5G49B

Crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
TQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
publication title Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 25
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5g49B00
1EQZC 5DNMD 3UT9D 3REIC 3WAAB 1P3KA 3AFAD 1P3PC 3UT9B 4WU9B 3AZHA 4XUJD 3UTAD 1U35C 4J8VC 3WA9D 2IO5B 3MGPC 4UUZA 3A6ND 3UTAB 5BNXB 3V9RB 1P3OC 1BFMA 5AY8A 2CWEA 4H9SA 4R8PB 3AZLD 1M18C 1R4VA 3NQUA 2FJ7D 4DRAA 5B33D 5B40B 3X1TB 5B1MC 1P3PD 1P3LB 1U35D 2NZDC 4XZQB 3MVDA 2YFWB 3AZNA 5CP6D 5G49B 2YFVA 5CP6B 2HIOC 3WTPC 4DRBA 5DNNA 3NQJB 4YS3A 3AN2D 1KX4C 2F8NH 5E5AD 3LJAA 3UTBD 4H9RB 4J8WB 2F8ND 3W99B 3AN2B 5GXQC 2AROB 5E5AB 3UTBB 1M1AB 5AVBB 1TAFA 2F8NB 2NZDD 3C1BB 3B6FA 4ZUXA 1N1JB 5B0YC 1P3KB 3AZIA 3AZHD 1ID3C 5B31A 3AV2A 3LZ0C 3AYWA 1M19B 3VH5A 3MGRC 2CV5B 5CPKA 3KUYA 1BH9B 5AY8D 4H9OA 5GXQD 5JA4A 4KUDC 4J8UC 3RELA 3MGSA 3AZKB 1P3GC 3NQUB 3MVDD 1ID3D 2PYOA 3B6GC 4KGCA 2L5AA 1ZLAA 3O62C 1P3BA 3MGRD 1F66A 3AZNB 2YFVB 3KXBC 4ZBJB 5DNND 4LD9B 3REHC 2HUEC 4YS3D 3MNNC 5FUGB 4J8UD 5DNNB 4NE3A 3LJAB 5AVCB 3B6FD 1P3AC 2F8NK 1TAFB 4ZUXD 4HGAB 5B24A 3O62D 3AZID 5B31D 3KXBD 4Z2MG 1HQ3A 3AV2D 5AV8A 1KX3C 3AYWD 3TU4C 3AZIB 1AOIC 5CPKD 3KUYD 3REKA 3AYWB 3W97B 3X1VB 5CPKB 3MGQB 3RELD 3REJA 1P3IC 4H9OB 5JA4B 3MGSB 3AZGA 4WNNA 3AZJA 3TU4D 1ZLAD 3A6NA 2PYOB 3LZ1A 4KGCB 4WU8A 1S32C 3AZLA 1P3BB 3AZFC 1F66B 4Z5TC 3AZMC 1P34C 3B0DC 3X1UB 1EQZA 3REIA 4CSRB 3X1SC 3WKJC 1H3OA 3VH5W 3LELC 3C1CB 1P3PA 5JRGC 1P3MB 1WWIA 1U35A 5GSUC 4J8VA 3MGPA 1P3FC 4J8XB 5AV9B 5B24D 4WZSB 1P3OA 1HQ3D 1Q9CA 1BH8A 5AV8D 5B24B 5GT3B 4AWLB 3AZFD 4Z5TD 3AZMD 1M18A 1P34D 4G92C 5AV8B 3AZEC 3LELD 3REKB 5B1MA 3REJD 5B0ZC 2NZDA 5GSUD 4H9PA 5DNMB 5F99C 3AFAB 4WU9C 3AZGD 1JFIA 2HIOA 3AZJD 3WTPA 4CAYA 4XUJB 3LZ1D 4WNNB 4Z66C 3VH6A 3WA9B 3AZJB 4WU8D 1KX4A 3A6NB 5CHLB 4R8PC 3LZ1B 5GXQA 3AZLB 1EQZD 3W96B 3REID 2FJ7B 5F99D 5B0YA 5B33B 1H3OB 1P3LC 4J8VD 1ID3A 3KSYA 3MGPD 1P3PB 3LZ0A 1U35B 5AV6C 4Z66D 3MGRA 1P3OD 5BT1C 4EO5B 1M18D 4KUDA 4J8UA 5B2IC 1ULYA 1P3GA 5AV5C 5B1MD 5C3IB 2NQBC 3W99C 3AV1C 1M1AC 3B6GA 5B1MB 3C1BC 2NZDB 5AV6D 3O62A 4H9PB 2HIOD 3KXBA 3WTPD 1HTAA 3AZHB 3REHA 1JFIB 4E44A 3MNNA 1KX4D 1M19C 4UUZB 2BYMA 4CAYB 2CV5C 3WTPE 5AV5D 5AY8B 5B32G 4H9QA 1TZYC 5GXQB 3AZKC 1P3AA 5B0YD 4KHAA 3LZ0D 1KX3A 1AOIA 3TU4A 3MVDB 1ID3B 3VH5T 4YM6C 3B0CW 4ZBJC 3MGRB 4NE5A 4LD9C 4KUDD 5B2JC 1P3IA 1TZYD 1P3GD 4YS3B 4J8UB 1KX5C 3VH6W 3W98C 3B6GD 5AVCC 4HGAC 3B6FB 4JJNC 1S32A 4ZUXB 3O62B 3AZFA 3REHD 4Z5TA 3MNND 3AZMA 1P34A 5B31B 1A7WA 3KXBB 3AV2B 3X1SA 2HUEB 2LY8A 3WKJA 3W97C 3KUYB 3LELA 3X1VC 4G91B 2BYMB 5JRGA 3R45A 3MGQC 5GSUA 1P3AD 1P3FA 3RELB 5BNVA 4JJND 1KX3D 1AOID 5CPJC 3TU4B 3AZEA 1ZLAB 4H9NA 1P3ID 5B0ZA 3X1UC 2F8NG 5B32C 5F99A 3C1CC 4WU9A 4X23C 1P3MC 4Z66A 3KWQB 5AV9C 4J8XC 5CPJD 1S32D 3V9RA 5CPIC 4R8PA 5GT3C 4AWLC 1S32B 1HQ3B 3AZFB 3X1SD 4Z5TB 3WKJD 4QLCC 3AZMB 1P34B 3B0DB 5GT0C 5JRGD 5B1LC 3X1SB 3W96C 3KWQC 4NE6A 3WKJB 1P3LA 4X23D 3LELB 3WAAC 5JRGB 1P3FD 3REJB 5AV6A 5GSUB 5DNMC 3UT9C 3AFAC 2IO5C 3AZGB 4E45A 4XUJC 3UTAC 3AZED 3WA9C 5B2IA 4QLCD 4G92B 4H9RA 5AV5A 4WU8B 2NQBA 3W99A 5B1LD 3W96D 5B0ZD 3AV1A 1M1AA 3C1BA 5BS7C 1EQZB 5B40C 5B0ZB 3REIB 3B0CT 3X1TC 2FJ7C 4WU9D 1N1JA 5B33C 5F99B 4XZQC 4J8VB 4Z2MH 3MGPB 3VH6T 1M19A 2CV5A 5B31G 5CP6C 1BH9A 4Z66B 4R8PD 4EO5C 1P3OB 1BH8B 1M18B 1TZYA 4M6BA 4J8WC 3AZKA 5B40D 3AN2C 3X1TD 5C3IC 2AROC 5E5AC 3UTBC 1P3LD 5AVBC 4XZQD 5BT1D 4YM6A 1P3KC 5AV6B 4LD9A 2HIOB 3AZHC 3WTPB 5B2ID 5B2JA 5FUGA 1KX4B 4J8WD 1KX5A 2NQBD 3W99D 5B2IB 3W98A 5AY8C 2AROD 4H9SC 3AV1D 1M1AD 5AVBD 5AV5B 3C1BD 5AVCA 2NQBB 1B6WA 3AV1B 1P3KD 4JJNA 5B0YB 3LZ0B 3MVDC 1M19D 2CV5D 3AZNC 3W97A 3X1VA 1F1EA 3MGQA 2BYKA 5DNNC 4KUDB 3AZKD 4YS3C 1TZYB 1P3GB 3LJAC 3B6GB 1B67A 4YM6D 5CPJA 3AZND 3B6FC 4ZUXC 2JSSA 1WWSA 4WV4B 4YM6B 4LD9D 3AZIC 5B31C 5BO0A 5B2JD 3REHB 3AV2C 3MNNB 3X1UA 1KU5A 3AYWC 1KX5D 4CSRA 5B32A 5B2JB 5CPKC 3KUYC 3W98D 4G91C 3C1CA 3LJAD 1KX5B 4X23A 1P3MA 5AVCD 3W98B 4H9QB 3RELC 4J8XA 5AV9A 3MGSC 1P3AB 5CPIA 4KHAB 5GT3A 4JJNB 1KX3B 2PYOC 1AOIB 4KGCC 5KDMA 4QLCA 3W97D 5GT0A 1ZLAC 3X1VD 1P3BC 1F66C 5B1LA 3W96A 3KWQA 3MGQD 3WAAA 1P3IB 2BYKB 5DNMA 3MGSD 3B0BA 3UT9A 3AFAA 2PYOD 4XUJA 4NFTA 3UTAA 5BNXA 3WA9A 4KGCD 5B24C 2RVQC 5CPJB 1P3BD 1F66D 1HQ3C 5AV8C 3X1UD 5BS7A 5B32D 5B40A 5BO0B 3REKC 3C1CD 3X1TA 2FJ7A 1P3MD 5B32B 5B33A 4XZQA 3R45B 2YFWA 5G49A 4X23B 5AV9D 4J8XD 3REJC 1P3FB 5BNVB 5CP6A 5CPID 2RVQD 5GT3D 3NQJA 3AZGC 5CPIB 3AZJC 5GT0D 3A6NC 4J8WA 3LZ1C 3AZEB 5KDMB 3AN2A 3KWQD 3REKD 4QLCB 4WU8C 5GT0B 2AROA 5E5AA 3UTBA 3AZLC 5AVBA 2F8NA 3WAAD 5B1LB 4H9NB
chains in the Genus database with same CATH superfamily
1EQZC 5DNMD 3UT9D 3REIC 3WAAB 1P3KA 3AFAD 1P3PC 3UT9B 4WU9B 3AZHA 4XUJD 3UTAD 1U35C 4J8VC 3WA9D 2IO5B 3MGPC 2Y2IA 4UUZA 3A6ND 3UTAB 3EPJA 5BNXB 3V9RB 1P3OC 1BFMA 5AY8A 2CWEA 4H9SA 4R8PB 3AZLD 1M18C 1R4VA 3NQUA 2FJ7D 4DRAA 5B33D 5B40B 3X1TB 5B1MC 1P3PD 1P3LB 1U35D 2NZDC 4XZQB 3MVDA 2YFWB 3AZNA 2Y2HA 5CP6D 5G49B 2YFVA 5CP6B 3A1IA 2HIOC 3WTPC 4DRBA 5DNNA 3NQJB 4YS3A 3AN2D 1KX4C 2F8NH 5E5AD 3LJAA 3UTBD 4H9RB 4J8WB 2F8ND 3W99B 3AN2B 5GXQC 2AROB 5E5AB 3UTBB 1M1AB 5AVBB 1TAFA 2F8NB 2NZDD 3C1BB 2Y2PA 3B6FA 4ZUXA 1N1JB 5B0YC 1P3KB 3AZIA 3AZHD 1ID3C 5B31A 3AV2A 3LZ0C 3AYWA 1M19B 3VH5A 3MGRC 2CV5B 5CPKA 3KUYA 1BH9B 5AY8D 4H9OA 5GXQD 5JA4A 4KUDC 4J8UC 3RELA 3EG5B 3MGSA 3AZKB 1P3GC 3NQUB 3MVDD 1ID3D 2PYOA 3B6GC 4KGCA 2L5AA 1ZLAA 3O62C 3IP4C 3MGRD 1P3BA 1F66A 3AZNB 2YFVB 3KXBC 4ZBJB 5DNND 4LD9B 3REHC 2HUEC 4YS3D 3MNNC 5FUGB 4J8UD 5DNNB 2JE5A 4NE3A 3LJAB 3EPHA 5AVCB 3B6FD 1P3AC 2F8NK 1TAFB 4ZUXD 4HGAB 5B24A 3O62D 3AZID 2Y2MA 5B31D 3KXBD 4Z2MG 1HQ3A 3AV2D 5AV8A 1KX3C 3AYWD 3TU4C 3AZIB 1AOIC 5CPKD 3KUYD 3REKA 3AYWB 3W97B 3X1VB 5CPKB 3MGQB 3RELD 3REJA 1P3IC 4H9OB 5JA4B 3H0LC 3MGSB 2G5IC 3FDDA 3AZGA 4WNNA 3AZJA 3TU4D 1ZLAD 3A6NA 2PYOB 3LZ1A 4KGCB 4WU8A 1S32C 3AZLA 1P3BB 3AZFC 1F66B 4Z5TC 3AZMC 1P34C 3B0DC 3X1UB 1EQZA 3REIA 4CSRB 3X1SC 3WKJC 1H3OA 3VH5W 3LELC 3C1CB 1P3PA 5JRGC 1P3MB 1WWIA 1U35A 5GSUC 4J8VA 3MGPA 1P3FC 4J8XB 5AV9B 5B24D 4WZSB 1P3OA 1HQ3D 1BH8A 1Q9CA 5AV8D 5B24B 5GT3B 4AWLB 3AZFD 4Z5TD 2G5HC 3AZMD 1P34D 1M18A 4G92C 5AV8B 3AZEC 3LELD 3REKB 5B1MA 3REJD 5B0ZC 2NZDA 5GSUD 4H9PA 5DNMB 5F99C 3AFAB 4WU9C 3AZGD 1JFIA 2HIOA 3AZJD 3WTPA 4CAYA 4XUJB 3LZ1D 4WNNB 4Z66C 3VH6A 3WA9B 3AZJB 4WU8D 1KX4A 3A6NB 5CHLB 4R8PC 3LZ1B 2ZY2A 5GXQA 3AZLB 1EQZD 3W96B 3REID 2FJ7B 2Y2GA 5F99D 5B0YA 5B33B 1H3OB 1P3LC 4J8VD 1ID3A 3KSYA 2XD5A 3MGPD 3LZ0A 1P3PB 1U35B 5AV6C 4Z66D 2Y2LA 3MGRA 1P3OD 5BT1C 4EO5B 3H0RC 2W8SA 1M18D 4KUDA 4J8UA 5B2IC 1ULYA 1P3GA 2DQNC 5AV5C 5B1MD 5C3IB 2NQBC 3W99C 3AV1C 1M1AC 3B6GA 5B1MB 3C1BC 2NZDB 5AV6D 3O62A 4H9PB 2HIOD 3KXBA 3WTPD 1HTAA 3AZHB 3REHA 1JFIB 4E44A 3MNNA 1KX4D 1M19C 4UUZB 2BYMA 4CAYB 1Z2CB 3WTPE 2CV5C 5AV5D 5AY8B 5B32G 4H9QA 2JCHA 1TZYC 5GXQB 3AZKC 1P3AA 2J8PA 5B0YD 4DQYB 4KHAA 3LZ0D 1KX3A 1AOIA 3TU4A 3MVDB 1ID3B 3VH5T 4YM6C 3P5JB 3B0CW 4ZBJC 3MGRB 4NE5A 4LD9C 4KUDD 5B2JC 1P3IA 1TZYD 1P3GD 4YS3B 2Y2OA 4J8UB 1KX5C 3VH6W 2DF4C 3W98C 2Y2QA 3B6GD 5AVCC 4HGAC 3B6FB 4JJNC 1S32A 4ZUXB 3O62B 3AZFA 3REHD 4Z5TA 3MNND 3AZMA 1P34A 5B31B 1A7WA 3KXBB 3AV2B 3X1SA 2HUEB 2LY8A 3WKJA 3W97C 3KUYB 3LELA 3X1VC 4G91B 2BYMB 5JRGA 3R45A 3MGQC 5GSUA 1P3AD 1P3FA 3RELB 5BNVA 4JJND 1KX3D 1AOID 2ZY3A 5CPJC 3TU4B 3AZEA 1ZLAB 4H9NA 1P3ID 5B0ZA 3X1UC 2F8NG 5B32C 5F99A 2UWXA 3C1CC 4WU9A 4X23C 1P3MC 4Z66A 3KWQB 5AV9C 4J8XC 5CPJD 1S32D 3V9RA 5CPIC 4R8PA 5GT3C 4AWLC 1S32B 1HQ3B 3AZFB 3X1SD 4Z5TB 3WKJD 4QLCC 3AZMB 1P34B 3B0DB 5GT0C 3H0MC 5JRGD 5B1LC 3X1SB 3W96C 3KWQC 4NE6A 2Y2NA 3F6TA 3WKJB 1P3LA 4X23D 3LELB 3WAAC 5JRGB 1P3FD 3REJB 5AV6A 5GSUB 5DNMC 3UT9C 3AFAC 2IO5C 3AZGB 4E45A 4XUJC 3UTAC 3AZED 3A1KA 5B2IA 3WA9C 4QLCD 4G92B 4H9RA 5AV5A 4WU8B 2NQBA 3W99A 5B1LD 3W96D 5B0ZD 3AV1A 1M1AA 3C1BA 5BS7C 1EQZB 5B40C 5B0ZB 3REIB 3B0CT 3X1TC 2FJ7C 4WU9D 1N1JA 5B33C 5F99B 4XZQC 4J8VB 4Z2MH 3MGPB 3VH6T 1M19A 2CV5A 5B31G 5CP6C 1BH9A 2RIQA 4Z66B 4EO5C 4R8PD 1P3OB 1BH8B 1M18B 1TZYA 4M6BA 4J8WC 3AZKA 5B40D 3AN2C 3X1TD 2VQRA 5C3IC 2AROC 5E5AC 3UTBC 1P3LD 5AVBC 4XZQD 2FFFB 5BT1D 4YM6A 1P3KC 3EPLA 5AV6B 4LD9A 2HIOB 3AZHC 3WTPB 5B2ID 5B2JA 5FUGA 2XD1A 4J8WD 1KX4B 1KX5A 2NQBD 3W99D 5B2IB 3W98A 5AY8C 2AROD 4H9SC 3AV1D 1M1AD 5AVBD 5AV5B 2F2AC 5AVCA 3C1BD 2NQBB 1B6WA 3AV1B 1P3KD 4JJNA 4WJ3C 5B0YB 3LZ0B 3MVDC 1M19D 3EPKA 2CV5D 3AZNC 3W97A 3AL0C 1W2EA 3X1VA 1F1EA 3MGQA 2BYKA 5DNNC 4KUDB 3AZKD 4YS3C 1TZYB 1P3GB 3LJAC 3B6GB 1B67A 4YM6D 5CPJA 3AZND 3B6FC 4ZUXC 2JSSA 1WWSA 4WV4B 4YM6B 4LD9D 3AZIC 1T3UA 5B31C 5BO0A 5B2JD 3REHB 3AV2C 3MNNB 3X1UA 1KU5A 3AYWC 2ZY5A 1KX5D 4CSRA 5B32A 5B2JB 5CPKC 3KUYC 3W98D 4G91C 3C1CA 3LJAD 1KX5B 4X23A 1P3MA 5AVCD 3W98B 4H9QB 3RELC 4J8XA 5AV9A 3MGSC 1P3AB 5CPIA 4KHAB 5GT3A 4JJNB 3KFUG 1KX3B 2PYOC 1AOIB 4KGCC 5KDMA 4QLCA 3W97D 5GT0A 1ZLAC 3X1VD 1P3BC 1F66C 5B1LA 3W96A 3KWQA 3MGQD 3WAAA 2Y2JA 4UPKA 1P3IB 2BYKB 5DNMA 3MGSD 3B0BA 3UT9A 3AFAA 2BG1A 2PYOD 4XUJA 4NFTA 3UTAA 5BNXA 3WA9A 4KGCD 5B24C 2RVQC 5CPJB 1P3BD 1F66D 1HQ3C 5AV8C 3X1UD 1PZRA 5BS7A 5B32D 5B40A 5BO0B 3REKC 3C1CD 2ZY4A 3X1TA 2FJ7A 1P3MD 5B32B 5B33A 4XZQA 3R45B 2ZM5A 2YFWA 5G49A 4X23B 5AV9D 4J8XD 3REJC 2Y2KA 1P3FB 5BNVB 5CP6A 5CPID 2RVQD 5GT3D 3NQJA 3AZGC 5CPIB 3AZJC 5GT0D 3A6NC 4J8WA 3LZ1C 3AZEB 5KDMB 3AN2A 3KWQD 3REKD 4QLCB 4WU8C 5GT0B 2AROA 5E5AA 3UTBA 3AZLC 5AVBA 2F8NA 3WAAD 5B1LB 4H9NB
chains in the Genus database with same CATH topology
1EQZC 5DNMD 3UT9D 3REIC 3WAAB 1P3KA 3AFAD 1P3PC 3UT9B 4WU9B 3AZHA 4XUJD 3UTAD 1U35C 4J8VC 3WA9D 2IO5B 3MGPC 2Y2IA 4UUZA 3A6ND 3UTAB 3EPJA 5BNXB 3V9RB 1P3OC 1BFMA 5AY8A 2CWEA 4H9SA 4R8PB 3AZLD 1M18C 1R4VA 3NQUA 2FJ7D 4DRAA 5B33D 5B40B 3X1TB 5B1MC 1P3PD 1P3LB 1U35D 2NZDC 4XZQB 3MVDA 2YFWB 3AZNA 2Y2HA 5CP6D 5G49B 2YFVA 5CP6B 3A1IA 2HIOC 3WTPC 4DRBA 5DNNA 3NQJB 4YS3A 3AN2D 1KX4C 2F8NH 5E5AD 3LJAA 3UTBD 4H9RB 4J8WB 2F8ND 3W99B 3AN2B 5GXQC 2AROB 5E5AB 3UTBB 1M1AB 5AVBB 1TAFA 2F8NB 2NZDD 3C1BB 2Y2PA 3B6FA 4ZUXA 1N1JB 5B0YC 1P3KB 3AZIA 3AZHD 1ID3C 5B31A 3AV2A 3LZ0C 3AYWA 1M19B 3VH5A 3MGRC 2CV5B 5CPKA 3KUYA 1BH9B 5AY8D 4H9OA 5GXQD 5JA4A 4KUDC 4J8UC 3RELA 3EG5B 3MGSA 3AZKB 1P3GC 3NQUB 3MVDD 1ID3D 2PYOA 3B6GC 4KGCA 2L5AA 1ZLAA 3O62C 3IP4C 3MGRD 1P3BA 1F66A 3AZNB 2YFVB 3KXBC 4ZBJB 5DNND 4LD9B 3REHC 2HUEC 4YS3D 3MNNC 5FUGB 4J8UD 5DNNB 2JE5A 4NE3A 3LJAB 3EPHA 5AVCB 3B6FD 1P3AC 2F8NK 1TAFB 4ZUXD 4HGAB 5B24A 3O62D 3AZID 2Y2MA 5B31D 3KXBD 4Z2MG 1HQ3A 3AV2D 5AV8A 1KX3C 3AYWD 3TU4C 3AZIB 1AOIC 5CPKD 3KUYD 3REKA 3AYWB 3W97B 3X1VB 5CPKB 3MGQB 3RELD 3REJA 1P3IC 4H9OB 5JA4B 3H0LC 3MGSB 2G5IC 3FDDA 3AZGA 4WNNA 3AZJA 3TU4D 1ZLAD 3A6NA 2PYOB 3LZ1A 4KGCB 4WU8A 1S32C 3AZLA 1P3BB 3AZFC 1F66B 4Z5TC 3AZMC 1P34C 3B0DC 3X1UB 1EQZA 3REIA 4CSRB 3X1SC 3WKJC 1H3OA 3VH5W 3LELC 3C1CB 1P3PA 5JRGC 1P3MB 1WWIA 1U35A 5GSUC 4J8VA 3MGPA 1P3FC 4J8XB 5AV9B 5B24D 4WZSB 1P3OA 1HQ3D 1BH8A 1Q9CA 5AV8D 5B24B 5GT3B 4AWLB 3AZFD 4Z5TD 2G5HC 3AZMD 1P34D 1M18A 4G92C 5AV8B 3AZEC 3LELD 3REKB 5B1MA 3REJD 5B0ZC 2NZDA 5GSUD 4H9PA 5DNMB 5F99C 3AFAB 4WU9C 3AZGD 1JFIA 2HIOA 3AZJD 3WTPA 4CAYA 4XUJB 3LZ1D 4WNNB 4Z66C 3VH6A 3WA9B 3AZJB 4WU8D 1KX4A 3A6NB 5CHLB 4R8PC 3LZ1B 2ZY2A 5GXQA 3AZLB 1EQZD 3W96B 3REID 2FJ7B 2Y2GA 5F99D 5B0YA 5B33B 1H3OB 1P3LC 4J8VD 1ID3A 3KSYA 2XD5A 3MGPD 3LZ0A 1P3PB 1U35B 5AV6C 4Z66D 2Y2LA 3MGRA 1P3OD 5BT1C 4EO5B 3H0RC 2W8SA 1M18D 4KUDA 4J8UA 5B2IC 1ULYA 1P3GA 2DQNC 5AV5C 5B1MD 5C3IB 2NQBC 3W99C 3AV1C 1M1AC 3B6GA 5B1MB 3C1BC 2NZDB 5AV6D 3O62A 4H9PB 2HIOD 3KXBA 3WTPD 1HTAA 3AZHB 3REHA 1JFIB 4E44A 3MNNA 1KX4D 1M19C 4UUZB 2BYMA 4CAYB 1Z2CB 3WTPE 2CV5C 5AV5D 5AY8B 5B32G 4H9QA 2JCHA 1TZYC 5GXQB 3AZKC 1P3AA 2J8PA 5B0YD 4DQYB 4KHAA 3LZ0D 1KX3A 1AOIA 3TU4A 3MVDB 1ID3B 3VH5T 4YM6C 3P5JB 3B0CW 4ZBJC 3MGRB 4NE5A 4LD9C 4KUDD 5B2JC 1P3IA 1TZYD 1P3GD 4YS3B 2Y2OA 4J8UB 1KX5C 3VH6W 2DF4C 3W98C 2Y2QA 3B6GD 5AVCC 4HGAC 3B6FB 4JJNC 1S32A 4ZUXB 3O62B 3AZFA 3REHD 4Z5TA 3MNND 3AZMA 1P34A 5B31B 1A7WA 3KXBB 3AV2B 3X1SA 2HUEB 2LY8A 3WKJA 3W97C 3KUYB 3LELA 3X1VC 4G91B 2BYMB 5JRGA 3R45A 3MGQC 5GSUA 1P3AD 1P3FA 3RELB 5BNVA 4JJND 1KX3D 1AOID 2ZY3A 5CPJC 3TU4B 3AZEA 1ZLAB 4H9NA 1P3ID 5B0ZA 3X1UC 2F8NG 5B32C 5F99A 2UWXA 3C1CC 4WU9A 4X23C 1P3MC 4Z66A 3KWQB 5AV9C 4J8XC 5CPJD 1S32D 3V9RA 5CPIC 4R8PA 5GT3C 4AWLC 1S32B 1HQ3B 3AZFB 3X1SD 4Z5TB 3WKJD 4QLCC 3AZMB 1P34B 3B0DB 5GT0C 3H0MC 5JRGD 5B1LC 3X1SB 3W96C 3KWQC 4NE6A 2Y2NA 3F6TA 3WKJB 1P3LA 4X23D 3LELB 3WAAC 5JRGB 1P3FD 3REJB 5AV6A 5GSUB 5DNMC 3UT9C 3AFAC 2IO5C 3AZGB 4E45A 4XUJC 3UTAC 3AZED 3A1KA 5B2IA 3WA9C 4QLCD 4G92B 4H9RA 5AV5A 4WU8B 2NQBA 3W99A 5B1LD 3W96D 5B0ZD 3AV1A 1M1AA 3C1BA 5BS7C 1EQZB 5B40C 5B0ZB 3REIB 3B0CT 3X1TC 2FJ7C 4WU9D 1N1JA 5B33C 5F99B 4XZQC 4J8VB 4Z2MH 3MGPB 3VH6T 1M19A 2CV5A 5B31G 5CP6C 1BH9A 2RIQA 4Z66B 4EO5C 4R8PD 1P3OB 1BH8B 1M18B 1TZYA 4M6BA 4J8WC 3AZKA 5B40D 3AN2C 3X1TD 2VQRA 5C3IC 2AROC 5E5AC 3UTBC 1P3LD 5AVBC 4XZQD 2FFFB 5BT1D 4YM6A 1P3KC 3EPLA 5AV6B 4LD9A 2HIOB 3AZHC 3WTPB 5B2ID 5B2JA 5FUGA 2XD1A 4J8WD 1KX4B 1KX5A 2NQBD 3W99D 5B2IB 3W98A 5AY8C 2AROD 4H9SC 3AV1D 1M1AD 5AVBD 5AV5B 2F2AC 5AVCA 3C1BD 2NQBB 1B6WA 3AV1B 1P3KD 4JJNA 4WJ3C 5B0YB 3LZ0B 3MVDC 1M19D 3EPKA 2CV5D 3AZNC 3W97A 3AL0C 1W2EA 3X1VA 1F1EA 3MGQA 2BYKA 5DNNC 4KUDB 3AZKD 4YS3C 1TZYB 1P3GB 3LJAC 3B6GB 1B67A 4YM6D 5CPJA 3AZND 3B6FC 4ZUXC 2JSSA 1WWSA 4WV4B 4YM6B 4LD9D 3AZIC 1T3UA 5B31C 5BO0A 5B2JD 3REHB 3AV2C 3MNNB 3X1UA 1KU5A 3AYWC 2ZY5A 1KX5D 4CSRA 5B32A 5B2JB 5CPKC 3KUYC 3W98D 4G91C 3C1CA 3LJAD 1KX5B 4X23A 1P3MA 5AVCD 3W98B 4H9QB 3RELC 4J8XA 5AV9A 3MGSC 1P3AB 5CPIA 4KHAB 5GT3A 4JJNB 3KFUG 1KX3B 2PYOC 1AOIB 4KGCC 5KDMA 4QLCA 3W97D 5GT0A 1ZLAC 3X1VD 1P3BC 1F66C 5B1LA 3W96A 3KWQA 3MGQD 3WAAA 2Y2JA 4UPKA 1P3IB 2BYKB 5DNMA 3MGSD 3B0BA 3UT9A 3AFAA 2BG1A 2PYOD 4XUJA 4NFTA 3UTAA 5BNXA 3WA9A 4KGCD 5B24C 2RVQC 5CPJB 1P3BD 1F66D 1HQ3C 5AV8C 3X1UD 1PZRA 5BS7A 5B32D 5B40A 5BO0B 3REKC 3C1CD 2ZY4A 3X1TA 2FJ7A 1P3MD 5B32B 5B33A 4XZQA 3R45B 2ZM5A 2YFWA 5G49A 4X23B 5AV9D 4J8XD 3REJC 2Y2KA 1P3FB 5BNVB 5CP6A 5CPID 2RVQD 5GT3D 3NQJA 3AZGC 5CPIB 3AZJC 5GT0D 3A6NC 4J8WA 3LZ1C 3AZEB 5KDMB 3AN2A 3KWQD 3REKD 4QLCB 4WU8C 5GT0B 2AROA 5E5AA 3UTBA 3AZLC 5AVBA 2F8NA 3WAAD 5B1LB 4H9NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ C;  5DNM D;  3UT9 D;  3REI C;  3WAA B;  1P3K A;  3AFA D;  1P3P C;  3UT9 B;  4WU9 B;  3AZH A;  4XUJ D;  3UTA D;  1U35 C;  4J8V C;  3WA9 D;  2IO5 B;  3MGP C;  4UUZ A;  3A6N D;  3UTA B;  5BNX B;  3V9R B;  1P3O C;  1BFM A;  5AY8 A;  2CWE A;  4H9S A;  4R8P B;  3AZL D;  1M18 C;  1R4V A;  3NQU A;  2FJ7 D;  4DRA A;  5B33 D;  5B40 B;  3X1T B;  5B1M C;  1P3P D;  1P3L B;  1U35 D;  2NZD C;  4XZQ B;  3MVD A;  2YFW B;  3AZN A;  5CP6 D;  5G49 B;  2YFV A;  5CP6 B;  2HIO C;  3WTP C;  4DRB A;  5DNN A;  3NQJ B;  4YS3 A;  3AN2 D;  1KX4 C;  2F8N H;  5E5A D;  3LJA A;  3UTB D;  4H9R B;  4J8W B;  2F8N D;  3W99 B;  3AN2 B;  5GXQ C;  2ARO B;  5E5A B;  3UTB B;  1M1A B;  5AVB B;  1TAF A;  2F8N B;  2NZD D;  3C1B B;  3B6F A;  4ZUX A;  1N1J B;  5B0Y C;  1P3K B;  3AZI A;  3AZH D;  1ID3 C;  5B31 A;  3AV2 A;  3LZ0 C;  3AYW A;  1M19 B;  3VH5 A;  3MGR C;  2CV5 B;  5CPK A;  3KUY A;  1BH9 B;  5AY8 D;  4H9O A;  5GXQ D;  5JA4 A;  4KUD C;  4J8U C;  3REL A;  3MGS A;  3AZK B;  1P3G C;  3NQU B;  3MVD D;  1ID3 D;  2PYO A;  3B6G C;  4KGC A;  2L5A A;  1ZLA A;  3O62 C;  1P3B A;  3MGR D;  1F66 A;  3AZN B;  2YFV B;  3KXB C;  4ZBJ B;  5DNN D;  4LD9 B;  3REH C;  2HUE C;  4YS3 D;  3MNN C;  5FUG B;  4J8U D;  5DNN B;  4NE3 A;  3LJA B;  5AVC B;  3B6F D;  1P3A C;  2F8N K;  1TAF B;  4ZUX D;  4HGA B;  5B24 A;  3O62 D;  3AZI D;  5B31 D;  3KXB D;  4Z2M G;  1HQ3 A;  3AV2 D;  5AV8 A;  1KX3 C;  3AYW D;  3TU4 C;  3AZI B;  1AOI C;  5CPK D;  3KUY D;  3REK A;  3AYW B;  3W97 B;  3X1V B;  5CPK B;  3MGQ B;  3REL D;  3REJ A;  1P3I C;  4H9O B;  5JA4 B;  3MGS B;  3AZG A;  4WNN A;  3AZJ A;  3TU4 D;  1ZLA D;  3A6N A;  2PYO B;  3LZ1 A;  4KGC B;  4WU8 A;  1S32 C;  3AZL A;  1P3B B;  3AZF C;  1F66 B;  4Z5T C;  3AZM C;  1P34 C;  3B0D C;  3X1U B;  1EQZ A;  3REI A;  4CSR B;  3X1S C;  3WKJ C;  1H3O A;  3VH5 W;  3LEL C;  3C1C B;  1P3P A;  5JRG C;  1P3M B;  1WWI A;  1U35 A;  5GSU C;  4J8V A;  3MGP A;  1P3F C;  4J8X B;  5AV9 B;  5B24 D;  4WZS B;  1P3O A;  1HQ3 D;  1Q9C A;  1BH8 A;  5AV8 D;  5B24 B;  5GT3 B;  4AWL B;  3AZF D;  4Z5T D;  3AZM D;  1M18 A;  1P34 D;  4G92 C;  5AV8 B;  3AZE C;  3LEL D;  3REK B;  5B1M A;  3REJ D;  5B0Z C;  2NZD A;  5GSU D;  4H9P A;  5DNM B;  5F99 C;  3AFA B;  4WU9 C;  3AZG D;  1JFI A;  2HIO A;  3AZJ D;  3WTP A;  4CAY A;  4XUJ B;  3LZ1 D;  4WNN B;  4Z66 C;  3VH6 A;  3WA9 B;  3AZJ B;  4WU8 D;  1KX4 A;  3A6N B;  5CHL B;  4R8P C;  3LZ1 B;  5GXQ A;  3AZL B;  1EQZ D;  3W96 B;  3REI D;  2FJ7 B;  5F99 D;  5B0Y A;  5B33 B;  1H3O B;  1P3L C;  4J8V D;  1ID3 A;  3KSY A;  3MGP D;  1P3P B;  3LZ0 A;  1U35 B;  5AV6 C;  4Z66 D;  3MGR A;  1P3O D;  5BT1 C;  4EO5 B;  1M18 D;  4KUD A;  4J8U A;  5B2I C;  1ULY A;  1P3G A;  5AV5 C;  5B1M D;  5C3I B;  2NQB C;  3W99 C;  3AV1 C;  1M1A C;  3B6G A;  5B1M B;  3C1B C;  2NZD B;  5AV6 D;  3O62 A;  4H9P B;  2HIO D;  3KXB A;  3WTP D;  1HTA A;  3AZH B;  3REH A;  1JFI B;  4E44 A;  3MNN A;  1KX4 D;  1M19 C;  4UUZ B;  2BYM A;  4CAY B;  2CV5 C;  3WTP E;  5AV5 D;  5AY8 B;  5B32 G;  4H9Q A;  1TZY C;  5GXQ B;  3AZK C;  1P3A A;  5B0Y D;  4KHA A;  3LZ0 D;  1KX3 A;  1AOI A;  3TU4 A;  3MVD B;  1ID3 B;  3VH5 T;  4YM6 C;  3B0C W;  4ZBJ C;  3MGR B;  4NE5 A;  4LD9 C;  4KUD D;  5B2J C;  1P3I A;  1TZY D;  1P3G D;  4YS3 B;  4J8U B;  1KX5 C;  3VH6 W;  3W98 C;  3B6G D;  5AVC C;  4HGA C;  3B6F B;  4JJN C;  1S32 A;  4ZUX B;  3O62 B;  3AZF A;  3REH D;  4Z5T A;  3MNN D;  3AZM A;  1P34 A;  5B31 B;  1A7W A;  3KXB B;  3AV2 B;  3X1S A;  2HUE B;  2LY8 A;  3WKJ A;  3W97 C;  3KUY B;  3LEL A;  3X1V C;  4G91 B;  2BYM B;  5JRG A;  3R45 A;  3MGQ C;  5GSU A;  1P3A D;  1P3F A;  3REL B;  5BNV A;  4JJN D;  1KX3 D;  1AOI D;  5CPJ C;  3TU4 B;  3AZE A;  1ZLA B;  4H9N A;  1P3I D;  5B0Z A;  3X1U C;  2F8N G;  5B32 C;  5F99 A;  3C1C C;  4WU9 A;  4X23 C;  1P3M C;  4Z66 A;  3KWQ B;  5AV9 C;  4J8X C;  5CPJ D;  1S32 D;  3V9R A;  5CPI C;  4R8P A;  5GT3 C;  4AWL C;  1S32 B;  1HQ3 B;  3AZF B;  3X1S D;  4Z5T B;  3WKJ D;  4QLC C;  3AZM B;  1P34 B;  3B0D B;  5GT0 C;  5JRG D;  5B1L C;  3X1S B;  3W96 C;  3KWQ C;  4NE6 A;  3WKJ B;  1P3L A;  4X23 D;  3LEL B;  3WAA C;  5JRG B;  1P3F D;  3REJ B;  5AV6 A;  5GSU B;  5DNM C;  3UT9 C;  3AFA C;  2IO5 C;  3AZG B;  4E45 A;  4XUJ C;  3UTA C;  3AZE D;  3WA9 C;  5B2I A;  4QLC D;  4G92 B;  4H9R A;  5AV5 A;  4WU8 B;  2NQB A;  3W99 A;  5B1L D;  3W96 D;  5B0Z D;  3AV1 A;  1M1A A;  3C1B A;  5BS7 C;  1EQZ B;  5B40 C;  5B0Z B;  3REI B;  3B0C T;  3X1T C;  2FJ7 C;  4WU9 D;  1N1J A;  5B33 C;  5F99 B;  4XZQ C;  4J8V B;  4Z2M H;  3MGP B;  3VH6 T;  1M19 A;  2CV5 A;  5B31 G;  5CP6 C;  1BH9 A;  4Z66 B;  4R8P D;  4EO5 C;  1P3O B;  1BH8 B;  1M18 B;  1TZY A;  4M6B A;  4J8W C;  3AZK A;  5B40 D;  3AN2 C;  3X1T D;  5C3I C;  2ARO C;  5E5A C;  3UTB C;  1P3L D;  5AVB C;  4XZQ D;  5BT1 D;  4YM6 A;  1P3K C;  5AV6 B;  4LD9 A;  2HIO B;  3AZH C;  3WTP B;  5B2I D;  5B2J A;  5FUG A;  1KX4 B;  4J8W D;  1KX5 A;  2NQB D;  3W99 D;  5B2I B;  3W98 A;  5AY8 C;  2ARO D;  4H9S C;  3AV1 D;  1M1A D;  5AVB D;  5AV5 B;  3C1B D;  5AVC A;  2NQB B;  1B6W A;  3AV1 B;  1P3K D;  4JJN A;  5B0Y B;  3LZ0 B;  3MVD C;  1M19 D;  2CV5 D;  3AZN C;  3W97 A;  3X1V A;  1F1E A;  3MGQ A;  2BYK A;  5DNN C;  4KUD B;  3AZK D;  4YS3 C;  1TZY B;  1P3G B;  3LJA C;  3B6G B;  1B67 A;  4YM6 D;  5CPJ A;  3AZN D;  3B6F C;  4ZUX C;  2JSS A;  1WWS A;  4WV4 B;  4YM6 B;  4LD9 D;  3AZI C;  5B31 C;  5BO0 A;  5B2J D;  3REH B;  3AV2 C;  3MNN B;  3X1U A;  1KU5 A;  3AYW C;  1KX5 D;  4CSR A;  5B32 A;  5B2J B;  5CPK C;  3KUY C;  3W98 D;  4G91 C;  3C1C A;  3LJA D;  1KX5 B;  4X23 A;  1P3M A;  5AVC D;  3W98 B;  4H9Q B;  3REL C;  4J8X A;  5AV9 A;  3MGS C;  1P3A B;  5CPI A;  4KHA B;  5GT3 A;  4JJN B;  1KX3 B;  2PYO C;  1AOI B;  4KGC C;  5KDM A;  4QLC A;  3W97 D;  5GT0 A;  1ZLA C;  3X1V D;  1P3B C;  1F66 C;  5B1L A;  3W96 A;  3KWQ A;  3MGQ D;  3WAA A;  1P3I B;  2BYK B;  5DNM A;  3MGS D;  3B0B A;  3UT9 A;  3AFA A;  2PYO D;  4XUJ A;  4NFT A;  3UTA A;  5BNX A;  3WA9 A;  4KGC D;  5B24 C;  2RVQ C;  5CPJ B;  1P3B D;  1F66 D;  1HQ3 C;  5AV8 C;  3X1U D;  5BS7 A;  5B32 D;  5B40 A;  5BO0 B;  3REK C;  3C1C D;  3X1T A;  2FJ7 A;  1P3M D;  5B32 B;  5B33 A;  4XZQ A;  3R45 B;  2YFW A;  5G49 A;  4X23 B;  5AV9 D;  4J8X D;  3REJ C;  1P3F B;  5BNV B;  5CP6 A;  5CPI D;  2RVQ D;  5GT3 D;  3NQJ A;  3AZG C;  5CPI B;  3AZJ C;  5GT0 D;  3A6N C;  4J8W A;  3LZ1 C;  3AZE B;  5KDM B;  3AN2 A;  3KWQ D;  3REK D;  4QLC B;  4WU8 C;  5GT0 B;  2ARO A;  5E5A A;  3UTB A;  3AZL C;  5AVB A;  2F8N A;  3WAA D;  5B1L B;  4H9N B; 
#chains in the Genus database with same CATH topology
 1EQZ C;  5DNM D;  3UT9 D;  3REI C;  3WAA B;  1P3K A;  3AFA D;  1P3P C;  3UT9 B;  4WU9 B;  3AZH A;  4XUJ D;  3UTA D;  1U35 C;  4J8V C;  3WA9 D;  2IO5 B;  3MGP C;  2Y2I A;  4UUZ A;  3A6N D;  3UTA B;  3EPJ A;  5BNX B;  3V9R B;  1P3O C;  1BFM A;  5AY8 A;  2CWE A;  4H9S A;  4R8P B;  3AZL D;  1M18 C;  1R4V A;  3NQU A;  2FJ7 D;  4DRA A;  5B33 D;  5B40 B;  3X1T B;  5B1M C;  1P3P D;  1P3L B;  1U35 D;  2NZD C;  4XZQ B;  3MVD A;  2YFW B;  3AZN A;  2Y2H A;  5CP6 D;  5G49 B;  2YFV A;  5CP6 B;  3A1I A;  2HIO C;  3WTP C;  4DRB A;  5DNN A;  3NQJ B;  4YS3 A;  3AN2 D;  1KX4 C;  2F8N H;  5E5A D;  3LJA A;  3UTB D;  4H9R B;  4J8W B;  2F8N D;  3W99 B;  3AN2 B;  5GXQ C;  2ARO B;  5E5A B;  3UTB B;  1M1A B;  5AVB B;  1TAF A;  2F8N B;  2NZD D;  3C1B B;  2Y2P A;  3B6F A;  4ZUX A;  1N1J B;  5B0Y C;  1P3K B;  3AZI A;  3AZH D;  1ID3 C;  5B31 A;  3AV2 A;  3LZ0 C;  3AYW A;  1M19 B;  3VH5 A;  3MGR C;  2CV5 B;  5CPK A;  3KUY A;  1BH9 B;  5AY8 D;  4H9O A;  5GXQ D;  5JA4 A;  4KUD C;  4J8U C;  3REL A;  3EG5 B;  3MGS A;  3AZK B;  1P3G C;  3NQU B;  3MVD D;  1ID3 D;  2PYO A;  3B6G C;  4KGC A;  2L5A A;  1ZLA A;  3O62 C;  3IP4 C;  3MGR D;  1P3B A;  1F66 A;  3AZN B;  2YFV B;  3KXB C;  4ZBJ B;  5DNN D;  4LD9 B;  3REH C;  2HUE C;  4YS3 D;  3MNN C;  5FUG B;  4J8U D;  5DNN B;  2JE5 A;  4NE3 A;  3LJA B;  3EPH A;  5AVC B;  3B6F D;  1P3A C;  2F8N K;  1TAF B;  4ZUX D;  4HGA B;  5B24 A;  3O62 D;  3AZI D;  2Y2M A;  5B31 D;  3KXB D;  4Z2M G;  1HQ3 A;  3AV2 D;  5AV8 A;  1KX3 C;  3AYW D;  3TU4 C;  3AZI B;  1AOI C;  5CPK D;  3KUY D;  3REK A;  3AYW B;  3W97 B;  3X1V B;  5CPK B;  3MGQ B;  3REL D;  3REJ A;  1P3I C;  4H9O B;  5JA4 B;  3H0L C;  3MGS B;  2G5I C;  3FDD A;  3AZG A;  4WNN A;  3AZJ A;  3TU4 D;  1ZLA D;  3A6N A;  2PYO B;  3LZ1 A;  4KGC B;  4WU8 A;  1S32 C;  3AZL A;  1P3B B;  3AZF C;  1F66 B;  4Z5T C;  3AZM C;  1P34 C;  3B0D C;  3X1U B;  1EQZ A;  3REI A;  4CSR B;  3X1S C;  3WKJ C;  1H3O A;  3VH5 W;  3LEL C;  3C1C B;  1P3P A;  5JRG C;  1P3M B;  1WWI A;  1U35 A;  5GSU C;  4J8V A;  3MGP A;  1P3F C;  4J8X B;  5AV9 B;  5B24 D;  4WZS B;  1P3O A;  1HQ3 D;  1BH8 A;  1Q9C A;  5AV8 D;  5B24 B;  5GT3 B;  4AWL B;  3AZF D;  4Z5T D;  2G5H C;  3AZM D;  1P34 D;  1M18 A;  4G92 C;  5AV8 B;  3AZE C;  3LEL D;  3REK B;  5B1M A;  3REJ D;  5B0Z C;  2NZD A;  5GSU D;  4H9P A;  5DNM B;  5F99 C;  3AFA B;  4WU9 C;  3AZG D;  1JFI A;  2HIO A;  3AZJ D;  3WTP A;  4CAY A;  4XUJ B;  3LZ1 D;  4WNN B;  4Z66 C;  3VH6 A;  3WA9 B;  3AZJ B;  4WU8 D;  1KX4 A;  3A6N B;  5CHL B;  4R8P C;  3LZ1 B;  2ZY2 A;  5GXQ A;  3AZL B;  1EQZ D;  3W96 B;  3REI D;  2FJ7 B;  2Y2G A;  5F99 D;  5B0Y A;  5B33 B;  1H3O B;  1P3L C;  4J8V D;  1ID3 A;  3KSY A;  2XD5 A;  3MGP D;  3LZ0 A;  1P3P B;  1U35 B;  5AV6 C;  4Z66 D;  2Y2L A;  3MGR A;  1P3O D;  5BT1 C;  4EO5 B;  3H0R C;  2W8S A;  1M18 D;  4KUD A;  4J8U A;  5B2I C;  1ULY A;  1P3G A;  2DQN C;  5AV5 C;  5B1M D;  5C3I B;  2NQB C;  3W99 C;  3AV1 C;  1M1A C;  3B6G A;  5B1M B;  3C1B C;  2NZD B;  5AV6 D;  3O62 A;  4H9P B;  2HIO D;  3KXB A;  3WTP D;  1HTA A;  3AZH B;  3REH A;  1JFI B;  4E44 A;  3MNN A;  1KX4 D;  1M19 C;  4UUZ B;  2BYM A;  4CAY B;  1Z2C B;  3WTP E;  2CV5 C;  5AV5 D;  5AY8 B;  5B32 G;  4H9Q A;  2JCH A;  1TZY C;  5GXQ B;  3AZK C;  1P3A A;  2J8P A;  5B0Y D;  4DQY B;  4KHA A;  3LZ0 D;  1KX3 A;  1AOI A;  3TU4 A;  3MVD B;  1ID3 B;  3VH5 T;  4YM6 C;  3P5J B;  3B0C W;  4ZBJ C;  3MGR B;  4NE5 A;  4LD9 C;  4KUD D;  5B2J C;  1P3I A;  1TZY D;  1P3G D;  4YS3 B;  2Y2O A;  4J8U B;  1KX5 C;  3VH6 W;  2DF4 C;  3W98 C;  2Y2Q A;  3B6G D;  5AVC C;  4HGA C;  3B6F B;  4JJN C;  1S32 A;  4ZUX B;  3O62 B;  3AZF A;  3REH D;  4Z5T A;  3MNN D;  3AZM A;  1P34 A;  5B31 B;  1A7W A;  3KXB B;  3AV2 B;  3X1S A;  2HUE B;  2LY8 A;  3WKJ A;  3W97 C;  3KUY B;  3LEL A;  3X1V C;  4G91 B;  2BYM B;  5JRG A;  3R45 A;  3MGQ C;  5GSU A;  1P3A D;  1P3F A;  3REL B;  5BNV A;  4JJN D;  1KX3 D;  1AOI D;  2ZY3 A;  5CPJ C;  3TU4 B;  3AZE A;  1ZLA B;  4H9N A;  1P3I D;  5B0Z A;  3X1U C;  2F8N G;  5B32 C;  5F99 A;  2UWX A;  3C1C C;  4WU9 A;  4X23 C;  1P3M C;  4Z66 A;  3KWQ B;  5AV9 C;  4J8X C;  5CPJ D;  1S32 D;  3V9R A;  5CPI C;  4R8P A;  5GT3 C;  4AWL C;  1S32 B;  1HQ3 B;  3AZF B;  3X1S D;  4Z5T B;  3WKJ D;  4QLC C;  3AZM B;  1P34 B;  3B0D B;  5GT0 C;  3H0M C;  5JRG D;  5B1L C;  3X1S B;  3W96 C;  3KWQ C;  4NE6 A;  2Y2N A;  3F6T A;  3WKJ B;  1P3L A;  4X23 D;  3LEL B;  3WAA C;  5JRG B;  1P3F D;  3REJ B;  5AV6 A;  5GSU B;  5DNM C;  3UT9 C;  3AFA C;  2IO5 C;  3AZG B;  4E45 A;  4XUJ C;  3UTA C;  3AZE D;  3A1K A;  5B2I A;  3WA9 C;  4QLC D;  4G92 B;  4H9R A;  5AV5 A;  4WU8 B;  2NQB A;  3W99 A;  5B1L D;  3W96 D;  5B0Z D;  3AV1 A;  1M1A A;  3C1B A;  5BS7 C;  1EQZ B;  5B40 C;  5B0Z B;  3REI B;  3B0C T;  3X1T C;  2FJ7 C;  4WU9 D;  1N1J A;  5B33 C;  5F99 B;  4XZQ C;  4J8V B;  4Z2M H;  3MGP B;  3VH6 T;  1M19 A;  2CV5 A;  5B31 G;  5CP6 C;  1BH9 A;  2RIQ A;  4Z66 B;  4EO5 C;  4R8P D;  1P3O B;  1BH8 B;  1M18 B;  1TZY A;  4M6B A;  4J8W C;  3AZK A;  5B40 D;  3AN2 C;  3X1T D;  2VQR A;  5C3I C;  2ARO C;  5E5A C;  3UTB C;  1P3L D;  5AVB C;  4XZQ D;  2FFF B;  5BT1 D;  4YM6 A;  1P3K C;  3EPL A;  5AV6 B;  4LD9 A;  2HIO B;  3AZH C;  3WTP B;  5B2I D;  5B2J A;  5FUG A;  2XD1 A;  4J8W D;  1KX4 B;  1KX5 A;  2NQB D;  3W99 D;  5B2I B;  3W98 A;  5AY8 C;  2ARO D;  4H9S C;  3AV1 D;  1M1A D;  5AVB D;  5AV5 B;  2F2A C;  5AVC A;  3C1B D;  2NQB B;  1B6W A;  3AV1 B;  1P3K D;  4JJN A;  4WJ3 C;  5B0Y B;  3LZ0 B;  3MVD C;  1M19 D;  3EPK A;  2CV5 D;  3AZN C;  3W97 A;  3AL0 C;  1W2E A;  3X1V A;  1F1E A;  3MGQ A;  2BYK A;  5DNN C;  4KUD B;  3AZK D;  4YS3 C;  1TZY B;  1P3G B;  3LJA C;  3B6G B;  1B67 A;  4YM6 D;  5CPJ A;  3AZN D;  3B6F C;  4ZUX C;  2JSS A;  1WWS A;  4WV4 B;  4YM6 B;  4LD9 D;  3AZI C;  1T3U A;  5B31 C;  5BO0 A;  5B2J D;  3REH B;  3AV2 C;  3MNN B;  3X1U A;  1KU5 A;  3AYW C;  2ZY5 A;  1KX5 D;  4CSR A;  5B32 A;  5B2J B;  5CPK C;  3KUY C;  3W98 D;  4G91 C;  3C1C A;  3LJA D;  1KX5 B;  4X23 A;  1P3M A;  5AVC D;  3W98 B;  4H9Q B;  3REL C;  4J8X A;  5AV9 A;  3MGS C;  1P3A B;  5CPI A;  4KHA B;  5GT3 A;  4JJN B;  3KFU G;  1KX3 B;  2PYO C;  1AOI B;  4KGC C;  5KDM A;  4QLC A;  3W97 D;  5GT0 A;  1ZLA C;  3X1V D;  1P3B C;  1F66 C;  5B1L A;  3W96 A;  3KWQ A;  3MGQ D;  3WAA A;  2Y2J A;  4UPK A;  1P3I B;  2BYK B;  5DNM A;  3MGS D;  3B0B A;  3UT9 A;  3AFA A;  2BG1 A;  2PYO D;  4XUJ A;  4NFT A;  3UTA A;  5BNX A;  3WA9 A;  4KGC D;  5B24 C;  2RVQ C;  5CPJ B;  1P3B D;  1F66 D;  1HQ3 C;  5AV8 C;  3X1U D;  1PZR A;  5BS7 A;  5B32 D;  5B40 A;  5BO0 B;  3REK C;  3C1C D;  2ZY4 A;  3X1T A;  2FJ7 A;  1P3M D;  5B32 B;  5B33 A;  4XZQ A;  3R45 B;  2ZM5 A;  2YFW A;  5G49 A;  4X23 B;  5AV9 D;  4J8X D;  3REJ C;  2Y2K A;  1P3F B;  5BNV B;  5CP6 A;  5CPI D;  2RVQ D;  5GT3 D;  3NQJ A;  3AZG C;  5CPI B;  3AZJ C;  5GT0 D;  3A6N C;  4J8W A;  3LZ1 C;  3AZE B;  5KDM B;  3AN2 A;  3KWQ D;  3REK D;  4QLC B;  4WU8 C;  5GT0 B;  2ARO A;  5E5A A;  3UTB A;  3AZL C;  5AVB A;  2F8N A;  3WAA D;  5B1L B;  4H9N B; 
#chains in the Genus database with same CATH homology
 1EQZ C;  5DNM D;  3UT9 D;  3REI C;  3WAA B;  1P3K A;  3AFA D;  1P3P C;  3UT9 B;  4WU9 B;  3AZH A;  4XUJ D;  3UTA D;  1U35 C;  4J8V C;  3WA9 D;  2IO5 B;  3MGP C;  2Y2I A;  4UUZ A;  3A6N D;  3UTA B;  3EPJ A;  5BNX B;  3V9R B;  1P3O C;  1BFM A;  5AY8 A;  2CWE A;  4H9S A;  4R8P B;  3AZL D;  1M18 C;  1R4V A;  3NQU A;  2FJ7 D;  4DRA A;  5B33 D;  5B40 B;  3X1T B;  5B1M C;  1P3P D;  1P3L B;  1U35 D;  2NZD C;  4XZQ B;  3MVD A;  2YFW B;  3AZN A;  2Y2H A;  5CP6 D;  5G49 B;  2YFV A;  5CP6 B;  3A1I A;  2HIO C;  3WTP C;  4DRB A;  5DNN A;  3NQJ B;  4YS3 A;  3AN2 D;  1KX4 C;  2F8N H;  5E5A D;  3LJA A;  3UTB D;  4H9R B;  4J8W B;  2F8N D;  3W99 B;  3AN2 B;  5GXQ C;  2ARO B;  5E5A B;  3UTB B;  1M1A B;  5AVB B;  1TAF A;  2F8N B;  2NZD D;  3C1B B;  2Y2P A;  3B6F A;  4ZUX A;  1N1J B;  5B0Y C;  1P3K B;  3AZI A;  3AZH D;  1ID3 C;  5B31 A;  3AV2 A;  3LZ0 C;  3AYW A;  1M19 B;  3VH5 A;  3MGR C;  2CV5 B;  5CPK A;  3KUY A;  1BH9 B;  5AY8 D;  4H9O A;  5GXQ D;  5JA4 A;  4KUD C;  4J8U C;  3REL A;  3EG5 B;  3MGS A;  3AZK B;  1P3G C;  3NQU B;  3MVD D;  1ID3 D;  2PYO A;  3B6G C;  4KGC A;  2L5A A;  1ZLA A;  3O62 C;  3IP4 C;  3MGR D;  1P3B A;  1F66 A;  3AZN B;  2YFV B;  3KXB C;  4ZBJ B;  5DNN D;  4LD9 B;  3REH C;  2HUE C;  4YS3 D;  3MNN C;  5FUG B;  4J8U D;  5DNN B;  2JE5 A;  4NE3 A;  3LJA B;  3EPH A;  5AVC B;  3B6F D;  1P3A C;  2F8N K;  1TAF B;  4ZUX D;  4HGA B;  5B24 A;  3O62 D;  3AZI D;  2Y2M A;  5B31 D;  3KXB D;  4Z2M G;  1HQ3 A;  3AV2 D;  5AV8 A;  1KX3 C;  3AYW D;  3TU4 C;  3AZI B;  1AOI C;  5CPK D;  3KUY D;  3REK A;  3AYW B;  3W97 B;  3X1V B;  5CPK B;  3MGQ B;  3REL D;  3REJ A;  1P3I C;  4H9O B;  5JA4 B;  3H0L C;  3MGS B;  2G5I C;  3FDD A;  3AZG A;  4WNN A;  3AZJ A;  3TU4 D;  1ZLA D;  3A6N A;  2PYO B;  3LZ1 A;  4KGC B;  4WU8 A;  1S32 C;  3AZL A;  1P3B B;  3AZF C;  1F66 B;  4Z5T C;  3AZM C;  1P34 C;  3B0D C;  3X1U B;  1EQZ A;  3REI A;  4CSR B;  3X1S C;  3WKJ C;  1H3O A;  3VH5 W;  3LEL C;  3C1C B;  1P3P A;  5JRG C;  1P3M B;  1WWI A;  1U35 A;  5GSU C;  4J8V A;  3MGP A;  1P3F C;  4J8X B;  5AV9 B;  5B24 D;  4WZS B;  1P3O A;  1HQ3 D;  1BH8 A;  1Q9C A;  5AV8 D;  5B24 B;  5GT3 B;  4AWL B;  3AZF D;  4Z5T D;  2G5H C;  3AZM D;  1P34 D;  1M18 A;  4G92 C;  5AV8 B;  3AZE C;  3LEL D;  3REK B;  5B1M A;  3REJ D;  5B0Z C;  2NZD A;  5GSU D;  4H9P A;  5DNM B;  5F99 C;  3AFA B;  4WU9 C;  3AZG D;  1JFI A;  2HIO A;  3AZJ D;  3WTP A;  4CAY A;  4XUJ B;  3LZ1 D;  4WNN B;  4Z66 C;  3VH6 A;  3WA9 B;  3AZJ B;  4WU8 D;  1KX4 A;  3A6N B;  5CHL B;  4R8P C;  3LZ1 B;  2ZY2 A;  5GXQ A;  3AZL B;  1EQZ D;  3W96 B;  3REI D;  2FJ7 B;  2Y2G A;  5F99 D;  5B0Y A;  5B33 B;  1H3O B;  1P3L C;  4J8V D;  1ID3 A;  3KSY A;  2XD5 A;  3MGP D;  3LZ0 A;  1P3P B;  1U35 B;  5AV6 C;  4Z66 D;  2Y2L A;  3MGR A;  1P3O D;  5BT1 C;  4EO5 B;  3H0R C;  2W8S A;  1M18 D;  4KUD A;  4J8U A;  5B2I C;  1ULY A;  1P3G A;  2DQN C;  5AV5 C;  5B1M D;  5C3I B;  2NQB C;  3W99 C;  3AV1 C;  1M1A C;  3B6G A;  5B1M B;  3C1B C;  2NZD B;  5AV6 D;  3O62 A;  4H9P B;  2HIO D;  3KXB A;  3WTP D;  1HTA A;  3AZH B;  3REH A;  1JFI B;  4E44 A;  3MNN A;  1KX4 D;  1M19 C;  4UUZ B;  2BYM A;  4CAY B;  1Z2C B;  3WTP E;  2CV5 C;  5AV5 D;  5AY8 B;  5B32 G;  4H9Q A;  2JCH A;  1TZY C;  5GXQ B;  3AZK C;  1P3A A;  2J8P A;  5B0Y D;  4DQY B;  4KHA A;  3LZ0 D;  1KX3 A;  1AOI A;  3TU4 A;  3MVD B;  1ID3 B;  3VH5 T;  4YM6 C;  3P5J B;  3B0C W;  4ZBJ C;  3MGR B;  4NE5 A;  4LD9 C;  4KUD D;  5B2J C;  1P3I A;  1TZY D;  1P3G D;  4YS3 B;  2Y2O A;  4J8U B;  1KX5 C;  3VH6 W;  2DF4 C;  3W98 C;  2Y2Q A;  3B6G D;  5AVC C;  4HGA C;  3B6F B;  4JJN C;  1S32 A;  4ZUX B;  3O62 B;  3AZF A;  3REH D;  4Z5T A;  3MNN D;  3AZM A;  1P34 A;  5B31 B;  1A7W A;  3KXB B;  3AV2 B;  3X1S A;  2HUE B;  2LY8 A;  3WKJ A;  3W97 C;  3KUY B;  3LEL A;  3X1V C;  4G91 B;  2BYM B;  5JRG A;  3R45 A;  3MGQ C;  5GSU A;  1P3A D;  1P3F A;  3REL B;  5BNV A;  4JJN D;  1KX3 D;  1AOI D;  2ZY3 A;  5CPJ C;  3TU4 B;  3AZE A;  1ZLA B;  4H9N A;  1P3I D;  5B0Z A;  3X1U C;  2F8N G;  5B32 C;  5F99 A;  2UWX A;  3C1C C;  4WU9 A;  4X23 C;  1P3M C;  4Z66 A;  3KWQ B;  5AV9 C;  4J8X C;  5CPJ D;  1S32 D;  3V9R A;  5CPI C;  4R8P A;  5GT3 C;  4AWL C;  1S32 B;  1HQ3 B;  3AZF B;  3X1S D;  4Z5T B;  3WKJ D;  4QLC C;  3AZM B;  1P34 B;  3B0D B;  5GT0 C;  3H0M C;  5JRG D;  5B1L C;  3X1S B;  3W96 C;  3KWQ C;  4NE6 A;  2Y2N A;  3F6T A;  3WKJ B;  1P3L A;  4X23 D;  3LEL B;  3WAA C;  5JRG B;  1P3F D;  3REJ B;  5AV6 A;  5GSU B;  5DNM C;  3UT9 C;  3AFA C;  2IO5 C;  3AZG B;  4E45 A;  4XUJ C;  3UTA C;  3AZE D;  3A1K A;  5B2I A;  3WA9 C;  4QLC D;  4G92 B;  4H9R A;  5AV5 A;  4WU8 B;  2NQB A;  3W99 A;  5B1L D;  3W96 D;  5B0Z D;  3AV1 A;  1M1A A;  3C1B A;  5BS7 C;  1EQZ B;  5B40 C;  5B0Z B;  3REI B;  3B0C T;  3X1T C;  2FJ7 C;  4WU9 D;  1N1J A;  5B33 C;  5F99 B;  4XZQ C;  4J8V B;  4Z2M H;  3MGP B;  3VH6 T;  1M19 A;  2CV5 A;  5B31 G;  5CP6 C;  1BH9 A;  2RIQ A;  4Z66 B;  4EO5 C;  4R8P D;  1P3O B;  1BH8 B;  1M18 B;  1TZY A;  4M6B A;  4J8W C;  3AZK A;  5B40 D;  3AN2 C;  3X1T D;  2VQR A;  5C3I C;  2ARO C;  5E5A C;  3UTB C;  1P3L D;  5AVB C;  4XZQ D;  2FFF B;  5BT1 D;  4YM6 A;  1P3K C;  3EPL A;  5AV6 B;  4LD9 A;  2HIO B;  3AZH C;  3WTP B;  5B2I D;  5B2J A;  5FUG A;  2XD1 A;  4J8W D;  1KX4 B;  1KX5 A;  2NQB D;  3W99 D;  5B2I B;  3W98 A;  5AY8 C;  2ARO D;  4H9S C;  3AV1 D;  1M1A D;  5AVB D;  5AV5 B;  2F2A C;  5AVC A;  3C1B D;  2NQB B;  1B6W A;  3AV1 B;  1P3K D;  4JJN A;  4WJ3 C;  5B0Y B;  3LZ0 B;  3MVD C;  1M19 D;  3EPK A;  2CV5 D;  3AZN C;  3W97 A;  3AL0 C;  1W2E A;  3X1V A;  1F1E A;  3MGQ A;  2BYK A;  5DNN C;  4KUD B;  3AZK D;  4YS3 C;  1TZY B;  1P3G B;  3LJA C;  3B6G B;  1B67 A;  4YM6 D;  5CPJ A;  3AZN D;  3B6F C;  4ZUX C;  2JSS A;  1WWS A;  4WV4 B;  4YM6 B;  4LD9 D;  3AZI C;  1T3U A;  5B31 C;  5BO0 A;  5B2J D;  3REH B;  3AV2 C;  3MNN B;  3X1U A;  1KU5 A;  3AYW C;  2ZY5 A;  1KX5 D;  4CSR A;  5B32 A;  5B2J B;  5CPK C;  3KUY C;  3W98 D;  4G91 C;  3C1C A;  3LJA D;  1KX5 B;  4X23 A;  1P3M A;  5AVC D;  3W98 B;  4H9Q B;  3REL C;  4J8X A;  5AV9 A;  3MGS C;  1P3A B;  5CPI A;  4KHA B;  5GT3 A;  4JJN B;  3KFU G;  1KX3 B;  2PYO C;  1AOI B;  4KGC C;  5KDM A;  4QLC A;  3W97 D;  5GT0 A;  1ZLA C;  3X1V D;  1P3B C;  1F66 C;  5B1L A;  3W96 A;  3KWQ A;  3MGQ D;  3WAA A;  2Y2J A;  4UPK A;  1P3I B;  2BYK B;  5DNM A;  3MGS D;  3B0B A;  3UT9 A;  3AFA A;  2BG1 A;  2PYO D;  4XUJ A;  4NFT A;  3UTA A;  5BNX A;  3WA9 A;  4KGC D;  5B24 C;  2RVQ C;  5CPJ B;  1P3B D;  1F66 D;  1HQ3 C;  5AV8 C;  3X1U D;  1PZR A;  5BS7 A;  5B32 D;  5B40 A;  5BO0 B;  3REK C;  3C1C D;  2ZY4 A;  3X1T A;  2FJ7 A;  1P3M D;  5B32 B;  5B33 A;  4XZQ A;  3R45 B;  2ZM5 A;  2YFW A;  5G49 A;  4X23 B;  5AV9 D;  4J8X D;  3REJ C;  2Y2K A;  1P3F B;  5BNV B;  5CP6 A;  5CPI D;  2RVQ D;  5GT3 D;  3NQJ A;  3AZG C;  5CPI B;  3AZJ C;  5GT0 D;  3A6N C;  4J8W A;  3LZ1 C;  3AZE B;  5KDM B;  3AN2 A;  3KWQ D;  3REK D;  4QLC B;  4WU8 C;  5GT0 B;  2ARO A;  5E5A A;  3UTB A;  3AZL C;  5AVB A;  2F8N A;  3WAA D;  5B1L B;  4H9N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...