1P3FA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fA00
1M19D 3KWQA 3B0CT 5GT0D 5B40B 3MGPA 3AV1B 1KX4D 3X1SD 1U35C 4Z2MG 3REKD 4YS3A 5JRGD 3VH5T 3UT9D 5AV6A 3R45B 1P3PA 3C1CD 1P3OB 3B0CW 1H3OA 3X1UC 5CPIC 4R8PB 2AROA 3V9RB 4LD9D 1B6WA 3UTBA 3B0DB 4KGCA 1KX3B 5AY8D 1AOIA 1KX5A 5DNNA 3WTPA 3AZLD 2PYOC 3KXBD 3W98C 3AV2C 4QLCB 4AWLB 1M1AB 5B2JA 2HIOA 3C1BB 5BT1C 3X1VA 3REIC 1TZYC 1BH8B 5B0ZD 3MGQB 5GSUD 1P3FC 1WWIA 5CHLB 3AFAB 1P3LB 5B2IA 5BS7A 4WU9D 5B33D 3REJC 3UTAB 3AZGD 5B0YD 3REHD 1P3GD 2FJ7B 5B31A 2LY8A 4J8VC 3LZ1C 5B1LD 3W97C 2HUEC 3O62C 1M18A 3AZNB 3LZ0B 3LELD 1ID3D 4X23D 5E5AC 3MGRC 2YFWB 5B40C 3AV1C 4UUZA 3LJAA 4KUDA 1S32B 3B6GA 3B6FC 1P3OC 3AN2D 5G49A 3VH5A 4J8WC 1P3AB 3AYWA 4YM6A 4R8PC 5GT3A 1KX3C 4G92B 4ZUXB 5CPKB 3AZFB 3NQJB 4H9SA 3AZHB 3A6NB 1P3ID 1ZLAA 3MGSC 4JJND 4XZQB 4J8VD 4XUJA 1P34C 3MNNB 5GXQB 5BNXB 3MGQC 3AZMB 3TU4C 5B32A 1B67A 1P3LC 5B32G 4Z66D 4KHAA 5E5AD 4J8XA 3X1TA 3UTAC 1U35B 5B1MA 1P3MB 1P3BA 3MVDA 5B24C 5AV8B 4E45A 4J8UC 3X1UB 5CPIB 4H9OB 1P3KA 2F8NH 1M19A 5GT0A 5BO0B 3LZ0C 5FUGB 5CPJD 3AZEC 3WAAC 4CAYB 2PYOB 3X1SA 3REKA 5JRGA 1KX3D 3UT9A 3C1CA 4DRAA 3AZKC 4EO5C 4QLCD 3REIB 1EQZC 5AV5C 1M1AD 4LD9A 1S32C 4WU8C 4YS3B 5AY8A 4H9RA 3C1BD 5AVBD 2F8NG 3AZLA 1P3AC 3KXBA 3REJB 1H3OB 3AZID 5AV9D 3AFAD 1P3LD 2AROB 1WWSA 4G92C 5CPKC 3UTBB 4KGCB 1AOIB 1HTAA 3LZ1B 3WTPB 5AVCC 3UTAD 5JA4A 5B0ZA 5GSUA 2FJ7D 1HQ3C 4XZQC 4WU9A 4H9NA 2NZDC 5B33A 2CV5C 3MNNC 3X1VB 3AZGA 5B0YA 3REHA 3MGRB 3AZND 1P3GA 3WA9B 5B2IB 5B1LA 3WTPE 1F1EA 2NQBC 1P3MC 3B6FB 5AV8C 3LELA 4J8WB 3AZJD 1ID3A 4X23A 3VH6A 3VH5W 1M18B 4Z5TD 5BNVA 5DNMB 2RVQD 3MGSB 3RELC 4ZUXD 3AZFD 3KWQC 3AZHD 3A6ND 4WV4B 3AN2A 3MGPC 4WNNA 5F99B 4ZBJB 2L5AA 3LJAB 3WKJD 4YS3C 3KUYD 4XZQD 1F66D 3TU4B 5AV6C 3W99A 1P3PC 5GXQD 1P3IA 5G49B 3AYWB 4YM6B 5GT3B 5CP6A 3AZMD 2AROC 1P34D 4JJNA 3UTBC 4KGCC 4J8VA 1AOIC 2YFVA 5B24B 5B31G 5DNNC 1KX5C 1U35D 3WTPC 4J8UB 4CSRA 5B2JC 3W96A 2HIOC 4Z66A 3AZEB 3X1UD 3WAAB 4XUJB 5CPID 3X1VC 5E5AA 2BYKA 4H9PB 3WA9C 5B32B 2PYOD 5B2IC 5BS7C 3B0BA 4EO5B 5C3IC 3AZKB 3AV2D 3W98D 4KHAB 1EQZB 2BYMB 5AV5B 4J8XB 3R45A 4WU8B 5B31C 5CPJA 1N1JA 5BT1D 3MVDB 1P3BB 3REID 3V9RA 1TZYD 4YS3D 1P3FD 1P3KB 1M18C 3REJD 5GT0B 4QLCA 5DNMC 5AVCB 1M1AA 3X1SB 5JRGB 1HQ3B 3C1BA 5AVBA 3LZ1D 3C1CB 2NZDB 2CV5B 3W97D 5F99C 4ZBJC 3LJAC 3AZIA 4KUDC 5AV9A 3O62D 3AFAA 1P3LA 3B6GC 5AY8B 4H9RB 2F8NB 3AZLB 1A7WA 4YM6C 3UTAA 3AYWC 5GT3C 3MGRD 2NQBB 2FJ7A 3WA9D 5B40D 3AV1D 4H9SC 3VH6T 1ZLAC 5JA4B 3AZNA 4NE5A 1ULYA 3B6FD 1P3OD 4J8WD 4WU9B 4XUJC 4R8PD 1KX4A 5B33B 3RELB 3AZGB 5B0YB 3REHB 5B32C 3KWQB 5DNMD 3AZJA 3MGSD 5B1LB 3MGPB 4J8XC 3X1TC 5B1MC 1R4VA 5AV6B 1P3BC 3MVDC 1KU5A 1P3PB 4Z5TA 5F99D 3MGQD 1ID3B 3TU4D 4ZUXA 3AZFA 1P3KC 3NQJA 1M19C 3AZHA 3A6NA 5GT0C 1KX5B 5DNNB 3KSYA 3X1SC 3REKC 3WKJA 5JRGC 4WZSB 4XZQA 3KUYA 5B24D 3UT9C 5B2JB 1F66A 2HIOB 5GXQA 3C1CC 4J8UD 5BNXA 1JFIA 3AZMA 2IO5B 1P34A 4LD9C 3LZ0D 5AY8C 3AZED 3WAAD 4XUJD 3W99B 4NE6A 1BFMA 1U35A 5C3IB 3AZLC 3KXBC 5CP6B 3NQUA 3AZKD 4JJNB 4Z2MH 5B31B 3X1UA 1EQZD 4M6BA 5CPIA 2CWEA 5AV5D 1S32D 4WU8D 5GSUC 5BO0A 1P3BD 4CAYA 1P3AD 2PYOA 3W98A 4WU9C 3W96B 3AV2A 4Z66B 5B33C 1BH9A 5CPKD 2BYKB 5B0YC 3REHC 3AZGC 1P3GC 4HGAB 3REIA 5AVCD 4H9QA 1TZYA 5B1LC 4UUZB 1P3FA 4KUDB 1HQ3D 3B6GB 2NZDD 3REJA 5KDMA 3MNND 2CV5D 1TAFA 5CPJB 1N1JB 3LELC 1ID3C 4X23C 2F8ND 3LZ1A 3W97A 2NQBD 1P3MD 1ZLAB 3O62A 5AV8D 5AVBB 3AN2C 4E44A 2IO5C 3MGRA 3AZIB 3WA9A 5AV9B 5B40A 4DRBA 3W99C 3AV1A 4NE3A 1P3IC 3RELD 3X1TB 5CP6C 5B1MB 3KWQD 1P3OA 4JJNC 3B6FA 4J8WA 4R8PA 3MGPD 1KX3A 4NFTA 5AV6D 1P3PD 1M19B 3W96C 5DNMA 4Z66C 3MGSA 1KX4B 2AROD 3REKB 3UTBD 4KGCD 3UT9B 1AOID 4HGAC 1KX5D 5DNND 4G91B 3WTPD 5F99A 1BH8A 3MGQA 3AZJB 3TU4A 5B2JD 4LD9B 1Q9CA 2HIOD 5CPJC 3X1VD 4Z5TB 3KXBB 3B0DC 3W99D 5B24A 5B2ID 4J8UA 4QLCC 4AWLC 2F8NK 5CP6D 1M1AC 5B0ZB 5GSUB 3LZ0A 3WKJB 5B31D 3AZEA 3KUYB 1F66B 3WAAA 3C1BC 5AVBC 4H9NB 4H9PA 3VH6W 3AZIC 2YFWA 5AV9C 1JFIB 1P34B 3AFAC 1M18D 3AZKA 1P3GB 3W96D 1EQZA 2BYMA 5AV5A 1S32A 4WU8A 2FJ7C 1P3AA 3NQUB 3LJAD 3LELB 4KUDD 4X23B 5CPKA 3B6GD 3AZNC 3W98B 5AVCA 3AYWD 4YM6D 5GT3D 3AV2B 1KX4C 5BNVB 1BH9B 1HQ3A 4G91C 2NZDA 2CV5A 3MNNA 3AN2B 1ZLAD 3AZJC 4H9QB 1TZYB 4WNNB 1P3FB 2F8NA 2JSSA 5KDMB 4Z5TC 1TAFB 1P3IB 2NQBA 1P3MA 2RVQC 5B32D 4ZUXC 5AV8A 3AZFC 3AZHC 3A6NC 4J8VB 2YFVB 4H9OA 4J8XD 3X1TD 3W97B 5B1MD 2HUEB 4CSRB 5B0ZC 3WKJC 3O62B 5FUGA 3MVDD 3KUYC 1F66C 5GXQC 3RELA 5E5AB 1P3KD 3AZMC
chains in the Genus database with same CATH superfamily
1M19D 3KWQA 3B0CT 5GT0D 5B40B 3MGPA 3AV1B 1KX4D 3X1SD 1U35C 4Z2MG 3REKD 4YS3A 5JRGD 3VH5T 3UT9D 5AV6A 3R45B 1P3PA 3C1CD 2Y2GA 1P3OB 3B0CW 1H3OA 3X1UC 5CPIC 4R8PB 2AROA 3V9RB 4LD9D 1B6WA 3UTBA 3B0DB 4KGCA 1KX3B 5AY8D 1AOIA 1KX5A 5DNNA 3WTPA 3H0LC 3AZLD 3KXBD 2PYOC 3W98C 3AV2C 4QLCB 4AWLB 1M1AB 5B2JA 3EPKA 2HIOA 3C1BB 5BT1C 3A1IA 3X1VA 3REIC 3IP4C 1TZYC 1BH8B 5B0ZD 3MGQB 5GSUD 1P3FC 1WWIA 5CHLB 3AFAB 1P3LB 5B2IA 5BS7A 4WU9D 5B33D 3REJC 3UTAB 3AZGD 5B0YD 3REHD 1P3GD 2FJ7B 5B31A 2LY8A 4J8VC 2VQRA 3LZ1C 5B1LD 3W97C 2HUEC 2DF4C 3O62C 1M18A 3AZNB 3LZ0B 3LELD 1ID3D 4X23D 5E5AC 3MGRC 2YFWB 5B40C 3AV1C 4UUZA 3LJAA 4KUDA 1S32B 3H0MC 3B6GA 3B6FC 1P3OC 3AN2D 5G49A 3VH5A 4J8WC 1P3AB 3AYWA 4YM6A 4R8PC 5GT3A 1PZRA 2Y2JA 1KX3C 4G92B 4ZUXB 5CPKB 3AZFB 3NQJB 4H9SA 3AZHB 3A6NB 1P3ID 1ZLAA 3MGSC 4JJND 4XZQB 4J8VD 4XUJA 4WJ3C 1P34C 3MNNB 5GXQB 5BNXB 3MGQC 3AZMB 3TU4C 5B32A 2Y2IA 1B67A 1P3LC 5B32G 4Z66D 4KHAA 5E5AD 4J8XA 3X1TA 3UTAC 1U35B 5B1MA 1P3MB 1P3BA 3MVDA 5B24C 5AV8B 4E45A 4J8UC 3X1UB 5CPIB 4H9OB 1P3KA 2F8NH 1M19A 2G5IC 5GT0A 5BO0B 3LZ0C 5FUGB 5CPJD 3AZEC 3WAAC 4CAYB 2PYOB 3X1SA 3REKA 5JRGA 1KX3D 3UT9A 1Z2CB 3C1CA 4DRAA 3EG5B 2XD1A 4EO5C 3AZKC 2J8PA 4QLCD 3REIB 1EQZC 5AV5C 1M1AD 4LD9A 1S32C 4WU8C 4YS3B 5AY8A 4H9RA 3C1BD 5AVBD 2F8NG 3AZLA 1P3AC 3KXBA 3REJB 1H3OB 3AZID 5AV9D 3AFAD 1P3LD 2AROB 1WWSA 4G92C 5CPKC 3UTBB 4KGCB 2UWXA 1AOIB 1HTAA 3LZ1B 3WTPB 5AVCC 3UTAD 5JA4A 5B0ZA 5GSUA 2FJ7D 1HQ3C 2Y2OA 4XZQC 4WU9A 4H9NA 2NZDC 5B33A 2CV5C 3MNNC 3X1VB 3AZGA 5B0YA 3REHA 3MGRB 3AZND 1P3GA 3WA9B 5B2IB 5B1LA 3WTPE 1F1EA 2NQBC 1P3MC 3B6FB 5AV8C 3LELA 4J8WB 3AZJD 1ID3A 4X23A 3VH6A 3VH5W 1M18B 4Z5TD 5BNVA 5DNMB 2RVQD 3MGSB 3RELC 4ZUXD 3AZFD 3KWQC 3AZHD 3A6ND 4WV4B 3AN2A 3MGPC 4WNNA 5F99B 4ZBJB 2L5AA 3LJAB 3WKJD 4YS3C 3KUYD 4XZQD 1F66D 3TU4B 5AV6C 3W99A 1P3PC 5GXQD 1P3IA 5G49B 3AYWB 4YM6B 5GT3B 5CP6A 3AZMD 2AROC 1P34D 4JJNA 3UTBC 4KGCC 4J8VA 1AOIC 2YFVA 5B24B 5B31G 5DNNC 1KX5C 1U35D 3WTPC 4J8UB 4CSRA 5B2JC 3W96A 2HIOC 4Z66A 2Y2PA 3X1UD 3AZEB 3WAAB 4XUJB 5CPID 3X1VC 5E5AA 3P5JB 2BYKA 4H9PB 3WA9C 5B32B 2PYOD 5B2IC 5BS7C 3B0BA 4EO5B 5C3IC 3AZKB 3AV2D 3W98D 4KHAB 1EQZB 2BYMB 5AV5B 4J8XB 3R45A 3AL0C 4WU8B 5B31C 5CPJA 1N1JA 5BT1D 3MVDB 1P3BB 3REID 3V9RA 1TZYD 4YS3D 1P3FD 1P3KB 1M18C 3REJD 5GT0B 2Y2LA 4QLCA 5DNMC 5AVCB 1M1AA 3X1SB 5JRGB 1HQ3B 3C1BA 5AVBA 2BG1A 3LZ1D 2XD5A 3C1CB 2NZDB 2CV5B 3W97D 5F99C 4ZBJC 3LJAC 3AZIA 4KUDC 5AV9A 3O62D 3AFAA 1P3LA 3B6GC 5AY8B 4H9RB 2F8NB 2ZY5A 3AZLB 1A7WA 4YM6C 3UTAA 3AYWC 5GT3C 3MGRD 2NQBB 2FJ7A 3EPLA 3WA9D 5B40D 3AV1D 4H9SC 3VH6T 1ZLAC 5JA4B 3AZNA 4NE5A 1ULYA 3B6FD 1P3OD 4J8WD 4WU9B 4XUJC 4R8PD 1KX4A 5B33B 3RELB 3AZGB 5B0YB 3REHB 5B32C 3KWQB 5DNMD 3AZJA 3MGSD 5B1LB 3MGPB 4J8XC 3X1TC 3F6TA 1R4VA 5B1MC 5AV6B 1P3BC 3MVDC 1KU5A 1P3PB 4Z5TA 5F99D 2Y2QA 3MGQD 1ID3B 3TU4D 4ZUXA 3AZFA 1P3KC 3NQJA 1M19C 3AZHA 3A6NA 5GT0C 1KX5B 5DNNB 3KSYA 3X1SC 3REKC 3WKJA 5JRGC 4WZSB 4XZQA 3KUYA 5B24D 3UT9C 5B2JB 1F66A 2HIOB 5GXQA 3C1CC 4J8UD 5BNXA 1JFIA 3AZMA 2IO5B 1P34A 4LD9C 3LZ0D 1T3UA 2ZY3A 5AY8C 3FDDA 3AZED 4XUJD 3WAAD 3W99B 4NE6A 1BFMA 1U35A 5C3IB 3AZLC 3KXBC 5CP6B 3NQUA 3AZKD 4JJNB 4Z2MH 5B31B 3X1UA 1EQZD 4M6BA 5CPIA 2CWEA 5AV5D 1S32D 4WU8D 2F2AC 5GSUC 5BO0A 4UPKA 1P3BD 4CAYA 1P3AD 2PYOA 3W98A 4WU9C 3W96B 3AV2A 4Z66B 5B33C 1BH9A 3A1KA 5CPKD 2BYKB 5B0YC 3REHC 3AZGC 1P3GC 4HGAB 3REIA 5AVCD 4H9QA 1TZYA 5B1LC 4UUZB 3KFUG 1P3FA 4KUDB 1HQ3D 2JCHA 3B6GB 2NZDD 3REJA 5KDMA 3MNND 4DQYB 2CV5D 1TAFA 5CPJB 1N1JB 3LELC 1ID3C 4X23C 2F8ND 2Y2KA 3LZ1A 3W97A 2RIQA 2NQBD 1P3MD 1ZLAB 3O62A 5AV8D 5AVBB 3AN2C 4E44A 2IO5C 3MGRA 3AZIB 3WA9A 5AV9B 5B40A 4DRBA 3W99C 3AV1A 4NE3A 1P3IC 3RELD 3X1TB 5CP6C 5B1MB 3KWQD 1P3OA 4JJNC 3B6FA 4J8WA 4R8PA 3MGPD 2ZM5A 1KX3A 2ZY2A 4NFTA 2G5HC 5AV6D 1P3PD 1M19B 3W96C 5DNMA 4Z66C 2Y2HA 3MGSA 1KX4B 2AROD 3REKB 3UTBD 4KGCD 3UT9B 1AOID 4HGAC 1KX5D 5DNND 4G91B 3WTPD 2FFFB 5F99A 1BH8A 3MGQA 3AZJB 3TU4A 5B2JD 4LD9B 1Q9CA 2Y2NA 2HIOD 5CPJC 3X1VD 4Z5TB 3KXBB 3B0DC 3W99D 2ZY4A 5B24A 5B2ID 4J8UA 1W2EA 4QLCC 4AWLC 2F8NK 5CP6D 1M1AC 5B0ZB 5GSUB 3LZ0A 3WKJB 5B31D 3AZEA 3KUYB 1F66B 3WAAA 3C1BC 5AVBC 4H9NB 4H9PA 3VH6W 3AZIC 2YFWA 5AV9C 1JFIB 1P34B 3AFAC 1M18D 3AZKA 1P3GB 3W96D 2W8SA 1EQZA 2BYMA 5AV5A 1S32A 4WU8A 2FJ7C 1P3AA 3NQUB 3H0RC 3LJAD 3LELB 4KUDD 2JE5A 4X23B 5CPKA 3B6GD 3AZNC 3W98B 5AVCA 3AYWD 4YM6D 5GT3D 3AV2B 1KX4C 5BNVB 1BH9B 1HQ3A 4G91C 2NZDA 2CV5A 3MNNA 3EPHA 3AN2B 1ZLAD 3AZJC 4H9QB 1TZYB 4WNNB 1P3FB 2F8NA 2DQNC 2JSSA 5KDMB 4Z5TC 1TAFB 1P3IB 2NQBA 1P3MA 2RVQC 5B32D 4ZUXC 5AV8A 3AZFC 3AZHC 3A6NC 4J8VB 2YFVB 4H9OA 2Y2MA 3X1TD 4J8XD 3W97B 5B1MD 2HUEB 4CSRB 5B0ZC 3WKJC 3O62B 5FUGA 3MVDD 3KUYC 1F66C 5GXQC 3EPJA 3RELA 5E5AB 1P3KD 3AZMC
chains in the Genus database with same CATH topology
1M19D 3KWQA 3B0CT 5GT0D 5B40B 3MGPA 3AV1B 1KX4D 3X1SD 1U35C 4Z2MG 3REKD 4YS3A 5JRGD 3VH5T 3UT9D 5AV6A 3R45B 1P3PA 3C1CD 2Y2GA 1P3OB 3B0CW 1H3OA 3X1UC 5CPIC 4R8PB 2AROA 3V9RB 4LD9D 1B6WA 3UTBA 3B0DB 4KGCA 1KX3B 5AY8D 1AOIA 1KX5A 5DNNA 3WTPA 3H0LC 3AZLD 3KXBD 2PYOC 3W98C 3AV2C 4QLCB 4AWLB 1M1AB 5B2JA 3EPKA 2HIOA 3C1BB 5BT1C 3A1IA 3X1VA 3REIC 3IP4C 1TZYC 1BH8B 5B0ZD 3MGQB 5GSUD 1P3FC 1WWIA 5CHLB 3AFAB 1P3LB 5B2IA 5BS7A 4WU9D 5B33D 3REJC 3UTAB 3AZGD 5B0YD 3REHD 1P3GD 2FJ7B 5B31A 2LY8A 4J8VC 2VQRA 3LZ1C 5B1LD 3W97C 2HUEC 2DF4C 3O62C 1M18A 3AZNB 3LZ0B 3LELD 1ID3D 4X23D 5E5AC 3MGRC 2YFWB 5B40C 3AV1C 4UUZA 3LJAA 4KUDA 1S32B 3H0MC 3B6GA 3B6FC 1P3OC 3AN2D 5G49A 3VH5A 4J8WC 1P3AB 3AYWA 4YM6A 4R8PC 5GT3A 1PZRA 2Y2JA 1KX3C 4G92B 4ZUXB 5CPKB 3AZFB 3NQJB 4H9SA 3AZHB 3A6NB 1P3ID 1ZLAA 3MGSC 4JJND 4XZQB 4J8VD 4XUJA 4WJ3C 1P34C 3MNNB 5GXQB 5BNXB 3MGQC 3AZMB 3TU4C 5B32A 2Y2IA 1B67A 1P3LC 5B32G 4Z66D 4KHAA 5E5AD 4J8XA 3X1TA 3UTAC 1U35B 5B1MA 1P3MB 1P3BA 3MVDA 5B24C 5AV8B 4E45A 4J8UC 3X1UB 5CPIB 4H9OB 1P3KA 2F8NH 1M19A 2G5IC 5GT0A 5BO0B 3LZ0C 5FUGB 5CPJD 3AZEC 3WAAC 4CAYB 2PYOB 3X1SA 3REKA 5JRGA 1KX3D 3UT9A 1Z2CB 3C1CA 4DRAA 3EG5B 2XD1A 4EO5C 3AZKC 2J8PA 4QLCD 3REIB 1EQZC 5AV5C 1M1AD 4LD9A 1S32C 4WU8C 4YS3B 5AY8A 4H9RA 3C1BD 5AVBD 2F8NG 3AZLA 1P3AC 3KXBA 3REJB 1H3OB 3AZID 5AV9D 3AFAD 1P3LD 2AROB 1WWSA 4G92C 5CPKC 3UTBB 4KGCB 2UWXA 1AOIB 1HTAA 3LZ1B 3WTPB 5AVCC 3UTAD 5JA4A 5B0ZA 5GSUA 2FJ7D 1HQ3C 2Y2OA 4XZQC 4WU9A 4H9NA 2NZDC 5B33A 2CV5C 3MNNC 3X1VB 3AZGA 5B0YA 3REHA 3MGRB 3AZND 1P3GA 3WA9B 5B2IB 5B1LA 3WTPE 1F1EA 2NQBC 1P3MC 3B6FB 5AV8C 3LELA 4J8WB 3AZJD 1ID3A 4X23A 3VH6A 3VH5W 1M18B 4Z5TD 5BNVA 5DNMB 2RVQD 3MGSB 3RELC 4ZUXD 3AZFD 3KWQC 3AZHD 3A6ND 4WV4B 3AN2A 3MGPC 4WNNA 5F99B 4ZBJB 2L5AA 3LJAB 3WKJD 4YS3C 3KUYD 4XZQD 1F66D 3TU4B 5AV6C 3W99A 1P3PC 5GXQD 1P3IA 5G49B 3AYWB 4YM6B 5GT3B 5CP6A 3AZMD 2AROC 1P34D 4JJNA 3UTBC 4KGCC 4J8VA 1AOIC 2YFVA 5B24B 5B31G 5DNNC 1KX5C 1U35D 3WTPC 4J8UB 4CSRA 5B2JC 3W96A 2HIOC 4Z66A 2Y2PA 3X1UD 3AZEB 3WAAB 4XUJB 5CPID 3X1VC 5E5AA 3P5JB 2BYKA 4H9PB 3WA9C 5B32B 2PYOD 5B2IC 5BS7C 3B0BA 4EO5B 5C3IC 3AZKB 3AV2D 3W98D 4KHAB 1EQZB 2BYMB 5AV5B 4J8XB 3R45A 3AL0C 4WU8B 5B31C 5CPJA 1N1JA 5BT1D 3MVDB 1P3BB 3REID 3V9RA 1TZYD 4YS3D 1P3FD 1P3KB 1M18C 3REJD 5GT0B 2Y2LA 4QLCA 5DNMC 5AVCB 1M1AA 3X1SB 5JRGB 1HQ3B 3C1BA 5AVBA 2BG1A 3LZ1D 2XD5A 3C1CB 2NZDB 2CV5B 3W97D 5F99C 4ZBJC 3LJAC 3AZIA 4KUDC 5AV9A 3O62D 3AFAA 1P3LA 3B6GC 5AY8B 4H9RB 2F8NB 2ZY5A 3AZLB 1A7WA 4YM6C 3UTAA 3AYWC 5GT3C 3MGRD 2NQBB 2FJ7A 3EPLA 3WA9D 5B40D 3AV1D 4H9SC 3VH6T 1ZLAC 5JA4B 3AZNA 4NE5A 1ULYA 3B6FD 1P3OD 4J8WD 4WU9B 4XUJC 4R8PD 1KX4A 5B33B 3RELB 3AZGB 5B0YB 3REHB 5B32C 3KWQB 5DNMD 3AZJA 3MGSD 5B1LB 3MGPB 4J8XC 3X1TC 3F6TA 1R4VA 5B1MC 5AV6B 1P3BC 3MVDC 1KU5A 1P3PB 4Z5TA 5F99D 2Y2QA 3MGQD 1ID3B 3TU4D 4ZUXA 3AZFA 1P3KC 3NQJA 1M19C 3AZHA 3A6NA 5GT0C 1KX5B 5DNNB 3KSYA 3X1SC 3REKC 3WKJA 5JRGC 4WZSB 4XZQA 3KUYA 5B24D 3UT9C 5B2JB 1F66A 2HIOB 5GXQA 3C1CC 4J8UD 5BNXA 1JFIA 3AZMA 2IO5B 1P34A 4LD9C 3LZ0D 1T3UA 2ZY3A 5AY8C 3FDDA 3AZED 4XUJD 3WAAD 3W99B 4NE6A 1BFMA 1U35A 5C3IB 3AZLC 3KXBC 5CP6B 3NQUA 3AZKD 4JJNB 4Z2MH 5B31B 3X1UA 1EQZD 4M6BA 5CPIA 2CWEA 5AV5D 1S32D 4WU8D 2F2AC 5GSUC 5BO0A 4UPKA 1P3BD 4CAYA 1P3AD 2PYOA 3W98A 4WU9C 3W96B 3AV2A 4Z66B 5B33C 1BH9A 3A1KA 5CPKD 2BYKB 5B0YC 3REHC 3AZGC 1P3GC 4HGAB 3REIA 5AVCD 4H9QA 1TZYA 5B1LC 4UUZB 3KFUG 1P3FA 4KUDB 1HQ3D 2JCHA 3B6GB 2NZDD 3REJA 5KDMA 3MNND 4DQYB 2CV5D 1TAFA 5CPJB 1N1JB 3LELC 1ID3C 4X23C 2F8ND 2Y2KA 3LZ1A 3W97A 2RIQA 2NQBD 1P3MD 1ZLAB 3O62A 5AV8D 5AVBB 3AN2C 4E44A 2IO5C 3MGRA 3AZIB 3WA9A 5AV9B 5B40A 4DRBA 3W99C 3AV1A 4NE3A 1P3IC 3RELD 3X1TB 5CP6C 5B1MB 3KWQD 1P3OA 4JJNC 3B6FA 4J8WA 4R8PA 3MGPD 2ZM5A 1KX3A 2ZY2A 4NFTA 2G5HC 5AV6D 1P3PD 1M19B 3W96C 5DNMA 4Z66C 2Y2HA 3MGSA 1KX4B 2AROD 3REKB 3UTBD 4KGCD 3UT9B 1AOID 4HGAC 1KX5D 5DNND 4G91B 3WTPD 2FFFB 5F99A 1BH8A 3MGQA 3AZJB 3TU4A 5B2JD 4LD9B 1Q9CA 2Y2NA 2HIOD 5CPJC 3X1VD 4Z5TB 3KXBB 3B0DC 3W99D 2ZY4A 5B24A 5B2ID 4J8UA 1W2EA 4QLCC 4AWLC 2F8NK 5CP6D 1M1AC 5B0ZB 5GSUB 3LZ0A 3WKJB 5B31D 3AZEA 3KUYB 1F66B 3WAAA 3C1BC 5AVBC 4H9NB 4H9PA 3VH6W 3AZIC 2YFWA 5AV9C 1JFIB 1P34B 3AFAC 1M18D 3AZKA 1P3GB 3W96D 2W8SA 1EQZA 2BYMA 5AV5A 1S32A 4WU8A 2FJ7C 1P3AA 3NQUB 3H0RC 3LJAD 3LELB 4KUDD 2JE5A 4X23B 5CPKA 3B6GD 3AZNC 3W98B 5AVCA 3AYWD 4YM6D 5GT3D 3AV2B 1KX4C 5BNVB 1BH9B 1HQ3A 4G91C 2NZDA 2CV5A 3MNNA 3EPHA 3AN2B 1ZLAD 3AZJC 4H9QB 1TZYB 4WNNB 1P3FB 2F8NA 2DQNC 2JSSA 5KDMB 4Z5TC 1TAFB 1P3IB 2NQBA 1P3MA 2RVQC 5B32D 4ZUXC 5AV8A 3AZFC 3AZHC 3A6NC 4J8VB 2YFVB 4H9OA 2Y2MA 3X1TD 4J8XD 3W97B 5B1MD 2HUEB 4CSRB 5B0ZC 3WKJC 3O62B 5FUGA 3MVDD 3KUYC 1F66C 5GXQC 3EPJA 3RELA 5E5AB 1P3KD 3AZMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 D;  3KWQ A;  3B0C T;  5GT0 D;  5B40 B;  3MGP A;  3AV1 B;  1KX4 D;  3X1S D;  1U35 C;  4Z2M G;  3REK D;  4YS3 A;  5JRG D;  3VH5 T;  3UT9 D;  5AV6 A;  3R45 B;  1P3P A;  3C1C D;  1P3O B;  3B0C W;  1H3O A;  3X1U C;  5CPI C;  4R8P B;  2ARO A;  3V9R B;  4LD9 D;  1B6W A;  3UTB A;  3B0D B;  4KGC A;  1KX3 B;  5AY8 D;  1AOI A;  1KX5 A;  5DNN A;  3WTP A;  3AZL D;  2PYO C;  3KXB D;  3W98 C;  3AV2 C;  4QLC B;  4AWL B;  1M1A B;  5B2J A;  2HIO A;  3C1B B;  5BT1 C;  3X1V A;  3REI C;  1TZY C;  1BH8 B;  5B0Z D;  3MGQ B;  5GSU D;  1P3F C;  1WWI A;  5CHL B;  3AFA B;  1P3L B;  5B2I A;  5BS7 A;  4WU9 D;  5B33 D;  3REJ C;  3UTA B;  3AZG D;  5B0Y D;  3REH D;  1P3G D;  2FJ7 B;  5B31 A;  2LY8 A;  4J8V C;  3LZ1 C;  5B1L D;  3W97 C;  2HUE C;  3O62 C;  1M18 A;  3AZN B;  3LZ0 B;  3LEL D;  1ID3 D;  4X23 D;  5E5A C;  3MGR C;  2YFW B;  5B40 C;  3AV1 C;  4UUZ A;  3LJA A;  4KUD A;  1S32 B;  3B6G A;  3B6F C;  1P3O C;  3AN2 D;  5G49 A;  3VH5 A;  4J8W C;  1P3A B;  3AYW A;  4YM6 A;  4R8P C;  5GT3 A;  1KX3 C;  4G92 B;  4ZUX B;  5CPK B;  3AZF B;  3NQJ B;  4H9S A;  3AZH B;  3A6N B;  1P3I D;  1ZLA A;  3MGS C;  4JJN D;  4XZQ B;  4J8V D;  4XUJ A;  1P34 C;  3MNN B;  5GXQ B;  5BNX B;  3MGQ C;  3AZM B;  3TU4 C;  5B32 A;  1B67 A;  1P3L C;  5B32 G;  4Z66 D;  4KHA A;  5E5A D;  4J8X A;  3X1T A;  3UTA C;  1U35 B;  5B1M A;  1P3M B;  1P3B A;  3MVD A;  5B24 C;  5AV8 B;  4E45 A;  4J8U C;  3X1U B;  5CPI B;  4H9O B;  1P3K A;  2F8N H;  1M19 A;  5GT0 A;  5BO0 B;  3LZ0 C;  5FUG B;  5CPJ D;  3AZE C;  3WAA C;  4CAY B;  2PYO B;  3X1S A;  3REK A;  5JRG A;  1KX3 D;  3UT9 A;  3C1C A;  4DRA A;  3AZK C;  4EO5 C;  4QLC D;  3REI B;  1EQZ C;  5AV5 C;  1M1A D;  4LD9 A;  1S32 C;  4WU8 C;  4YS3 B;  5AY8 A;  4H9R A;  3C1B D;  5AVB D;  2F8N G;  3AZL A;  1P3A C;  3KXB A;  3REJ B;  1H3O B;  3AZI D;  5AV9 D;  3AFA D;  1P3L D;  2ARO B;  1WWS A;  4G92 C;  5CPK C;  3UTB B;  4KGC B;  1AOI B;  1HTA A;  3LZ1 B;  3WTP B;  5AVC C;  3UTA D;  5JA4 A;  5B0Z A;  5GSU A;  2FJ7 D;  1HQ3 C;  4XZQ C;  4WU9 A;  4H9N A;  2NZD C;  5B33 A;  2CV5 C;  3MNN C;  3X1V B;  3AZG A;  5B0Y A;  3REH A;  3MGR B;  3AZN D;  1P3G A;  3WA9 B;  5B2I B;  5B1L A;  3WTP E;  1F1E A;  2NQB C;  1P3M C;  3B6F B;  5AV8 C;  3LEL A;  4J8W B;  3AZJ D;  1ID3 A;  4X23 A;  3VH6 A;  3VH5 W;  1M18 B;  4Z5T D;  5BNV A;  5DNM B;  2RVQ D;  3MGS B;  3REL C;  4ZUX D;  3AZF D;  3KWQ C;  3AZH D;  3A6N D;  4WV4 B;  3AN2 A;  3MGP C;  4WNN A;  5F99 B;  4ZBJ B;  2L5A A;  3LJA B;  3WKJ D;  4YS3 C;  3KUY D;  4XZQ D;  1F66 D;  3TU4 B;  5AV6 C;  3W99 A;  1P3P C;  5GXQ D;  1P3I A;  5G49 B;  3AYW B;  4YM6 B;  5GT3 B;  5CP6 A;  3AZM D;  2ARO C;  1P34 D;  4JJN A;  3UTB C;  4KGC C;  4J8V A;  1AOI C;  2YFV A;  5B24 B;  5B31 G;  5DNN C;  1KX5 C;  1U35 D;  3WTP C;  4J8U B;  4CSR A;  5B2J C;  3W96 A;  2HIO C;  4Z66 A;  3AZE B;  3X1U D;  3WAA B;  4XUJ B;  5CPI D;  3X1V C;  5E5A A;  2BYK A;  4H9P B;  3WA9 C;  5B32 B;  2PYO D;  5B2I C;  5BS7 C;  3B0B A;  4EO5 B;  5C3I C;  3AZK B;  3AV2 D;  3W98 D;  4KHA B;  1EQZ B;  2BYM B;  5AV5 B;  4J8X B;  3R45 A;  4WU8 B;  5B31 C;  5CPJ A;  1N1J A;  5BT1 D;  3MVD B;  1P3B B;  3REI D;  3V9R A;  1TZY D;  4YS3 D;  1P3F D;  1P3K B;  1M18 C;  3REJ D;  5GT0 B;  4QLC A;  5DNM C;  5AVC B;  1M1A A;  3X1S B;  5JRG B;  1HQ3 B;  3C1B A;  5AVB A;  3LZ1 D;  3C1C B;  2NZD B;  2CV5 B;  3W97 D;  5F99 C;  4ZBJ C;  3LJA C;  3AZI A;  4KUD C;  5AV9 A;  3O62 D;  3AFA A;  1P3L A;  3B6G C;  5AY8 B;  4H9R B;  2F8N B;  3AZL B;  1A7W A;  4YM6 C;  3UTA A;  3AYW C;  5GT3 C;  3MGR D;  2NQB B;  2FJ7 A;  3WA9 D;  5B40 D;  3AV1 D;  4H9S C;  3VH6 T;  1ZLA C;  5JA4 B;  3AZN A;  4NE5 A;  1ULY A;  3B6F D;  1P3O D;  4J8W D;  4WU9 B;  4XUJ C;  4R8P D;  1KX4 A;  5B33 B;  3REL B;  3AZG B;  5B0Y B;  3REH B;  5B32 C;  3KWQ B;  5DNM D;  3AZJ A;  3MGS D;  5B1L B;  3MGP B;  4J8X C;  3X1T C;  5B1M C;  1R4V A;  5AV6 B;  1P3B C;  3MVD C;  1KU5 A;  1P3P B;  4Z5T A;  5F99 D;  3MGQ D;  1ID3 B;  3TU4 D;  4ZUX A;  3AZF A;  1P3K C;  3NQJ A;  1M19 C;  3AZH A;  3A6N A;  5GT0 C;  1KX5 B;  5DNN B;  3KSY A;  3X1S C;  3REK C;  3WKJ A;  5JRG C;  4WZS B;  4XZQ A;  3KUY A;  5B24 D;  3UT9 C;  5B2J B;  1F66 A;  2HIO B;  5GXQ A;  3C1C C;  4J8U D;  5BNX A;  1JFI A;  3AZM A;  2IO5 B;  1P34 A;  4LD9 C;  3LZ0 D;  5AY8 C;  3AZE D;  3WAA D;  4XUJ D;  3W99 B;  4NE6 A;  1BFM A;  1U35 A;  5C3I B;  3AZL C;  3KXB C;  5CP6 B;  3NQU A;  3AZK D;  4JJN B;  4Z2M H;  5B31 B;  3X1U A;  1EQZ D;  4M6B A;  5CPI A;  2CWE A;  5AV5 D;  1S32 D;  4WU8 D;  5GSU C;  5BO0 A;  1P3B D;  4CAY A;  1P3A D;  2PYO A;  3W98 A;  4WU9 C;  3W96 B;  3AV2 A;  4Z66 B;  5B33 C;  1BH9 A;  5CPK D;  2BYK B;  5B0Y C;  3REH C;  3AZG C;  1P3G C;  4HGA B;  3REI A;  5AVC D;  4H9Q A;  1TZY A;  5B1L C;  4UUZ B;  1P3F A;  4KUD B;  1HQ3 D;  3B6G B;  2NZD D;  3REJ A;  5KDM A;  3MNN D;  2CV5 D;  1TAF A;  5CPJ B;  1N1J B;  3LEL C;  1ID3 C;  4X23 C;  2F8N D;  3LZ1 A;  3W97 A;  2NQB D;  1P3M D;  1ZLA B;  3O62 A;  5AV8 D;  5AVB B;  3AN2 C;  4E44 A;  2IO5 C;  3MGR A;  3AZI B;  3WA9 A;  5AV9 B;  5B40 A;  4DRB A;  3W99 C;  3AV1 A;  4NE3 A;  1P3I C;  3REL D;  3X1T B;  5CP6 C;  5B1M B;  3KWQ D;  1P3O A;  4JJN C;  3B6F A;  4J8W A;  4R8P A;  3MGP D;  1KX3 A;  4NFT A;  5AV6 D;  1P3P D;  1M19 B;  3W96 C;  5DNM A;  4Z66 C;  3MGS A;  1KX4 B;  2ARO D;  3REK B;  3UTB D;  4KGC D;  3UT9 B;  1AOI D;  4HGA C;  1KX5 D;  5DNN D;  4G91 B;  3WTP D;  5F99 A;  1BH8 A;  3MGQ A;  3AZJ B;  3TU4 A;  5B2J D;  4LD9 B;  1Q9C A;  2HIO D;  5CPJ C;  3X1V D;  4Z5T B;  3KXB B;  3B0D C;  3W99 D;  5B24 A;  5B2I D;  4J8U A;  4QLC C;  4AWL C;  2F8N K;  5CP6 D;  1M1A C;  5B0Z B;  5GSU B;  3LZ0 A;  3WKJ B;  5B31 D;  3AZE A;  3KUY B;  1F66 B;  3WAA A;  3C1B C;  5AVB C;  4H9N B;  4H9P A;  3VH6 W;  3AZI C;  2YFW A;  5AV9 C;  1JFI B;  1P34 B;  3AFA C;  1M18 D;  3AZK A;  1P3G B;  3W96 D;  1EQZ A;  2BYM A;  5AV5 A;  1S32 A;  4WU8 A;  2FJ7 C;  1P3A A;  3NQU B;  3LJA D;  3LEL B;  4KUD D;  4X23 B;  5CPK A;  3B6G D;  3AZN C;  3W98 B;  5AVC A;  3AYW D;  4YM6 D;  5GT3 D;  3AV2 B;  1KX4 C;  5BNV B;  1BH9 B;  1HQ3 A;  4G91 C;  2NZD A;  2CV5 A;  3MNN A;  3AN2 B;  1ZLA D;  3AZJ C;  4H9Q B;  1TZY B;  4WNN B;  1P3F B;  2F8N A;  2JSS A;  5KDM B;  4Z5T C;  1TAF B;  1P3I B;  2NQB A;  1P3M A;  2RVQ C;  5B32 D;  4ZUX C;  5AV8 A;  3AZF C;  3AZH C;  3A6N C;  4J8V B;  2YFV B;  4H9O A;  4J8X D;  3X1T D;  3W97 B;  5B1M D;  2HUE B;  4CSR B;  5B0Z C;  3WKJ C;  3O62 B;  5FUG A;  3MVD D;  3KUY C;  1F66 C;  5GXQ C;  3REL A;  5E5A B;  1P3K D;  3AZM C; 
#chains in the Genus database with same CATH topology
 1M19 D;  3KWQ A;  3B0C T;  5GT0 D;  5B40 B;  3MGP A;  3AV1 B;  1KX4 D;  3X1S D;  1U35 C;  4Z2M G;  3REK D;  4YS3 A;  5JRG D;  3VH5 T;  3UT9 D;  5AV6 A;  3R45 B;  1P3P A;  3C1C D;  2Y2G A;  1P3O B;  3B0C W;  1H3O A;  3X1U C;  5CPI C;  4R8P B;  2ARO A;  3V9R B;  4LD9 D;  1B6W A;  3UTB A;  3B0D B;  4KGC A;  1KX3 B;  5AY8 D;  1AOI A;  1KX5 A;  5DNN A;  3WTP A;  3H0L C;  3AZL D;  3KXB D;  2PYO C;  3W98 C;  3AV2 C;  4QLC B;  4AWL B;  1M1A B;  5B2J A;  3EPK A;  2HIO A;  3C1B B;  5BT1 C;  3A1I A;  3X1V A;  3REI C;  3IP4 C;  1TZY C;  1BH8 B;  5B0Z D;  3MGQ B;  5GSU D;  1P3F C;  1WWI A;  5CHL B;  3AFA B;  1P3L B;  5B2I A;  5BS7 A;  4WU9 D;  5B33 D;  3REJ C;  3UTA B;  3AZG D;  5B0Y D;  3REH D;  1P3G D;  2FJ7 B;  5B31 A;  2LY8 A;  4J8V C;  2VQR A;  3LZ1 C;  5B1L D;  3W97 C;  2HUE C;  2DF4 C;  3O62 C;  1M18 A;  3AZN B;  3LZ0 B;  3LEL D;  1ID3 D;  4X23 D;  5E5A C;  3MGR C;  2YFW B;  5B40 C;  3AV1 C;  4UUZ A;  3LJA A;  4KUD A;  1S32 B;  3H0M C;  3B6G A;  3B6F C;  1P3O C;  3AN2 D;  5G49 A;  3VH5 A;  4J8W C;  1P3A B;  3AYW A;  4YM6 A;  4R8P C;  5GT3 A;  1PZR A;  2Y2J A;  1KX3 C;  4G92 B;  4ZUX B;  5CPK B;  3AZF B;  3NQJ B;  4H9S A;  3AZH B;  3A6N B;  1P3I D;  1ZLA A;  3MGS C;  4JJN D;  4XZQ B;  4J8V D;  4XUJ A;  4WJ3 C;  1P34 C;  3MNN B;  5GXQ B;  5BNX B;  3MGQ C;  3AZM B;  3TU4 C;  5B32 A;  2Y2I A;  1B67 A;  1P3L C;  5B32 G;  4Z66 D;  4KHA A;  5E5A D;  4J8X A;  3X1T A;  3UTA C;  1U35 B;  5B1M A;  1P3M B;  1P3B A;  3MVD A;  5B24 C;  5AV8 B;  4E45 A;  4J8U C;  3X1U B;  5CPI B;  4H9O B;  1P3K A;  2F8N H;  1M19 A;  2G5I C;  5GT0 A;  5BO0 B;  3LZ0 C;  5FUG B;  5CPJ D;  3AZE C;  3WAA C;  4CAY B;  2PYO B;  3X1S A;  3REK A;  5JRG A;  1KX3 D;  3UT9 A;  1Z2C B;  3C1C A;  4DRA A;  3EG5 B;  2XD1 A;  4EO5 C;  3AZK C;  2J8P A;  4QLC D;  3REI B;  1EQZ C;  5AV5 C;  1M1A D;  4LD9 A;  1S32 C;  4WU8 C;  4YS3 B;  5AY8 A;  4H9R A;  3C1B D;  5AVB D;  2F8N G;  3AZL A;  1P3A C;  3KXB A;  3REJ B;  1H3O B;  3AZI D;  5AV9 D;  3AFA D;  1P3L D;  2ARO B;  1WWS A;  4G92 C;  5CPK C;  3UTB B;  4KGC B;  2UWX A;  1AOI B;  1HTA A;  3LZ1 B;  3WTP B;  5AVC C;  3UTA D;  5JA4 A;  5B0Z A;  5GSU A;  2FJ7 D;  1HQ3 C;  2Y2O A;  4XZQ C;  4WU9 A;  4H9N A;  2NZD C;  5B33 A;  2CV5 C;  3MNN C;  3X1V B;  3AZG A;  5B0Y A;  3REH A;  3MGR B;  3AZN D;  1P3G A;  3WA9 B;  5B2I B;  5B1L A;  3WTP E;  1F1E A;  2NQB C;  1P3M C;  3B6F B;  5AV8 C;  3LEL A;  4J8W B;  3AZJ D;  1ID3 A;  4X23 A;  3VH6 A;  3VH5 W;  1M18 B;  4Z5T D;  5BNV A;  5DNM B;  2RVQ D;  3MGS B;  3REL C;  4ZUX D;  3AZF D;  3KWQ C;  3AZH D;  3A6N D;  4WV4 B;  3AN2 A;  3MGP C;  4WNN A;  5F99 B;  4ZBJ B;  2L5A A;  3LJA B;  3WKJ D;  4YS3 C;  3KUY D;  4XZQ D;  1F66 D;  3TU4 B;  5AV6 C;  3W99 A;  1P3P C;  5GXQ D;  1P3I A;  5G49 B;  3AYW B;  4YM6 B;  5GT3 B;  5CP6 A;  3AZM D;  2ARO C;  1P34 D;  4JJN A;  3UTB C;  4KGC C;  4J8V A;  1AOI C;  2YFV A;  5B24 B;  5B31 G;  5DNN C;  1KX5 C;  1U35 D;  3WTP C;  4J8U B;  4CSR A;  5B2J C;  3W96 A;  2HIO C;  4Z66 A;  2Y2P A;  3X1U D;  3AZE B;  3WAA B;  4XUJ B;  5CPI D;  3X1V C;  5E5A A;  3P5J B;  2BYK A;  4H9P B;  3WA9 C;  5B32 B;  2PYO D;  5B2I C;  5BS7 C;  3B0B A;  4EO5 B;  5C3I C;  3AZK B;  3AV2 D;  3W98 D;  4KHA B;  1EQZ B;  2BYM B;  5AV5 B;  4J8X B;  3R45 A;  3AL0 C;  4WU8 B;  5B31 C;  5CPJ A;  1N1J A;  5BT1 D;  3MVD B;  1P3B B;  3REI D;  3V9R A;  1TZY D;  4YS3 D;  1P3F D;  1P3K B;  1M18 C;  3REJ D;  5GT0 B;  2Y2L A;  4QLC A;  5DNM C;  5AVC B;  1M1A A;  3X1S B;  5JRG B;  1HQ3 B;  3C1B A;  5AVB A;  2BG1 A;  3LZ1 D;  2XD5 A;  3C1C B;  2NZD B;  2CV5 B;  3W97 D;  5F99 C;  4ZBJ C;  3LJA C;  3AZI A;  4KUD C;  5AV9 A;  3O62 D;  3AFA A;  1P3L A;  3B6G C;  5AY8 B;  4H9R B;  2F8N B;  2ZY5 A;  3AZL B;  1A7W A;  4YM6 C;  3UTA A;  3AYW C;  5GT3 C;  3MGR D;  2NQB B;  2FJ7 A;  3EPL A;  3WA9 D;  5B40 D;  3AV1 D;  4H9S C;  3VH6 T;  1ZLA C;  5JA4 B;  3AZN A;  4NE5 A;  1ULY A;  3B6F D;  1P3O D;  4J8W D;  4WU9 B;  4XUJ C;  4R8P D;  1KX4 A;  5B33 B;  3REL B;  3AZG B;  5B0Y B;  3REH B;  5B32 C;  3KWQ B;  5DNM D;  3AZJ A;  3MGS D;  5B1L B;  3MGP B;  4J8X C;  3X1T C;  3F6T A;  1R4V A;  5B1M C;  5AV6 B;  1P3B C;  3MVD C;  1KU5 A;  1P3P B;  4Z5T A;  5F99 D;  2Y2Q A;  3MGQ D;  1ID3 B;  3TU4 D;  4ZUX A;  3AZF A;  1P3K C;  3NQJ A;  1M19 C;  3AZH A;  3A6N A;  5GT0 C;  1KX5 B;  5DNN B;  3KSY A;  3X1S C;  3REK C;  3WKJ A;  5JRG C;  4WZS B;  4XZQ A;  3KUY A;  5B24 D;  3UT9 C;  5B2J B;  1F66 A;  2HIO B;  5GXQ A;  3C1C C;  4J8U D;  5BNX A;  1JFI A;  3AZM A;  2IO5 B;  1P34 A;  4LD9 C;  3LZ0 D;  1T3U A;  2ZY3 A;  5AY8 C;  3FDD A;  3AZE D;  4XUJ D;  3WAA D;  3W99 B;  4NE6 A;  1BFM A;  1U35 A;  5C3I B;  3AZL C;  3KXB C;  5CP6 B;  3NQU A;  3AZK D;  4JJN B;  4Z2M H;  5B31 B;  3X1U A;  1EQZ D;  4M6B A;  5CPI A;  2CWE A;  5AV5 D;  1S32 D;  4WU8 D;  2F2A C;  5GSU C;  5BO0 A;  4UPK A;  1P3B D;  4CAY A;  1P3A D;  2PYO A;  3W98 A;  4WU9 C;  3W96 B;  3AV2 A;  4Z66 B;  5B33 C;  1BH9 A;  3A1K A;  5CPK D;  2BYK B;  5B0Y C;  3REH C;  3AZG C;  1P3G C;  4HGA B;  3REI A;  5AVC D;  4H9Q A;  1TZY A;  5B1L C;  4UUZ B;  3KFU G;  1P3F A;  4KUD B;  1HQ3 D;  2JCH A;  3B6G B;  2NZD D;  3REJ A;  5KDM A;  3MNN D;  4DQY B;  2CV5 D;  1TAF A;  5CPJ B;  1N1J B;  3LEL C;  1ID3 C;  4X23 C;  2F8N D;  2Y2K A;  3LZ1 A;  3W97 A;  2RIQ A;  2NQB D;  1P3M D;  1ZLA B;  3O62 A;  5AV8 D;  5AVB B;  3AN2 C;  4E44 A;  2IO5 C;  3MGR A;  3AZI B;  3WA9 A;  5AV9 B;  5B40 A;  4DRB A;  3W99 C;  3AV1 A;  4NE3 A;  1P3I C;  3REL D;  3X1T B;  5CP6 C;  5B1M B;  3KWQ D;  1P3O A;  4JJN C;  3B6F A;  4J8W A;  4R8P A;  3MGP D;  2ZM5 A;  1KX3 A;  2ZY2 A;  4NFT A;  2G5H C;  5AV6 D;  1P3P D;  1M19 B;  3W96 C;  5DNM A;  4Z66 C;  2Y2H A;  3MGS A;  1KX4 B;  2ARO D;  3REK B;  3UTB D;  4KGC D;  3UT9 B;  1AOI D;  4HGA C;  1KX5 D;  5DNN D;  4G91 B;  3WTP D;  2FFF B;  5F99 A;  1BH8 A;  3MGQ A;  3AZJ B;  3TU4 A;  5B2J D;  4LD9 B;  1Q9C A;  2Y2N A;  2HIO D;  5CPJ C;  3X1V D;  4Z5T B;  3KXB B;  3B0D C;  3W99 D;  2ZY4 A;  5B24 A;  5B2I D;  4J8U A;  1W2E A;  4QLC C;  4AWL C;  2F8N K;  5CP6 D;  1M1A C;  5B0Z B;  5GSU B;  3LZ0 A;  3WKJ B;  5B31 D;  3AZE A;  3KUY B;  1F66 B;  3WAA A;  3C1B C;  5AVB C;  4H9N B;  4H9P A;  3VH6 W;  3AZI C;  2YFW A;  5AV9 C;  1JFI B;  1P34 B;  3AFA C;  1M18 D;  3AZK A;  1P3G B;  3W96 D;  2W8S A;  1EQZ A;  2BYM A;  5AV5 A;  1S32 A;  4WU8 A;  2FJ7 C;  1P3A A;  3NQU B;  3H0R C;  3LJA D;  3LEL B;  4KUD D;  2JE5 A;  4X23 B;  5CPK A;  3B6G D;  3AZN C;  3W98 B;  5AVC A;  3AYW D;  4YM6 D;  5GT3 D;  3AV2 B;  1KX4 C;  5BNV B;  1BH9 B;  1HQ3 A;  4G91 C;  2NZD A;  2CV5 A;  3MNN A;  3EPH A;  3AN2 B;  1ZLA D;  3AZJ C;  4H9Q B;  1TZY B;  4WNN B;  1P3F B;  2F8N A;  2DQN C;  2JSS A;  5KDM B;  4Z5T C;  1TAF B;  1P3I B;  2NQB A;  1P3M A;  2RVQ C;  5B32 D;  4ZUX C;  5AV8 A;  3AZF C;  3AZH C;  3A6N C;  4J8V B;  2YFV B;  4H9O A;  2Y2M A;  3X1T D;  4J8X D;  3W97 B;  5B1M D;  2HUE B;  4CSR B;  5B0Z C;  3WKJ C;  3O62 B;  5FUG A;  3MVD D;  3KUY C;  1F66 C;  5GXQ C;  3EPJ A;  3REL A;  5E5A B;  1P3K D;  3AZM C; 
#chains in the Genus database with same CATH homology
 1M19 D;  3KWQ A;  3B0C T;  5GT0 D;  5B40 B;  3MGP A;  3AV1 B;  1KX4 D;  3X1S D;  1U35 C;  4Z2M G;  3REK D;  4YS3 A;  5JRG D;  3VH5 T;  3UT9 D;  5AV6 A;  3R45 B;  1P3P A;  3C1C D;  2Y2G A;  1P3O B;  3B0C W;  1H3O A;  3X1U C;  5CPI C;  4R8P B;  2ARO A;  3V9R B;  4LD9 D;  1B6W A;  3UTB A;  3B0D B;  4KGC A;  1KX3 B;  5AY8 D;  1AOI A;  1KX5 A;  5DNN A;  3WTP A;  3H0L C;  3AZL D;  3KXB D;  2PYO C;  3W98 C;  3AV2 C;  4QLC B;  4AWL B;  1M1A B;  5B2J A;  3EPK A;  2HIO A;  3C1B B;  5BT1 C;  3A1I A;  3X1V A;  3REI C;  3IP4 C;  1TZY C;  1BH8 B;  5B0Z D;  3MGQ B;  5GSU D;  1P3F C;  1WWI A;  5CHL B;  3AFA B;  1P3L B;  5B2I A;  5BS7 A;  4WU9 D;  5B33 D;  3REJ C;  3UTA B;  3AZG D;  5B0Y D;  3REH D;  1P3G D;  2FJ7 B;  5B31 A;  2LY8 A;  4J8V C;  2VQR A;  3LZ1 C;  5B1L D;  3W97 C;  2HUE C;  2DF4 C;  3O62 C;  1M18 A;  3AZN B;  3LZ0 B;  3LEL D;  1ID3 D;  4X23 D;  5E5A C;  3MGR C;  2YFW B;  5B40 C;  3AV1 C;  4UUZ A;  3LJA A;  4KUD A;  1S32 B;  3H0M C;  3B6G A;  3B6F C;  1P3O C;  3AN2 D;  5G49 A;  3VH5 A;  4J8W C;  1P3A B;  3AYW A;  4YM6 A;  4R8P C;  5GT3 A;  1PZR A;  2Y2J A;  1KX3 C;  4G92 B;  4ZUX B;  5CPK B;  3AZF B;  3NQJ B;  4H9S A;  3AZH B;  3A6N B;  1P3I D;  1ZLA A;  3MGS C;  4JJN D;  4XZQ B;  4J8V D;  4XUJ A;  4WJ3 C;  1P34 C;  3MNN B;  5GXQ B;  5BNX B;  3MGQ C;  3AZM B;  3TU4 C;  5B32 A;  2Y2I A;  1B67 A;  1P3L C;  5B32 G;  4Z66 D;  4KHA A;  5E5A D;  4J8X A;  3X1T A;  3UTA C;  1U35 B;  5B1M A;  1P3M B;  1P3B A;  3MVD A;  5B24 C;  5AV8 B;  4E45 A;  4J8U C;  3X1U B;  5CPI B;  4H9O B;  1P3K A;  2F8N H;  1M19 A;  2G5I C;  5GT0 A;  5BO0 B;  3LZ0 C;  5FUG B;  5CPJ D;  3AZE C;  3WAA C;  4CAY B;  2PYO B;  3X1S A;  3REK A;  5JRG A;  1KX3 D;  3UT9 A;  1Z2C B;  3C1C A;  4DRA A;  3EG5 B;  2XD1 A;  4EO5 C;  3AZK C;  2J8P A;  4QLC D;  3REI B;  1EQZ C;  5AV5 C;  1M1A D;  4LD9 A;  1S32 C;  4WU8 C;  4YS3 B;  5AY8 A;  4H9R A;  3C1B D;  5AVB D;  2F8N G;  3AZL A;  1P3A C;  3KXB A;  3REJ B;  1H3O B;  3AZI D;  5AV9 D;  3AFA D;  1P3L D;  2ARO B;  1WWS A;  4G92 C;  5CPK C;  3UTB B;  4KGC B;  2UWX A;  1AOI B;  1HTA A;  3LZ1 B;  3WTP B;  5AVC C;  3UTA D;  5JA4 A;  5B0Z A;  5GSU A;  2FJ7 D;  1HQ3 C;  2Y2O A;  4XZQ C;  4WU9 A;  4H9N A;  2NZD C;  5B33 A;  2CV5 C;  3MNN C;  3X1V B;  3AZG A;  5B0Y A;  3REH A;  3MGR B;  3AZN D;  1P3G A;  3WA9 B;  5B2I B;  5B1L A;  3WTP E;  1F1E A;  2NQB C;  1P3M C;  3B6F B;  5AV8 C;  3LEL A;  4J8W B;  3AZJ D;  1ID3 A;  4X23 A;  3VH6 A;  3VH5 W;  1M18 B;  4Z5T D;  5BNV A;  5DNM B;  2RVQ D;  3MGS B;  3REL C;  4ZUX D;  3AZF D;  3KWQ C;  3AZH D;  3A6N D;  4WV4 B;  3AN2 A;  3MGP C;  4WNN A;  5F99 B;  4ZBJ B;  2L5A A;  3LJA B;  3WKJ D;  4YS3 C;  3KUY D;  4XZQ D;  1F66 D;  3TU4 B;  5AV6 C;  3W99 A;  1P3P C;  5GXQ D;  1P3I A;  5G49 B;  3AYW B;  4YM6 B;  5GT3 B;  5CP6 A;  3AZM D;  2ARO C;  1P34 D;  4JJN A;  3UTB C;  4KGC C;  4J8V A;  1AOI C;  2YFV A;  5B24 B;  5B31 G;  5DNN C;  1KX5 C;  1U35 D;  3WTP C;  4J8U B;  4CSR A;  5B2J C;  3W96 A;  2HIO C;  4Z66 A;  2Y2P A;  3X1U D;  3AZE B;  3WAA B;  4XUJ B;  5CPI D;  3X1V C;  5E5A A;  3P5J B;  2BYK A;  4H9P B;  3WA9 C;  5B32 B;  2PYO D;  5B2I C;  5BS7 C;  3B0B A;  4EO5 B;  5C3I C;  3AZK B;  3AV2 D;  3W98 D;  4KHA B;  1EQZ B;  2BYM B;  5AV5 B;  4J8X B;  3R45 A;  3AL0 C;  4WU8 B;  5B31 C;  5CPJ A;  1N1J A;  5BT1 D;  3MVD B;  1P3B B;  3REI D;  3V9R A;  1TZY D;  4YS3 D;  1P3F D;  1P3K B;  1M18 C;  3REJ D;  5GT0 B;  2Y2L A;  4QLC A;  5DNM C;  5AVC B;  1M1A A;  3X1S B;  5JRG B;  1HQ3 B;  3C1B A;  5AVB A;  2BG1 A;  3LZ1 D;  2XD5 A;  3C1C B;  2NZD B;  2CV5 B;  3W97 D;  5F99 C;  4ZBJ C;  3LJA C;  3AZI A;  4KUD C;  5AV9 A;  3O62 D;  3AFA A;  1P3L A;  3B6G C;  5AY8 B;  4H9R B;  2F8N B;  2ZY5 A;  3AZL B;  1A7W A;  4YM6 C;  3UTA A;  3AYW C;  5GT3 C;  3MGR D;  2NQB B;  2FJ7 A;  3EPL A;  3WA9 D;  5B40 D;  3AV1 D;  4H9S C;  3VH6 T;  1ZLA C;  5JA4 B;  3AZN A;  4NE5 A;  1ULY A;  3B6F D;  1P3O D;  4J8W D;  4WU9 B;  4XUJ C;  4R8P D;  1KX4 A;  5B33 B;  3REL B;  3AZG B;  5B0Y B;  3REH B;  5B32 C;  3KWQ B;  5DNM D;  3AZJ A;  3MGS D;  5B1L B;  3MGP B;  4J8X C;  3X1T C;  3F6T A;  1R4V A;  5B1M C;  5AV6 B;  1P3B C;  3MVD C;  1KU5 A;  1P3P B;  4Z5T A;  5F99 D;  2Y2Q A;  3MGQ D;  1ID3 B;  3TU4 D;  4ZUX A;  3AZF A;  1P3K C;  3NQJ A;  1M19 C;  3AZH A;  3A6N A;  5GT0 C;  1KX5 B;  5DNN B;  3KSY A;  3X1S C;  3REK C;  3WKJ A;  5JRG C;  4WZS B;  4XZQ A;  3KUY A;  5B24 D;  3UT9 C;  5B2J B;  1F66 A;  2HIO B;  5GXQ A;  3C1C C;  4J8U D;  5BNX A;  1JFI A;  3AZM A;  2IO5 B;  1P34 A;  4LD9 C;  3LZ0 D;  1T3U A;  2ZY3 A;  5AY8 C;  3FDD A;  3AZE D;  4XUJ D;  3WAA D;  3W99 B;  4NE6 A;  1BFM A;  1U35 A;  5C3I B;  3AZL C;  3KXB C;  5CP6 B;  3NQU A;  3AZK D;  4JJN B;  4Z2M H;  5B31 B;  3X1U A;  1EQZ D;  4M6B A;  5CPI A;  2CWE A;  5AV5 D;  1S32 D;  4WU8 D;  2F2A C;  5GSU C;  5BO0 A;  4UPK A;  1P3B D;  4CAY A;  1P3A D;  2PYO A;  3W98 A;  4WU9 C;  3W96 B;  3AV2 A;  4Z66 B;  5B33 C;  1BH9 A;  3A1K A;  5CPK D;  2BYK B;  5B0Y C;  3REH C;  3AZG C;  1P3G C;  4HGA B;  3REI A;  5AVC D;  4H9Q A;  1TZY A;  5B1L C;  4UUZ B;  3KFU G;  1P3F A;  4KUD B;  1HQ3 D;  2JCH A;  3B6G B;  2NZD D;  3REJ A;  5KDM A;  3MNN D;  4DQY B;  2CV5 D;  1TAF A;  5CPJ B;  1N1J B;  3LEL C;  1ID3 C;  4X23 C;  2F8N D;  2Y2K A;  3LZ1 A;  3W97 A;  2RIQ A;  2NQB D;  1P3M D;  1ZLA B;  3O62 A;  5AV8 D;  5AVB B;  3AN2 C;  4E44 A;  2IO5 C;  3MGR A;  3AZI B;  3WA9 A;  5AV9 B;  5B40 A;  4DRB A;  3W99 C;  3AV1 A;  4NE3 A;  1P3I C;  3REL D;  3X1T B;  5CP6 C;  5B1M B;  3KWQ D;  1P3O A;  4JJN C;  3B6F A;  4J8W A;  4R8P A;  3MGP D;  2ZM5 A;  1KX3 A;  2ZY2 A;  4NFT A;  2G5H C;  5AV6 D;  1P3P D;  1M19 B;  3W96 C;  5DNM A;  4Z66 C;  2Y2H A;  3MGS A;  1KX4 B;  2ARO D;  3REK B;  3UTB D;  4KGC D;  3UT9 B;  1AOI D;  4HGA C;  1KX5 D;  5DNN D;  4G91 B;  3WTP D;  2FFF B;  5F99 A;  1BH8 A;  3MGQ A;  3AZJ B;  3TU4 A;  5B2J D;  4LD9 B;  1Q9C A;  2Y2N A;  2HIO D;  5CPJ C;  3X1V D;  4Z5T B;  3KXB B;  3B0D C;  3W99 D;  2ZY4 A;  5B24 A;  5B2I D;  4J8U A;  1W2E A;  4QLC C;  4AWL C;  2F8N K;  5CP6 D;  1M1A C;  5B0Z B;  5GSU B;  3LZ0 A;  3WKJ B;  5B31 D;  3AZE A;  3KUY B;  1F66 B;  3WAA A;  3C1B C;  5AVB C;  4H9N B;  4H9P A;  3VH6 W;  3AZI C;  2YFW A;  5AV9 C;  1JFI B;  1P34 B;  3AFA C;  1M18 D;  3AZK A;  1P3G B;  3W96 D;  2W8S A;  1EQZ A;  2BYM A;  5AV5 A;  1S32 A;  4WU8 A;  2FJ7 C;  1P3A A;  3NQU B;  3H0R C;  3LJA D;  3LEL B;  4KUD D;  2JE5 A;  4X23 B;  5CPK A;  3B6G D;  3AZN C;  3W98 B;  5AVC A;  3AYW D;  4YM6 D;  5GT3 D;  3AV2 B;  1KX4 C;  5BNV B;  1BH9 B;  1HQ3 A;  4G91 C;  2NZD A;  2CV5 A;  3MNN A;  3EPH A;  3AN2 B;  1ZLA D;  3AZJ C;  4H9Q B;  1TZY B;  4WNN B;  1P3F B;  2F8N A;  2DQN C;  2JSS A;  5KDM B;  4Z5T C;  1TAF B;  1P3I B;  2NQB A;  1P3M A;  2RVQ C;  5B32 D;  4ZUX C;  5AV8 A;  3AZF C;  3AZH C;  3A6N C;  4J8V B;  2YFV B;  4H9O A;  2Y2M A;  3X1T D;  4J8X D;  3W97 B;  5B1M D;  2HUE B;  4CSR B;  5B0Z C;  3WKJ C;  3O62 B;  5FUG A;  3MVD D;  3KUY C;  1F66 C;  5GXQ C;  3EPJ A;  3REL A;  5E5A B;  1P3K D;  3AZM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...