5G49B

Crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
TQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
publication title Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 25
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5g49B00
1S32C 1P3LB 3X1SA 2AROD 5GXQC 4J8WB 3AZHB 3AYWC 2PYOC 1M19B 5GT0B 4Z66C 1P3AA 2YFVA 1P3LA 1S32D 1ID3C 3VH5A 3VH6T 3AZHA 4J8WA 1KX4B 3AYWD 2PYOD 2F8ND 5CPJC 5GT0A 4YM6B 5C3IC 5AY8C 5B2IC 3LZ0B 3W98C 3B6GC 5B0YC 5BT1C 3AZJD 5B32D 1KX4A 4YM6A 5AY8D 3WTPC 3LZ0A 5B2ID 3W98D 3B6GD 4G91C 5CPIC 5B0YD 1P3KC 3AN2B 3VH6W 5JRGC 4QLCB 4M6BA 3KUYB 5BNXB 3A6NC 5CPID 3O62B 3AN2A 4QLCA 2FJ7A 3KUYA 3VH5T 5BNXA 1P3MB 5E5AC 3O62A 3A6ND 1P3IC 2CV5D 4H9RB 4ZUXC 3AZEC 5B1LB 4WU8C 1P3MA 4J8VB 4HGAB 3REIC 5B24C 5E5AD 5DNMC 1P3ID 4H9RA 4J8XB 4ZUXD 5B1LA 3AZED 4J8VA 3WKJB 4WU8D 4ZBJB 4WV4B 3REID 5DNMD 5AVCB 3MNNB 5G49A 4J8XA 2IO5B 3C1BD 2AROB 2HUEC 5B31C 3WKJA 1KU5A 4Z5TC 1BH9B 5AVCA 3MNNA 1ZLAC 1S32B 3NQUB 2AROA 5GXQB 3AYWB 2F8NB 2PYOB 3WA9C 4H9QB 1KX5C 1BH9A 3RELC 4Z5TD 3LZ1C 4Z66B 1S32A 3NQUA 1ID3B 5GXQA 3AYWA 2F8NA 2PYOA 2NZDA 4H9QA 5CPJB 3AV2C 1KX5D 1HQ3C 4Z66A 2NQBC 3RELD 5C3IB 3LZ1D 5AY8B 2LY8A 5B2IB 4WZSB 3W98B 1ID3A 1WWIA 3B6GB 3UTBC 5B0YB 3MGQB 5CPJA 1F66C 5AVBC 3AV2D 1HQ3D 4KHAB 5AY8A 4WU9C 2NQBD 3WTPB 2HIOC 5B2IA 3W98A 3B6GA 4JJNC 5B0YA 4G91B 4DRAA 3MGQA 3MGRC 3KWQC 3UTBD 5CPIB 1P3KB 3C1CC 3AZNC 1F66D 3REKC 4KHAA 5JRGB 3WTPA 3AZGC 2HIOD 3W97C 4JJND 5CPIA 3A6NB 3MGRD 1P3KA 3WAAA 3KWQD 3C1CD 3AZND 5JRGA 3REKD 3AZGD 3X1VC 4AWLC 3W97D 5B40C 3A6NA 5F99C 5E5AB 1P3IB 1P3FC 2RVQC 4XUJC 4ZUXB 3AZEB 3B0CT 3X1VD 4WU8B 4LD9C 5E5AA 5B40D 3REIB 3AZJC 5F99D 5B24B 5B32C 3AZFC 1P3IA 5DNMB 1M19A 4R8PD 1P3FD 4Z2MH 4ZUXA 2RVQD 4XUJD 3AZEA 4WU8A 1KX3C 3REIA 5B24A 4LD9D 5DNMA 3AZFD 5AV9C 3REJC 4XZQC 2HUEB 4YS3C 5B31B 1P3BD 3LELC 1KX3D 1P34C 4Z5TB 4Z2MG 3B0CW 2BYKB 5AV5D 5AV9D 1ZLAB 1A7WA 5B31A 4CSRB 4XZQD 1H3OB 4YS3D 3REJD 3WA9B 4DRBA 1B6WA 3LELD 4Z5TA 1KX5B 1P34D 3RELB 3LZ1B 4H9OB 2BYKA 4NE6A 1ZLAA 3AZIC 2CV5C 2BYMB 5B2JD 4CSRA 4EO5C 1H3OA 3WA9A 1KX5A 4H9PB 3X1TB 3RELA 3AV2B 3LZ1A 1HQ3B 4H9OA 4KGCC 2NQBB 2BYMA 3AZID 5AV6C 3UTBB 5B31G 4KUDD 4H9PA 3X1TA 3AZMC 3AV2A 1F66B 1HQ3A 2NQBA 5AVBB 4KGCD 3AZKC 4WU9B 2HIOB 4UUZB 3NQJB 4JJNB 3UTBA 3C1BC 3MGRB 3W99C 5AV6D 3KWQB 3C1CB 3AZNB 1F66A 5AVBA 3AZMD 3REKB 4WU9A 3AFAC 3AZKD 3AZGB 2HIOA 3B6FC 3VH5W 4UUZA 3NQJA 4JJNA 3W97B 3MGRA 3KWQA 4WNNB 4H9SC 3W99D 3C1CA 3AZNA 4J8UC 3REKA 1BFMA 3AZGA 3AFAD 3MVDC 4AWLB 3X1VB 1P3GC 3B6FD 3W97A 5B40B 4WNNA 5F99B 1JFIB 1TZYC 4J8UD 3TU4C 4E45A 1P3FB 4XUJB 3MVDD 3X1VA 5AV8C 1P3GD 5B40A 5F99A 4LD9B 5JA4B 3AZJB 1JFIA 5B32B 3AZFB 1TZYD 1P3FA 3TU4D 4XUJA 2CWEA 5AV8D 2F8NH 1KX3B 4LD9A 5JA4A 3UT9C 3AZJA 5B32A 3AZFA 5B33C 2FJ7C 5AV9B 1HTAA 2F8NK 3REJB 4XZQB 4YS3B 1KX3A 3KSYA 5GT3C 3LELB 1P34B 3UT9D 5CPKC 5B1MC 1P3PC 5B33D 2F8NG 5AV9A 4QLCD 3REJA 2FJ7D 4XZQA 4YS3A 5GSUC 3KXBC 3KUYD 3MGSC 3LELA 2YFWB 5CP6C 5GT3D 1P34A 1TAFB 5B32G 5CPKD 5B1MD 1P3PD 3AZIB 2CV5B 4EO5B 5GSUD 3KXBD 3MGSD 1TAFA 3X1UC 1P3MD 5CP6D 4KGCB 2CV5A 4R8PC 5AV6B 1WWSA 4J8VD 3AZMB 3X1UD 4KGCA 3AZKB 3AZLC 1P3OC 5AV6A 1U35C 3C1BB 3W99B 1AOIC 1M18C 1P3BC 3AZKA 3AFAB 3AZLD 4CAYB 2L5AA 2JSSA 1N1JB 5AVCD 1P3OD 3B6FB 3V9RB 5AV5C 3C1BA 1U35D 3W99A 1AOID 5BO0B 2NZDC 1M18D 4J8UB 3AFAA 4CAYA 4X23C 3MVDB 1N1JA 3B6FA 5BNVB 1P3GB 1M1AC 5B0ZC 3V9RA 1F1EA 4H9NB 5B2JC 4H9SA 3MGPC 5GXQD 5BO0A 2NZDD 4J8UA 1TZYB 3B0DC 3TU4B 3AV1C 4Z66D 3MVDA 3UTAC 5BNVA 4X23D 1P3GA 5AV8B 1EQZC 1M1AD 5B0ZD 1ULYA 4H9NA 1ID3D 3MGQC 3MGPD 4KUDC 1TZYA 5CPJD 3TU4A 3R45B 3AV1D 5BS7C 3UTAD 5AV8A 1EQZD 3REHC 3LJAC 5BT1D 3WAAC 3W96C 3MGQD 3UT9B 5B33B 3R45A 2FJ7B 4NFTA 3WTPD 5GT3B 1R4VA 5DNNC 3REHD 3UT9A 3LJAD 5B33A 5CPKB 5B1MB 3X1SC 1P3KD 1P3PB 3WAAD 3W96D 5JRGD 4G92C 1P3AC 5GSUB 3KXBB 3MGSB 5GT3A 5CP6B 5DNND 3WTPE 1P3LC 5CPKA 4NE5A 5B1MA 1P3PA 3AZHC 4J8WC 3X1SD 1M19C 5GT0C 5GSUA 4E44A 1P3AD 3KXBA 3MGSA 5CP6A 3X1UB 1P3LD 1KX4C 3AZHD 4J8WD 5G49B 1M19D 4YM6C 4R8PB 5GT0D 1BH8B 3X1UA 3LZ0C 5B24D 3AZLB 1P3OB 1KX4D 4R8PA 4YM6D 1BH8A 1U35B 1AOIB 1M18B 1P3BB 3LZ0D 5FUGB 3AZLA 1P3OA 3AN2C 1U35A 4QLCC 5AV5B 5B31D 1AOIA 1M18A 3KUYC 2NZDB 1B67A 1P3BA 4NE3A 5FUGA 3O62C 4X23B 3AN2D 1M1AB 5B0ZB 1ZLAD 1Q9CA 5AV5A 5B2JB 3MGPB 3WA9D 3X1TC 1P3MC 3B0DB 3AV1B 4X23A 3UTAB 3O62D 1M1AA 5B0ZA 1EQZB 5B2JA 3MGPA 4KUDB 5B1LC 2YFWA 4HGAC 3VH6A 5KDMB 3X1TD 4J8VC 3AV1A 3UTAA 3B0BA 1EQZA 3REHB 4J8XC 3AZIA 3LJAB 3WAAB 3W96B 4KUDA 3WKJC 5KDMA 5B1LD 4ZBJC 5AVBD 5BS7A 4WU9D 5CHLB 5AVCC 3REHA 3MNNC 5DNNB 2IO5C 3LJAA 4J8XD 3W96A 2AROC 3X1SB 3WKJD 3AZMA 4G92B 1P3AB 2YFVB 5DNNA 3MNND
chains in the Genus database with same CATH superfamily
1S32C 2DQNC 1P3LB 3X1SA 2AROD 5GXQC 4J8WB 3AZHB 3AYWC 2PYOC 1M19B 5GT0B 4Z66C 1P3AA 2YFVA 1P3LA 1S32D 1ID3C 3VH5A 3VH6T 3AZHA 4J8WA 1KX4B 3AYWD 2Y2JA 2F8ND 2G5IC 2PYOD 5CPJC 2JE5A 5GT0A 4YM6B 5C3IC 5AY8C 5B2IC 1T3UA 3LZ0B 3W98C 3B6GC 5B0YC 5BT1C 3AZJD 5B32D 1KX4A 2Y2GA 4YM6A 5AY8D 3WTPC 3KFUG 3LZ0A 5B2ID 3W98D 3B6GD 4G91C 5CPIC 5B0YD 1P3KC 2J8PA 3AN2B 3VH6W 5JRGC 4QLCB 4M6BA 3KUYB 5BNXB 3A6NC 5CPID 3O62B 3AN2A 4QLCA 2FJ7A 3KUYA 3VH5T 5BNXA 1P3MB 5E5AC 3O62A 3A6ND 1P3IC 4WJ3C 2CV5D 4H9RB 4ZUXC 3AZEC 5B1LB 4WU8C 1P3MA 4J8VB 4HGAB 3REIC 5B24C 5E5AD 5DNMC 1P3ID 4H9RA 4J8XB 4ZUXD 5B1LA 3AZED 4J8VA 3WKJB 4WU8D 4ZBJB 4WV4B 3REID 5DNMD 5AVCB 3MNNB 5G49A 4J8XA 2IO5B 3C1BD 2AROB 2HUEC 5B31C 3WKJA 1KU5A 4Z5TC 1BH9B 5AVCA 3MNNA 1ZLAC 1S32B 3NQUB 2AROA 3AL0C 5GXQB 3AYWB 2F8NB 2PYOB 3WA9C 4H9QB 1KX5C 1BH9A 3RELC 4Z5TD 3LZ1C 4Z66B 1S32A 3NQUA 1ID3B 1W2EA 5GXQA 3AYWA 2F8NA 2PYOA 2NZDA 4H9QA 5CPJB 3AV2C 1KX5D 1HQ3C 4Z66A 2NQBC 3RELD 5C3IB 3LZ1D 5AY8B 2LY8A 5B2IB 4WZSB 3W98B 3H0RC 1WWIA 1ID3A 3B6GB 3UTBC 5B0YB 3MGQB 2Y2QA 5CPJA 1F66C 5AVBC 3AV2D 2Y2LA 1HQ3D 4KHAB 5AY8A 4WU9C 2NQBD 3WTPB 2HIOC 5B2IA 3W98A 3B6GA 4JJNC 5B0YA 4G91B 4DRAA 3MGQA 3MGRC 3KWQC 3UTBD 5CPIB 1P3KB 3C1CC 3AZNC 1F66D 3REKC 4KHAA 2XD1A 5JRGB 3WTPA 3AZGC 2HIOD 3W97C 4JJND 5CPIA 3A6NB 3MGRD 1P3KA 3WAAA 3KWQD 3C1CD 3AZND 5JRGA 3REKD 3AZGD 3X1VC 4AWLC 3W97D 5B40C 3A6NA 5F99C 5E5AB 1P3IB 1P3FC 2RVQC 4XUJC 4ZUXB 4DQYB 3AZEB 3B0CT 3X1VD 4WU8B 2VQRA 2BG1A 4LD9C 5E5AA 5B40D 3REIB 3AZJC 5F99D 5B24B 5B32C 3AZFC 1P3IA 5DNMB 1M19A 4R8PD 1P3FD 4Z2MH 4ZUXA 2RVQD 4XUJD 3AZEA 4WU8A 1KX3C 2ZY2A 3IP4C 3REIA 5B24A 4LD9D 3F6TA 5DNMA 3AZFD 5AV9C 3REJC 4XZQC 2HUEB 4YS3C 5B31B 1P3BD 3LELC 3EG5B 1KX3D 1P34C 3A1KA 4Z5TB 4Z2MG 3B0CW 2BYKB 5AV5D 5AV9D 1ZLAB 1A7WA 5B31A 4CSRB 4XZQD 1H3OB 4YS3D 3REJD 3WA9B 4DRBA 1B6WA 3LELD 4Z5TA 1KX5B 1P34D 3H0MC 3RELB 3LZ1B 4H9OB 2BYKA 4NE6A 4UPKA 1ZLAA 3AZIC 2CV5C 2BYMB 5B2JD 4CSRA 4EO5C 1H3OA 3WA9A 1KX5A 4H9PB 3X1TB 3RELA 3AV2B 3LZ1A 1HQ3B 4H9OA 4KGCC 2NQBB 2FFFB 2BYMA 3AZID 5AV6C 3UTBB 5B31G 4KUDD 4H9PA 3X1TA 3AZMC 3AV2A 1F66B 1HQ3A 2NQBA 5AVBB 4KGCD 3AZKC 4WU9B 2HIOB 4UUZB 3NQJB 4JJNB 3UTBA 3C1BC 3MGRB 3W99C 5AV6D 3KWQB 3EPKA 3C1CB 3AZNB 1F66A 5AVBA 3AZMD 3REKB 4WU9A 3AFAC 3AZKD 3AZGB 2HIOA 3B6FC 3VH5W 4UUZA 3NQJA 4JJNA 3W97B 3MGRA 3KWQA 4WNNB 4H9SC 3W99D 3C1CA 3AZNA 4J8UC 3REKA 1BFMA 3AZGA 3AFAD 3MVDC 4AWLB 3X1VB 1P3GC 3B6FD 3W97A 5B40B 4WNNA 5F99B 1JFIB 1TZYC 4J8UD 3TU4C 4E45A 1P3FB 4XUJB 3MVDD 3X1VA 5AV8C 1P3GD 5B40A 5F99A 4LD9B 5JA4B 3AZJB 1JFIA 5B32B 3AZFB 1TZYD 1P3FA 3TU4D 4XUJA 2CWEA 5AV8D 2F8NH 1KX3B 2ZY3A 4LD9A 5JA4A 3UT9C 3AZJA 5B32A 3AZFA 5B33C 2F2AC 2FJ7C 5AV9B 1HTAA 2F8NK 2Y2KA 3REJB 4XZQB 4YS3B 1KX3A 3KSYA 5GT3C 3LELB 2G5HC 1P34B 3UT9D 5CPKC 5B1MC 1P3PC 5B33D 2F8NG 5AV9A 4QLCD 3REJA 2FJ7D 4XZQA 4YS3A 5GSUC 3KXBC 3KUYD 3MGSC 3LELA 2YFWB 5CP6C 5GT3D 1P34A 1TAFB 5B32G 5CPKD 5B1MD 3H0LC 1P3PD 3AZIB 2CV5B 3A1IA 4EO5B 5GSUD 3KXBD 3MGSD 1TAFA 3X1UC 1P3MD 5CP6D 4KGCB 2XD5A 2CV5A 4R8PC 5AV6B 2W8SA 1WWSA 4J8VD 3AZMB 3X1UD 4KGCA 2ZY4A 3AZKB 3AZLC 1PZRA 1P3OC 3P5JB 3EPLA 5AV6A 1U35C 3C1BB 3W99B 1AOIC 1M18C 1P3BC 3AZKA 3AFAB 3AZLD 4CAYB 2L5AA 2JSSA 1N1JB 5AVCD 1P3OD 3B6FB 3V9RB 5AV5C 3C1BA 1U35D 3W99A 1Z2CB 1AOID 5BO0B 2NZDC 1M18D 4J8UB 2ZY5A 3AFAA 4CAYA 4X23C 3MVDB 1N1JA 3B6FA 5BNVB 2ZM5A 1P3GB 5B0ZC 1M1AC 3V9RA 1F1EA 4H9NB 5B2JC 4H9SA 3MGPC 2RIQA 5GXQD 5BO0A 2NZDD 4J8UA 1TZYB 3B0DC 3TU4B 3AV1C 4Z66D 3MVDA 3UTAC 5BNVA 4X23D 1P3GA 5AV8B 1EQZC 1M1AD 5B0ZD 1ULYA 4H9NA 1ID3D 3MGQC 3MGPD 4KUDC 1TZYA 5CPJD 3TU4A 3R45B 3AV1D 5BS7C 3UTAD 5AV8A 1EQZD 3REHC 3LJAC 5BT1D 3WAAC 3W96C 3MGQD 3UT9B 5B33B 3R45A 2FJ7B 3EPHA 4NFTA 3WTPD 5GT3B 1R4VA 5DNNC 3REHD 3UT9A 3LJAD 5B33A 5CPKB 5B1MB 3X1SC 1P3KD 1P3PB 3WAAD 3W96D 5JRGD 4G92C 1P3AC 5GSUB 3KXBB 3MGSB 5GT3A 3EPJA 5CP6B 5DNND 3WTPE 1P3LC 5CPKA 4NE5A 5B1MA 1P3PA 3AZHC 4J8WC 3X1SD 1M19C 2Y2MA 2UWXA 5GT0C 5GSUA 4E44A 1P3AD 3KXBA 3MGSA 5CP6A 3X1UB 1P3LD 1KX4C 2JCHA 4J8WD 3AZHD 5G49B 1M19D 4YM6C 4R8PB 5GT0D 1BH8B 3X1UA 3LZ0C 5B24D 3AZLB 1P3OB 1KX4D 4R8PA 4YM6D 1BH8A 1U35B 1AOIB 1M18B 1P3BB 3LZ0D 5FUGB 3AZLA 1P3OA 3AN2C 1U35A 4QLCC 5AV5B 5B31D 1AOIA 1M18A 3KUYC 2NZDB 1B67A 1P3BA 4NE3A 5FUGA 3O62C 4X23B 3AN2D 1M1AB 5B0ZB 1ZLAD 1Q9CA 5AV5A 2Y2IA 2Y2OA 5B2JB 3MGPB 3WA9D 3X1TC 1P3MC 3B0DB 3AV1B 4X23A 3UTAB 3O62D 2Y2NA 1M1AA 5B0ZA 1EQZB 3FDDA 5B2JA 3MGPA 4KUDB 5B1LC 2YFWA 4HGAC 3VH6A 5KDMB 3X1TD 4J8VC 3AV1A 3UTAA 3B0BA 1EQZA 3REHB 4J8XC 3AZIA 3LJAB 3WAAB 3W96B 4KUDA 3WKJC 5KDMA 5B1LD 4ZBJC 5AVBD 5BS7A 4WU9D 5CHLB 5AVCC 3REHA 3MNNC 5DNNB 2IO5C 3LJAA 4J8XD 3W96A 2AROC 3X1SB 2DF4C 3WKJD 3AZMA 2Y2PA 4G92B 1P3AB 2YFVB 5DNNA 2Y2HA 3MNND
chains in the Genus database with same CATH topology
1S32C 2DQNC 1P3LB 3X1SA 2AROD 5GXQC 4J8WB 3AZHB 3AYWC 2PYOC 1M19B 5GT0B 4Z66C 1P3AA 2YFVA 1P3LA 1S32D 1ID3C 3VH5A 3VH6T 3AZHA 4J8WA 1KX4B 3AYWD 2Y2JA 2F8ND 2G5IC 2PYOD 5CPJC 2JE5A 5GT0A 4YM6B 5C3IC 5AY8C 5B2IC 1T3UA 3LZ0B 3W98C 3B6GC 5B0YC 5BT1C 3AZJD 5B32D 1KX4A 2Y2GA 4YM6A 5AY8D 3WTPC 3KFUG 3LZ0A 5B2ID 3W98D 3B6GD 4G91C 5CPIC 5B0YD 1P3KC 2J8PA 3AN2B 3VH6W 5JRGC 4QLCB 4M6BA 3KUYB 5BNXB 3A6NC 5CPID 3O62B 3AN2A 4QLCA 2FJ7A 3KUYA 3VH5T 5BNXA 1P3MB 5E5AC 3O62A 3A6ND 1P3IC 4WJ3C 2CV5D 4H9RB 4ZUXC 3AZEC 5B1LB 4WU8C 1P3MA 4J8VB 4HGAB 3REIC 5B24C 5E5AD 5DNMC 1P3ID 4H9RA 4J8XB 4ZUXD 5B1LA 3AZED 4J8VA 3WKJB 4WU8D 4ZBJB 4WV4B 3REID 5DNMD 5AVCB 3MNNB 5G49A 4J8XA 2IO5B 3C1BD 2AROB 2HUEC 5B31C 3WKJA 1KU5A 4Z5TC 1BH9B 5AVCA 3MNNA 1ZLAC 1S32B 3NQUB 2AROA 3AL0C 5GXQB 3AYWB 2F8NB 2PYOB 3WA9C 4H9QB 1KX5C 1BH9A 3RELC 4Z5TD 3LZ1C 4Z66B 1S32A 3NQUA 1ID3B 1W2EA 5GXQA 3AYWA 2F8NA 2PYOA 2NZDA 4H9QA 5CPJB 3AV2C 1KX5D 1HQ3C 4Z66A 2NQBC 3RELD 5C3IB 3LZ1D 5AY8B 2LY8A 5B2IB 4WZSB 3W98B 3H0RC 1WWIA 1ID3A 3B6GB 3UTBC 5B0YB 3MGQB 2Y2QA 5CPJA 1F66C 5AVBC 3AV2D 2Y2LA 1HQ3D 4KHAB 5AY8A 4WU9C 2NQBD 3WTPB 2HIOC 5B2IA 3W98A 3B6GA 4JJNC 5B0YA 4G91B 4DRAA 3MGQA 3MGRC 3KWQC 3UTBD 5CPIB 1P3KB 3C1CC 3AZNC 1F66D 3REKC 4KHAA 2XD1A 5JRGB 3WTPA 3AZGC 2HIOD 3W97C 4JJND 5CPIA 3A6NB 3MGRD 1P3KA 3WAAA 3KWQD 3C1CD 3AZND 5JRGA 3REKD 3AZGD 3X1VC 4AWLC 3W97D 5B40C 3A6NA 5F99C 5E5AB 1P3IB 1P3FC 2RVQC 4XUJC 4ZUXB 4DQYB 3AZEB 3B0CT 3X1VD 4WU8B 2VQRA 2BG1A 4LD9C 5E5AA 5B40D 3REIB 3AZJC 5F99D 5B24B 5B32C 3AZFC 1P3IA 5DNMB 1M19A 4R8PD 1P3FD 4Z2MH 4ZUXA 2RVQD 4XUJD 3AZEA 4WU8A 1KX3C 2ZY2A 3IP4C 3REIA 5B24A 4LD9D 3F6TA 5DNMA 3AZFD 5AV9C 3REJC 4XZQC 2HUEB 4YS3C 5B31B 1P3BD 3LELC 3EG5B 1KX3D 1P34C 3A1KA 4Z5TB 4Z2MG 3B0CW 2BYKB 5AV5D 5AV9D 1ZLAB 1A7WA 5B31A 4CSRB 4XZQD 1H3OB 4YS3D 3REJD 3WA9B 4DRBA 1B6WA 3LELD 4Z5TA 1KX5B 1P34D 3H0MC 3RELB 3LZ1B 4H9OB 2BYKA 4NE6A 4UPKA 1ZLAA 3AZIC 2CV5C 2BYMB 5B2JD 4CSRA 4EO5C 1H3OA 3WA9A 1KX5A 4H9PB 3X1TB 3RELA 3AV2B 3LZ1A 1HQ3B 4H9OA 4KGCC 2NQBB 2FFFB 2BYMA 3AZID 5AV6C 3UTBB 5B31G 4KUDD 4H9PA 3X1TA 3AZMC 3AV2A 1F66B 1HQ3A 2NQBA 5AVBB 4KGCD 3AZKC 4WU9B 2HIOB 4UUZB 3NQJB 4JJNB 3UTBA 3C1BC 3MGRB 3W99C 5AV6D 3KWQB 3EPKA 3C1CB 3AZNB 1F66A 5AVBA 3AZMD 3REKB 4WU9A 3AFAC 3AZKD 3AZGB 2HIOA 3B6FC 3VH5W 4UUZA 3NQJA 4JJNA 3W97B 3MGRA 3KWQA 4WNNB 4H9SC 3W99D 3C1CA 3AZNA 4J8UC 3REKA 1BFMA 3AZGA 3AFAD 3MVDC 4AWLB 3X1VB 1P3GC 3B6FD 3W97A 5B40B 4WNNA 5F99B 1JFIB 1TZYC 4J8UD 3TU4C 4E45A 1P3FB 4XUJB 3MVDD 3X1VA 5AV8C 1P3GD 5B40A 5F99A 4LD9B 5JA4B 3AZJB 1JFIA 5B32B 3AZFB 1TZYD 1P3FA 3TU4D 4XUJA 2CWEA 5AV8D 2F8NH 1KX3B 2ZY3A 4LD9A 5JA4A 3UT9C 3AZJA 5B32A 3AZFA 5B33C 2F2AC 2FJ7C 5AV9B 1HTAA 2F8NK 2Y2KA 3REJB 4XZQB 4YS3B 1KX3A 3KSYA 5GT3C 3LELB 2G5HC 1P34B 3UT9D 5CPKC 5B1MC 1P3PC 5B33D 2F8NG 5AV9A 4QLCD 3REJA 2FJ7D 4XZQA 4YS3A 5GSUC 3KXBC 3KUYD 3MGSC 3LELA 2YFWB 5CP6C 5GT3D 1P34A 1TAFB 5B32G 5CPKD 5B1MD 3H0LC 1P3PD 3AZIB 2CV5B 3A1IA 4EO5B 5GSUD 3KXBD 3MGSD 1TAFA 3X1UC 1P3MD 5CP6D 4KGCB 2XD5A 2CV5A 4R8PC 5AV6B 2W8SA 1WWSA 4J8VD 3AZMB 3X1UD 4KGCA 2ZY4A 3AZKB 3AZLC 1PZRA 1P3OC 3P5JB 3EPLA 5AV6A 1U35C 3C1BB 3W99B 1AOIC 1M18C 1P3BC 3AZKA 3AFAB 3AZLD 4CAYB 2L5AA 2JSSA 1N1JB 5AVCD 1P3OD 3B6FB 3V9RB 5AV5C 3C1BA 1U35D 3W99A 1Z2CB 1AOID 5BO0B 2NZDC 1M18D 4J8UB 2ZY5A 3AFAA 4CAYA 4X23C 3MVDB 1N1JA 3B6FA 5BNVB 2ZM5A 1P3GB 5B0ZC 1M1AC 3V9RA 1F1EA 4H9NB 5B2JC 4H9SA 3MGPC 2RIQA 5GXQD 5BO0A 2NZDD 4J8UA 1TZYB 3B0DC 3TU4B 3AV1C 4Z66D 3MVDA 3UTAC 5BNVA 4X23D 1P3GA 5AV8B 1EQZC 1M1AD 5B0ZD 1ULYA 4H9NA 1ID3D 3MGQC 3MGPD 4KUDC 1TZYA 5CPJD 3TU4A 3R45B 3AV1D 5BS7C 3UTAD 5AV8A 1EQZD 3REHC 3LJAC 5BT1D 3WAAC 3W96C 3MGQD 3UT9B 5B33B 3R45A 2FJ7B 3EPHA 4NFTA 3WTPD 5GT3B 1R4VA 5DNNC 3REHD 3UT9A 3LJAD 5B33A 5CPKB 5B1MB 3X1SC 1P3KD 1P3PB 3WAAD 3W96D 5JRGD 4G92C 1P3AC 5GSUB 3KXBB 3MGSB 5GT3A 3EPJA 5CP6B 5DNND 3WTPE 1P3LC 5CPKA 4NE5A 5B1MA 1P3PA 3AZHC 4J8WC 3X1SD 1M19C 2Y2MA 2UWXA 5GT0C 5GSUA 4E44A 1P3AD 3KXBA 3MGSA 5CP6A 3X1UB 1P3LD 1KX4C 2JCHA 4J8WD 3AZHD 5G49B 1M19D 4YM6C 4R8PB 5GT0D 1BH8B 3X1UA 3LZ0C 5B24D 3AZLB 1P3OB 1KX4D 4R8PA 4YM6D 1BH8A 1U35B 1AOIB 1M18B 1P3BB 3LZ0D 5FUGB 3AZLA 1P3OA 3AN2C 1U35A 4QLCC 5AV5B 5B31D 1AOIA 1M18A 3KUYC 2NZDB 1B67A 1P3BA 4NE3A 5FUGA 3O62C 4X23B 3AN2D 1M1AB 5B0ZB 1ZLAD 1Q9CA 5AV5A 2Y2IA 2Y2OA 5B2JB 3MGPB 3WA9D 3X1TC 1P3MC 3B0DB 3AV1B 4X23A 3UTAB 3O62D 2Y2NA 1M1AA 5B0ZA 1EQZB 3FDDA 5B2JA 3MGPA 4KUDB 5B1LC 2YFWA 4HGAC 3VH6A 5KDMB 3X1TD 4J8VC 3AV1A 3UTAA 3B0BA 1EQZA 3REHB 4J8XC 3AZIA 3LJAB 3WAAB 3W96B 4KUDA 3WKJC 5KDMA 5B1LD 4ZBJC 5AVBD 5BS7A 4WU9D 5CHLB 5AVCC 3REHA 3MNNC 5DNNB 2IO5C 3LJAA 4J8XD 3W96A 2AROC 3X1SB 2DF4C 3WKJD 3AZMA 2Y2PA 4G92B 1P3AB 2YFVB 5DNNA 2Y2HA 3MNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 C;  1P3L B;  3X1S A;  2ARO D;  5GXQ C;  4J8W B;  3AZH B;  3AYW C;  2PYO C;  1M19 B;  5GT0 B;  4Z66 C;  1P3A A;  2YFV A;  1P3L A;  1S32 D;  1ID3 C;  3VH5 A;  3VH6 T;  3AZH A;  4J8W A;  1KX4 B;  3AYW D;  2PYO D;  2F8N D;  5CPJ C;  5GT0 A;  4YM6 B;  5C3I C;  5AY8 C;  5B2I C;  3LZ0 B;  3W98 C;  3B6G C;  5B0Y C;  5BT1 C;  3AZJ D;  5B32 D;  1KX4 A;  4YM6 A;  5AY8 D;  3WTP C;  3LZ0 A;  5B2I D;  3W98 D;  3B6G D;  4G91 C;  5CPI C;  5B0Y D;  1P3K C;  3AN2 B;  3VH6 W;  5JRG C;  4QLC B;  4M6B A;  3KUY B;  5BNX B;  3A6N C;  5CPI D;  3O62 B;  3AN2 A;  4QLC A;  2FJ7 A;  3KUY A;  3VH5 T;  5BNX A;  1P3M B;  5E5A C;  3O62 A;  3A6N D;  1P3I C;  2CV5 D;  4H9R B;  4ZUX C;  3AZE C;  5B1L B;  4WU8 C;  1P3M A;  4J8V B;  4HGA B;  3REI C;  5B24 C;  5E5A D;  5DNM C;  1P3I D;  4H9R A;  4J8X B;  4ZUX D;  5B1L A;  3AZE D;  4J8V A;  3WKJ B;  4WU8 D;  4ZBJ B;  4WV4 B;  3REI D;  5DNM D;  5AVC B;  3MNN B;  5G49 A;  4J8X A;  2IO5 B;  3C1B D;  2ARO B;  2HUE C;  5B31 C;  3WKJ A;  1KU5 A;  4Z5T C;  1BH9 B;  5AVC A;  3MNN A;  1ZLA C;  1S32 B;  3NQU B;  2ARO A;  5GXQ B;  3AYW B;  2F8N B;  2PYO B;  3WA9 C;  4H9Q B;  1KX5 C;  1BH9 A;  3REL C;  4Z5T D;  3LZ1 C;  4Z66 B;  1S32 A;  3NQU A;  1ID3 B;  5GXQ A;  3AYW A;  2F8N A;  2PYO A;  2NZD A;  4H9Q A;  5CPJ B;  3AV2 C;  1KX5 D;  1HQ3 C;  4Z66 A;  2NQB C;  3REL D;  5C3I B;  3LZ1 D;  5AY8 B;  2LY8 A;  5B2I B;  4WZS B;  3W98 B;  1ID3 A;  1WWI A;  3B6G B;  3UTB C;  5B0Y B;  3MGQ B;  5CPJ A;  1F66 C;  5AVB C;  3AV2 D;  1HQ3 D;  4KHA B;  5AY8 A;  4WU9 C;  2NQB D;  3WTP B;  2HIO C;  5B2I A;  3W98 A;  3B6G A;  4JJN C;  5B0Y A;  4G91 B;  4DRA A;  3MGQ A;  3MGR C;  3KWQ C;  3UTB D;  5CPI B;  1P3K B;  3C1C C;  3AZN C;  1F66 D;  3REK C;  4KHA A;  5JRG B;  3WTP A;  3AZG C;  2HIO D;  3W97 C;  4JJN D;  5CPI A;  3A6N B;  3MGR D;  1P3K A;  3WAA A;  3KWQ D;  3C1C D;  3AZN D;  5JRG A;  3REK D;  3AZG D;  3X1V C;  4AWL C;  3W97 D;  5B40 C;  3A6N A;  5F99 C;  5E5A B;  1P3I B;  1P3F C;  2RVQ C;  4XUJ C;  4ZUX B;  3AZE B;  3B0C T;  3X1V D;  4WU8 B;  4LD9 C;  5E5A A;  5B40 D;  3REI B;  3AZJ C;  5F99 D;  5B24 B;  5B32 C;  3AZF C;  1P3I A;  5DNM B;  1M19 A;  4R8P D;  1P3F D;  4Z2M H;  4ZUX A;  2RVQ D;  4XUJ D;  3AZE A;  4WU8 A;  1KX3 C;  3REI A;  5B24 A;  4LD9 D;  5DNM A;  3AZF D;  5AV9 C;  3REJ C;  4XZQ C;  2HUE B;  4YS3 C;  5B31 B;  1P3B D;  3LEL C;  1KX3 D;  1P34 C;  4Z5T B;  4Z2M G;  3B0C W;  2BYK B;  5AV5 D;  5AV9 D;  1ZLA B;  1A7W A;  5B31 A;  4CSR B;  4XZQ D;  1H3O B;  4YS3 D;  3REJ D;  3WA9 B;  4DRB A;  1B6W A;  3LEL D;  4Z5T A;  1KX5 B;  1P34 D;  3REL B;  3LZ1 B;  4H9O B;  2BYK A;  4NE6 A;  1ZLA A;  3AZI C;  2CV5 C;  2BYM B;  5B2J D;  4CSR A;  4EO5 C;  1H3O A;  3WA9 A;  1KX5 A;  4H9P B;  3X1T B;  3REL A;  3AV2 B;  3LZ1 A;  1HQ3 B;  4H9O A;  4KGC C;  2NQB B;  2BYM A;  3AZI D;  5AV6 C;  3UTB B;  5B31 G;  4KUD D;  4H9P A;  3X1T A;  3AZM C;  3AV2 A;  1F66 B;  1HQ3 A;  2NQB A;  5AVB B;  4KGC D;  3AZK C;  4WU9 B;  2HIO B;  4UUZ B;  3NQJ B;  4JJN B;  3UTB A;  3C1B C;  3MGR B;  3W99 C;  5AV6 D;  3KWQ B;  3C1C B;  3AZN B;  1F66 A;  5AVB A;  3AZM D;  3REK B;  4WU9 A;  3AFA C;  3AZK D;  3AZG B;  2HIO A;  3B6F C;  3VH5 W;  4UUZ A;  3NQJ A;  4JJN A;  3W97 B;  3MGR A;  3KWQ A;  4WNN B;  4H9S C;  3W99 D;  3C1C A;  3AZN A;  4J8U C;  3REK A;  1BFM A;  3AZG A;  3AFA D;  3MVD C;  4AWL B;  3X1V B;  1P3G C;  3B6F D;  3W97 A;  5B40 B;  4WNN A;  5F99 B;  1JFI B;  1TZY C;  4J8U D;  3TU4 C;  4E45 A;  1P3F B;  4XUJ B;  3MVD D;  3X1V A;  5AV8 C;  1P3G D;  5B40 A;  5F99 A;  4LD9 B;  5JA4 B;  3AZJ B;  1JFI A;  5B32 B;  3AZF B;  1TZY D;  1P3F A;  3TU4 D;  4XUJ A;  2CWE A;  5AV8 D;  2F8N H;  1KX3 B;  4LD9 A;  5JA4 A;  3UT9 C;  3AZJ A;  5B32 A;  3AZF A;  5B33 C;  2FJ7 C;  5AV9 B;  1HTA A;  2F8N K;  3REJ B;  4XZQ B;  4YS3 B;  1KX3 A;  3KSY A;  5GT3 C;  3LEL B;  1P34 B;  3UT9 D;  5CPK C;  5B1M C;  1P3P C;  5B33 D;  2F8N G;  5AV9 A;  4QLC D;  3REJ A;  2FJ7 D;  4XZQ A;  4YS3 A;  5GSU C;  3KXB C;  3KUY D;  3MGS C;  3LEL A;  2YFW B;  5CP6 C;  5GT3 D;  1P34 A;  1TAF B;  5B32 G;  5CPK D;  5B1M D;  1P3P D;  3AZI B;  2CV5 B;  4EO5 B;  5GSU D;  3KXB D;  3MGS D;  1TAF A;  3X1U C;  1P3M D;  5CP6 D;  4KGC B;  2CV5 A;  4R8P C;  5AV6 B;  1WWS A;  4J8V D;  3AZM B;  3X1U D;  4KGC A;  3AZK B;  3AZL C;  1P3O C;  5AV6 A;  1U35 C;  3C1B B;  3W99 B;  1AOI C;  1M18 C;  1P3B C;  3AZK A;  3AFA B;  3AZL D;  4CAY B;  2L5A A;  2JSS A;  1N1J B;  5AVC D;  1P3O D;  3B6F B;  3V9R B;  5AV5 C;  3C1B A;  1U35 D;  3W99 A;  1AOI D;  5BO0 B;  2NZD C;  1M18 D;  4J8U B;  3AFA A;  4CAY A;  4X23 C;  3MVD B;  1N1J A;  3B6F A;  5BNV B;  1P3G B;  1M1A C;  5B0Z C;  3V9R A;  1F1E A;  4H9N B;  5B2J C;  4H9S A;  3MGP C;  5GXQ D;  5BO0 A;  2NZD D;  4J8U A;  1TZY B;  3B0D C;  3TU4 B;  3AV1 C;  4Z66 D;  3MVD A;  3UTA C;  5BNV A;  4X23 D;  1P3G A;  5AV8 B;  1EQZ C;  1M1A D;  5B0Z D;  1ULY A;  4H9N A;  1ID3 D;  3MGQ C;  3MGP D;  4KUD C;  1TZY A;  5CPJ D;  3TU4 A;  3R45 B;  3AV1 D;  5BS7 C;  3UTA D;  5AV8 A;  1EQZ D;  3REH C;  3LJA C;  5BT1 D;  3WAA C;  3W96 C;  3MGQ D;  3UT9 B;  5B33 B;  3R45 A;  2FJ7 B;  4NFT A;  3WTP D;  5GT3 B;  1R4V A;  5DNN C;  3REH D;  3UT9 A;  3LJA D;  5B33 A;  5CPK B;  5B1M B;  3X1S C;  1P3K D;  1P3P B;  3WAA D;  3W96 D;  5JRG D;  4G92 C;  1P3A C;  5GSU B;  3KXB B;  3MGS B;  5GT3 A;  5CP6 B;  5DNN D;  3WTP E;  1P3L C;  5CPK A;  4NE5 A;  5B1M A;  1P3P A;  3AZH C;  4J8W C;  3X1S D;  1M19 C;  5GT0 C;  5GSU A;  4E44 A;  1P3A D;  3KXB A;  3MGS A;  5CP6 A;  3X1U B;  1P3L D;  1KX4 C;  3AZH D;  4J8W D;  5G49 B;  1M19 D;  4YM6 C;  4R8P B;  5GT0 D;  1BH8 B;  3X1U A;  3LZ0 C;  5B24 D;  3AZL B;  1P3O B;  1KX4 D;  4R8P A;  4YM6 D;  1BH8 A;  1U35 B;  1AOI B;  1M18 B;  1P3B B;  3LZ0 D;  5FUG B;  3AZL A;  1P3O A;  3AN2 C;  1U35 A;  4QLC C;  5AV5 B;  5B31 D;  1AOI A;  1M18 A;  3KUY C;  2NZD B;  1B67 A;  1P3B A;  4NE3 A;  5FUG A;  3O62 C;  4X23 B;  3AN2 D;  1M1A B;  5B0Z B;  1ZLA D;  1Q9C A;  5AV5 A;  5B2J B;  3MGP B;  3WA9 D;  3X1T C;  1P3M C;  3B0D B;  3AV1 B;  4X23 A;  3UTA B;  3O62 D;  1M1A A;  5B0Z A;  1EQZ B;  5B2J A;  3MGP A;  4KUD B;  5B1L C;  2YFW A;  4HGA C;  3VH6 A;  5KDM B;  3X1T D;  4J8V C;  3AV1 A;  3UTA A;  3B0B A;  1EQZ A;  3REH B;  4J8X C;  3AZI A;  3LJA B;  3WAA B;  3W96 B;  4KUD A;  3WKJ C;  5KDM A;  5B1L D;  4ZBJ C;  5AVB D;  5BS7 A;  4WU9 D;  5CHL B;  5AVC C;  3REH A;  3MNN C;  5DNN B;  2IO5 C;  3LJA A;  4J8X D;  3W96 A;  2ARO C;  3X1S B;  3WKJ D;  3AZM A;  4G92 B;  1P3A B;  2YFV B;  5DNN A;  3MNN D; 
#chains in the Genus database with same CATH topology
 1S32 C;  2DQN C;  1P3L B;  3X1S A;  2ARO D;  5GXQ C;  4J8W B;  3AZH B;  3AYW C;  2PYO C;  1M19 B;  5GT0 B;  4Z66 C;  1P3A A;  2YFV A;  1P3L A;  1S32 D;  1ID3 C;  3VH5 A;  3VH6 T;  3AZH A;  4J8W A;  1KX4 B;  3AYW D;  2Y2J A;  2F8N D;  2G5I C;  2PYO D;  5CPJ C;  2JE5 A;  5GT0 A;  4YM6 B;  5C3I C;  5AY8 C;  5B2I C;  1T3U A;  3LZ0 B;  3W98 C;  3B6G C;  5B0Y C;  5BT1 C;  3AZJ D;  5B32 D;  1KX4 A;  2Y2G A;  4YM6 A;  5AY8 D;  3WTP C;  3KFU G;  3LZ0 A;  5B2I D;  3W98 D;  3B6G D;  4G91 C;  5CPI C;  5B0Y D;  1P3K C;  2J8P A;  3AN2 B;  3VH6 W;  5JRG C;  4QLC B;  4M6B A;  3KUY B;  5BNX B;  3A6N C;  5CPI D;  3O62 B;  3AN2 A;  4QLC A;  2FJ7 A;  3KUY A;  3VH5 T;  5BNX A;  1P3M B;  5E5A C;  3O62 A;  3A6N D;  1P3I C;  4WJ3 C;  2CV5 D;  4H9R B;  4ZUX C;  3AZE C;  5B1L B;  4WU8 C;  1P3M A;  4J8V B;  4HGA B;  3REI C;  5B24 C;  5E5A D;  5DNM C;  1P3I D;  4H9R A;  4J8X B;  4ZUX D;  5B1L A;  3AZE D;  4J8V A;  3WKJ B;  4WU8 D;  4ZBJ B;  4WV4 B;  3REI D;  5DNM D;  5AVC B;  3MNN B;  5G49 A;  4J8X A;  2IO5 B;  3C1B D;  2ARO B;  2HUE C;  5B31 C;  3WKJ A;  1KU5 A;  4Z5T C;  1BH9 B;  5AVC A;  3MNN A;  1ZLA C;  1S32 B;  3NQU B;  2ARO A;  3AL0 C;  5GXQ B;  3AYW B;  2F8N B;  2PYO B;  3WA9 C;  4H9Q B;  1KX5 C;  1BH9 A;  3REL C;  4Z5T D;  3LZ1 C;  4Z66 B;  1S32 A;  3NQU A;  1ID3 B;  1W2E A;  5GXQ A;  3AYW A;  2F8N A;  2PYO A;  2NZD A;  4H9Q A;  5CPJ B;  3AV2 C;  1KX5 D;  1HQ3 C;  4Z66 A;  2NQB C;  3REL D;  5C3I B;  3LZ1 D;  5AY8 B;  2LY8 A;  5B2I B;  4WZS B;  3W98 B;  3H0R C;  1WWI A;  1ID3 A;  3B6G B;  3UTB C;  5B0Y B;  3MGQ B;  2Y2Q A;  5CPJ A;  1F66 C;  5AVB C;  3AV2 D;  2Y2L A;  1HQ3 D;  4KHA B;  5AY8 A;  4WU9 C;  2NQB D;  3WTP B;  2HIO C;  5B2I A;  3W98 A;  3B6G A;  4JJN C;  5B0Y A;  4G91 B;  4DRA A;  3MGQ A;  3MGR C;  3KWQ C;  3UTB D;  5CPI B;  1P3K B;  3C1C C;  3AZN C;  1F66 D;  3REK C;  4KHA A;  2XD1 A;  5JRG B;  3WTP A;  3AZG C;  2HIO D;  3W97 C;  4JJN D;  5CPI A;  3A6N B;  3MGR D;  1P3K A;  3WAA A;  3KWQ D;  3C1C D;  3AZN D;  5JRG A;  3REK D;  3AZG D;  3X1V C;  4AWL C;  3W97 D;  5B40 C;  3A6N A;  5F99 C;  5E5A B;  1P3I B;  1P3F C;  2RVQ C;  4XUJ C;  4ZUX B;  4DQY B;  3AZE B;  3B0C T;  3X1V D;  4WU8 B;  2VQR A;  2BG1 A;  4LD9 C;  5E5A A;  5B40 D;  3REI B;  3AZJ C;  5F99 D;  5B24 B;  5B32 C;  3AZF C;  1P3I A;  5DNM B;  1M19 A;  4R8P D;  1P3F D;  4Z2M H;  4ZUX A;  2RVQ D;  4XUJ D;  3AZE A;  4WU8 A;  1KX3 C;  2ZY2 A;  3IP4 C;  3REI A;  5B24 A;  4LD9 D;  3F6T A;  5DNM A;  3AZF D;  5AV9 C;  3REJ C;  4XZQ C;  2HUE B;  4YS3 C;  5B31 B;  1P3B D;  3LEL C;  3EG5 B;  1KX3 D;  1P34 C;  3A1K A;  4Z5T B;  4Z2M G;  3B0C W;  2BYK B;  5AV5 D;  5AV9 D;  1ZLA B;  1A7W A;  5B31 A;  4CSR B;  4XZQ D;  1H3O B;  4YS3 D;  3REJ D;  3WA9 B;  4DRB A;  1B6W A;  3LEL D;  4Z5T A;  1KX5 B;  1P34 D;  3H0M C;  3REL B;  3LZ1 B;  4H9O B;  2BYK A;  4NE6 A;  4UPK A;  1ZLA A;  3AZI C;  2CV5 C;  2BYM B;  5B2J D;  4CSR A;  4EO5 C;  1H3O A;  3WA9 A;  1KX5 A;  4H9P B;  3X1T B;  3REL A;  3AV2 B;  3LZ1 A;  1HQ3 B;  4H9O A;  4KGC C;  2NQB B;  2FFF B;  2BYM A;  3AZI D;  5AV6 C;  3UTB B;  5B31 G;  4KUD D;  4H9P A;  3X1T A;  3AZM C;  3AV2 A;  1F66 B;  1HQ3 A;  2NQB A;  5AVB B;  4KGC D;  3AZK C;  4WU9 B;  2HIO B;  4UUZ B;  3NQJ B;  4JJN B;  3UTB A;  3C1B C;  3MGR B;  3W99 C;  5AV6 D;  3KWQ B;  3EPK A;  3C1C B;  3AZN B;  1F66 A;  5AVB A;  3AZM D;  3REK B;  4WU9 A;  3AFA C;  3AZK D;  3AZG B;  2HIO A;  3B6F C;  3VH5 W;  4UUZ A;  3NQJ A;  4JJN A;  3W97 B;  3MGR A;  3KWQ A;  4WNN B;  4H9S C;  3W99 D;  3C1C A;  3AZN A;  4J8U C;  3REK A;  1BFM A;  3AZG A;  3AFA D;  3MVD C;  4AWL B;  3X1V B;  1P3G C;  3B6F D;  3W97 A;  5B40 B;  4WNN A;  5F99 B;  1JFI B;  1TZY C;  4J8U D;  3TU4 C;  4E45 A;  1P3F B;  4XUJ B;  3MVD D;  3X1V A;  5AV8 C;  1P3G D;  5B40 A;  5F99 A;  4LD9 B;  5JA4 B;  3AZJ B;  1JFI A;  5B32 B;  3AZF B;  1TZY D;  1P3F A;  3TU4 D;  4XUJ A;  2CWE A;  5AV8 D;  2F8N H;  1KX3 B;  2ZY3 A;  4LD9 A;  5JA4 A;  3UT9 C;  3AZJ A;  5B32 A;  3AZF A;  5B33 C;  2F2A C;  2FJ7 C;  5AV9 B;  1HTA A;  2F8N K;  2Y2K A;  3REJ B;  4XZQ B;  4YS3 B;  1KX3 A;  3KSY A;  5GT3 C;  3LEL B;  2G5H C;  1P34 B;  3UT9 D;  5CPK C;  5B1M C;  1P3P C;  5B33 D;  2F8N G;  5AV9 A;  4QLC D;  3REJ A;  2FJ7 D;  4XZQ A;  4YS3 A;  5GSU C;  3KXB C;  3KUY D;  3MGS C;  3LEL A;  2YFW B;  5CP6 C;  5GT3 D;  1P34 A;  1TAF B;  5B32 G;  5CPK D;  5B1M D;  3H0L C;  1P3P D;  3AZI B;  2CV5 B;  3A1I A;  4EO5 B;  5GSU D;  3KXB D;  3MGS D;  1TAF A;  3X1U C;  1P3M D;  5CP6 D;  4KGC B;  2XD5 A;  2CV5 A;  4R8P C;  5AV6 B;  2W8S A;  1WWS A;  4J8V D;  3AZM B;  3X1U D;  4KGC A;  2ZY4 A;  3AZK B;  3AZL C;  1PZR A;  1P3O C;  3P5J B;  3EPL A;  5AV6 A;  1U35 C;  3C1B B;  3W99 B;  1AOI C;  1M18 C;  1P3B C;  3AZK A;  3AFA B;  3AZL D;  4CAY B;  2L5A A;  2JSS A;  1N1J B;  5AVC D;  1P3O D;  3B6F B;  3V9R B;  5AV5 C;  3C1B A;  1U35 D;  3W99 A;  1Z2C B;  1AOI D;  5BO0 B;  2NZD C;  1M18 D;  4J8U B;  2ZY5 A;  3AFA A;  4CAY A;  4X23 C;  3MVD B;  1N1J A;  3B6F A;  5BNV B;  2ZM5 A;  1P3G B;  5B0Z C;  1M1A C;  3V9R A;  1F1E A;  4H9N B;  5B2J C;  4H9S A;  3MGP C;  2RIQ A;  5GXQ D;  5BO0 A;  2NZD D;  4J8U A;  1TZY B;  3B0D C;  3TU4 B;  3AV1 C;  4Z66 D;  3MVD A;  3UTA C;  5BNV A;  4X23 D;  1P3G A;  5AV8 B;  1EQZ C;  1M1A D;  5B0Z D;  1ULY A;  4H9N A;  1ID3 D;  3MGQ C;  3MGP D;  4KUD C;  1TZY A;  5CPJ D;  3TU4 A;  3R45 B;  3AV1 D;  5BS7 C;  3UTA D;  5AV8 A;  1EQZ D;  3REH C;  3LJA C;  5BT1 D;  3WAA C;  3W96 C;  3MGQ D;  3UT9 B;  5B33 B;  3R45 A;  2FJ7 B;  3EPH A;  4NFT A;  3WTP D;  5GT3 B;  1R4V A;  5DNN C;  3REH D;  3UT9 A;  3LJA D;  5B33 A;  5CPK B;  5B1M B;  3X1S C;  1P3K D;  1P3P B;  3WAA D;  3W96 D;  5JRG D;  4G92 C;  1P3A C;  5GSU B;  3KXB B;  3MGS B;  5GT3 A;  3EPJ A;  5CP6 B;  5DNN D;  3WTP E;  1P3L C;  5CPK A;  4NE5 A;  5B1M A;  1P3P A;  3AZH C;  4J8W C;  3X1S D;  1M19 C;  2Y2M A;  2UWX A;  5GT0 C;  5GSU A;  4E44 A;  1P3A D;  3KXB A;  3MGS A;  5CP6 A;  3X1U B;  1P3L D;  1KX4 C;  2JCH A;  4J8W D;  3AZH D;  5G49 B;  1M19 D;  4YM6 C;  4R8P B;  5GT0 D;  1BH8 B;  3X1U A;  3LZ0 C;  5B24 D;  3AZL B;  1P3O B;  1KX4 D;  4R8P A;  4YM6 D;  1BH8 A;  1U35 B;  1AOI B;  1M18 B;  1P3B B;  3LZ0 D;  5FUG B;  3AZL A;  1P3O A;  3AN2 C;  1U35 A;  4QLC C;  5AV5 B;  5B31 D;  1AOI A;  1M18 A;  3KUY C;  2NZD B;  1B67 A;  1P3B A;  4NE3 A;  5FUG A;  3O62 C;  4X23 B;  3AN2 D;  1M1A B;  5B0Z B;  1ZLA D;  1Q9C A;  5AV5 A;  2Y2I A;  2Y2O A;  5B2J B;  3MGP B;  3WA9 D;  3X1T C;  1P3M C;  3B0D B;  3AV1 B;  4X23 A;  3UTA B;  3O62 D;  2Y2N A;  1M1A A;  5B0Z A;  1EQZ B;  3FDD A;  5B2J A;  3MGP A;  4KUD B;  5B1L C;  2YFW A;  4HGA C;  3VH6 A;  5KDM B;  3X1T D;  4J8V C;  3AV1 A;  3UTA A;  3B0B A;  1EQZ A;  3REH B;  4J8X C;  3AZI A;  3LJA B;  3WAA B;  3W96 B;  4KUD A;  3WKJ C;  5KDM A;  5B1L D;  4ZBJ C;  5AVB D;  5BS7 A;  4WU9 D;  5CHL B;  5AVC C;  3REH A;  3MNN C;  5DNN B;  2IO5 C;  3LJA A;  4J8X D;  3W96 A;  2ARO C;  3X1S B;  2DF4 C;  3WKJ D;  3AZM A;  2Y2P A;  4G92 B;  1P3A B;  2YFV B;  5DNN A;  2Y2H A;  3MNN D; 
#chains in the Genus database with same CATH homology
 1S32 C;  2DQN C;  1P3L B;  3X1S A;  2ARO D;  5GXQ C;  4J8W B;  3AZH B;  3AYW C;  2PYO C;  1M19 B;  5GT0 B;  4Z66 C;  1P3A A;  2YFV A;  1P3L A;  1S32 D;  1ID3 C;  3VH5 A;  3VH6 T;  3AZH A;  4J8W A;  1KX4 B;  3AYW D;  2Y2J A;  2F8N D;  2G5I C;  2PYO D;  5CPJ C;  2JE5 A;  5GT0 A;  4YM6 B;  5C3I C;  5AY8 C;  5B2I C;  1T3U A;  3LZ0 B;  3W98 C;  3B6G C;  5B0Y C;  5BT1 C;  3AZJ D;  5B32 D;  1KX4 A;  2Y2G A;  4YM6 A;  5AY8 D;  3WTP C;  3KFU G;  3LZ0 A;  5B2I D;  3W98 D;  3B6G D;  4G91 C;  5CPI C;  5B0Y D;  1P3K C;  2J8P A;  3AN2 B;  3VH6 W;  5JRG C;  4QLC B;  4M6B A;  3KUY B;  5BNX B;  3A6N C;  5CPI D;  3O62 B;  3AN2 A;  4QLC A;  2FJ7 A;  3KUY A;  3VH5 T;  5BNX A;  1P3M B;  5E5A C;  3O62 A;  3A6N D;  1P3I C;  4WJ3 C;  2CV5 D;  4H9R B;  4ZUX C;  3AZE C;  5B1L B;  4WU8 C;  1P3M A;  4J8V B;  4HGA B;  3REI C;  5B24 C;  5E5A D;  5DNM C;  1P3I D;  4H9R A;  4J8X B;  4ZUX D;  5B1L A;  3AZE D;  4J8V A;  3WKJ B;  4WU8 D;  4ZBJ B;  4WV4 B;  3REI D;  5DNM D;  5AVC B;  3MNN B;  5G49 A;  4J8X A;  2IO5 B;  3C1B D;  2ARO B;  2HUE C;  5B31 C;  3WKJ A;  1KU5 A;  4Z5T C;  1BH9 B;  5AVC A;  3MNN A;  1ZLA C;  1S32 B;  3NQU B;  2ARO A;  3AL0 C;  5GXQ B;  3AYW B;  2F8N B;  2PYO B;  3WA9 C;  4H9Q B;  1KX5 C;  1BH9 A;  3REL C;  4Z5T D;  3LZ1 C;  4Z66 B;  1S32 A;  3NQU A;  1ID3 B;  1W2E A;  5GXQ A;  3AYW A;  2F8N A;  2PYO A;  2NZD A;  4H9Q A;  5CPJ B;  3AV2 C;  1KX5 D;  1HQ3 C;  4Z66 A;  2NQB C;  3REL D;  5C3I B;  3LZ1 D;  5AY8 B;  2LY8 A;  5B2I B;  4WZS B;  3W98 B;  3H0R C;  1WWI A;  1ID3 A;  3B6G B;  3UTB C;  5B0Y B;  3MGQ B;  2Y2Q A;  5CPJ A;  1F66 C;  5AVB C;  3AV2 D;  2Y2L A;  1HQ3 D;  4KHA B;  5AY8 A;  4WU9 C;  2NQB D;  3WTP B;  2HIO C;  5B2I A;  3W98 A;  3B6G A;  4JJN C;  5B0Y A;  4G91 B;  4DRA A;  3MGQ A;  3MGR C;  3KWQ C;  3UTB D;  5CPI B;  1P3K B;  3C1C C;  3AZN C;  1F66 D;  3REK C;  4KHA A;  2XD1 A;  5JRG B;  3WTP A;  3AZG C;  2HIO D;  3W97 C;  4JJN D;  5CPI A;  3A6N B;  3MGR D;  1P3K A;  3WAA A;  3KWQ D;  3C1C D;  3AZN D;  5JRG A;  3REK D;  3AZG D;  3X1V C;  4AWL C;  3W97 D;  5B40 C;  3A6N A;  5F99 C;  5E5A B;  1P3I B;  1P3F C;  2RVQ C;  4XUJ C;  4ZUX B;  4DQY B;  3AZE B;  3B0C T;  3X1V D;  4WU8 B;  2VQR A;  2BG1 A;  4LD9 C;  5E5A A;  5B40 D;  3REI B;  3AZJ C;  5F99 D;  5B24 B;  5B32 C;  3AZF C;  1P3I A;  5DNM B;  1M19 A;  4R8P D;  1P3F D;  4Z2M H;  4ZUX A;  2RVQ D;  4XUJ D;  3AZE A;  4WU8 A;  1KX3 C;  2ZY2 A;  3IP4 C;  3REI A;  5B24 A;  4LD9 D;  3F6T A;  5DNM A;  3AZF D;  5AV9 C;  3REJ C;  4XZQ C;  2HUE B;  4YS3 C;  5B31 B;  1P3B D;  3LEL C;  3EG5 B;  1KX3 D;  1P34 C;  3A1K A;  4Z5T B;  4Z2M G;  3B0C W;  2BYK B;  5AV5 D;  5AV9 D;  1ZLA B;  1A7W A;  5B31 A;  4CSR B;  4XZQ D;  1H3O B;  4YS3 D;  3REJ D;  3WA9 B;  4DRB A;  1B6W A;  3LEL D;  4Z5T A;  1KX5 B;  1P34 D;  3H0M C;  3REL B;  3LZ1 B;  4H9O B;  2BYK A;  4NE6 A;  4UPK A;  1ZLA A;  3AZI C;  2CV5 C;  2BYM B;  5B2J D;  4CSR A;  4EO5 C;  1H3O A;  3WA9 A;  1KX5 A;  4H9P B;  3X1T B;  3REL A;  3AV2 B;  3LZ1 A;  1HQ3 B;  4H9O A;  4KGC C;  2NQB B;  2FFF B;  2BYM A;  3AZI D;  5AV6 C;  3UTB B;  5B31 G;  4KUD D;  4H9P A;  3X1T A;  3AZM C;  3AV2 A;  1F66 B;  1HQ3 A;  2NQB A;  5AVB B;  4KGC D;  3AZK C;  4WU9 B;  2HIO B;  4UUZ B;  3NQJ B;  4JJN B;  3UTB A;  3C1B C;  3MGR B;  3W99 C;  5AV6 D;  3KWQ B;  3EPK A;  3C1C B;  3AZN B;  1F66 A;  5AVB A;  3AZM D;  3REK B;  4WU9 A;  3AFA C;  3AZK D;  3AZG B;  2HIO A;  3B6F C;  3VH5 W;  4UUZ A;  3NQJ A;  4JJN A;  3W97 B;  3MGR A;  3KWQ A;  4WNN B;  4H9S C;  3W99 D;  3C1C A;  3AZN A;  4J8U C;  3REK A;  1BFM A;  3AZG A;  3AFA D;  3MVD C;  4AWL B;  3X1V B;  1P3G C;  3B6F D;  3W97 A;  5B40 B;  4WNN A;  5F99 B;  1JFI B;  1TZY C;  4J8U D;  3TU4 C;  4E45 A;  1P3F B;  4XUJ B;  3MVD D;  3X1V A;  5AV8 C;  1P3G D;  5B40 A;  5F99 A;  4LD9 B;  5JA4 B;  3AZJ B;  1JFI A;  5B32 B;  3AZF B;  1TZY D;  1P3F A;  3TU4 D;  4XUJ A;  2CWE A;  5AV8 D;  2F8N H;  1KX3 B;  2ZY3 A;  4LD9 A;  5JA4 A;  3UT9 C;  3AZJ A;  5B32 A;  3AZF A;  5B33 C;  2F2A C;  2FJ7 C;  5AV9 B;  1HTA A;  2F8N K;  2Y2K A;  3REJ B;  4XZQ B;  4YS3 B;  1KX3 A;  3KSY A;  5GT3 C;  3LEL B;  2G5H C;  1P34 B;  3UT9 D;  5CPK C;  5B1M C;  1P3P C;  5B33 D;  2F8N G;  5AV9 A;  4QLC D;  3REJ A;  2FJ7 D;  4XZQ A;  4YS3 A;  5GSU C;  3KXB C;  3KUY D;  3MGS C;  3LEL A;  2YFW B;  5CP6 C;  5GT3 D;  1P34 A;  1TAF B;  5B32 G;  5CPK D;  5B1M D;  3H0L C;  1P3P D;  3AZI B;  2CV5 B;  3A1I A;  4EO5 B;  5GSU D;  3KXB D;  3MGS D;  1TAF A;  3X1U C;  1P3M D;  5CP6 D;  4KGC B;  2XD5 A;  2CV5 A;  4R8P C;  5AV6 B;  2W8S A;  1WWS A;  4J8V D;  3AZM B;  3X1U D;  4KGC A;  2ZY4 A;  3AZK B;  3AZL C;  1PZR A;  1P3O C;  3P5J B;  3EPL A;  5AV6 A;  1U35 C;  3C1B B;  3W99 B;  1AOI C;  1M18 C;  1P3B C;  3AZK A;  3AFA B;  3AZL D;  4CAY B;  2L5A A;  2JSS A;  1N1J B;  5AVC D;  1P3O D;  3B6F B;  3V9R B;  5AV5 C;  3C1B A;  1U35 D;  3W99 A;  1Z2C B;  1AOI D;  5BO0 B;  2NZD C;  1M18 D;  4J8U B;  2ZY5 A;  3AFA A;  4CAY A;  4X23 C;  3MVD B;  1N1J A;  3B6F A;  5BNV B;  2ZM5 A;  1P3G B;  5B0Z C;  1M1A C;  3V9R A;  1F1E A;  4H9N B;  5B2J C;  4H9S A;  3MGP C;  2RIQ A;  5GXQ D;  5BO0 A;  2NZD D;  4J8U A;  1TZY B;  3B0D C;  3TU4 B;  3AV1 C;  4Z66 D;  3MVD A;  3UTA C;  5BNV A;  4X23 D;  1P3G A;  5AV8 B;  1EQZ C;  1M1A D;  5B0Z D;  1ULY A;  4H9N A;  1ID3 D;  3MGQ C;  3MGP D;  4KUD C;  1TZY A;  5CPJ D;  3TU4 A;  3R45 B;  3AV1 D;  5BS7 C;  3UTA D;  5AV8 A;  1EQZ D;  3REH C;  3LJA C;  5BT1 D;  3WAA C;  3W96 C;  3MGQ D;  3UT9 B;  5B33 B;  3R45 A;  2FJ7 B;  3EPH A;  4NFT A;  3WTP D;  5GT3 B;  1R4V A;  5DNN C;  3REH D;  3UT9 A;  3LJA D;  5B33 A;  5CPK B;  5B1M B;  3X1S C;  1P3K D;  1P3P B;  3WAA D;  3W96 D;  5JRG D;  4G92 C;  1P3A C;  5GSU B;  3KXB B;  3MGS B;  5GT3 A;  3EPJ A;  5CP6 B;  5DNN D;  3WTP E;  1P3L C;  5CPK A;  4NE5 A;  5B1M A;  1P3P A;  3AZH C;  4J8W C;  3X1S D;  1M19 C;  2Y2M A;  2UWX A;  5GT0 C;  5GSU A;  4E44 A;  1P3A D;  3KXB A;  3MGS A;  5CP6 A;  3X1U B;  1P3L D;  1KX4 C;  2JCH A;  4J8W D;  3AZH D;  5G49 B;  1M19 D;  4YM6 C;  4R8P B;  5GT0 D;  1BH8 B;  3X1U A;  3LZ0 C;  5B24 D;  3AZL B;  1P3O B;  1KX4 D;  4R8P A;  4YM6 D;  1BH8 A;  1U35 B;  1AOI B;  1M18 B;  1P3B B;  3LZ0 D;  5FUG B;  3AZL A;  1P3O A;  3AN2 C;  1U35 A;  4QLC C;  5AV5 B;  5B31 D;  1AOI A;  1M18 A;  3KUY C;  2NZD B;  1B67 A;  1P3B A;  4NE3 A;  5FUG A;  3O62 C;  4X23 B;  3AN2 D;  1M1A B;  5B0Z B;  1ZLA D;  1Q9C A;  5AV5 A;  2Y2I A;  2Y2O A;  5B2J B;  3MGP B;  3WA9 D;  3X1T C;  1P3M C;  3B0D B;  3AV1 B;  4X23 A;  3UTA B;  3O62 D;  2Y2N A;  1M1A A;  5B0Z A;  1EQZ B;  3FDD A;  5B2J A;  3MGP A;  4KUD B;  5B1L C;  2YFW A;  4HGA C;  3VH6 A;  5KDM B;  3X1T D;  4J8V C;  3AV1 A;  3UTA A;  3B0B A;  1EQZ A;  3REH B;  4J8X C;  3AZI A;  3LJA B;  3WAA B;  3W96 B;  4KUD A;  3WKJ C;  5KDM A;  5B1L D;  4ZBJ C;  5AVB D;  5BS7 A;  4WU9 D;  5CHL B;  5AVC C;  3REH A;  3MNN C;  5DNN B;  2IO5 C;  3LJA A;  4J8X D;  3W96 A;  2ARO C;  3X1S B;  2DF4 C;  3WKJ D;  3AZM A;  2Y2P A;  4G92 B;  1P3A B;  2YFV B;  5DNN A;  2Y2H A;  3MNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...