3C1CD

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cD00
5BO0A 2NZDD 1P3GD 3MGRC 4Z66D 1HTAA 1P3LC 2F8NA 4YM6C 5CPIB 2AROC 4J8XC 5CPID 1U35A 1KX5C 4YS3B 1M18C 5AVBC 4J8WA 4WZSB 3KUYB 5F99A 5B0ZB 2NQBD 3UT9B 1P3OA 1TZYC 3REHC 3AZIB 1AOIB 4YS3D 3TU4B 3KUYD 3AFAA 5B0ZD 1P3BC 3UT9D 1M1AB 3AZID 5B31A 1AOID 3TU4D 1M1AD 4J8VA 3W99B 5GT3D 4KGCC 5AV6C 5B32C 5AV9C 3C1CC 3W99D 4Z66A 3MGRB 1P3LB 4YM6B 3AN2C 4LD9B 5BNXB 5CPIA 2YFWB 1P3KB 1P3LD 4YM6D 3AV1C 4H9QA 4LD9D 1KX5B 1M18B 5AV8C 4YS3A 1P3KD 1P3FB 3AZLC 1TZYB 3KUYA 1HQ3C 5B0ZA 3UT9A 4KUDC 1M18D 3WTPE 1AOIA 3TU4A 1P3FD 1TZYD 3A6NC 3B0CW 1M1AA 4WV4B 4WU8C 3AZEC 5AV6B 5AV9B 5KDMB 5AV6D 3X1VB 2BYMA 2RVQD 1P3IC 3B0DC 5AV9D 3AZJB 3MGSC 3MGRA 5GXQC 1P3LA 4YM6A 3X1VD 5GT0B 2AROA 3AZGC 4J8XA 5BNXA 3AZJD 3AV1B 2YFWA 1P3AB 4XZQC 5GT0D 1KX5A 5B1LB 4H9SC 1M18A 3AZLB 3AV1D 1P3AD 1P34B 1TZYA 5B1LD 3LZ1C 1P3BA 2PYOC 1P34D 3VH5W 3AZKC 4NFTA 3WTPB 4WU8B 3B0CT 4KGCA 5AY8B 5AV6A 3AZMB 3WTPD 5AV9A 4WU8D 5B33B 5KDMA 3B0DB 5AY8D 3LJAC 3AZMD 3X1VA 4R8PB 1U35C 3AZJA 5GXQB 4J8WC 5B33D 5F99C 2BYKA 3AZGB 1P3OC 4R8PD 4WU9D 4XZQB 3AV1A 4H9RB 1P3AA 3AZGD 5B1LA 1A7WA 4XZQD 3MGQC 3AZLA 4KUDA 1HQ3A 4DRAA 3RELC 4WNNA 5CPKC 4KHAB 2NZDC 1P3GC 3UTBC 1BFMA 4Z66C 3C1BB 3AZNB 4WU8A 4AWLB 3AZEA 3VH5T 3C1BD 4H9PA 5AY8A 3AZND 1ID3B 3NQJB 5BT1D 5B33A 2NQBC 1EQZB 1ID3D 4R8PA 4ZBJC 5GXQA 3KUYC 5B0ZC 3UT9C 3AZGA 3AZIC 1EQZD 1AOIC 3TU4C 4XZQA 5AVCC 1M1AC 4H9RA 4H9SA 5GT3C 3MGQB 5GSUB 3AZFB 4EO5C 2HUEB 3RELB 4NE6A 1B6WA 3LZ0C 1WWSA 5CPKB 5C3IB 3W99C 2PYOA 5GSUD 4KHAA 3AZFD 3UTBB 3AZKA 5CPKD 3C1BA 3X1TC 3MVDB 5JRGC 3UTBD 4LD9C 1N1JB 3MGPD 3KWQB 2NQBB 1ID3A 3MVDD 2F8NK 3NQJA 1P3KC 3LJAA 3KWQD 4ZBJB 3LELB 1EQZA 1P3FC 3VH5A 5DNMD 2FJ7B 5DNNB 3LELD 5B1MB 1BH9B 5AVCB 4X23C 3B6FB 2IO5C 2FJ7D 5GT3B 5DNND 4EO5B 3MGQA 5B1MD 5AVCD 3B6FD 3LZ0B 5GSUA 3AZFA 3RELA 5CPKA 2RVQC 2NZDA 3LZ0D 1P3GA 1KX3B 3UTBA 3W98D 4J8UC 3X1TB 3X1VC 3AZJC 5JRGB 1KX3D 1KU5A 1TAFB 3X1TD 5GT0C 3R45B 5B24C 5JRGD 2NQBA 1P3AC 3VH6A 1JFIB 5B1LC 3O62B 3LELA 1H3OB 1P34C 3W96B 3AZIA 2JSSA 4X23B 2IO5B 1Q9CA 1WWIA 3O62D 5B1MA 1BH9A 4ZUXC 5AVCA 3W96D 5GT3A 3AV2B 4X23D 3WTPC 5G49B 3LZ0A 3W99A 5AV5B 3AV2D 5AY8C 3AZMC 5B33C 4J8UB 1KX3A 5AV5D 3X1TA 4R8PC 4WU9C 5JRGA 4J8UD 4LD9A 3MNNB 3REKC 5B24B 1TAFA 1F1EA 3R45A 1P3KA 3MNND 5B24D 1P3FA 5CHLB 1H3OA 3W96A 1ULYA 4ZUXB 4X23A 3W97B 5CP6D 3C1BC 3X1UB 4ZUXD 3AZNC 3AV2A 5G49A 3W97D 4AWLC 5BT1C 3AYWC 5AV5A 3X1UD 1ID3C 5B2IC 4J8UA 3V9RB 3WA9C 4WU9B 1EQZC 3REKB 5GT0A 3MNNA 5B24A 3REJB 3REKD 5B2JB 3REJD 5GSUC 3AZFC 2HUEC 5B2JD 3VH6W 1P34A 5C3IC 1KX4B 4XUJB 4ZUXA 3MGPC 3WTPA 3KXBB 4XUJD 3X1UA 3REIB 1KX4D 3AYWB 3MVDC 5B40B 3AZMA 3KWQC 4CSRB 3KXBD 3REID 5BNVB 5B2IB 3AYWD 3WA9B 5B40D 3V9RA 5DNMC 4WU9A 4QLCB 5B2ID 3LELC 3WA9D 3REKA 3AZHB 2FJ7C 5DNNC 4Z5TB 4QLCD 5B1MC 3B6FC 3AZHD 5B2JA 4Z5TD 3B6GB 5BO0B 3W98C 2F8NB 3B6GD 3B0BA 1KX3C 3VH6T 3MGPB 2F8ND 3AZNA 4HGAB 3KXBA 3AYWA 5B40A 4CSRA 5B0YC 5B2IA 3X1SB 5DNMB 3WA9A 1ZLAB 5B31B 3O62C 3X1SD 3AFAD 1ZLAD 3W96C 5B31D 4E45A 3WAAC 5CPJB 3AV2C 3W98B 2F8NH 1S32B 5CPJD 5AV5C 1S32D 4H9QB 3MGPA 3UTAB 3WKJC 3MVDA 1N1JA 3UTAD 3MNNC 3KWQA 5B0YB 5BS7C 3X1SA 4UUZB 5DNMA 1ZLAA 5B0YD 4JJNB 4NE5A 5CP6C 2CV5B 5DNNA 2FJ7A 1B67A 1P3MB 1M19C 3B6FA 4JJND 3W97C 3WAAB 2YFVB 2CV5D 2BYMB 1P3MD 5CPJA 3X1UC 3WAAD 4DRBA 3W98A 1S32A 2AROB 4J8XB 3NQUB 3MGRD 2HIOC 3WKJB 4G91C 3UTAA 2AROD 4J8XD 4Z2MG 5AVBB 4NE3A 3WKJD 3REHB 1KX5D 3REJC 5B0YA 4E44A 5AVBD 1P3BB 5FUGB 5B2JC 1JFIA 4UUZA 3REHD 4CAYB 3O62A 5CP6B 1P3BD 4JJNA 2LY8A 2CV5A 5B32G 1M19B 4KGCB 1P3MA 5B32B 4G92C 4XUJC 1KX4C 3C1CB 3WAAA 2YFVA 1M19D 4KGCD 5B32D 3KXBC 3REIC 3C1CD 3AN2B 5B40C 2BYKB 2HIOB 4G91B 5E5AC 3AN2D 3NQUA 3WKJA 5AV8B 1BH8B 4Z2MH 4H9NB 2HIOD 4QLCC 5AVBA 4KUDB 1HQ3B 3AZHC 4WNNB 5BS7A 5AV8D 3REHA 4Z5TC 3AZLD 1P3PC 5FUGA 1HQ3D 3A6NB 1F66C 4KUDD 1R4VA 4CAYA 3B6GC 3AZEB 5CP6A 3A6ND 4G92B 1M19A 4H9PB 5B32A 3W97A 3AZED 3C1CA 1P3IB 4HGAC 3MGSB 3AN2A 1P3ID 5E5AB 3MGSD 5GXQD 2HIOA 3X1SC 3AFAC 1ZLAC 5B31C 5AV8A 1BH8A 5E5AD 4H9NA 2CWEA 4J8VC 3REJA 3LZ1B 5JA4B 1P3PB 2PYOB 4H9OB 1F66B 3AZKB 3A6NA 5CPJC 3LZ1D 2L5AA 1P3PD 2PYOD 1F66D 2F8NG 3AZKD 1S32C 3KSYA 1KX4A 4XUJA 5CPIC 4M6BA 3LJAB 3UTAC 1U35B 1P3IA 3REIA 4J8WB 5F99B 4YS3C 3MGSA 1P3OB 3LJAD 1U35D 5BNVA 4J8WD 5F99D 5E5AA 3AFAB 5B31G 1P3OD 4QLCA 4JJNC 4J8VB 3AZHA 2CV5C 4Z5TA 1P3MC 3LZ1A 5JA4A 3MGQD 1P3PA 4J8VD 4H9OA 1P3GB 1F66A 2NZDB 4Z66B 3RELD 3B6GA
chains in the Genus database with same CATH superfamily
5BO0A 2DF4C 2NZDD 1P3GD 3MGRC 4Z66D 1HTAA 1P3LC 2F8NA 4YM6C 5CPIB 2AROC 4J8XC 5CPID 1U35A 1KX5C 4YS3B 1M18C 5AVBC 4J8WA 4WZSB 3KUYB 5F99A 5B0ZB 2NQBD 3UT9B 1P3OA 1TZYC 3REHC 3AZIB 1AOIB 4YS3D 3TU4B 3KUYD 3AFAA 5B0ZD 1P3BC 3UT9D 1M1AB 3AZID 5B31A 1AOID 3TU4D 1M1AD 4J8VA 3W99B 5GT3D 4KGCC 5AV6C 5B32C 5AV9C 3C1CC 3W99D 4Z66A 3MGRB 2Y2LA 2BG1A 4YM6B 3AN2C 1P3LB 4LD9B 5BNXB 5CPIA 2YFWB 1P3KB 1P3LD 4YM6D 3AV1C 4H9QA 4LD9D 1KX5B 1M18B 5AV8C 4YS3A 1P3KD 1P3FB 3AZLC 1TZYB 3KUYA 1HQ3C 5B0ZA 3UT9A 4KUDC 3IP4C 1M18D 2Y2JA 3WTPE 3AL0C 1AOIA 3TU4A 1P3FD 1TZYD 3A6NC 3B0CW 1M1AA 4WV4B 4WU8C 3AZEC 5AV6B 5AV9B 5KDMB 5AV6D 3X1VB 2BYMA 2RVQD 1P3IC 3B0DC 5AV9D 3AZJB 3MGSC 3MGRA 2XD5A 5GXQC 1P3LA 4YM6A 3X1VD 5GT0B 2AROA 3AZGC 4J8XA 5BNXA 3AZJD 3AV1B 2YFWA 1P3AB 4XZQC 5GT0D 1KX5A 5B1LB 4H9SC 1M18A 3AZLB 3AV1D 1P3AD 1P34B 1TZYA 5B1LD 3LZ1C 1P3BA 2PYOC 1P34D 4UPKA 3VH5W 3AZKC 4NFTA 3FDDA 3WTPB 2FFFB 4WU8B 2Y2IA 3B0CT 4KGCA 5AY8B 5AV6A 3AZMB 3WTPD 5AV9A 4WU8D 5B33B 5KDMA 3B0DB 3H0LC 5AY8D 3LJAC 3AZMD 3X1VA 4R8PB 1U35C 3AZJA 5GXQB 4J8WC 5B33D 5F99C 2BYKA 3AZGB 1P3OC 4R8PD 4WU9D 1PZRA 4XZQB 3AV1A 4H9RB 1P3AA 3AZGD 5B1LA 1A7WA 4XZQD 3MGQC 3AZLA 4KUDA 1HQ3A 4DRAA 3RELC 4WNNA 5CPKC 2ZY2A 4KHAB 2NZDC 1P3GC 3UTBC 1BFMA 4Z66C 3C1BB 3AZNB 4WU8A 4AWLB 3AZEA 3VH5T 3C1BD 4H9PA 5AY8A 3AZND 1ID3B 3NQJB 5BT1D 5B33A 2NQBC 3EPHA 1EQZB 1ID3D 4R8PA 4ZBJC 5GXQA 3KUYC 3A1IA 5B0ZC 3UT9C 3AZGA 3AZIC 1EQZD 1AOIC 3TU4C 4XZQA 5AVCC 1M1AC 4H9RA 4H9SA 2J8PA 5GT3C 3MGQB 5GSUB 3AZFB 4EO5C 2HUEB 3RELB 4NE6A 1B6WA 3LZ0C 1WWSA 5CPKB 5C3IB 3W99C 2PYOA 2ZY3A 5GSUD 4KHAA 3AZFD 3UTBB 3EPJA 3AZKA 5CPKD 3C1BA 3X1TC 3MVDB 5JRGC 3UTBD 4LD9C 1N1JB 2F2AC 3MGPD 3KWQB 2NQBB 1ID3A 3MVDD 2F8NK 3NQJA 1P3KC 3LJAA 3KWQD 4ZBJB 2VQRA 3LELB 1EQZA 1P3FC 3VH5A 5DNMD 2FJ7B 5DNNB 3EG5B 3H0MC 3LELD 5B1MB 1BH9B 5AVCB 4X23C 3H0RC 2IO5C 3B6FB 1T3UA 2FJ7D 5GT3B 5DNND 4EO5B 3MGQA 5B1MD 5AVCD 3B6FD 3LZ0B 5GSUA 3AZFA 3RELA 5CPKA 2RVQC 2NZDA 3LZ0D 1P3GA 1KX3B 3UTBA 3W98D 4J8UC 3X1TB 3X1VC 3AZJC 5JRGB 1KX3D 1KU5A 1TAFB 3X1TD 5GT0C 3R45B 5B24C 5JRGD 2NQBA 1P3AC 2W8SA 3VH6A 1JFIB 5B1LC 3O62B 2G5IC 3LELA 1H3OB 2Y2HA 1P34C 3W96B 3AZIA 2JSSA 4X23B 2IO5B 1Q9CA 1WWIA 3O62D 5B1MA 1BH9A 4ZUXC 5AVCA 3W96D 5GT3A 3AV2B 4X23D 3WTPC 5G49B 3LZ0A 3W99A 5AV5B 3AV2D 5AY8C 3AZMC 5B33C 4J8UB 1KX3A 5AV5D 3X1TA 4R8PC 4WU9C 5JRGA 4J8UD 4LD9A 3MNNB 3REKC 5B24B 1TAFA 1F1EA 3R45A 1P3KA 2XD1A 3MNND 5B24D 2ZM5A 1P3FA 5CHLB 1H3OA 3W96A 2Y2NA 1ULYA 4ZUXB 4X23A 3W97B 5CP6D 3C1BC 3X1UB 4ZUXD 3AZNC 3AV2A 5G49A 3W97D 4AWLC 5BT1C 3AYWC 5AV5A 3X1UD 1ID3C 2ZY5A 5B2IC 4J8UA 3V9RB 3WA9C 4WU9B 1EQZC 3REKB 2Y2OA 5GT0A 3MNNA 5B24A 3REJB 2JCHA 2UWXA 3REKD 5B2JB 2Y2GA 3REJD 5GSUC 3AZFC 2HUEC 5B2JD 3VH6W 1P34A 5C3IC 1KX4B 4XUJB 4ZUXA 3MGPC 3WTPA 3KXBB 4XUJD 3X1UA 3REIB 1KX4D 3AYWB 3MVDC 5B40B 3AZMA 3KWQC 4CSRB 3KXBD 3REID 5BNVB 5B2IB 3AYWD 3WA9B 5B40D 3V9RA 5DNMC 4WU9A 4QLCB 5B2ID 3LELC 3WA9D 3REKA 3AZHB 3EPKA 2FJ7C 5DNNC 4Z5TB 4QLCD 5B1MC 3B6FC 3AZHD 5B2JA 3F6TA 4Z5TD 3B6GB 5BO0B 3P5JB 3W98C 2F8NB 3B6GD 3B0BA 1KX3C 3VH6T 3MGPB 2F8ND 3AZNA 4HGAB 3KXBA 3AYWA 5B40A 4CSRA 5B0YC 5B2IA 3X1SB 5DNMB 1Z2CB 3WA9A 1ZLAB 5B31B 3O62C 3X1SD 3AFAD 1ZLAD 3W96C 5B31D 4E45A 3WAAC 5CPJB 3AV2C 3W98B 2F8NH 1S32B 2ZY4A 5CPJD 5AV5C 1S32D 4H9QB 3MGPA 3UTAB 3WKJC 3MVDA 1N1JA 3UTAD 3MNNC 3KWQA 5B0YB 5BS7C 3X1SA 4UUZB 5DNMA 1ZLAA 5B0YD 4JJNB 4NE5A 5CP6C 2CV5B 5DNNA 2FJ7A 1B67A 1P3MB 1M19C 3B6FA 4JJND 3W97C 3A1KA 2YFVB 3WAAB 2CV5D 2BYMB 1P3MD 5CPJA 3X1UC 1W2EA 3WAAD 4DRBA 3W98A 1S32A 3KFUG 2AROB 4J8XB 3NQUB 3MGRD 2HIOC 3WKJB 4WJ3C 4G91C 3UTAA 2AROD 4J8XD 4DQYB 4Z2MG 5AVBB 4NE3A 3WKJD 3REHB 2Y2QA 1KX5D 3REJC 5B0YA 4E44A 5AVBD 1P3BB 5FUGB 5B2JC 1JFIA 4UUZA 3REHD 4CAYB 3O62A 5CP6B 1P3BD 4JJNA 2LY8A 2Y2KA 2CV5A 5B32G 1M19B 4KGCB 1P3MA 5B32B 4G92C 4XUJC 1KX4C 3C1CB 3WAAA 2YFVA 1M19D 4KGCD 5B32D 3KXBC 3REIC 3C1CD 3AN2B 5B40C 2BYKB 2HIOB 4G91B 5E5AC 3AN2D 3NQUA 3WKJA 2JE5A 5AV8B 1BH8B 4Z2MH 4H9NB 2HIOD 4QLCC 5AVBA 4KUDB 1HQ3B 3AZHC 5BS7A 4WNNB 5AV8D 3REHA 4Z5TC 3AZLD 1P3PC 5FUGA 1HQ3D 3A6NB 1F66C 4KUDD 1R4VA 4CAYA 3B6GC 3AZEB 5CP6A 3A6ND 4G92B 1M19A 4H9PB 5B32A 3W97A 2Y2PA 3AZED 3C1CA 1P3IB 4HGAC 3MGSB 3AN2A 1P3ID 2DQNC 5E5AB 3MGSD 5GXQD 2HIOA 3X1SC 3AFAC 1ZLAC 5B31C 5AV8A 1BH8A 5E5AD 4H9NA 2CWEA 4J8VC 3REJA 3LZ1B 5JA4B 1P3PB 2PYOB 4H9OB 1F66B 3AZKB 3A6NA 5CPJC 3LZ1D 2L5AA 1P3PD 2PYOD 1F66D 2F8NG 3AZKD 1S32C 3KSYA 1KX4A 4XUJA 5CPIC 4M6BA 3LJAB 3UTAC 3EPLA 1U35B 1P3IA 2Y2MA 3REIA 4J8WB 5F99B 4YS3C 3MGSA 1P3OB 3LJAD 1U35D 5BNVA 4J8WD 5F99D 5E5AA 3AFAB 5B31G 1P3OD 4QLCA 4JJNC 4J8VB 3AZHA 2CV5C 4Z5TA 1P3MC 3LZ1A 5JA4A 2G5HC 3MGQD 1P3PA 4J8VD 2RIQA 4H9OA 1P3GB 1F66A 2NZDB 4Z66B 3RELD 3B6GA
chains in the Genus database with same CATH topology
5BO0A 2DF4C 2NZDD 1P3GD 3MGRC 4Z66D 1HTAA 1P3LC 2F8NA 4YM6C 5CPIB 2AROC 4J8XC 5CPID 1U35A 1KX5C 4YS3B 1M18C 5AVBC 4J8WA 4WZSB 3KUYB 5F99A 5B0ZB 2NQBD 3UT9B 1P3OA 1TZYC 3REHC 3AZIB 1AOIB 4YS3D 3TU4B 3KUYD 3AFAA 5B0ZD 1P3BC 3UT9D 1M1AB 3AZID 5B31A 1AOID 3TU4D 1M1AD 4J8VA 3W99B 5GT3D 4KGCC 5AV6C 5B32C 5AV9C 3C1CC 3W99D 4Z66A 3MGRB 2Y2LA 2BG1A 4YM6B 3AN2C 1P3LB 4LD9B 5BNXB 5CPIA 2YFWB 1P3KB 1P3LD 4YM6D 3AV1C 4H9QA 4LD9D 1KX5B 1M18B 5AV8C 4YS3A 1P3KD 1P3FB 3AZLC 1TZYB 3KUYA 1HQ3C 5B0ZA 3UT9A 4KUDC 3IP4C 1M18D 2Y2JA 3WTPE 3AL0C 1AOIA 3TU4A 1P3FD 1TZYD 3A6NC 3B0CW 1M1AA 4WV4B 4WU8C 3AZEC 5AV6B 5AV9B 5KDMB 5AV6D 3X1VB 2BYMA 2RVQD 1P3IC 3B0DC 5AV9D 3AZJB 3MGSC 3MGRA 2XD5A 5GXQC 1P3LA 4YM6A 3X1VD 5GT0B 2AROA 3AZGC 4J8XA 5BNXA 3AZJD 3AV1B 2YFWA 1P3AB 4XZQC 5GT0D 1KX5A 5B1LB 4H9SC 1M18A 3AZLB 3AV1D 1P3AD 1P34B 1TZYA 5B1LD 3LZ1C 1P3BA 2PYOC 1P34D 4UPKA 3VH5W 3AZKC 4NFTA 3FDDA 3WTPB 2FFFB 4WU8B 2Y2IA 3B0CT 4KGCA 5AY8B 5AV6A 3AZMB 3WTPD 5AV9A 4WU8D 5B33B 5KDMA 3B0DB 3H0LC 5AY8D 3LJAC 3AZMD 3X1VA 4R8PB 1U35C 3AZJA 5GXQB 4J8WC 5B33D 5F99C 2BYKA 3AZGB 1P3OC 4R8PD 4WU9D 1PZRA 4XZQB 3AV1A 4H9RB 1P3AA 3AZGD 5B1LA 1A7WA 4XZQD 3MGQC 3AZLA 4KUDA 1HQ3A 4DRAA 3RELC 4WNNA 5CPKC 2ZY2A 4KHAB 2NZDC 1P3GC 3UTBC 1BFMA 4Z66C 3C1BB 3AZNB 4WU8A 4AWLB 3AZEA 3VH5T 3C1BD 4H9PA 5AY8A 3AZND 1ID3B 3NQJB 5BT1D 5B33A 2NQBC 3EPHA 1EQZB 1ID3D 4R8PA 4ZBJC 5GXQA 3KUYC 3A1IA 5B0ZC 3UT9C 3AZGA 3AZIC 1EQZD 1AOIC 3TU4C 4XZQA 5AVCC 1M1AC 4H9RA 4H9SA 2J8PA 5GT3C 3MGQB 5GSUB 3AZFB 4EO5C 2HUEB 3RELB 4NE6A 1B6WA 3LZ0C 1WWSA 5CPKB 5C3IB 3W99C 2PYOA 2ZY3A 5GSUD 4KHAA 3AZFD 3UTBB 3EPJA 3AZKA 5CPKD 3C1BA 3X1TC 3MVDB 5JRGC 3UTBD 4LD9C 1N1JB 2F2AC 3MGPD 3KWQB 2NQBB 1ID3A 3MVDD 2F8NK 3NQJA 1P3KC 3LJAA 3KWQD 4ZBJB 2VQRA 3LELB 1EQZA 1P3FC 3VH5A 5DNMD 2FJ7B 5DNNB 3EG5B 3H0MC 3LELD 5B1MB 1BH9B 5AVCB 4X23C 3H0RC 2IO5C 3B6FB 1T3UA 2FJ7D 5GT3B 5DNND 4EO5B 3MGQA 5B1MD 5AVCD 3B6FD 3LZ0B 5GSUA 3AZFA 3RELA 5CPKA 2RVQC 2NZDA 3LZ0D 1P3GA 1KX3B 3UTBA 3W98D 4J8UC 3X1TB 3X1VC 3AZJC 5JRGB 1KX3D 1KU5A 1TAFB 3X1TD 5GT0C 3R45B 5B24C 5JRGD 2NQBA 1P3AC 2W8SA 3VH6A 1JFIB 5B1LC 3O62B 2G5IC 3LELA 1H3OB 2Y2HA 1P34C 3W96B 3AZIA 2JSSA 4X23B 2IO5B 1Q9CA 1WWIA 3O62D 5B1MA 1BH9A 4ZUXC 5AVCA 3W96D 5GT3A 3AV2B 4X23D 3WTPC 5G49B 3LZ0A 3W99A 5AV5B 3AV2D 5AY8C 3AZMC 5B33C 4J8UB 1KX3A 5AV5D 3X1TA 4R8PC 4WU9C 5JRGA 4J8UD 4LD9A 3MNNB 3REKC 5B24B 1TAFA 1F1EA 3R45A 1P3KA 2XD1A 3MNND 5B24D 2ZM5A 1P3FA 5CHLB 1H3OA 3W96A 2Y2NA 1ULYA 4ZUXB 4X23A 3W97B 5CP6D 3C1BC 3X1UB 4ZUXD 3AZNC 3AV2A 5G49A 3W97D 4AWLC 5BT1C 3AYWC 5AV5A 3X1UD 1ID3C 2ZY5A 5B2IC 4J8UA 3V9RB 3WA9C 4WU9B 1EQZC 3REKB 2Y2OA 5GT0A 3MNNA 5B24A 3REJB 2JCHA 2UWXA 3REKD 5B2JB 2Y2GA 3REJD 5GSUC 3AZFC 2HUEC 5B2JD 3VH6W 1P34A 5C3IC 1KX4B 4XUJB 4ZUXA 3MGPC 3WTPA 3KXBB 4XUJD 3X1UA 3REIB 1KX4D 3AYWB 3MVDC 5B40B 3AZMA 3KWQC 4CSRB 3KXBD 3REID 5BNVB 5B2IB 3AYWD 3WA9B 5B40D 3V9RA 5DNMC 4WU9A 4QLCB 5B2ID 3LELC 3WA9D 3REKA 3AZHB 3EPKA 2FJ7C 5DNNC 4Z5TB 4QLCD 5B1MC 3B6FC 3AZHD 5B2JA 3F6TA 4Z5TD 3B6GB 5BO0B 3P5JB 3W98C 2F8NB 3B6GD 3B0BA 1KX3C 3VH6T 3MGPB 2F8ND 3AZNA 4HGAB 3KXBA 3AYWA 5B40A 4CSRA 5B0YC 5B2IA 3X1SB 5DNMB 1Z2CB 3WA9A 1ZLAB 5B31B 3O62C 3X1SD 3AFAD 1ZLAD 3W96C 5B31D 4E45A 3WAAC 5CPJB 3AV2C 3W98B 2F8NH 1S32B 2ZY4A 5CPJD 5AV5C 1S32D 4H9QB 3MGPA 3UTAB 3WKJC 3MVDA 1N1JA 3UTAD 3MNNC 3KWQA 5B0YB 5BS7C 3X1SA 4UUZB 5DNMA 1ZLAA 5B0YD 4JJNB 4NE5A 5CP6C 2CV5B 5DNNA 2FJ7A 1B67A 1P3MB 1M19C 3B6FA 4JJND 3W97C 3A1KA 2YFVB 3WAAB 2CV5D 2BYMB 1P3MD 5CPJA 3X1UC 1W2EA 3WAAD 4DRBA 3W98A 1S32A 3KFUG 2AROB 4J8XB 3NQUB 3MGRD 2HIOC 3WKJB 4WJ3C 4G91C 3UTAA 2AROD 4J8XD 4DQYB 4Z2MG 5AVBB 4NE3A 3WKJD 3REHB 2Y2QA 1KX5D 3REJC 5B0YA 4E44A 5AVBD 1P3BB 5FUGB 5B2JC 1JFIA 4UUZA 3REHD 4CAYB 3O62A 5CP6B 1P3BD 4JJNA 2LY8A 2Y2KA 2CV5A 5B32G 1M19B 4KGCB 1P3MA 5B32B 4G92C 4XUJC 1KX4C 3C1CB 3WAAA 2YFVA 1M19D 4KGCD 5B32D 3KXBC 3REIC 3C1CD 3AN2B 5B40C 2BYKB 2HIOB 4G91B 5E5AC 3AN2D 3NQUA 3WKJA 2JE5A 5AV8B 1BH8B 4Z2MH 4H9NB 2HIOD 4QLCC 5AVBA 4KUDB 1HQ3B 3AZHC 5BS7A 4WNNB 5AV8D 3REHA 4Z5TC 3AZLD 1P3PC 5FUGA 1HQ3D 3A6NB 1F66C 4KUDD 1R4VA 4CAYA 3B6GC 3AZEB 5CP6A 3A6ND 4G92B 1M19A 4H9PB 5B32A 3W97A 2Y2PA 3AZED 3C1CA 1P3IB 4HGAC 3MGSB 3AN2A 1P3ID 2DQNC 5E5AB 3MGSD 5GXQD 2HIOA 3X1SC 3AFAC 1ZLAC 5B31C 5AV8A 1BH8A 5E5AD 4H9NA 2CWEA 4J8VC 3REJA 3LZ1B 5JA4B 1P3PB 2PYOB 4H9OB 1F66B 3AZKB 3A6NA 5CPJC 3LZ1D 2L5AA 1P3PD 2PYOD 1F66D 2F8NG 3AZKD 1S32C 3KSYA 1KX4A 4XUJA 5CPIC 4M6BA 3LJAB 3UTAC 3EPLA 1U35B 1P3IA 2Y2MA 3REIA 4J8WB 5F99B 4YS3C 3MGSA 1P3OB 3LJAD 1U35D 5BNVA 4J8WD 5F99D 5E5AA 3AFAB 5B31G 1P3OD 4QLCA 4JJNC 4J8VB 3AZHA 2CV5C 4Z5TA 1P3MC 3LZ1A 5JA4A 2G5HC 3MGQD 1P3PA 4J8VD 2RIQA 4H9OA 1P3GB 1F66A 2NZDB 4Z66B 3RELD 3B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BO0 A;  2NZD D;  1P3G D;  3MGR C;  4Z66 D;  1HTA A;  1P3L C;  2F8N A;  4YM6 C;  5CPI B;  2ARO C;  4J8X C;  5CPI D;  1U35 A;  1KX5 C;  4YS3 B;  1M18 C;  5AVB C;  4J8W A;  4WZS B;  3KUY B;  5F99 A;  5B0Z B;  2NQB D;  3UT9 B;  1P3O A;  1TZY C;  3REH C;  3AZI B;  1AOI B;  4YS3 D;  3TU4 B;  3KUY D;  3AFA A;  5B0Z D;  1P3B C;  3UT9 D;  1M1A B;  3AZI D;  5B31 A;  1AOI D;  3TU4 D;  1M1A D;  4J8V A;  3W99 B;  5GT3 D;  4KGC C;  5AV6 C;  5B32 C;  5AV9 C;  3C1C C;  3W99 D;  4Z66 A;  3MGR B;  1P3L B;  4YM6 B;  3AN2 C;  4LD9 B;  5BNX B;  5CPI A;  2YFW B;  1P3K B;  1P3L D;  4YM6 D;  3AV1 C;  4H9Q A;  4LD9 D;  1KX5 B;  1M18 B;  5AV8 C;  4YS3 A;  1P3K D;  1P3F B;  3AZL C;  1TZY B;  3KUY A;  1HQ3 C;  5B0Z A;  3UT9 A;  4KUD C;  1M18 D;  3WTP E;  1AOI A;  3TU4 A;  1P3F D;  1TZY D;  3A6N C;  3B0C W;  1M1A A;  4WV4 B;  4WU8 C;  3AZE C;  5AV6 B;  5AV9 B;  5KDM B;  5AV6 D;  3X1V B;  2BYM A;  2RVQ D;  1P3I C;  3B0D C;  5AV9 D;  3AZJ B;  3MGS C;  3MGR A;  5GXQ C;  1P3L A;  4YM6 A;  3X1V D;  5GT0 B;  2ARO A;  3AZG C;  4J8X A;  5BNX A;  3AZJ D;  3AV1 B;  2YFW A;  1P3A B;  4XZQ C;  5GT0 D;  1KX5 A;  5B1L B;  4H9S C;  1M18 A;  3AZL B;  3AV1 D;  1P3A D;  1P34 B;  1TZY A;  5B1L D;  3LZ1 C;  1P3B A;  2PYO C;  1P34 D;  3VH5 W;  3AZK C;  4NFT A;  3WTP B;  4WU8 B;  3B0C T;  4KGC A;  5AY8 B;  5AV6 A;  3AZM B;  3WTP D;  5AV9 A;  4WU8 D;  5B33 B;  5KDM A;  3B0D B;  5AY8 D;  3LJA C;  3AZM D;  3X1V A;  4R8P B;  1U35 C;  3AZJ A;  5GXQ B;  4J8W C;  5B33 D;  5F99 C;  2BYK A;  3AZG B;  1P3O C;  4R8P D;  4WU9 D;  4XZQ B;  3AV1 A;  4H9R B;  1P3A A;  3AZG D;  5B1L A;  1A7W A;  4XZQ D;  3MGQ C;  3AZL A;  4KUD A;  1HQ3 A;  4DRA A;  3REL C;  4WNN A;  5CPK C;  4KHA B;  2NZD C;  1P3G C;  3UTB C;  1BFM A;  4Z66 C;  3C1B B;  3AZN B;  4WU8 A;  4AWL B;  3AZE A;  3VH5 T;  3C1B D;  4H9P A;  5AY8 A;  3AZN D;  1ID3 B;  3NQJ B;  5BT1 D;  5B33 A;  2NQB C;  1EQZ B;  1ID3 D;  4R8P A;  4ZBJ C;  5GXQ A;  3KUY C;  5B0Z C;  3UT9 C;  3AZG A;  3AZI C;  1EQZ D;  1AOI C;  3TU4 C;  4XZQ A;  5AVC C;  1M1A C;  4H9R A;  4H9S A;  5GT3 C;  3MGQ B;  5GSU B;  3AZF B;  4EO5 C;  2HUE B;  3REL B;  4NE6 A;  1B6W A;  3LZ0 C;  1WWS A;  5CPK B;  5C3I B;  3W99 C;  2PYO A;  5GSU D;  4KHA A;  3AZF D;  3UTB B;  3AZK A;  5CPK D;  3C1B A;  3X1T C;  3MVD B;  5JRG C;  3UTB D;  4LD9 C;  1N1J B;  3MGP D;  3KWQ B;  2NQB B;  1ID3 A;  3MVD D;  2F8N K;  3NQJ A;  1P3K C;  3LJA A;  3KWQ D;  4ZBJ B;  3LEL B;  1EQZ A;  1P3F C;  3VH5 A;  5DNM D;  2FJ7 B;  5DNN B;  3LEL D;  5B1M B;  1BH9 B;  5AVC B;  4X23 C;  3B6F B;  2IO5 C;  2FJ7 D;  5GT3 B;  5DNN D;  4EO5 B;  3MGQ A;  5B1M D;  5AVC D;  3B6F D;  3LZ0 B;  5GSU A;  3AZF A;  3REL A;  5CPK A;  2RVQ C;  2NZD A;  3LZ0 D;  1P3G A;  1KX3 B;  3UTB A;  3W98 D;  4J8U C;  3X1T B;  3X1V C;  3AZJ C;  5JRG B;  1KX3 D;  1KU5 A;  1TAF B;  3X1T D;  5GT0 C;  3R45 B;  5B24 C;  5JRG D;  2NQB A;  1P3A C;  3VH6 A;  1JFI B;  5B1L C;  3O62 B;  3LEL A;  1H3O B;  1P34 C;  3W96 B;  3AZI A;  2JSS A;  4X23 B;  2IO5 B;  1Q9C A;  1WWI A;  3O62 D;  5B1M A;  1BH9 A;  4ZUX C;  5AVC A;  3W96 D;  5GT3 A;  3AV2 B;  4X23 D;  3WTP C;  5G49 B;  3LZ0 A;  3W99 A;  5AV5 B;  3AV2 D;  5AY8 C;  3AZM C;  5B33 C;  4J8U B;  1KX3 A;  5AV5 D;  3X1T A;  4R8P C;  4WU9 C;  5JRG A;  4J8U D;  4LD9 A;  3MNN B;  3REK C;  5B24 B;  1TAF A;  1F1E A;  3R45 A;  1P3K A;  3MNN D;  5B24 D;  1P3F A;  5CHL B;  1H3O A;  3W96 A;  1ULY A;  4ZUX B;  4X23 A;  3W97 B;  5CP6 D;  3C1B C;  3X1U B;  4ZUX D;  3AZN C;  3AV2 A;  5G49 A;  3W97 D;  4AWL C;  5BT1 C;  3AYW C;  5AV5 A;  3X1U D;  1ID3 C;  5B2I C;  4J8U A;  3V9R B;  3WA9 C;  4WU9 B;  1EQZ C;  3REK B;  5GT0 A;  3MNN A;  5B24 A;  3REJ B;  3REK D;  5B2J B;  3REJ D;  5GSU C;  3AZF C;  2HUE C;  5B2J D;  3VH6 W;  1P34 A;  5C3I C;  1KX4 B;  4XUJ B;  4ZUX A;  3MGP C;  3WTP A;  3KXB B;  4XUJ D;  3X1U A;  3REI B;  1KX4 D;  3AYW B;  3MVD C;  5B40 B;  3AZM A;  3KWQ C;  4CSR B;  3KXB D;  3REI D;  5BNV B;  5B2I B;  3AYW D;  3WA9 B;  5B40 D;  3V9R A;  5DNM C;  4WU9 A;  4QLC B;  5B2I D;  3LEL C;  3WA9 D;  3REK A;  3AZH B;  2FJ7 C;  5DNN C;  4Z5T B;  4QLC D;  5B1M C;  3B6F C;  3AZH D;  5B2J A;  4Z5T D;  3B6G B;  5BO0 B;  3W98 C;  2F8N B;  3B6G D;  3B0B A;  1KX3 C;  3VH6 T;  3MGP B;  2F8N D;  3AZN A;  4HGA B;  3KXB A;  3AYW A;  5B40 A;  4CSR A;  5B0Y C;  5B2I A;  3X1S B;  5DNM B;  3WA9 A;  1ZLA B;  5B31 B;  3O62 C;  3X1S D;  3AFA D;  1ZLA D;  3W96 C;  5B31 D;  4E45 A;  3WAA C;  5CPJ B;  3AV2 C;  3W98 B;  2F8N H;  1S32 B;  5CPJ D;  5AV5 C;  1S32 D;  4H9Q B;  3MGP A;  3UTA B;  3WKJ C;  3MVD A;  1N1J A;  3UTA D;  3MNN C;  3KWQ A;  5B0Y B;  5BS7 C;  3X1S A;  4UUZ B;  5DNM A;  1ZLA A;  5B0Y D;  4JJN B;  4NE5 A;  5CP6 C;  2CV5 B;  5DNN A;  2FJ7 A;  1B67 A;  1P3M B;  1M19 C;  3B6F A;  4JJN D;  3W97 C;  3WAA B;  2YFV B;  2CV5 D;  2BYM B;  1P3M D;  5CPJ A;  3X1U C;  3WAA D;  4DRB A;  3W98 A;  1S32 A;  2ARO B;  4J8X B;  3NQU B;  3MGR D;  2HIO C;  3WKJ B;  4G91 C;  3UTA A;  2ARO D;  4J8X D;  4Z2M G;  5AVB B;  4NE3 A;  3WKJ D;  3REH B;  1KX5 D;  3REJ C;  5B0Y A;  4E44 A;  5AVB D;  1P3B B;  5FUG B;  5B2J C;  1JFI A;  4UUZ A;  3REH D;  4CAY B;  3O62 A;  5CP6 B;  1P3B D;  4JJN A;  2LY8 A;  2CV5 A;  5B32 G;  1M19 B;  4KGC B;  1P3M A;  5B32 B;  4G92 C;  4XUJ C;  1KX4 C;  3C1C B;  3WAA A;  2YFV A;  1M19 D;  4KGC D;  5B32 D;  3KXB C;  3REI C;  3C1C D;  3AN2 B;  5B40 C;  2BYK B;  2HIO B;  4G91 B;  5E5A C;  3AN2 D;  3NQU A;  3WKJ A;  5AV8 B;  1BH8 B;  4Z2M H;  4H9N B;  2HIO D;  4QLC C;  5AVB A;  4KUD B;  1HQ3 B;  3AZH C;  4WNN B;  5BS7 A;  5AV8 D;  3REH A;  4Z5T C;  3AZL D;  1P3P C;  5FUG A;  1HQ3 D;  3A6N B;  1F66 C;  4KUD D;  1R4V A;  4CAY A;  3B6G C;  3AZE B;  5CP6 A;  3A6N D;  4G92 B;  1M19 A;  4H9P B;  5B32 A;  3W97 A;  3AZE D;  3C1C A;  1P3I B;  4HGA C;  3MGS B;  3AN2 A;  1P3I D;  5E5A B;  3MGS D;  5GXQ D;  2HIO A;  3X1S C;  3AFA C;  1ZLA C;  5B31 C;  5AV8 A;  1BH8 A;  5E5A D;  4H9N A;  2CWE A;  4J8V C;  3REJ A;  3LZ1 B;  5JA4 B;  1P3P B;  2PYO B;  4H9O B;  1F66 B;  3AZK B;  3A6N A;  5CPJ C;  3LZ1 D;  2L5A A;  1P3P D;  2PYO D;  1F66 D;  2F8N G;  3AZK D;  1S32 C;  3KSY A;  1KX4 A;  4XUJ A;  5CPI C;  4M6B A;  3LJA B;  3UTA C;  1U35 B;  1P3I A;  3REI A;  4J8W B;  5F99 B;  4YS3 C;  3MGS A;  1P3O B;  3LJA D;  1U35 D;  5BNV A;  4J8W D;  5F99 D;  5E5A A;  3AFA B;  5B31 G;  1P3O D;  4QLC A;  4JJN C;  4J8V B;  3AZH A;  2CV5 C;  4Z5T A;  1P3M C;  3LZ1 A;  5JA4 A;  3MGQ D;  1P3P A;  4J8V D;  4H9O A;  1P3G B;  1F66 A;  2NZD B;  4Z66 B;  3REL D;  3B6G A; 
#chains in the Genus database with same CATH topology
 5BO0 A;  2DF4 C;  2NZD D;  1P3G D;  3MGR C;  4Z66 D;  1HTA A;  1P3L C;  2F8N A;  4YM6 C;  5CPI B;  2ARO C;  4J8X C;  5CPI D;  1U35 A;  1KX5 C;  4YS3 B;  1M18 C;  5AVB C;  4J8W A;  4WZS B;  3KUY B;  5F99 A;  5B0Z B;  2NQB D;  3UT9 B;  1P3O A;  1TZY C;  3REH C;  3AZI B;  1AOI B;  4YS3 D;  3TU4 B;  3KUY D;  3AFA A;  5B0Z D;  1P3B C;  3UT9 D;  1M1A B;  3AZI D;  5B31 A;  1AOI D;  3TU4 D;  1M1A D;  4J8V A;  3W99 B;  5GT3 D;  4KGC C;  5AV6 C;  5B32 C;  5AV9 C;  3C1C C;  3W99 D;  4Z66 A;  3MGR B;  2Y2L A;  2BG1 A;  4YM6 B;  3AN2 C;  1P3L B;  4LD9 B;  5BNX B;  5CPI A;  2YFW B;  1P3K B;  1P3L D;  4YM6 D;  3AV1 C;  4H9Q A;  4LD9 D;  1KX5 B;  1M18 B;  5AV8 C;  4YS3 A;  1P3K D;  1P3F B;  3AZL C;  1TZY B;  3KUY A;  1HQ3 C;  5B0Z A;  3UT9 A;  4KUD C;  3IP4 C;  1M18 D;  2Y2J A;  3WTP E;  3AL0 C;  1AOI A;  3TU4 A;  1P3F D;  1TZY D;  3A6N C;  3B0C W;  1M1A A;  4WV4 B;  4WU8 C;  3AZE C;  5AV6 B;  5AV9 B;  5KDM B;  5AV6 D;  3X1V B;  2BYM A;  2RVQ D;  1P3I C;  3B0D C;  5AV9 D;  3AZJ B;  3MGS C;  3MGR A;  2XD5 A;  5GXQ C;  1P3L A;  4YM6 A;  3X1V D;  5GT0 B;  2ARO A;  3AZG C;  4J8X A;  5BNX A;  3AZJ D;  3AV1 B;  2YFW A;  1P3A B;  4XZQ C;  5GT0 D;  1KX5 A;  5B1L B;  4H9S C;  1M18 A;  3AZL B;  3AV1 D;  1P3A D;  1P34 B;  1TZY A;  5B1L D;  3LZ1 C;  1P3B A;  2PYO C;  1P34 D;  4UPK A;  3VH5 W;  3AZK C;  4NFT A;  3FDD A;  3WTP B;  2FFF B;  4WU8 B;  2Y2I A;  3B0C T;  4KGC A;  5AY8 B;  5AV6 A;  3AZM B;  3WTP D;  5AV9 A;  4WU8 D;  5B33 B;  5KDM A;  3B0D B;  3H0L C;  5AY8 D;  3LJA C;  3AZM D;  3X1V A;  4R8P B;  1U35 C;  3AZJ A;  5GXQ B;  4J8W C;  5B33 D;  5F99 C;  2BYK A;  3AZG B;  1P3O C;  4R8P D;  4WU9 D;  1PZR A;  4XZQ B;  3AV1 A;  4H9R B;  1P3A A;  3AZG D;  5B1L A;  1A7W A;  4XZQ D;  3MGQ C;  3AZL A;  4KUD A;  1HQ3 A;  4DRA A;  3REL C;  4WNN A;  5CPK C;  2ZY2 A;  4KHA B;  2NZD C;  1P3G C;  3UTB C;  1BFM A;  4Z66 C;  3C1B B;  3AZN B;  4WU8 A;  4AWL B;  3AZE A;  3VH5 T;  3C1B D;  4H9P A;  5AY8 A;  3AZN D;  1ID3 B;  3NQJ B;  5BT1 D;  5B33 A;  2NQB C;  3EPH A;  1EQZ B;  1ID3 D;  4R8P A;  4ZBJ C;  5GXQ A;  3KUY C;  3A1I A;  5B0Z C;  3UT9 C;  3AZG A;  3AZI C;  1EQZ D;  1AOI C;  3TU4 C;  4XZQ A;  5AVC C;  1M1A C;  4H9R A;  4H9S A;  2J8P A;  5GT3 C;  3MGQ B;  5GSU B;  3AZF B;  4EO5 C;  2HUE B;  3REL B;  4NE6 A;  1B6W A;  3LZ0 C;  1WWS A;  5CPK B;  5C3I B;  3W99 C;  2PYO A;  2ZY3 A;  5GSU D;  4KHA A;  3AZF D;  3UTB B;  3EPJ A;  3AZK A;  5CPK D;  3C1B A;  3X1T C;  3MVD B;  5JRG C;  3UTB D;  4LD9 C;  1N1J B;  2F2A C;  3MGP D;  3KWQ B;  2NQB B;  1ID3 A;  3MVD D;  2F8N K;  3NQJ A;  1P3K C;  3LJA A;  3KWQ D;  4ZBJ B;  2VQR A;  3LEL B;  1EQZ A;  1P3F C;  3VH5 A;  5DNM D;  2FJ7 B;  5DNN B;  3EG5 B;  3H0M C;  3LEL D;  5B1M B;  1BH9 B;  5AVC B;  4X23 C;  3H0R C;  2IO5 C;  3B6F B;  1T3U A;  2FJ7 D;  5GT3 B;  5DNN D;  4EO5 B;  3MGQ A;  5B1M D;  5AVC D;  3B6F D;  3LZ0 B;  5GSU A;  3AZF A;  3REL A;  5CPK A;  2RVQ C;  2NZD A;  3LZ0 D;  1P3G A;  1KX3 B;  3UTB A;  3W98 D;  4J8U C;  3X1T B;  3X1V C;  3AZJ C;  5JRG B;  1KX3 D;  1KU5 A;  1TAF B;  3X1T D;  5GT0 C;  3R45 B;  5B24 C;  5JRG D;  2NQB A;  1P3A C;  2W8S A;  3VH6 A;  1JFI B;  5B1L C;  3O62 B;  2G5I C;  3LEL A;  1H3O B;  2Y2H A;  1P34 C;  3W96 B;  3AZI A;  2JSS A;  4X23 B;  2IO5 B;  1Q9C A;  1WWI A;  3O62 D;  5B1M A;  1BH9 A;  4ZUX C;  5AVC A;  3W96 D;  5GT3 A;  3AV2 B;  4X23 D;  3WTP C;  5G49 B;  3LZ0 A;  3W99 A;  5AV5 B;  3AV2 D;  5AY8 C;  3AZM C;  5B33 C;  4J8U B;  1KX3 A;  5AV5 D;  3X1T A;  4R8P C;  4WU9 C;  5JRG A;  4J8U D;  4LD9 A;  3MNN B;  3REK C;  5B24 B;  1TAF A;  1F1E A;  3R45 A;  1P3K A;  2XD1 A;  3MNN D;  5B24 D;  2ZM5 A;  1P3F A;  5CHL B;  1H3O A;  3W96 A;  2Y2N A;  1ULY A;  4ZUX B;  4X23 A;  3W97 B;  5CP6 D;  3C1B C;  3X1U B;  4ZUX D;  3AZN C;  3AV2 A;  5G49 A;  3W97 D;  4AWL C;  5BT1 C;  3AYW C;  5AV5 A;  3X1U D;  1ID3 C;  2ZY5 A;  5B2I C;  4J8U A;  3V9R B;  3WA9 C;  4WU9 B;  1EQZ C;  3REK B;  2Y2O A;  5GT0 A;  3MNN A;  5B24 A;  3REJ B;  2JCH A;  2UWX A;  3REK D;  5B2J B;  2Y2G A;  3REJ D;  5GSU C;  3AZF C;  2HUE C;  5B2J D;  3VH6 W;  1P34 A;  5C3I C;  1KX4 B;  4XUJ B;  4ZUX A;  3MGP C;  3WTP A;  3KXB B;  4XUJ D;  3X1U A;  3REI B;  1KX4 D;  3AYW B;  3MVD C;  5B40 B;  3AZM A;  3KWQ C;  4CSR B;  3KXB D;  3REI D;  5BNV B;  5B2I B;  3AYW D;  3WA9 B;  5B40 D;  3V9R A;  5DNM C;  4WU9 A;  4QLC B;  5B2I D;  3LEL C;  3WA9 D;  3REK A;  3AZH B;  3EPK A;  2FJ7 C;  5DNN C;  4Z5T B;  4QLC D;  5B1M C;  3B6F C;  3AZH D;  5B2J A;  3F6T A;  4Z5T D;  3B6G B;  5BO0 B;  3P5J B;  3W98 C;  2F8N B;  3B6G D;  3B0B A;  1KX3 C;  3VH6 T;  3MGP B;  2F8N D;  3AZN A;  4HGA B;  3KXB A;  3AYW A;  5B40 A;  4CSR A;  5B0Y C;  5B2I A;  3X1S B;  5DNM B;  1Z2C B;  3WA9 A;  1ZLA B;  5B31 B;  3O62 C;  3X1S D;  3AFA D;  1ZLA D;  3W96 C;  5B31 D;  4E45 A;  3WAA C;  5CPJ B;  3AV2 C;  3W98 B;  2F8N H;  1S32 B;  2ZY4 A;  5CPJ D;  5AV5 C;  1S32 D;  4H9Q B;  3MGP A;  3UTA B;  3WKJ C;  3MVD A;  1N1J A;  3UTA D;  3MNN C;  3KWQ A;  5B0Y B;  5BS7 C;  3X1S A;  4UUZ B;  5DNM A;  1ZLA A;  5B0Y D;  4JJN B;  4NE5 A;  5CP6 C;  2CV5 B;  5DNN A;  2FJ7 A;  1B67 A;  1P3M B;  1M19 C;  3B6F A;  4JJN D;  3W97 C;  3A1K A;  2YFV B;  3WAA B;  2CV5 D;  2BYM B;  1P3M D;  5CPJ A;  3X1U C;  1W2E A;  3WAA D;  4DRB A;  3W98 A;  1S32 A;  3KFU G;  2ARO B;  4J8X B;  3NQU B;  3MGR D;  2HIO C;  3WKJ B;  4WJ3 C;  4G91 C;  3UTA A;  2ARO D;  4J8X D;  4DQY B;  4Z2M G;  5AVB B;  4NE3 A;  3WKJ D;  3REH B;  2Y2Q A;  1KX5 D;  3REJ C;  5B0Y A;  4E44 A;  5AVB D;  1P3B B;  5FUG B;  5B2J C;  1JFI A;  4UUZ A;  3REH D;  4CAY B;  3O62 A;  5CP6 B;  1P3B D;  4JJN A;  2LY8 A;  2Y2K A;  2CV5 A;  5B32 G;  1M19 B;  4KGC B;  1P3M A;  5B32 B;  4G92 C;  4XUJ C;  1KX4 C;  3C1C B;  3WAA A;  2YFV A;  1M19 D;  4KGC D;  5B32 D;  3KXB C;  3REI C;  3C1C D;  3AN2 B;  5B40 C;  2BYK B;  2HIO B;  4G91 B;  5E5A C;  3AN2 D;  3NQU A;  3WKJ A;  2JE5 A;  5AV8 B;  1BH8 B;  4Z2M H;  4H9N B;  2HIO D;  4QLC C;  5AVB A;  4KUD B;  1HQ3 B;  3AZH C;  5BS7 A;  4WNN B;  5AV8 D;  3REH A;  4Z5T C;  3AZL D;  1P3P C;  5FUG A;  1HQ3 D;  3A6N B;  1F66 C;  4KUD D;  1R4V A;  4CAY A;  3B6G C;  3AZE B;  5CP6 A;  3A6N D;  4G92 B;  1M19 A;  4H9P B;  5B32 A;  3W97 A;  2Y2P A;  3AZE D;  3C1C A;  1P3I B;  4HGA C;  3MGS B;  3AN2 A;  1P3I D;  2DQN C;  5E5A B;  3MGS D;  5GXQ D;  2HIO A;  3X1S C;  3AFA C;  1ZLA C;  5B31 C;  5AV8 A;  1BH8 A;  5E5A D;  4H9N A;  2CWE A;  4J8V C;  3REJ A;  3LZ1 B;  5JA4 B;  1P3P B;  2PYO B;  4H9O B;  1F66 B;  3AZK B;  3A6N A;  5CPJ C;  3LZ1 D;  2L5A A;  1P3P D;  2PYO D;  1F66 D;  2F8N G;  3AZK D;  1S32 C;  3KSY A;  1KX4 A;  4XUJ A;  5CPI C;  4M6B A;  3LJA B;  3UTA C;  3EPL A;  1U35 B;  1P3I A;  2Y2M A;  3REI A;  4J8W B;  5F99 B;  4YS3 C;  3MGS A;  1P3O B;  3LJA D;  1U35 D;  5BNV A;  4J8W D;  5F99 D;  5E5A A;  3AFA B;  5B31 G;  1P3O D;  4QLC A;  4JJN C;  4J8V B;  3AZH A;  2CV5 C;  4Z5T A;  1P3M C;  3LZ1 A;  5JA4 A;  2G5H C;  3MGQ D;  1P3P A;  4J8V D;  2RIQ A;  4H9O A;  1P3G B;  1F66 A;  2NZD B;  4Z66 B;  3REL D;  3B6G A; 
#chains in the Genus database with same CATH homology
 5BO0 A;  2DF4 C;  2NZD D;  1P3G D;  3MGR C;  4Z66 D;  1HTA A;  1P3L C;  2F8N A;  4YM6 C;  5CPI B;  2ARO C;  4J8X C;  5CPI D;  1U35 A;  1KX5 C;  4YS3 B;  1M18 C;  5AVB C;  4J8W A;  4WZS B;  3KUY B;  5F99 A;  5B0Z B;  2NQB D;  3UT9 B;  1P3O A;  1TZY C;  3REH C;  3AZI B;  1AOI B;  4YS3 D;  3TU4 B;  3KUY D;  3AFA A;  5B0Z D;  1P3B C;  3UT9 D;  1M1A B;  3AZI D;  5B31 A;  1AOI D;  3TU4 D;  1M1A D;  4J8V A;  3W99 B;  5GT3 D;  4KGC C;  5AV6 C;  5B32 C;  5AV9 C;  3C1C C;  3W99 D;  4Z66 A;  3MGR B;  2Y2L A;  2BG1 A;  4YM6 B;  3AN2 C;  1P3L B;  4LD9 B;  5BNX B;  5CPI A;  2YFW B;  1P3K B;  1P3L D;  4YM6 D;  3AV1 C;  4H9Q A;  4LD9 D;  1KX5 B;  1M18 B;  5AV8 C;  4YS3 A;  1P3K D;  1P3F B;  3AZL C;  1TZY B;  3KUY A;  1HQ3 C;  5B0Z A;  3UT9 A;  4KUD C;  3IP4 C;  1M18 D;  2Y2J A;  3WTP E;  3AL0 C;  1AOI A;  3TU4 A;  1P3F D;  1TZY D;  3A6N C;  3B0C W;  1M1A A;  4WV4 B;  4WU8 C;  3AZE C;  5AV6 B;  5AV9 B;  5KDM B;  5AV6 D;  3X1V B;  2BYM A;  2RVQ D;  1P3I C;  3B0D C;  5AV9 D;  3AZJ B;  3MGS C;  3MGR A;  2XD5 A;  5GXQ C;  1P3L A;  4YM6 A;  3X1V D;  5GT0 B;  2ARO A;  3AZG C;  4J8X A;  5BNX A;  3AZJ D;  3AV1 B;  2YFW A;  1P3A B;  4XZQ C;  5GT0 D;  1KX5 A;  5B1L B;  4H9S C;  1M18 A;  3AZL B;  3AV1 D;  1P3A D;  1P34 B;  1TZY A;  5B1L D;  3LZ1 C;  1P3B A;  2PYO C;  1P34 D;  4UPK A;  3VH5 W;  3AZK C;  4NFT A;  3FDD A;  3WTP B;  2FFF B;  4WU8 B;  2Y2I A;  3B0C T;  4KGC A;  5AY8 B;  5AV6 A;  3AZM B;  3WTP D;  5AV9 A;  4WU8 D;  5B33 B;  5KDM A;  3B0D B;  3H0L C;  5AY8 D;  3LJA C;  3AZM D;  3X1V A;  4R8P B;  1U35 C;  3AZJ A;  5GXQ B;  4J8W C;  5B33 D;  5F99 C;  2BYK A;  3AZG B;  1P3O C;  4R8P D;  4WU9 D;  1PZR A;  4XZQ B;  3AV1 A;  4H9R B;  1P3A A;  3AZG D;  5B1L A;  1A7W A;  4XZQ D;  3MGQ C;  3AZL A;  4KUD A;  1HQ3 A;  4DRA A;  3REL C;  4WNN A;  5CPK C;  2ZY2 A;  4KHA B;  2NZD C;  1P3G C;  3UTB C;  1BFM A;  4Z66 C;  3C1B B;  3AZN B;  4WU8 A;  4AWL B;  3AZE A;  3VH5 T;  3C1B D;  4H9P A;  5AY8 A;  3AZN D;  1ID3 B;  3NQJ B;  5BT1 D;  5B33 A;  2NQB C;  3EPH A;  1EQZ B;  1ID3 D;  4R8P A;  4ZBJ C;  5GXQ A;  3KUY C;  3A1I A;  5B0Z C;  3UT9 C;  3AZG A;  3AZI C;  1EQZ D;  1AOI C;  3TU4 C;  4XZQ A;  5AVC C;  1M1A C;  4H9R A;  4H9S A;  2J8P A;  5GT3 C;  3MGQ B;  5GSU B;  3AZF B;  4EO5 C;  2HUE B;  3REL B;  4NE6 A;  1B6W A;  3LZ0 C;  1WWS A;  5CPK B;  5C3I B;  3W99 C;  2PYO A;  2ZY3 A;  5GSU D;  4KHA A;  3AZF D;  3UTB B;  3EPJ A;  3AZK A;  5CPK D;  3C1B A;  3X1T C;  3MVD B;  5JRG C;  3UTB D;  4LD9 C;  1N1J B;  2F2A C;  3MGP D;  3KWQ B;  2NQB B;  1ID3 A;  3MVD D;  2F8N K;  3NQJ A;  1P3K C;  3LJA A;  3KWQ D;  4ZBJ B;  2VQR A;  3LEL B;  1EQZ A;  1P3F C;  3VH5 A;  5DNM D;  2FJ7 B;  5DNN B;  3EG5 B;  3H0M C;  3LEL D;  5B1M B;  1BH9 B;  5AVC B;  4X23 C;  3H0R C;  2IO5 C;  3B6F B;  1T3U A;  2FJ7 D;  5GT3 B;  5DNN D;  4EO5 B;  3MGQ A;  5B1M D;  5AVC D;  3B6F D;  3LZ0 B;  5GSU A;  3AZF A;  3REL A;  5CPK A;  2RVQ C;  2NZD A;  3LZ0 D;  1P3G A;  1KX3 B;  3UTB A;  3W98 D;  4J8U C;  3X1T B;  3X1V C;  3AZJ C;  5JRG B;  1KX3 D;  1KU5 A;  1TAF B;  3X1T D;  5GT0 C;  3R45 B;  5B24 C;  5JRG D;  2NQB A;  1P3A C;  2W8S A;  3VH6 A;  1JFI B;  5B1L C;  3O62 B;  2G5I C;  3LEL A;  1H3O B;  2Y2H A;  1P34 C;  3W96 B;  3AZI A;  2JSS A;  4X23 B;  2IO5 B;  1Q9C A;  1WWI A;  3O62 D;  5B1M A;  1BH9 A;  4ZUX C;  5AVC A;  3W96 D;  5GT3 A;  3AV2 B;  4X23 D;  3WTP C;  5G49 B;  3LZ0 A;  3W99 A;  5AV5 B;  3AV2 D;  5AY8 C;  3AZM C;  5B33 C;  4J8U B;  1KX3 A;  5AV5 D;  3X1T A;  4R8P C;  4WU9 C;  5JRG A;  4J8U D;  4LD9 A;  3MNN B;  3REK C;  5B24 B;  1TAF A;  1F1E A;  3R45 A;  1P3K A;  2XD1 A;  3MNN D;  5B24 D;  2ZM5 A;  1P3F A;  5CHL B;  1H3O A;  3W96 A;  2Y2N A;  1ULY A;  4ZUX B;  4X23 A;  3W97 B;  5CP6 D;  3C1B C;  3X1U B;  4ZUX D;  3AZN C;  3AV2 A;  5G49 A;  3W97 D;  4AWL C;  5BT1 C;  3AYW C;  5AV5 A;  3X1U D;  1ID3 C;  2ZY5 A;  5B2I C;  4J8U A;  3V9R B;  3WA9 C;  4WU9 B;  1EQZ C;  3REK B;  2Y2O A;  5GT0 A;  3MNN A;  5B24 A;  3REJ B;  2JCH A;  2UWX A;  3REK D;  5B2J B;  2Y2G A;  3REJ D;  5GSU C;  3AZF C;  2HUE C;  5B2J D;  3VH6 W;  1P34 A;  5C3I C;  1KX4 B;  4XUJ B;  4ZUX A;  3MGP C;  3WTP A;  3KXB B;  4XUJ D;  3X1U A;  3REI B;  1KX4 D;  3AYW B;  3MVD C;  5B40 B;  3AZM A;  3KWQ C;  4CSR B;  3KXB D;  3REI D;  5BNV B;  5B2I B;  3AYW D;  3WA9 B;  5B40 D;  3V9R A;  5DNM C;  4WU9 A;  4QLC B;  5B2I D;  3LEL C;  3WA9 D;  3REK A;  3AZH B;  3EPK A;  2FJ7 C;  5DNN C;  4Z5T B;  4QLC D;  5B1M C;  3B6F C;  3AZH D;  5B2J A;  3F6T A;  4Z5T D;  3B6G B;  5BO0 B;  3P5J B;  3W98 C;  2F8N B;  3B6G D;  3B0B A;  1KX3 C;  3VH6 T;  3MGP B;  2F8N D;  3AZN A;  4HGA B;  3KXB A;  3AYW A;  5B40 A;  4CSR A;  5B0Y C;  5B2I A;  3X1S B;  5DNM B;  1Z2C B;  3WA9 A;  1ZLA B;  5B31 B;  3O62 C;  3X1S D;  3AFA D;  1ZLA D;  3W96 C;  5B31 D;  4E45 A;  3WAA C;  5CPJ B;  3AV2 C;  3W98 B;  2F8N H;  1S32 B;  2ZY4 A;  5CPJ D;  5AV5 C;  1S32 D;  4H9Q B;  3MGP A;  3UTA B;  3WKJ C;  3MVD A;  1N1J A;  3UTA D;  3MNN C;  3KWQ A;  5B0Y B;  5BS7 C;  3X1S A;  4UUZ B;  5DNM A;  1ZLA A;  5B0Y D;  4JJN B;  4NE5 A;  5CP6 C;  2CV5 B;  5DNN A;  2FJ7 A;  1B67 A;  1P3M B;  1M19 C;  3B6F A;  4JJN D;  3W97 C;  3A1K A;  2YFV B;  3WAA B;  2CV5 D;  2BYM B;  1P3M D;  5CPJ A;  3X1U C;  1W2E A;  3WAA D;  4DRB A;  3W98 A;  1S32 A;  3KFU G;  2ARO B;  4J8X B;  3NQU B;  3MGR D;  2HIO C;  3WKJ B;  4WJ3 C;  4G91 C;  3UTA A;  2ARO D;  4J8X D;  4DQY B;  4Z2M G;  5AVB B;  4NE3 A;  3WKJ D;  3REH B;  2Y2Q A;  1KX5 D;  3REJ C;  5B0Y A;  4E44 A;  5AVB D;  1P3B B;  5FUG B;  5B2J C;  1JFI A;  4UUZ A;  3REH D;  4CAY B;  3O62 A;  5CP6 B;  1P3B D;  4JJN A;  2LY8 A;  2Y2K A;  2CV5 A;  5B32 G;  1M19 B;  4KGC B;  1P3M A;  5B32 B;  4G92 C;  4XUJ C;  1KX4 C;  3C1C B;  3WAA A;  2YFV A;  1M19 D;  4KGC D;  5B32 D;  3KXB C;  3REI C;  3C1C D;  3AN2 B;  5B40 C;  2BYK B;  2HIO B;  4G91 B;  5E5A C;  3AN2 D;  3NQU A;  3WKJ A;  2JE5 A;  5AV8 B;  1BH8 B;  4Z2M H;  4H9N B;  2HIO D;  4QLC C;  5AVB A;  4KUD B;  1HQ3 B;  3AZH C;  5BS7 A;  4WNN B;  5AV8 D;  3REH A;  4Z5T C;  3AZL D;  1P3P C;  5FUG A;  1HQ3 D;  3A6N B;  1F66 C;  4KUD D;  1R4V A;  4CAY A;  3B6G C;  3AZE B;  5CP6 A;  3A6N D;  4G92 B;  1M19 A;  4H9P B;  5B32 A;  3W97 A;  2Y2P A;  3AZE D;  3C1C A;  1P3I B;  4HGA C;  3MGS B;  3AN2 A;  1P3I D;  2DQN C;  5E5A B;  3MGS D;  5GXQ D;  2HIO A;  3X1S C;  3AFA C;  1ZLA C;  5B31 C;  5AV8 A;  1BH8 A;  5E5A D;  4H9N A;  2CWE A;  4J8V C;  3REJ A;  3LZ1 B;  5JA4 B;  1P3P B;  2PYO B;  4H9O B;  1F66 B;  3AZK B;  3A6N A;  5CPJ C;  3LZ1 D;  2L5A A;  1P3P D;  2PYO D;  1F66 D;  2F8N G;  3AZK D;  1S32 C;  3KSY A;  1KX4 A;  4XUJ A;  5CPI C;  4M6B A;  3LJA B;  3UTA C;  3EPL A;  1U35 B;  1P3I A;  2Y2M A;  3REI A;  4J8W B;  5F99 B;  4YS3 C;  3MGS A;  1P3O B;  3LJA D;  1U35 D;  5BNV A;  4J8W D;  5F99 D;  5E5A A;  3AFA B;  5B31 G;  1P3O D;  4QLC A;  4JJN C;  4J8V B;  3AZH A;  2CV5 C;  4Z5T A;  1P3M C;  3LZ1 A;  5JA4 A;  2G5H C;  3MGQ D;  1P3P A;  4J8V D;  2RIQ A;  4H9O A;  1P3G B;  1F66 A;  2NZD B;  4Z66 B;  3REL D;  3B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...