3C1CD

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cD00
1P3LC 3W98B 3AZND 3KUYB 3KWQB 1P3BB 3MGQA 1ZLAC 4Z5TB 3W98C 1JFIB 3R45B 1P3BC 3V9RB 3REID 1BH8B 4G92C 3AV1B 5AV5A 3WTPC 5AV8B 5B0ZA 4R8PB 4J8VD 4Z2MG 3B0CT 5AVBA 3AZKB 3TU4B 1S32B 3AV1C 5FUGB 4EO5B 5AV8C 2HUEB 3B0BA 4UUZA 1U35A 3B0CW 1M1AD 3B6GD 1P3FA 3AZHD 1KX3D 5GT3B 2BYMB 5GT0B 5C3IC 1S32C 4G91C 4WV4B 3RELA 3LZ1B 4EO5C 2HUEC 2YFWB 5B32A 4J8XA 3AZEB 5GT3C 2NZDA 3MGQD 5B2IB 5B40B 3MVDA 3AZGC 1P3PB 1F66B 3X1VB 3X1UC 5CHLB 5CPKA 3WKJA 1KX5A 1P34B 5CP6C 5B2IC 5AV5D 4LD9C 1P3PC 1F66C 5B0ZD 3AN2A 3MGSC 3O62A 5G49A 5AVBD 1HTAA 4ZBJB 3X1SB 5DNMC 3W96C 3UT9B 3MGRC 3AZLA 5B2JA 1P34C 2F8NG 5DNNB 4WU9A 4XZQC 1M18C 1U35D 1P3MA 4WNNA 1P3FD 1EQZB 3MNNA 2HIOB 3X1SC 5AVCB 1N1JA 3B6FB 3RELD 5DNNC 5B32D 3AZJB 4J8XD 3MGPB 5BS7A 3AFAA 2NZDD 1EQZC 3MVDD 5AVCC 4J8WA 3AZFB 2PYOB 2CV5A 5CPKD 3WKJD 1KX5D 4E44A 4M6BA 2YFVA 1P3LA 3AZFC 3X1TB 3AN2D 3O62D 3REJC 5E5AB 5BNXA 1TZYB 3AZLD 4YS3B 1P3KB 1ID3B 3VH6T 5B2JD 1ZLAA 4WU9D 3W98A 1P3GC 1P3MD 1P3BA 1Q9CA 3VH6W 5E5AC 3LELB 4JJNB 3MNND 1TZYC 4YS3C 1P3KC 3WTPA 3VH5A 1JFIA 3R45A 1AOID 3A6NC 3AFAD 3LJAB 5B33B 5KDMA 3LELC 4JJNC 4KUDB 1M19C 5JRGC 4J8WD 3AV1A 5CPIB 5AV8A 2CV5D 1KX4B 4WU8B 4KUDC 4H9PA 1P3LD 1S32A 5GT3A 5GXQB 5B1MB 2BYMA 5AV6C 4QLCC 1ZLAD 3AZGA 3W98D 4ZUXC 3X1UA 3C1CC 1P3BD 3C1BB 5GXQC 5CP6A 5B2IA 3WTPD 4LD9A 1BFMA 1P3PA 1F66A 3WTPE 1F1EA 3MGSA 5B24C 3C1BC 1P3OB 5DNMA 3W96A 3UTAB 3MGRA 3AV1D 1P34A 2BYKA 5AV8D 1M18A 4XZQA 1WWSA 4H9RB 1S32D 1P3OC 3X1SA 3UTAC 4H9NB 5DNNA 3AV2C 5GT3D 3AYWB 1EQZA 5B1LB 3AZGD 5AVCA 3KUYC 3X1UD 3KWQC 2RVQC 5CP6D 5B1LC 5B2ID 3KXBB 4Z5TC 4LD9D 1P3PD 4YM6B 3AZFA 1F66D 4Z2MH 3MGSD 2FJ7B 3REJA 4Z66B 5DNMD 1P34D 3W96D 3MGRD 3KXBC 1B6WA 1M18D 4XZQD 2JSSA 1P3GA 4R8PC 2FJ7C 3LZ0B 4XUJB 2L5AA 5E5AA 4Z66C 3AZKC 3B0DB 3TU4C 1TZYA 3X1SD 3REHB 4YS3A 1P3KA 5DNND 3A6NA 3LELA 4JJNA 1EQZD 5GT0C 3B0DC 5AVCD 3REHC 5JRGA 1M19A 3UTBB 3B6FD 4CAYB 3LZ1C 3AZEC 4E45A 1P3AB 4KUDA 5B40C 3NQJB 4WZSB 3AZFD 3X1VC 3REJD 3AZMB 3WAAB 1P3AC 2F8NH 5AV6A 4QLCA 4AWLB 1P3GD 4ZUXA 3C1CA 3AZMC 5E5AD 3WAAC 1BH9B 4ZBJC 1TZYD 4YS3D 3UT9C 1P3KD 5GXQA 3KSYA 1AOIA 2F8NA 3A6ND 3NQUB 5B31B 5B24A 3LELD 2AROB 4JJND 5CPJB 2F8NK 3C1BA 2HIOC 5GSUB 1M19D 5JRGD 1M1AB 5BO0B 2LY8A 3B6GB 3B6FC 3AZJC 3MGPC 3AZHB 1KX3B 1A7WA 5B31C 2AROC 5CPJC 4KUDD 1B67A 5GSUC 4HGAB 1P3OA 2PYOC 3UTAA 5B0YB 5AY8B 3AV2A 3VH6A 5AV6D 4HGAC 4QLCD 4J8UB 3X1TC 4ZUXD 3KUYA 3C1CD 1TAFB 5AY8C 5B0YC 3KWQA 3W97B 1KU5A 1ID3C 5AV9B 5GXQD 1R4VA 5B1LA 4J8UC 4Z5TA 4X23B 2F8ND 5B24D 3W97C 3V9RA 3C1BD 1BH8A 5AV9C 3KXBA 4X23C 4R8PA 2FJ7A 3LJAC 5B33C 3AZKA 3TU4A 1P3OD 4J8XB 3UTAD 5FUGA 5CPIC 1KX4C 4WU8C 3AV2D 4NE6A 2CWEA 2NQBB 4CSRB 3MVDB 5GT0A 1ULYA 5BNVB 3REHA 4KGCB 5CPKB 4H9SC 3LZ1A 3KUYD 3WKJB 3AZEA 2YFWA 3KWQD 2NQBC 3AZIB 2RVQD 5B1MC 5B1LD 4Z5TD 5B40A 4KGCC 3X1VA 3AZLB 3AZIC 5B2JB 3REKB 1P3AA 3KXBD 1P3MB 3NQJA 4R8PD 2FJ7D 3W99B 3MNNB 1N1JB 3AZMA 4Z66D 3AZKD 3WAAA 3TU4D 3REKC 3UT9A 5B31G 3W99C 4H9QB 3WA9B 5GT0D 2HIOA 3REHD 3B6FA 3LZ1D 3AZJA 3AZED 2YFVB 3MGPA 4H9OB 3NQUA 5BT1C 5B31A 3AYWC 1P3LB 2AROA 5CPJA 3WA9C 5GSUA 5B40D 2PYOA 3X1VD 1ZLAB 1P3AD 4YM6C 3X1TA 4DRAA 5B0YA 5AY8A 4G92B 3AZMD 3WAAD 3WTPB 1ID3A 3UT9D 5F99B 4J8UA 5KDMB 3LZ0C 4XUJC 1TAFA 3W97A 5JA4B 2HIOD 5AV9A 1P3IB 5F99C 3AZJD 1HQ3B 4X23A 3MGPD 4H9PB 3LJAA 5B33A 5C3IB 5B31D 5B32G 3AZNB 2AROD 4G91B 5CPJD 5GSUD 3UTBC 1P3IC 2PYOD 1HQ3C 5CPIA 1KX4A 4WU8A 3AZGB 3AZNC 3X1TD 3X1UB 4NFTA 4H9SA 3REIB 5B0YD 5AY8D 2NQBA 5CP6B 4CSRA 4LD9B 4KHAB 1ID3D 5B1MA 3MGSB 4J8UD 4AWLC 4J8VB 5BNVA 4KGCA 3REIC 3W97D 5DNMB 3W96B 3AZIA 3MGRB 2BYKB 5AV9D 4XZQB 1M18B 1H3OB 4J8VC 4X23D 3LJAD 5B33D 3REKA 1M1AC 3B6GC 5CPID 3AZHC 1KX3C 1KX4D 4WU8D 3MGQB 4H9RA 3W99A 2IO5B 4H9NA 2NQBD 3MGQC 5AV5B 2IO5C 3AYWA 4H9QA 5B1MD 5B0ZB 3WA9A 3REJB 4KGCD 5AVBB 3AZID 5AV5C 4H9OA 4UUZB 5B0ZC 1U35B 1P3GB 1P3FB 4YM6A 5AVBC 4Z66A 3RELB 5B32B 3REKD 1U35C 1P3FC 1WWIA 3A6NB 2NZDB 3W99D 3LZ0A 4XUJA 1M19B 5JRGB 3RELC 5B32C 3VH5T 4J8XC 5F99A 1KX5B 2NZDC 3MVDC 3VH5W 5BT1D 3AYWD 3AN2B 5JA4A 3WA9D 3O62B 5G49B 5CPKC 3UTBA 1P3IA 3WKJC 4CAYA 1KX5C 1HQ3A 5AV6B 4QLCB 4WU9B 3AZNA 3AN2C 4WNNB 4ZUXB 3O62C 4YM6D 3C1CB 4NE5A 3AZLC 5B2JC 4WU9C 1P3MC 1AOIB 2F8NB 3AFAB 5B24B 3MNNC 3REIA 3LZ0D 4XUJD 4J8WB 1BH9A 4KHAA 2CV5B 5BS7C 5F99D 1AOIC 3AFAC 4J8VA 4DRBA 4J8WC 2CV5C 1M1AA 5BO0A 3UTBD 1P3ID 3AV2B 3B6GA 5BNXB 1H3OA 1HQ3D 4NE3A 3AZHA 1KX3A
chains in the Genus database with same CATH superfamily
1P3LC 3W98B 3AZND 3KUYB 3KWQB 1P3BB 3EG5B 3MGQA 1ZLAC 4Z5TB 2XD1A 1JFIB 3W98C 3R45B 1P3BC 3V9RB 3REID 1BH8B 4G92C 3AV1B 5AV5A 3WTPC 5AV8B 5B0ZA 4R8PB 4J8VD 4Z2MG 3B0CT 5AVBA 3AZKB 2ZY4A 3TU4B 1S32B 3AV1C 2RIQA 5FUGB 4EO5B 5AV8C 2HUEB 3B0BA 4UUZA 1U35A 3B0CW 1M1AD 3B6GD 1P3FA 3AZHD 1KX3D 5GT3B 2BYMB 5GT0B 5C3IC 1S32C 2Y2NA 4G91C 4WV4B 3RELA 3LZ1B 4EO5C 2HUEC 2YFWB 5B32A 4J8XA 3AZEB 5GT3C 2NZDA 3MGQD 5B2IB 2Y2KA 5B40B 3MVDA 3AZGC 1P3PB 1F66B 3X1VB 3X1UC 5CHLB 2BG1A 1W2EA 5CPKA 3WKJA 1KX5A 1P34B 5CP6C 5B2IC 5AV5D 4LD9C 1P3PC 1F66C 5B0ZD 3AN2A 3MGSC 3O62A 5G49A 5AVBD 2UWXA 1HTAA 4ZBJB 3X1SB 5DNMC 3W96C 3UT9B 3MGRC 3AZLA 5B2JA 1P34C 2F8NG 5DNNB 4WU9A 4XZQC 1M18C 1U35D 1P3MA 4WNNA 1P3FD 2FFFB 1EQZB 3MNNA 2HIOB 3X1SC 5AVCB 1N1JA 3B6FB 3RELD 5DNNC 5B32D 3AZJB 4J8XD 3MGPB 5BS7A 3AFAA 2NZDD 1EQZC 3MVDD 5AVCC 4J8WA 3AZFB 2PYOB 2CV5A 5CPKD 3WKJD 1KX5D 4E44A 3F6TA 4M6BA 2YFVA 3EPKA 1P3LA 3AZFC 3X1TB 3AN2D 3O62D 3REJC 5E5AB 5BNXA 1TZYB 3AZLD 4YS3B 1P3KB 1ID3B 3VH6T 5B2JD 1ZLAA 2ZY2A 4WU9D 1P3GC 3W98A 1P3MD 1P3BA 1Q9CA 3VH6W 5E5AC 3LELB 4JJNB 3MNND 2ZM5A 1TZYC 4YS3C 1P3KC 3WTPA 3VH5A 1JFIA 3R45A 1AOID 3A6NC 3AFAD 3LJAB 5B33B 5KDMA 3LELC 4JJNC 4KUDB 3KFUG 1M19C 5JRGC 4J8WD 2JCHA 4DQYB 3AV1A 5CPIB 5AV8A 2CV5D 1KX4B 4WU8B 4KUDC 4H9PA 1P3LD 1S32A 5GT3A 5GXQB 5B1MB 2BYMA 5AV6C 4QLCC 1ZLAD 3AZGA 3W98D 4ZUXC 3X1UA 3C1CC 1P3BD 3C1BB 5GXQC 5CP6A 5B2IA 3WTPD 4LD9A 1BFMA 1P3PA 1F66A 3WTPE 1F1EA 3MGSA 5B24C 3C1BC 2ZY3A 1P3OB 5DNMA 3W96A 3UTAB 3MGRA 3AV1D 1P34A 2BYKA 5AV8D 1M18A 4XZQA 1WWSA 3A1IA 4H9RB 1S32D 1P3OC 3X1SA 3UTAC 4H9NB 5DNNA 3AV2C 5GT3D 3AYWB 1EQZA 5B1LB 3EPLA 3AZGD 5AVCA 3KUYC 3X1UD 3KWQC 2RVQC 5CP6D 5B1LC 5B2ID 3KXBB 4Z5TC 4LD9D 1P3PD 4YM6B 3AZFA 1F66D 4Z2MH 3MGSD 2FJ7B 3REJA 4Z66B 5DNMD 1P34D 3W96D 3MGRD 3KXBC 1B6WA 1M18D 4XZQD 2JSSA 1P3GA 4R8PC 2FJ7C 3LZ0B 4XUJB 2L5AA 5E5AA 4Z66C 3AZKC 3B0DB 3TU4C 1TZYA 3X1SD 1PZRA 3REHB 4YS3A 1P3KA 5DNND 3A6NA 1T3UA 3LELA 4JJNA 1EQZD 5GT0C 3B0DC 5AVCD 3REHC 1Z2CB 5JRGA 3UTBB 1M19A 3B6FD 4CAYB 3LZ1C 3AZEC 4E45A 1P3AB 4KUDA 5B40C 3NQJB 4WZSB 3AZFD 3X1VC 3REJD 2JE5A 3AZMB 4WJ3C 3WAAB 1P3AC 2F8NH 5AV6A 4QLCA 4AWLB 1P3GD 4ZUXA 3C1CA 2Y2GA 4UPKA 5E5AD 3WAAC 3AZMC 1BH9B 4ZBJC 1TZYD 4YS3D 3UT9C 1P3KD 5GXQA 3KSYA 1AOIA 2F8NA 3A6ND 3NQUB 5B31B 5B24A 3LELD 2AROB 4JJND 2Y2MA 5CPJB 3C1BA 2HIOC 5GSUB 2F8NK 2DQNC 1M19D 5JRGD 1M1AB 5BO0B 2LY8A 3B6GB 3B6FC 3AZJC 3MGPC 3AZHB 1KX3B 1A7WA 5B31C 2AROC 5CPJC 4KUDD 1B67A 5GSUC 4HGAB 3A1KA 1P3OA 2PYOC 3UTAA 5B0YB 5AY8B 3AV2A 3VH6A 5AV6D 4HGAC 4QLCD 4J8UB 3X1TC 4ZUXD 3KUYA 3C1CD 1TAFB 5AY8C 5B0YC 3KWQA 3W97B 1KU5A 1ID3C 5AV9B 5GXQD 1R4VA 5B1LA 4J8UC 4Z5TA 4X23B 3IP4C 2F8ND 5B24D 3W97C 3P5JB 3V9RA 3C1BD 1BH8A 5AV9C 3KXBA 4X23C 4R8PA 2FJ7A 3LJAC 5B33C 3AZKA 3TU4A 1P3OD 4J8XB 2XD5A 3UTAD 5FUGA 5CPIC 1KX4C 4WU8C 3AV2D 4NE6A 2CWEA 2NQBB 4CSRB 3MVDB 5GT0A 1ULYA 5BNVB 3REHA 4KGCB 5CPKB 4H9SC 3LZ1A 3KUYD 3WKJB 3AZEA 2YFWA 3KWQD 2NQBC 3AZIB 2RVQD 5B1MC 5B1LD 4Z5TD 5B40A 4KGCC 3X1VA 3AZLB 3AZIC 5B2JB 3REKB 1P3AA 3KXBD 1P3MB 3H0MC 3NQJA 4R8PD 2FJ7D 3W99B 3AL0C 3MNNB 1N1JB 2Y2QA 4Z66D 3AZKD 3AZMA 3TU4D 3WAAA 2Y2IA 3REKC 3UT9A 5B31G 3W99C 4H9QB 3WA9B 5GT0D 2HIOA 3REHD 3B6FA 3LZ1D 3AZJA 3AZED 2YFVB 3MGPA 4H9OB 3NQUA 5BT1C 5B31A 3AYWC 1P3LB 2AROA 2DF4C 5CPJA 3WA9C 5GSUA 5B40D 2ZY5A 2PYOA 3X1VD 1ZLAB 3EPJA 2Y2LA 1P3AD 4YM6C 3X1TA 2VQRA 4DRAA 5B0YA 5AY8A 4G92B 3AZMD 3WAAD 3WTPB 1ID3A 3UT9D 5F99B 4J8UA 2Y2JA 5KDMB 3LZ0C 4XUJC 1TAFA 3W97A 5JA4B 2HIOD 5AV9A 1P3IB 5F99C 3AZJD 1HQ3B 4X23A 3MGPD 4H9PB 3LJAA 5B33A 5C3IB 5B31D 5B32G 3AZNB 2AROD 4G91B 5CPJD 5GSUD 3UTBC 1P3IC 2PYOD 1HQ3C 5CPIA 1KX4A 4WU8A 3AZGB 3AZNC 3X1TD 3X1UB 4NFTA 4H9SA 3REIB 5B0YD 5AY8D 2NQBA 5CP6B 4CSRA 4LD9B 4KHAB 1ID3D 5B1MA 3MGSB 4J8UD 4AWLC 4J8VB 5BNVA 4KGCA 3REIC 3W97D 5DNMB 3W96B 3AZIA 3MGRB 2BYKB 5AV9D 4XZQB 1M18B 1H3OB 4J8VC 4X23D 3LJAD 5B33D 3REKA 1M1AC 3B6GC 3FDDA 5CPID 3AZHC 1KX3C 1KX4D 4WU8D 3MGQB 4H9RA 3W99A 3EPHA 2IO5B 4H9NA 2J8PA 2NQBD 3MGQC 2Y2HA 5AV5B 2IO5C 3AYWA 4H9QA 5B1MD 5B0ZB 3WA9A 2Y2PA 3REJB 4KGCD 5AVBB 3AZID 5AV5C 4H9OA 4UUZB 5B0ZC 1U35B 1P3GB 1P3FB 4YM6A 5AVBC 4Z66A 3RELB 5B32B 3REKD 1U35C 2W8SA 2G5HC 1P3FC 1WWIA 3A6NB 2NZDB 2F2AC 3W99D 3LZ0A 4XUJA 1M19B 5JRGB 3RELC 5B32C 3VH5T 4J8XC 5F99A 1KX5B 2NZDC 3MVDC 3VH5W 5BT1D 3AYWD 3AN2B 2G5IC 5JA4A 3WA9D 3O62B 5G49B 5CPKC 3UTBA 1P3IA 3WKJC 4CAYA 1KX5C 1HQ3A 5AV6B 3H0RC 4QLCB 4WU9B 3AZNA 3AN2C 4WNNB 4ZUXB 3O62C 4YM6D 3C1CB 4NE5A 3AZLC 5B2JC 4WU9C 1P3MC 1AOIB 2F8NB 3AFAB 5B24B 3MNNC 3REIA 3LZ0D 4XUJD 4J8WB 3H0LC 1BH9A 2Y2OA 4KHAA 2CV5B 5BS7C 5F99D 1AOIC 3AFAC 4J8VA 4DRBA 4J8WC 2CV5C 1M1AA 5BO0A 3UTBD 1P3ID 3AV2B 3B6GA 5BNXB 1H3OA 1HQ3D 4NE3A 3AZHA 1KX3A
chains in the Genus database with same CATH topology
1P3LC 3W98B 3AZND 3KUYB 3KWQB 1P3BB 3EG5B 3MGQA 1ZLAC 4Z5TB 2XD1A 1JFIB 3W98C 3R45B 1P3BC 3V9RB 3REID 1BH8B 4G92C 3AV1B 5AV5A 3WTPC 5AV8B 5B0ZA 4R8PB 4J8VD 4Z2MG 3B0CT 5AVBA 3AZKB 2ZY4A 3TU4B 1S32B 3AV1C 2RIQA 5FUGB 4EO5B 5AV8C 2HUEB 3B0BA 4UUZA 1U35A 3B0CW 1M1AD 3B6GD 1P3FA 3AZHD 1KX3D 5GT3B 2BYMB 5GT0B 5C3IC 1S32C 2Y2NA 4G91C 4WV4B 3RELA 3LZ1B 4EO5C 2HUEC 2YFWB 5B32A 4J8XA 3AZEB 5GT3C 2NZDA 3MGQD 5B2IB 2Y2KA 5B40B 3MVDA 3AZGC 1P3PB 1F66B 3X1VB 3X1UC 5CHLB 2BG1A 1W2EA 5CPKA 3WKJA 1KX5A 1P34B 5CP6C 5B2IC 5AV5D 4LD9C 1P3PC 1F66C 5B0ZD 3AN2A 3MGSC 3O62A 5G49A 5AVBD 2UWXA 1HTAA 4ZBJB 3X1SB 5DNMC 3W96C 3UT9B 3MGRC 3AZLA 5B2JA 1P34C 2F8NG 5DNNB 4WU9A 4XZQC 1M18C 1U35D 1P3MA 4WNNA 1P3FD 2FFFB 1EQZB 3MNNA 2HIOB 3X1SC 5AVCB 1N1JA 3B6FB 3RELD 5DNNC 5B32D 3AZJB 4J8XD 3MGPB 5BS7A 3AFAA 2NZDD 1EQZC 3MVDD 5AVCC 4J8WA 3AZFB 2PYOB 2CV5A 5CPKD 3WKJD 1KX5D 4E44A 3F6TA 4M6BA 2YFVA 3EPKA 1P3LA 3AZFC 3X1TB 3AN2D 3O62D 3REJC 5E5AB 5BNXA 1TZYB 3AZLD 4YS3B 1P3KB 1ID3B 3VH6T 5B2JD 1ZLAA 2ZY2A 4WU9D 1P3GC 3W98A 1P3MD 1P3BA 1Q9CA 3VH6W 5E5AC 3LELB 4JJNB 3MNND 2ZM5A 1TZYC 4YS3C 1P3KC 3WTPA 3VH5A 1JFIA 3R45A 1AOID 3A6NC 3AFAD 3LJAB 5B33B 5KDMA 3LELC 4JJNC 4KUDB 3KFUG 1M19C 5JRGC 4J8WD 2JCHA 4DQYB 3AV1A 5CPIB 5AV8A 2CV5D 1KX4B 4WU8B 4KUDC 4H9PA 1P3LD 1S32A 5GT3A 5GXQB 5B1MB 2BYMA 5AV6C 4QLCC 1ZLAD 3AZGA 3W98D 4ZUXC 3X1UA 3C1CC 1P3BD 3C1BB 5GXQC 5CP6A 5B2IA 3WTPD 4LD9A 1BFMA 1P3PA 1F66A 3WTPE 1F1EA 3MGSA 5B24C 3C1BC 2ZY3A 1P3OB 5DNMA 3W96A 3UTAB 3MGRA 3AV1D 1P34A 2BYKA 5AV8D 1M18A 4XZQA 1WWSA 3A1IA 4H9RB 1S32D 1P3OC 3X1SA 3UTAC 4H9NB 5DNNA 3AV2C 5GT3D 3AYWB 1EQZA 5B1LB 3EPLA 3AZGD 5AVCA 3KUYC 3X1UD 3KWQC 2RVQC 5CP6D 5B1LC 5B2ID 3KXBB 4Z5TC 4LD9D 1P3PD 4YM6B 3AZFA 1F66D 4Z2MH 3MGSD 2FJ7B 3REJA 4Z66B 5DNMD 1P34D 3W96D 3MGRD 3KXBC 1B6WA 1M18D 4XZQD 2JSSA 1P3GA 4R8PC 2FJ7C 3LZ0B 4XUJB 2L5AA 5E5AA 4Z66C 3AZKC 3B0DB 3TU4C 1TZYA 3X1SD 1PZRA 3REHB 4YS3A 1P3KA 5DNND 3A6NA 1T3UA 3LELA 4JJNA 1EQZD 5GT0C 3B0DC 5AVCD 3REHC 1Z2CB 5JRGA 3UTBB 1M19A 3B6FD 4CAYB 3LZ1C 3AZEC 4E45A 1P3AB 4KUDA 5B40C 3NQJB 4WZSB 3AZFD 3X1VC 3REJD 2JE5A 3AZMB 4WJ3C 3WAAB 1P3AC 2F8NH 5AV6A 4QLCA 4AWLB 1P3GD 4ZUXA 3C1CA 2Y2GA 4UPKA 5E5AD 3WAAC 3AZMC 1BH9B 4ZBJC 1TZYD 4YS3D 3UT9C 1P3KD 5GXQA 3KSYA 1AOIA 2F8NA 3A6ND 3NQUB 5B31B 5B24A 3LELD 2AROB 4JJND 2Y2MA 5CPJB 3C1BA 2HIOC 5GSUB 2F8NK 2DQNC 1M19D 5JRGD 1M1AB 5BO0B 2LY8A 3B6GB 3B6FC 3AZJC 3MGPC 3AZHB 1KX3B 1A7WA 5B31C 2AROC 5CPJC 4KUDD 1B67A 5GSUC 4HGAB 3A1KA 1P3OA 2PYOC 3UTAA 5B0YB 5AY8B 3AV2A 3VH6A 5AV6D 4HGAC 4QLCD 4J8UB 3X1TC 4ZUXD 3KUYA 3C1CD 1TAFB 5AY8C 5B0YC 3KWQA 3W97B 1KU5A 1ID3C 5AV9B 5GXQD 1R4VA 5B1LA 4J8UC 4Z5TA 4X23B 3IP4C 2F8ND 5B24D 3W97C 3P5JB 3V9RA 3C1BD 1BH8A 5AV9C 3KXBA 4X23C 4R8PA 2FJ7A 3LJAC 5B33C 3AZKA 3TU4A 1P3OD 4J8XB 2XD5A 3UTAD 5FUGA 5CPIC 1KX4C 4WU8C 3AV2D 4NE6A 2CWEA 2NQBB 4CSRB 3MVDB 5GT0A 1ULYA 5BNVB 3REHA 4KGCB 5CPKB 4H9SC 3LZ1A 3KUYD 3WKJB 3AZEA 2YFWA 3KWQD 2NQBC 3AZIB 2RVQD 5B1MC 5B1LD 4Z5TD 5B40A 4KGCC 3X1VA 3AZLB 3AZIC 5B2JB 3REKB 1P3AA 3KXBD 1P3MB 3H0MC 3NQJA 4R8PD 2FJ7D 3W99B 3AL0C 3MNNB 1N1JB 2Y2QA 4Z66D 3AZKD 3AZMA 3TU4D 3WAAA 2Y2IA 3REKC 3UT9A 5B31G 3W99C 4H9QB 3WA9B 5GT0D 2HIOA 3REHD 3B6FA 3LZ1D 3AZJA 3AZED 2YFVB 3MGPA 4H9OB 3NQUA 5BT1C 5B31A 3AYWC 1P3LB 2AROA 2DF4C 5CPJA 3WA9C 5GSUA 5B40D 2ZY5A 2PYOA 3X1VD 1ZLAB 3EPJA 2Y2LA 1P3AD 4YM6C 3X1TA 2VQRA 4DRAA 5B0YA 5AY8A 4G92B 3AZMD 3WAAD 3WTPB 1ID3A 3UT9D 5F99B 4J8UA 2Y2JA 5KDMB 3LZ0C 4XUJC 1TAFA 3W97A 5JA4B 2HIOD 5AV9A 1P3IB 5F99C 3AZJD 1HQ3B 4X23A 3MGPD 4H9PB 3LJAA 5B33A 5C3IB 5B31D 5B32G 3AZNB 2AROD 4G91B 5CPJD 5GSUD 3UTBC 1P3IC 2PYOD 1HQ3C 5CPIA 1KX4A 4WU8A 3AZGB 3AZNC 3X1TD 3X1UB 4NFTA 4H9SA 3REIB 5B0YD 5AY8D 2NQBA 5CP6B 4CSRA 4LD9B 4KHAB 1ID3D 5B1MA 3MGSB 4J8UD 4AWLC 4J8VB 5BNVA 4KGCA 3REIC 3W97D 5DNMB 3W96B 3AZIA 3MGRB 2BYKB 5AV9D 4XZQB 1M18B 1H3OB 4J8VC 4X23D 3LJAD 5B33D 3REKA 1M1AC 3B6GC 3FDDA 5CPID 3AZHC 1KX3C 1KX4D 4WU8D 3MGQB 4H9RA 3W99A 3EPHA 2IO5B 4H9NA 2J8PA 2NQBD 3MGQC 2Y2HA 5AV5B 2IO5C 3AYWA 4H9QA 5B1MD 5B0ZB 3WA9A 2Y2PA 3REJB 4KGCD 5AVBB 3AZID 5AV5C 4H9OA 4UUZB 5B0ZC 1U35B 1P3GB 1P3FB 4YM6A 5AVBC 4Z66A 3RELB 5B32B 3REKD 1U35C 2W8SA 2G5HC 1P3FC 1WWIA 3A6NB 2NZDB 2F2AC 3W99D 3LZ0A 4XUJA 1M19B 5JRGB 3RELC 5B32C 3VH5T 4J8XC 5F99A 1KX5B 2NZDC 3MVDC 3VH5W 5BT1D 3AYWD 3AN2B 2G5IC 5JA4A 3WA9D 3O62B 5G49B 5CPKC 3UTBA 1P3IA 3WKJC 4CAYA 1KX5C 1HQ3A 5AV6B 3H0RC 4QLCB 4WU9B 3AZNA 3AN2C 4WNNB 4ZUXB 3O62C 4YM6D 3C1CB 4NE5A 3AZLC 5B2JC 4WU9C 1P3MC 1AOIB 2F8NB 3AFAB 5B24B 3MNNC 3REIA 3LZ0D 4XUJD 4J8WB 3H0LC 1BH9A 2Y2OA 4KHAA 2CV5B 5BS7C 5F99D 1AOIC 3AFAC 4J8VA 4DRBA 4J8WC 2CV5C 1M1AA 5BO0A 3UTBD 1P3ID 3AV2B 3B6GA 5BNXB 1H3OA 1HQ3D 4NE3A 3AZHA 1KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3L C;  3W98 B;  3AZN D;  3KUY B;  3KWQ B;  1P3B B;  3MGQ A;  1ZLA C;  4Z5T B;  3W98 C;  1JFI B;  3R45 B;  1P3B C;  3V9R B;  3REI D;  1BH8 B;  4G92 C;  3AV1 B;  5AV5 A;  3WTP C;  5AV8 B;  5B0Z A;  4R8P B;  4J8V D;  4Z2M G;  3B0C T;  5AVB A;  3AZK B;  3TU4 B;  1S32 B;  3AV1 C;  5FUG B;  4EO5 B;  5AV8 C;  2HUE B;  3B0B A;  4UUZ A;  1U35 A;  3B0C W;  1M1A D;  3B6G D;  1P3F A;  3AZH D;  1KX3 D;  5GT3 B;  2BYM B;  5GT0 B;  5C3I C;  1S32 C;  4G91 C;  4WV4 B;  3REL A;  3LZ1 B;  4EO5 C;  2HUE C;  2YFW B;  5B32 A;  4J8X A;  3AZE B;  5GT3 C;  2NZD A;  3MGQ D;  5B2I B;  5B40 B;  3MVD A;  3AZG C;  1P3P B;  1F66 B;  3X1V B;  3X1U C;  5CHL B;  5CPK A;  3WKJ A;  1KX5 A;  1P34 B;  5CP6 C;  5B2I C;  5AV5 D;  4LD9 C;  1P3P C;  1F66 C;  5B0Z D;  3AN2 A;  3MGS C;  3O62 A;  5G49 A;  5AVB D;  1HTA A;  4ZBJ B;  3X1S B;  5DNM C;  3W96 C;  3UT9 B;  3MGR C;  3AZL A;  5B2J A;  1P34 C;  2F8N G;  5DNN B;  4WU9 A;  4XZQ C;  1M18 C;  1U35 D;  1P3M A;  4WNN A;  1P3F D;  1EQZ B;  3MNN A;  2HIO B;  3X1S C;  5AVC B;  1N1J A;  3B6F B;  3REL D;  5DNN C;  5B32 D;  3AZJ B;  4J8X D;  3MGP B;  5BS7 A;  3AFA A;  2NZD D;  1EQZ C;  3MVD D;  5AVC C;  4J8W A;  3AZF B;  2PYO B;  2CV5 A;  5CPK D;  3WKJ D;  1KX5 D;  4E44 A;  4M6B A;  2YFV A;  1P3L A;  3AZF C;  3X1T B;  3AN2 D;  3O62 D;  3REJ C;  5E5A B;  5BNX A;  1TZY B;  3AZL D;  4YS3 B;  1P3K B;  1ID3 B;  3VH6 T;  5B2J D;  1ZLA A;  4WU9 D;  3W98 A;  1P3G C;  1P3M D;  1P3B A;  1Q9C A;  3VH6 W;  5E5A C;  3LEL B;  4JJN B;  3MNN D;  1TZY C;  4YS3 C;  1P3K C;  3WTP A;  3VH5 A;  1JFI A;  3R45 A;  1AOI D;  3A6N C;  3AFA D;  3LJA B;  5B33 B;  5KDM A;  3LEL C;  4JJN C;  4KUD B;  1M19 C;  5JRG C;  4J8W D;  3AV1 A;  5CPI B;  5AV8 A;  2CV5 D;  1KX4 B;  4WU8 B;  4KUD C;  4H9P A;  1P3L D;  1S32 A;  5GT3 A;  5GXQ B;  5B1M B;  2BYM A;  5AV6 C;  4QLC C;  1ZLA D;  3AZG A;  3W98 D;  4ZUX C;  3X1U A;  3C1C C;  1P3B D;  3C1B B;  5GXQ C;  5CP6 A;  5B2I A;  3WTP D;  4LD9 A;  1BFM A;  1P3P A;  1F66 A;  3WTP E;  1F1E A;  3MGS A;  5B24 C;  3C1B C;  1P3O B;  5DNM A;  3W96 A;  3UTA B;  3MGR A;  3AV1 D;  1P34 A;  2BYK A;  5AV8 D;  1M18 A;  4XZQ A;  1WWS A;  4H9R B;  1S32 D;  1P3O C;  3X1S A;  3UTA C;  4H9N B;  5DNN A;  3AV2 C;  5GT3 D;  3AYW B;  1EQZ A;  5B1L B;  3AZG D;  5AVC A;  3KUY C;  3X1U D;  3KWQ C;  2RVQ C;  5CP6 D;  5B1L C;  5B2I D;  3KXB B;  4Z5T C;  4LD9 D;  1P3P D;  4YM6 B;  3AZF A;  1F66 D;  4Z2M H;  3MGS D;  2FJ7 B;  3REJ A;  4Z66 B;  5DNM D;  1P34 D;  3W96 D;  3MGR D;  3KXB C;  1B6W A;  1M18 D;  4XZQ D;  2JSS A;  1P3G A;  4R8P C;  2FJ7 C;  3LZ0 B;  4XUJ B;  2L5A A;  5E5A A;  4Z66 C;  3AZK C;  3B0D B;  3TU4 C;  1TZY A;  3X1S D;  3REH B;  4YS3 A;  1P3K A;  5DNN D;  3A6N A;  3LEL A;  4JJN A;  1EQZ D;  5GT0 C;  3B0D C;  5AVC D;  3REH C;  5JRG A;  1M19 A;  3UTB B;  3B6F D;  4CAY B;  3LZ1 C;  3AZE C;  4E45 A;  1P3A B;  4KUD A;  5B40 C;  3NQJ B;  4WZS B;  3AZF D;  3X1V C;  3REJ D;  3AZM B;  3WAA B;  1P3A C;  2F8N H;  5AV6 A;  4QLC A;  4AWL B;  1P3G D;  4ZUX A;  3C1C A;  3AZM C;  5E5A D;  3WAA C;  1BH9 B;  4ZBJ C;  1TZY D;  4YS3 D;  3UT9 C;  1P3K D;  5GXQ A;  3KSY A;  1AOI A;  2F8N A;  3A6N D;  3NQU B;  5B31 B;  5B24 A;  3LEL D;  2ARO B;  4JJN D;  5CPJ B;  2F8N K;  3C1B A;  2HIO C;  5GSU B;  1M19 D;  5JRG D;  1M1A B;  5BO0 B;  2LY8 A;  3B6G B;  3B6F C;  3AZJ C;  3MGP C;  3AZH B;  1KX3 B;  1A7W A;  5B31 C;  2ARO C;  5CPJ C;  4KUD D;  1B67 A;  5GSU C;  4HGA B;  1P3O A;  2PYO C;  3UTA A;  5B0Y B;  5AY8 B;  3AV2 A;  3VH6 A;  5AV6 D;  4HGA C;  4QLC D;  4J8U B;  3X1T C;  4ZUX D;  3KUY A;  3C1C D;  1TAF B;  5AY8 C;  5B0Y C;  3KWQ A;  3W97 B;  1KU5 A;  1ID3 C;  5AV9 B;  5GXQ D;  1R4V A;  5B1L A;  4J8U C;  4Z5T A;  4X23 B;  2F8N D;  5B24 D;  3W97 C;  3V9R A;  3C1B D;  1BH8 A;  5AV9 C;  3KXB A;  4X23 C;  4R8P A;  2FJ7 A;  3LJA C;  5B33 C;  3AZK A;  3TU4 A;  1P3O D;  4J8X B;  3UTA D;  5FUG A;  5CPI C;  1KX4 C;  4WU8 C;  3AV2 D;  4NE6 A;  2CWE A;  2NQB B;  4CSR B;  3MVD B;  5GT0 A;  1ULY A;  5BNV B;  3REH A;  4KGC B;  5CPK B;  4H9S C;  3LZ1 A;  3KUY D;  3WKJ B;  3AZE A;  2YFW A;  3KWQ D;  2NQB C;  3AZI B;  2RVQ D;  5B1M C;  5B1L D;  4Z5T D;  5B40 A;  4KGC C;  3X1V A;  3AZL B;  3AZI C;  5B2J B;  3REK B;  1P3A A;  3KXB D;  1P3M B;  3NQJ A;  4R8P D;  2FJ7 D;  3W99 B;  3MNN B;  1N1J B;  3AZM A;  4Z66 D;  3AZK D;  3WAA A;  3TU4 D;  3REK C;  3UT9 A;  5B31 G;  3W99 C;  4H9Q B;  3WA9 B;  5GT0 D;  2HIO A;  3REH D;  3B6F A;  3LZ1 D;  3AZJ A;  3AZE D;  2YFV B;  3MGP A;  4H9O B;  3NQU A;  5BT1 C;  5B31 A;  3AYW C;  1P3L B;  2ARO A;  5CPJ A;  3WA9 C;  5GSU A;  5B40 D;  2PYO A;  3X1V D;  1ZLA B;  1P3A D;  4YM6 C;  3X1T A;  4DRA A;  5B0Y A;  5AY8 A;  4G92 B;  3AZM D;  3WAA D;  3WTP B;  1ID3 A;  3UT9 D;  5F99 B;  4J8U A;  5KDM B;  3LZ0 C;  4XUJ C;  1TAF A;  3W97 A;  5JA4 B;  2HIO D;  5AV9 A;  1P3I B;  5F99 C;  3AZJ D;  1HQ3 B;  4X23 A;  3MGP D;  4H9P B;  3LJA A;  5B33 A;  5C3I B;  5B31 D;  5B32 G;  3AZN B;  2ARO D;  4G91 B;  5CPJ D;  5GSU D;  3UTB C;  1P3I C;  2PYO D;  1HQ3 C;  5CPI A;  1KX4 A;  4WU8 A;  3AZG B;  3AZN C;  3X1T D;  3X1U B;  4NFT A;  4H9S A;  3REI B;  5B0Y D;  5AY8 D;  2NQB A;  5CP6 B;  4CSR A;  4LD9 B;  4KHA B;  1ID3 D;  5B1M A;  3MGS B;  4J8U D;  4AWL C;  4J8V B;  5BNV A;  4KGC A;  3REI C;  3W97 D;  5DNM B;  3W96 B;  3AZI A;  3MGR B;  2BYK B;  5AV9 D;  4XZQ B;  1M18 B;  1H3O B;  4J8V C;  4X23 D;  3LJA D;  5B33 D;  3REK A;  1M1A C;  3B6G C;  5CPI D;  3AZH C;  1KX3 C;  1KX4 D;  4WU8 D;  3MGQ B;  4H9R A;  3W99 A;  2IO5 B;  4H9N A;  2NQB D;  3MGQ C;  5AV5 B;  2IO5 C;  3AYW A;  4H9Q A;  5B1M D;  5B0Z B;  3WA9 A;  3REJ B;  4KGC D;  5AVB B;  3AZI D;  5AV5 C;  4H9O A;  4UUZ B;  5B0Z C;  1U35 B;  1P3G B;  1P3F B;  4YM6 A;  5AVB C;  4Z66 A;  3REL B;  5B32 B;  3REK D;  1U35 C;  1P3F C;  1WWI A;  3A6N B;  2NZD B;  3W99 D;  3LZ0 A;  4XUJ A;  1M19 B;  5JRG B;  3REL C;  5B32 C;  3VH5 T;  4J8X C;  5F99 A;  1KX5 B;  2NZD C;  3MVD C;  3VH5 W;  5BT1 D;  3AYW D;  3AN2 B;  5JA4 A;  3WA9 D;  3O62 B;  5G49 B;  5CPK C;  3UTB A;  1P3I A;  3WKJ C;  4CAY A;  1KX5 C;  1HQ3 A;  5AV6 B;  4QLC B;  4WU9 B;  3AZN A;  3AN2 C;  4WNN B;  4ZUX B;  3O62 C;  4YM6 D;  3C1C B;  4NE5 A;  3AZL C;  5B2J C;  4WU9 C;  1P3M C;  1AOI B;  2F8N B;  3AFA B;  5B24 B;  3MNN C;  3REI A;  3LZ0 D;  4XUJ D;  4J8W B;  1BH9 A;  4KHA A;  2CV5 B;  5BS7 C;  5F99 D;  1AOI C;  3AFA C;  4J8V A;  4DRB A;  4J8W C;  2CV5 C;  1M1A A;  5BO0 A;  3UTB D;  1P3I D;  3AV2 B;  3B6G A;  5BNX B;  1H3O A;  1HQ3 D;  4NE3 A;  3AZH A;  1KX3 A; 
#chains in the Genus database with same CATH topology
 1P3L C;  3W98 B;  3AZN D;  3KUY B;  3KWQ B;  1P3B B;  3EG5 B;  3MGQ A;  1ZLA C;  4Z5T B;  2XD1 A;  1JFI B;  3W98 C;  3R45 B;  1P3B C;  3V9R B;  3REI D;  1BH8 B;  4G92 C;  3AV1 B;  5AV5 A;  3WTP C;  5AV8 B;  5B0Z A;  4R8P B;  4J8V D;  4Z2M G;  3B0C T;  5AVB A;  3AZK B;  2ZY4 A;  3TU4 B;  1S32 B;  3AV1 C;  2RIQ A;  5FUG B;  4EO5 B;  5AV8 C;  2HUE B;  3B0B A;  4UUZ A;  1U35 A;  3B0C W;  1M1A D;  3B6G D;  1P3F A;  3AZH D;  1KX3 D;  5GT3 B;  2BYM B;  5GT0 B;  5C3I C;  1S32 C;  2Y2N A;  4G91 C;  4WV4 B;  3REL A;  3LZ1 B;  4EO5 C;  2HUE C;  2YFW B;  5B32 A;  4J8X A;  3AZE B;  5GT3 C;  2NZD A;  3MGQ D;  5B2I B;  2Y2K A;  5B40 B;  3MVD A;  3AZG C;  1P3P B;  1F66 B;  3X1V B;  3X1U C;  5CHL B;  2BG1 A;  1W2E A;  5CPK A;  3WKJ A;  1KX5 A;  1P34 B;  5CP6 C;  5B2I C;  5AV5 D;  4LD9 C;  1P3P C;  1F66 C;  5B0Z D;  3AN2 A;  3MGS C;  3O62 A;  5G49 A;  5AVB D;  2UWX A;  1HTA A;  4ZBJ B;  3X1S B;  5DNM C;  3W96 C;  3UT9 B;  3MGR C;  3AZL A;  5B2J A;  1P34 C;  2F8N G;  5DNN B;  4WU9 A;  4XZQ C;  1M18 C;  1U35 D;  1P3M A;  4WNN A;  1P3F D;  2FFF B;  1EQZ B;  3MNN A;  2HIO B;  3X1S C;  5AVC B;  1N1J A;  3B6F B;  3REL D;  5DNN C;  5B32 D;  3AZJ B;  4J8X D;  3MGP B;  5BS7 A;  3AFA A;  2NZD D;  1EQZ C;  3MVD D;  5AVC C;  4J8W A;  3AZF B;  2PYO B;  2CV5 A;  5CPK D;  3WKJ D;  1KX5 D;  4E44 A;  3F6T A;  4M6B A;  2YFV A;  3EPK A;  1P3L A;  3AZF C;  3X1T B;  3AN2 D;  3O62 D;  3REJ C;  5E5A B;  5BNX A;  1TZY B;  3AZL D;  4YS3 B;  1P3K B;  1ID3 B;  3VH6 T;  5B2J D;  1ZLA A;  2ZY2 A;  4WU9 D;  1P3G C;  3W98 A;  1P3M D;  1P3B A;  1Q9C A;  3VH6 W;  5E5A C;  3LEL B;  4JJN B;  3MNN D;  2ZM5 A;  1TZY C;  4YS3 C;  1P3K C;  3WTP A;  3VH5 A;  1JFI A;  3R45 A;  1AOI D;  3A6N C;  3AFA D;  3LJA B;  5B33 B;  5KDM A;  3LEL C;  4JJN C;  4KUD B;  3KFU G;  1M19 C;  5JRG C;  4J8W D;  2JCH A;  4DQY B;  3AV1 A;  5CPI B;  5AV8 A;  2CV5 D;  1KX4 B;  4WU8 B;  4KUD C;  4H9P A;  1P3L D;  1S32 A;  5GT3 A;  5GXQ B;  5B1M B;  2BYM A;  5AV6 C;  4QLC C;  1ZLA D;  3AZG A;  3W98 D;  4ZUX C;  3X1U A;  3C1C C;  1P3B D;  3C1B B;  5GXQ C;  5CP6 A;  5B2I A;  3WTP D;  4LD9 A;  1BFM A;  1P3P A;  1F66 A;  3WTP E;  1F1E A;  3MGS A;  5B24 C;  3C1B C;  2ZY3 A;  1P3O B;  5DNM A;  3W96 A;  3UTA B;  3MGR A;  3AV1 D;  1P34 A;  2BYK A;  5AV8 D;  1M18 A;  4XZQ A;  1WWS A;  3A1I A;  4H9R B;  1S32 D;  1P3O C;  3X1S A;  3UTA C;  4H9N B;  5DNN A;  3AV2 C;  5GT3 D;  3AYW B;  1EQZ A;  5B1L B;  3EPL A;  3AZG D;  5AVC A;  3KUY C;  3X1U D;  3KWQ C;  2RVQ C;  5CP6 D;  5B1L C;  5B2I D;  3KXB B;  4Z5T C;  4LD9 D;  1P3P D;  4YM6 B;  3AZF A;  1F66 D;  4Z2M H;  3MGS D;  2FJ7 B;  3REJ A;  4Z66 B;  5DNM D;  1P34 D;  3W96 D;  3MGR D;  3KXB C;  1B6W A;  1M18 D;  4XZQ D;  2JSS A;  1P3G A;  4R8P C;  2FJ7 C;  3LZ0 B;  4XUJ B;  2L5A A;  5E5A A;  4Z66 C;  3AZK C;  3B0D B;  3TU4 C;  1TZY A;  3X1S D;  1PZR A;  3REH B;  4YS3 A;  1P3K A;  5DNN D;  3A6N A;  1T3U A;  3LEL A;  4JJN A;  1EQZ D;  5GT0 C;  3B0D C;  5AVC D;  3REH C;  1Z2C B;  5JRG A;  3UTB B;  1M19 A;  3B6F D;  4CAY B;  3LZ1 C;  3AZE C;  4E45 A;  1P3A B;  4KUD A;  5B40 C;  3NQJ B;  4WZS B;  3AZF D;  3X1V C;  3REJ D;  2JE5 A;  3AZM B;  4WJ3 C;  3WAA B;  1P3A C;  2F8N H;  5AV6 A;  4QLC A;  4AWL B;  1P3G D;  4ZUX A;  3C1C A;  2Y2G A;  4UPK A;  5E5A D;  3WAA C;  3AZM C;  1BH9 B;  4ZBJ C;  1TZY D;  4YS3 D;  3UT9 C;  1P3K D;  5GXQ A;  3KSY A;  1AOI A;  2F8N A;  3A6N D;  3NQU B;  5B31 B;  5B24 A;  3LEL D;  2ARO B;  4JJN D;  2Y2M A;  5CPJ B;  3C1B A;  2HIO C;  5GSU B;  2F8N K;  2DQN C;  1M19 D;  5JRG D;  1M1A B;  5BO0 B;  2LY8 A;  3B6G B;  3B6F C;  3AZJ C;  3MGP C;  3AZH B;  1KX3 B;  1A7W A;  5B31 C;  2ARO C;  5CPJ C;  4KUD D;  1B67 A;  5GSU C;  4HGA B;  3A1K A;  1P3O A;  2PYO C;  3UTA A;  5B0Y B;  5AY8 B;  3AV2 A;  3VH6 A;  5AV6 D;  4HGA C;  4QLC D;  4J8U B;  3X1T C;  4ZUX D;  3KUY A;  3C1C D;  1TAF B;  5AY8 C;  5B0Y C;  3KWQ A;  3W97 B;  1KU5 A;  1ID3 C;  5AV9 B;  5GXQ D;  1R4V A;  5B1L A;  4J8U C;  4Z5T A;  4X23 B;  3IP4 C;  2F8N D;  5B24 D;  3W97 C;  3P5J B;  3V9R A;  3C1B D;  1BH8 A;  5AV9 C;  3KXB A;  4X23 C;  4R8P A;  2FJ7 A;  3LJA C;  5B33 C;  3AZK A;  3TU4 A;  1P3O D;  4J8X B;  2XD5 A;  3UTA D;  5FUG A;  5CPI C;  1KX4 C;  4WU8 C;  3AV2 D;  4NE6 A;  2CWE A;  2NQB B;  4CSR B;  3MVD B;  5GT0 A;  1ULY A;  5BNV B;  3REH A;  4KGC B;  5CPK B;  4H9S C;  3LZ1 A;  3KUY D;  3WKJ B;  3AZE A;  2YFW A;  3KWQ D;  2NQB C;  3AZI B;  2RVQ D;  5B1M C;  5B1L D;  4Z5T D;  5B40 A;  4KGC C;  3X1V A;  3AZL B;  3AZI C;  5B2J B;  3REK B;  1P3A A;  3KXB D;  1P3M B;  3H0M C;  3NQJ A;  4R8P D;  2FJ7 D;  3W99 B;  3AL0 C;  3MNN B;  1N1J B;  2Y2Q A;  4Z66 D;  3AZK D;  3AZM A;  3TU4 D;  3WAA A;  2Y2I A;  3REK C;  3UT9 A;  5B31 G;  3W99 C;  4H9Q B;  3WA9 B;  5GT0 D;  2HIO A;  3REH D;  3B6F A;  3LZ1 D;  3AZJ A;  3AZE D;  2YFV B;  3MGP A;  4H9O B;  3NQU A;  5BT1 C;  5B31 A;  3AYW C;  1P3L B;  2ARO A;  2DF4 C;  5CPJ A;  3WA9 C;  5GSU A;  5B40 D;  2ZY5 A;  2PYO A;  3X1V D;  1ZLA B;  3EPJ A;  2Y2L A;  1P3A D;  4YM6 C;  3X1T A;  2VQR A;  4DRA A;  5B0Y A;  5AY8 A;  4G92 B;  3AZM D;  3WAA D;  3WTP B;  1ID3 A;  3UT9 D;  5F99 B;  4J8U A;  2Y2J A;  5KDM B;  3LZ0 C;  4XUJ C;  1TAF A;  3W97 A;  5JA4 B;  2HIO D;  5AV9 A;  1P3I B;  5F99 C;  3AZJ D;  1HQ3 B;  4X23 A;  3MGP D;  4H9P B;  3LJA A;  5B33 A;  5C3I B;  5B31 D;  5B32 G;  3AZN B;  2ARO D;  4G91 B;  5CPJ D;  5GSU D;  3UTB C;  1P3I C;  2PYO D;  1HQ3 C;  5CPI A;  1KX4 A;  4WU8 A;  3AZG B;  3AZN C;  3X1T D;  3X1U B;  4NFT A;  4H9S A;  3REI B;  5B0Y D;  5AY8 D;  2NQB A;  5CP6 B;  4CSR A;  4LD9 B;  4KHA B;  1ID3 D;  5B1M A;  3MGS B;  4J8U D;  4AWL C;  4J8V B;  5BNV A;  4KGC A;  3REI C;  3W97 D;  5DNM B;  3W96 B;  3AZI A;  3MGR B;  2BYK B;  5AV9 D;  4XZQ B;  1M18 B;  1H3O B;  4J8V C;  4X23 D;  3LJA D;  5B33 D;  3REK A;  1M1A C;  3B6G C;  3FDD A;  5CPI D;  3AZH C;  1KX3 C;  1KX4 D;  4WU8 D;  3MGQ B;  4H9R A;  3W99 A;  3EPH A;  2IO5 B;  4H9N A;  2J8P A;  2NQB D;  3MGQ C;  2Y2H A;  5AV5 B;  2IO5 C;  3AYW A;  4H9Q A;  5B1M D;  5B0Z B;  3WA9 A;  2Y2P A;  3REJ B;  4KGC D;  5AVB B;  3AZI D;  5AV5 C;  4H9O A;  4UUZ B;  5B0Z C;  1U35 B;  1P3G B;  1P3F B;  4YM6 A;  5AVB C;  4Z66 A;  3REL B;  5B32 B;  3REK D;  1U35 C;  2W8S A;  2G5H C;  1P3F C;  1WWI A;  3A6N B;  2NZD B;  2F2A C;  3W99 D;  3LZ0 A;  4XUJ A;  1M19 B;  5JRG B;  3REL C;  5B32 C;  3VH5 T;  4J8X C;  5F99 A;  1KX5 B;  2NZD C;  3MVD C;  3VH5 W;  5BT1 D;  3AYW D;  3AN2 B;  2G5I C;  5JA4 A;  3WA9 D;  3O62 B;  5G49 B;  5CPK C;  3UTB A;  1P3I A;  3WKJ C;  4CAY A;  1KX5 C;  1HQ3 A;  5AV6 B;  3H0R C;  4QLC B;  4WU9 B;  3AZN A;  3AN2 C;  4WNN B;  4ZUX B;  3O62 C;  4YM6 D;  3C1C B;  4NE5 A;  3AZL C;  5B2J C;  4WU9 C;  1P3M C;  1AOI B;  2F8N B;  3AFA B;  5B24 B;  3MNN C;  3REI A;  3LZ0 D;  4XUJ D;  4J8W B;  3H0L C;  1BH9 A;  2Y2O A;  4KHA A;  2CV5 B;  5BS7 C;  5F99 D;  1AOI C;  3AFA C;  4J8V A;  4DRB A;  4J8W C;  2CV5 C;  1M1A A;  5BO0 A;  3UTB D;  1P3I D;  3AV2 B;  3B6G A;  5BNX B;  1H3O A;  1HQ3 D;  4NE3 A;  3AZH A;  1KX3 A; 
#chains in the Genus database with same CATH homology
 1P3L C;  3W98 B;  3AZN D;  3KUY B;  3KWQ B;  1P3B B;  3EG5 B;  3MGQ A;  1ZLA C;  4Z5T B;  2XD1 A;  1JFI B;  3W98 C;  3R45 B;  1P3B C;  3V9R B;  3REI D;  1BH8 B;  4G92 C;  3AV1 B;  5AV5 A;  3WTP C;  5AV8 B;  5B0Z A;  4R8P B;  4J8V D;  4Z2M G;  3B0C T;  5AVB A;  3AZK B;  2ZY4 A;  3TU4 B;  1S32 B;  3AV1 C;  2RIQ A;  5FUG B;  4EO5 B;  5AV8 C;  2HUE B;  3B0B A;  4UUZ A;  1U35 A;  3B0C W;  1M1A D;  3B6G D;  1P3F A;  3AZH D;  1KX3 D;  5GT3 B;  2BYM B;  5GT0 B;  5C3I C;  1S32 C;  2Y2N A;  4G91 C;  4WV4 B;  3REL A;  3LZ1 B;  4EO5 C;  2HUE C;  2YFW B;  5B32 A;  4J8X A;  3AZE B;  5GT3 C;  2NZD A;  3MGQ D;  5B2I B;  2Y2K A;  5B40 B;  3MVD A;  3AZG C;  1P3P B;  1F66 B;  3X1V B;  3X1U C;  5CHL B;  2BG1 A;  1W2E A;  5CPK A;  3WKJ A;  1KX5 A;  1P34 B;  5CP6 C;  5B2I C;  5AV5 D;  4LD9 C;  1P3P C;  1F66 C;  5B0Z D;  3AN2 A;  3MGS C;  3O62 A;  5G49 A;  5AVB D;  2UWX A;  1HTA A;  4ZBJ B;  3X1S B;  5DNM C;  3W96 C;  3UT9 B;  3MGR C;  3AZL A;  5B2J A;  1P34 C;  2F8N G;  5DNN B;  4WU9 A;  4XZQ C;  1M18 C;  1U35 D;  1P3M A;  4WNN A;  1P3F D;  2FFF B;  1EQZ B;  3MNN A;  2HIO B;  3X1S C;  5AVC B;  1N1J A;  3B6F B;  3REL D;  5DNN C;  5B32 D;  3AZJ B;  4J8X D;  3MGP B;  5BS7 A;  3AFA A;  2NZD D;  1EQZ C;  3MVD D;  5AVC C;  4J8W A;  3AZF B;  2PYO B;  2CV5 A;  5CPK D;  3WKJ D;  1KX5 D;  4E44 A;  3F6T A;  4M6B A;  2YFV A;  3EPK A;  1P3L A;  3AZF C;  3X1T B;  3AN2 D;  3O62 D;  3REJ C;  5E5A B;  5BNX A;  1TZY B;  3AZL D;  4YS3 B;  1P3K B;  1ID3 B;  3VH6 T;  5B2J D;  1ZLA A;  2ZY2 A;  4WU9 D;  1P3G C;  3W98 A;  1P3M D;  1P3B A;  1Q9C A;  3VH6 W;  5E5A C;  3LEL B;  4JJN B;  3MNN D;  2ZM5 A;  1TZY C;  4YS3 C;  1P3K C;  3WTP A;  3VH5 A;  1JFI A;  3R45 A;  1AOI D;  3A6N C;  3AFA D;  3LJA B;  5B33 B;  5KDM A;  3LEL C;  4JJN C;  4KUD B;  3KFU G;  1M19 C;  5JRG C;  4J8W D;  2JCH A;  4DQY B;  3AV1 A;  5CPI B;  5AV8 A;  2CV5 D;  1KX4 B;  4WU8 B;  4KUD C;  4H9P A;  1P3L D;  1S32 A;  5GT3 A;  5GXQ B;  5B1M B;  2BYM A;  5AV6 C;  4QLC C;  1ZLA D;  3AZG A;  3W98 D;  4ZUX C;  3X1U A;  3C1C C;  1P3B D;  3C1B B;  5GXQ C;  5CP6 A;  5B2I A;  3WTP D;  4LD9 A;  1BFM A;  1P3P A;  1F66 A;  3WTP E;  1F1E A;  3MGS A;  5B24 C;  3C1B C;  2ZY3 A;  1P3O B;  5DNM A;  3W96 A;  3UTA B;  3MGR A;  3AV1 D;  1P34 A;  2BYK A;  5AV8 D;  1M18 A;  4XZQ A;  1WWS A;  3A1I A;  4H9R B;  1S32 D;  1P3O C;  3X1S A;  3UTA C;  4H9N B;  5DNN A;  3AV2 C;  5GT3 D;  3AYW B;  1EQZ A;  5B1L B;  3EPL A;  3AZG D;  5AVC A;  3KUY C;  3X1U D;  3KWQ C;  2RVQ C;  5CP6 D;  5B1L C;  5B2I D;  3KXB B;  4Z5T C;  4LD9 D;  1P3P D;  4YM6 B;  3AZF A;  1F66 D;  4Z2M H;  3MGS D;  2FJ7 B;  3REJ A;  4Z66 B;  5DNM D;  1P34 D;  3W96 D;  3MGR D;  3KXB C;  1B6W A;  1M18 D;  4XZQ D;  2JSS A;  1P3G A;  4R8P C;  2FJ7 C;  3LZ0 B;  4XUJ B;  2L5A A;  5E5A A;  4Z66 C;  3AZK C;  3B0D B;  3TU4 C;  1TZY A;  3X1S D;  1PZR A;  3REH B;  4YS3 A;  1P3K A;  5DNN D;  3A6N A;  1T3U A;  3LEL A;  4JJN A;  1EQZ D;  5GT0 C;  3B0D C;  5AVC D;  3REH C;  1Z2C B;  5JRG A;  3UTB B;  1M19 A;  3B6F D;  4CAY B;  3LZ1 C;  3AZE C;  4E45 A;  1P3A B;  4KUD A;  5B40 C;  3NQJ B;  4WZS B;  3AZF D;  3X1V C;  3REJ D;  2JE5 A;  3AZM B;  4WJ3 C;  3WAA B;  1P3A C;  2F8N H;  5AV6 A;  4QLC A;  4AWL B;  1P3G D;  4ZUX A;  3C1C A;  2Y2G A;  4UPK A;  5E5A D;  3WAA C;  3AZM C;  1BH9 B;  4ZBJ C;  1TZY D;  4YS3 D;  3UT9 C;  1P3K D;  5GXQ A;  3KSY A;  1AOI A;  2F8N A;  3A6N D;  3NQU B;  5B31 B;  5B24 A;  3LEL D;  2ARO B;  4JJN D;  2Y2M A;  5CPJ B;  3C1B A;  2HIO C;  5GSU B;  2F8N K;  2DQN C;  1M19 D;  5JRG D;  1M1A B;  5BO0 B;  2LY8 A;  3B6G B;  3B6F C;  3AZJ C;  3MGP C;  3AZH B;  1KX3 B;  1A7W A;  5B31 C;  2ARO C;  5CPJ C;  4KUD D;  1B67 A;  5GSU C;  4HGA B;  3A1K A;  1P3O A;  2PYO C;  3UTA A;  5B0Y B;  5AY8 B;  3AV2 A;  3VH6 A;  5AV6 D;  4HGA C;  4QLC D;  4J8U B;  3X1T C;  4ZUX D;  3KUY A;  3C1C D;  1TAF B;  5AY8 C;  5B0Y C;  3KWQ A;  3W97 B;  1KU5 A;  1ID3 C;  5AV9 B;  5GXQ D;  1R4V A;  5B1L A;  4J8U C;  4Z5T A;  4X23 B;  3IP4 C;  2F8N D;  5B24 D;  3W97 C;  3P5J B;  3V9R A;  3C1B D;  1BH8 A;  5AV9 C;  3KXB A;  4X23 C;  4R8P A;  2FJ7 A;  3LJA C;  5B33 C;  3AZK A;  3TU4 A;  1P3O D;  4J8X B;  2XD5 A;  3UTA D;  5FUG A;  5CPI C;  1KX4 C;  4WU8 C;  3AV2 D;  4NE6 A;  2CWE A;  2NQB B;  4CSR B;  3MVD B;  5GT0 A;  1ULY A;  5BNV B;  3REH A;  4KGC B;  5CPK B;  4H9S C;  3LZ1 A;  3KUY D;  3WKJ B;  3AZE A;  2YFW A;  3KWQ D;  2NQB C;  3AZI B;  2RVQ D;  5B1M C;  5B1L D;  4Z5T D;  5B40 A;  4KGC C;  3X1V A;  3AZL B;  3AZI C;  5B2J B;  3REK B;  1P3A A;  3KXB D;  1P3M B;  3H0M C;  3NQJ A;  4R8P D;  2FJ7 D;  3W99 B;  3AL0 C;  3MNN B;  1N1J B;  2Y2Q A;  4Z66 D;  3AZK D;  3AZM A;  3TU4 D;  3WAA A;  2Y2I A;  3REK C;  3UT9 A;  5B31 G;  3W99 C;  4H9Q B;  3WA9 B;  5GT0 D;  2HIO A;  3REH D;  3B6F A;  3LZ1 D;  3AZJ A;  3AZE D;  2YFV B;  3MGP A;  4H9O B;  3NQU A;  5BT1 C;  5B31 A;  3AYW C;  1P3L B;  2ARO A;  2DF4 C;  5CPJ A;  3WA9 C;  5GSU A;  5B40 D;  2ZY5 A;  2PYO A;  3X1V D;  1ZLA B;  3EPJ A;  2Y2L A;  1P3A D;  4YM6 C;  3X1T A;  2VQR A;  4DRA A;  5B0Y A;  5AY8 A;  4G92 B;  3AZM D;  3WAA D;  3WTP B;  1ID3 A;  3UT9 D;  5F99 B;  4J8U A;  2Y2J A;  5KDM B;  3LZ0 C;  4XUJ C;  1TAF A;  3W97 A;  5JA4 B;  2HIO D;  5AV9 A;  1P3I B;  5F99 C;  3AZJ D;  1HQ3 B;  4X23 A;  3MGP D;  4H9P B;  3LJA A;  5B33 A;  5C3I B;  5B31 D;  5B32 G;  3AZN B;  2ARO D;  4G91 B;  5CPJ D;  5GSU D;  3UTB C;  1P3I C;  2PYO D;  1HQ3 C;  5CPI A;  1KX4 A;  4WU8 A;  3AZG B;  3AZN C;  3X1T D;  3X1U B;  4NFT A;  4H9S A;  3REI B;  5B0Y D;  5AY8 D;  2NQB A;  5CP6 B;  4CSR A;  4LD9 B;  4KHA B;  1ID3 D;  5B1M A;  3MGS B;  4J8U D;  4AWL C;  4J8V B;  5BNV A;  4KGC A;  3REI C;  3W97 D;  5DNM B;  3W96 B;  3AZI A;  3MGR B;  2BYK B;  5AV9 D;  4XZQ B;  1M18 B;  1H3O B;  4J8V C;  4X23 D;  3LJA D;  5B33 D;  3REK A;  1M1A C;  3B6G C;  3FDD A;  5CPI D;  3AZH C;  1KX3 C;  1KX4 D;  4WU8 D;  3MGQ B;  4H9R A;  3W99 A;  3EPH A;  2IO5 B;  4H9N A;  2J8P A;  2NQB D;  3MGQ C;  2Y2H A;  5AV5 B;  2IO5 C;  3AYW A;  4H9Q A;  5B1M D;  5B0Z B;  3WA9 A;  2Y2P A;  3REJ B;  4KGC D;  5AVB B;  3AZI D;  5AV5 C;  4H9O A;  4UUZ B;  5B0Z C;  1U35 B;  1P3G B;  1P3F B;  4YM6 A;  5AVB C;  4Z66 A;  3REL B;  5B32 B;  3REK D;  1U35 C;  2W8S A;  2G5H C;  1P3F C;  1WWI A;  3A6N B;  2NZD B;  2F2A C;  3W99 D;  3LZ0 A;  4XUJ A;  1M19 B;  5JRG B;  3REL C;  5B32 C;  3VH5 T;  4J8X C;  5F99 A;  1KX5 B;  2NZD C;  3MVD C;  3VH5 W;  5BT1 D;  3AYW D;  3AN2 B;  2G5I C;  5JA4 A;  3WA9 D;  3O62 B;  5G49 B;  5CPK C;  3UTB A;  1P3I A;  3WKJ C;  4CAY A;  1KX5 C;  1HQ3 A;  5AV6 B;  3H0R C;  4QLC B;  4WU9 B;  3AZN A;  3AN2 C;  4WNN B;  4ZUX B;  3O62 C;  4YM6 D;  3C1C B;  4NE5 A;  3AZL C;  5B2J C;  4WU9 C;  1P3M C;  1AOI B;  2F8N B;  3AFA B;  5B24 B;  3MNN C;  3REI A;  3LZ0 D;  4XUJ D;  4J8W B;  3H0L C;  1BH9 A;  2Y2O A;  4KHA A;  2CV5 B;  5BS7 C;  5F99 D;  1AOI C;  3AFA C;  4J8V A;  4DRB A;  4J8W C;  2CV5 C;  1M1A A;  5BO0 A;  3UTB D;  1P3I D;  3AV2 B;  3B6G A;  5BNX B;  1H3O A;  1HQ3 D;  4NE3 A;  3AZH A;  1KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...