  3V9R A;  5GSU D;  1KU5 A;  3B6G B;  3LEL B;  3P5J B;  3R45 A;  2CWE A;  5B31 A;  3IP4 C;  3B0B A;  2Y2O A;  1U35 C;  5GT3 C;  3X1U D;  4KHA B;  2F8N K;  5B1L A;  3NQU B;  3O62 A;  3AYW B;  5GXQ C;  5F99 A;  3MVD B;  3MGQ A;  5AV8 D;  4WU9 B;  1P3L C;  3W96 A;  4H9P B;  5B2J C;  3B6G D;  2ARO A;  1F66 B;  3C1B D;  3TU4 B;  5B32 C;  3X1V B;  3H0M C;  3WAA A;  4KUD D;  3REI C;  1WWI A;  1KX3 D;  4H9S C;  1ID3 D;  1P3M C;  5DNM B;  5B1M A;  4CAY A;  3LJA B;  1AOI A;  2VQR A;  2HIO C;  5GSU C;  4WU8 A;  1KX5 B;  5B40 A;  5B24 D;  3X1U C;  3AZE D;  1P3O C;  1ULY A;  2PYO C;  5C3I B;  2ZY3 A;  1U35 A;  5GT3 A;  2ZY5 A;  1BH9 A;  4CSR B;  3W98 B;  2Y2H A;  5GXQ A;  3C1B C;  5GT0 D;  1P3K B;  3VH6 W;  4KUD C;  5E5A B;  1KX3 C;  3KXB C;  1ID3 C;  5JA4 A;  5AVB B;  1P3L A;  5B2J A;  5CPI D;  1P3G B;  4DRB A;  5B32 A;  5BNV B;  5BS7 C;  3REI A;  4H9O B;  4Z5T D;  4H9S A;  4DRA A;  3AV1 B;  2F8N B;  1P3M A;  3AZL D;  1F1E A;  1BH8 B;  4YS3 B;  1P3F D;  3UTA C;  5B24 C;  3AZE C;  3F6T A;  4H9Q A;  4G91 C;  2HIO A;  5GSU A;  5CP6 C;  4J8X B;  4J8W B;  1EQZ B;  3AZK B;  3B0C W;  4KGC B;  5BO0 B;  4WJ3 C;  1Z2C B;  3X1U A;  1P3O A;  3AZN B;  3AZI C;  2PYO A;  2Y2Q A;  5AY8 C;  5GT0 C;  2G5H C;  2BYM A;  3LZ0 B;  3AZJ D;  2J8P A;  3V9R B;  5CPI C;  4WNN A;  4XZQ D;  3R45 B;  3C1B A;  3AZH B;  3AZK D;  4KUD A;  5BT1 D;  4WV4 B;  1KX3 A;  4Z5T C;  3KXB A;  3KWQ C;  3UTB B;  5CPJ B;  1ID3 A;  3AZL C;  1HTA A;  1P3P D;  4J8U B;  3REJ D;  3FDD A;  2FJ7 C;  3REK D;  3B0C T;  5B0Z D;  5BS7 A;  3WKJ B;  4ZUX B;  4H9R A;  3KFU G;  2CV5 C;  2DQN C;  3MGS D;  3UTA A;  5B24 A;  3AZE A;  5CP6 A;  3WTP E;  3MGR D;  4J8V C;  5G49 A;  3AZF D;  1Q9C A;  2RVQ D;  4ZBJ C;  3WTP D;  4AWL C;  3LZ1 B;  4J8U D;  1AOI B;  1TZY C;  1P3I D;  3AZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...