1P3FA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fA00
5GSUC 4XUJB 2F8NH 1HQ3A 3WAAB 5BNVB 1TAFB 3WAAC 3UT9A 2NZDA 4WU9A 3O62C 5C3IB 1M1AA 5AVBD 1B6WA 3A6NB 3MGQA 1P3AD 3AZEA 4WNNA 3MGRD 3W96D 3AZHC 1ID3D 3UTBC 1P3IC 4H9RB 2JSSA 4YS3A 1KU5A 3B0DB 1U35A 3W97A 1P3PD 5AVCC 2IO5B 3UTAD 1M19B 3WA9B 3WA9C 3AZLD 1F66D 5GT3D 2PYOB 5B40B 5BT1D 5B1MA 4J8UB 2YFVB 1P3BC 4QLCB 1ZLAC 1HTAA 5BNXA 5DNND 5GXQA 4R8PB 3AZMB 1P3KB 3C1BB 1AOIC 3LZ0D 3KWQB 3LZ1A 4J8WC 5E5AB 1P34D 1P3LD 3B6FA 3AFAA 4G92B 4JJNB 4G92C 4NE3A 3REHC 1P3GA 1P3FA 3X1VC 1P3MA 3AZGD 5JRGB 4KGCB 3AYWC 4J8VC 5B31A 5AV5A 5F99B 5CPKA 3WAAD 1WWSA 3O62D 3TU4B 4KUDA 4J8XC 3C1CA 1N1JA 5GSUA 4ZUXB 4XZQC 4HGAC 1TZYB 1M18A 4ZBJC 3UTBD 5BO0B 1P3ID 5CPIA 3AN2A 5B1LA 3W98B 3WTPA 3MGSC 2BYMA 3AZJC 3AV2C 5CPJC 1EQZB 5AVCD 3REJA 3KXBB 2CV5B 3AV1A 3WA9D 3X1UB 5B40D 2HIOB 3W99A 2F8NK 5B0YC 4CAYA 1P3BD 5CP6A 4H9OA 1ZLAD 4Z5TA 1JFIA 1P3AC 3MGRC 5B31G 1HQ3B 3C1BD 4WU9B 5E5AD 3NQJA 3B6GC 5AV9A 2F8NA 3MGQB 3AZEB 3AZNC 4WNNB 1P3PC 5AY8C 3X1VD 3MNNC 1AOIA 4J8WA 2AROA 4KGCD 1P3OA 4J8VD 4YM6A 4X23A 4YS3B 5F99D 3REHA 4NFTA 1U35B 2NQBC 5B32B 5DNNC 3X1TA 2FJ7B 3NQUA 4J8XD 4H9NA 3AZFA 1KX5A 5B33A 3AYWA 4NE5A 5B1MB 1S32A 5AV8C 4WU8C 4Z66B 5BNXB 5GXQB 1BH8A 3VH5T 3MGSD 5B2IC 3AZJD 1A7WA 3AV2D 3LELA 4XZQA 4H9SA 3LZ1B 5DNMA 1KX3A 3KXBD 3LJAA 3KUYA 3B6FB 2F8NG 3WKJA 4XUJC 3X1UD 5BS7A 3MGPB 2HIOD 1P3FB 5B0YD 5C3IC 5GT0A 3REKA 5AV6B 1P3MB 1KX4A 5AV6C 3A6NC 5AV5B 5FUGA 5CPKB 4AWLB 4KUDB 4Z2MG 5AVBA 3B6GD 1P3AA 3B0DC 1N1JB 3MGRA 3VH5W 3AZND 5AY8D 3W96A 2IO5C 3MNND 1M19C 1M18B 1ID3A 4H9PA 3RELB 2PYOC 3RELC 5B40C 5CPIB 5B1LB 3WTPB 2BYMB 4J8UC 1B67A 2NQBD 5B32D 4QLCC 3UTAA 3REJB 2FJ7D 3AZLA 3AZMC 4R8PC 5GT3A 3AV1B 1F66A 1P3KC 1BH9B 3C1BC 3REIB 4EO5B 3KWQC 3VH5A 5E5AC 4CAYB 5CP6B 4H9OB 5AV8D 4WU8D 4Z5TB 4Z66D 1JFIB 4JJNC 5B2ID 3MVDB 3AZKA 3R45A 3MVDC 3LZ0A 1P34A 3WTPE 5JRGC 1P3LA 4KGCC 3NQJB 1H3OA 3B6FD 5AV9B 5G49A 5F99C 4XUJD 3MGPD 1P3FD 3AZGA 3TU4C 5AV6D 3A6ND 1P3OB 4LD9B 4ZUXC 4X23B 5AV5D 3WAAA 3B0CT 1TZYC 3O62A 3NQUB 4H9NB 3AZFB 3W98C 5B33B 1EQZC 5B0ZB 3KXBC 1M19D 3AZHA 2CV5C 3UTBA 5KDMB 1S32B 2PYOD 1P3IA 3X1UC 5B24B 3RELD 5B24C 3X1SB 3X1SC 2HIOC 4WV4B 5CPID 1BH8B 4J8UD 3LELB 5AVCA 4QLCD 1R4VA 5B2JB 3AZIB 5B2JC 5DNMB 3AZIC 3LJAB 3KUYB 3AZMD 4R8PD 1KX3B 3WA9A 3WKJB 5B40A 1P3KD 1HQ3C 3REID 3UT9B 2NZDB 3KWQD 3UT9C 3B0CW 1P3BA 2HUEB 4WU9C 2NZDC 3REKB 1ZLAA 1M1AB 1KX4B 1M1AC 4JJND 3MGQC 3AZEC 5FUGB 3MVDD 1Q9CA 5JRGD 4KHAA 1ULYA 5E5AA 5AVBB 4YS3C 1U35C 3W97B 5B32C 3X1VA 2YFWA 3W96B 3TU4D 2FJ7C 1ID3B 4H9PB 4J8VA 4LD9D 4ZUXD 5F99A 4CSRA 5B1MC 1TZYD 4M6BA 1F1EA 3UTAB 4Z66C 4J8XA 3AZLB 5GXQC 5GT3B 3W98D 1EQZD 5B0ZD 3LZ1C 2CV5D 3B6FC 3AFAB 1P3GB 5B24D 1P3GC 3X1SD 3MGSA 3AZJA 3AV2A 3MGPC 5CPJA 1P3FC 3AZKB 3R45B 1P3MC 1P34B 1P3LB 5B2JD 3AZID 3LJAD 1H3OB 5B31B 5B31C 5G49B 2LY8A 5AV5C 1HQ3D 5CPKC 2HIOA 2RVQC 3UT9D 2NZDD 5B0YA 4WU9D 4AWLC 3AZGB 4KUDC 1M1AD 3C1CB 4G91B 3VH6T 5GSUB 3MGQD 3C1CC 3V9RA 3AZED 5CHLB 5JA4A 1M18C 3O62B 3B6GA 3AN2B 5CPIC 3AN2C 5B1LC 4YS3D 2BYKA 3WTPC 1P3PA 3AZNA 1U35D 3B0BA 5AY8A 3W97D 3MNNA 3REJC 3AZHB 3AV1C 3UTBB 1P3IB 4Z2MH 3REIC 4EO5C 3W99B 3W99C 2NQBA 5B1MD 5B32A 5AVCB 5DNNA 5CP6C 2FJ7A 4Z5TC 4H9QA 5GXQD 3VH6W 3LZ1D 4UUZA 1P3BB 5AV8A 4WU8A 1ZLAB 2F8NB 5AV9C 4Z66A 3AFAD 1P3GD 5B2IA 3AZKD 1AOIB 1P3MD 4J8WB 2AROB 4KHAB 2AROC 4LD9C 1P3OC 4YM6B 4XUJA 5B31D 4NE6A 4YM6C 2L5AA 4X23C 3REHB 5BNVA 1TAFA 1BFMA 5CPKD 2RVQD 3VH6A 3MGPA 3X1VB 3X1TB 4DRBA 2YFWB 3X1TC 5AV6A 4KUDD 1KX5B 3A6NA 3AZFC 1KX5C 3AYWB 4J8VB 3C1CD 5B33C 5GSUD 5B0ZC 4CSRB 5B32G 1M18D 1S32C 4J8XB 4H9RA 3AN2D 5B1LD 3WTPD 4XZQB 4HGAB 3LELC 4H9SC 1M19A 3REJD 5DNMC 1KX3C 3LJAC 3KUYC 3AV1D 3AZHD 4ZBJB 2PYOA 3RELA 3WKJC 5BS7C 3MGSB 3AZJB 4J8UA 3AV2B 5CPJB 3W99D 2YFVA 2HUEC 5GT0B 4QLCA 4E44A 5GT0C 5CP6D 3REKC 1KX4C 3AZMA 4R8PA 4Z5TD 1P3KA 4DRAA 3C1BA 1BH9A 3REIA 3KSYA 3KWQA 1WWIA 5B0YB 2CWEA 4E45A 5AVBC 5AV9D 2F8ND 4JJNA 1P3AB 3MGRB 3V9RB 3W97C 3MVDA 3W96C 5JA4B 5JRGA 1AOID 4KGCA 4J8WD 1ID3C 2AROD 3B6GB 1P3OD 4YM6D 4X23D 2BYKB 3REHD 1P3PB 3AZNB 5AY8B 3TU4A 3MNNB 3UTAC 3X1TD 1F66B 3AZLC 1F66C 5GT3C 3AZFD 1KX5D 5BT1C 4LD9A 4ZUXA 5B33D 3AYWD 4WZSB 1TZYA 2NQBB 5DNNB 1S32D 5BO0A 3AFAC 4H9QB 3W98A 1EQZA 3AZKC 5B0ZA 3LZ0B 4XZQD 3LELD 3LZ0C 3KXBA 1P34C 4UUZB 5DNMD 2CV5A 1P3LC 1KX3D 3KUYD 5AV8B 4WU8B 5KDMA 3X1UA 3WKJD 5B24A 3X1SA 5B2IB 5CPJD 3AZGC 3REKD 5GT0D 1KX4D 5B2JA 3AZIA 4G91C
chains in the Genus database with same CATH superfamily
5GSUC 4XUJB 2F8NH 1HQ3A 3WAAB 5BNVB 1TAFB 3WAAC 3UT9A 2NZDA 2ZY4A 4WU9A 3O62C 5C3IB 3IP4C 1M1AA 5AVBD 1B6WA 3A6NB 3MGQA 1P3AD 3AZEA 4WNNA 3MGRD 3W96D 3AZHC 1ID3D 3UTBC 2DQNC 1P3IC 4H9RB 2JSSA 4YS3A 1KU5A 3B0DB 3H0MC 1U35A 3W97A 1P3PD 5AVCC 2IO5B 3UTAD 1M19B 3WA9B 3WA9C 3AZLD 1F66D 5GT3D 2PYOB 5B40B 5BT1D 5B1MA 4J8UB 2YFVB 1P3BC 4QLCB 1ZLAC 1HTAA 5BNXA 5DNND 5GXQA 4R8PB 3AZMB 1P3KB 3C1BB 1AOIC 3LZ0D 3KWQB 3LZ1A 4J8WC 3H0RC 5E5AB 1P34D 1P3LD 3B6FA 2Y2JA 3AFAA 4G92B 4JJNB 4G92C 4NE3A 3REHC 1P3GA 1P3FA 3X1VC 1P3MA 3AZGD 5JRGB 4KGCB 4DQYB 3AYWC 4J8VC 5B31A 5AV5A 5F99B 5CPKA 3WAAD 1WWSA 2Y2NA 3O62D 3TU4B 4KUDA 4J8XC 2UWXA 3C1CA 1N1JA 5GSUA 4ZUXB 4XZQC 4HGAC 1TZYB 1M18A 4ZBJC 3UTBD 5BO0B 1P3ID 5CPIA 3AN2A 5B1LA 3W98B 3WTPA 3MGSC 2BYMA 3AZJC 3AV2C 5CPJC 1EQZB 5AVCD 3REJA 3KXBB 2CV5B 3AV1A 3WA9D 3X1UB 2Y2OA 5B40D 2HIOB 3W99A 2F8NK 5B0YC 4CAYA 1P3BD 5CP6A 4H9OA 1ZLAD 4Z5TA 1JFIA 1P3AC 3MGRC 5B31G 1HQ3B 3C1BD 4WU9B 5E5AD 3NQJA 4UPKA 3B6GC 5AV9A 2F8NA 3MGQB 3AZEB 3AZNC 4WNNB 1P3PC 1W2EA 5AY8C 3X1VD 3MNNC 1AOIA 4J8WA 2AROA 4KGCD 1P3OA 4J8VD 4YM6A 4X23A 4YS3B 5F99D 3REHA 4NFTA 1U35B 2NQBC 5B32B 5DNNC 3X1TA 2FJ7B 3NQUA 4J8XD 4H9NA 3AZFA 1KX5A 2ZY3A 5B33A 3AYWA 4NE5A 5B1MB 1S32A 5AV8C 4WU8C 4Z66B 5BNXB 5GXQB 1BH8A 3VH5T 3MGSD 5B2IC 3AZJD 1A7WA 3AV2D 3LELA 4XZQA 4H9SA 3LZ1B 3EPKA 5DNMA 1KX3A 3KXBD 3LJAA 3KUYA 2BG1A 3B6FB 2F8NG 3WKJA 4XUJC 3X1UD 5BS7A 3MGPB 2HIOD 1P3FB 2FFFB 2Y2PA 2ZY2A 5B0YD 5C3IC 5GT0A 3REKA 5AV6B 1P3MB 1KX4A 5AV6C 3A6NC 5AV5B 5FUGA 5CPKB 4AWLB 4KUDB 4Z2MG 5AVBA 3B6GD 3A1IA 1P3AA 3KFUG 3B0DC 1N1JB 3MGRA 3VH5W 3AZND 5AY8D 3W96A 2IO5C 3MNND 1M19C 1M18B 1ID3A 4H9PA 3RELB 2PYOC 4WJ3C 3RELC 5B40C 3EPLA 5CPIB 5B1LB 3WTPB 2BYMB 4J8UC 1B67A 2NQBD 5B32D 4QLCC 3UTAA 3REJB 2FJ7D 3AZLA 3AZMC 4R8PC 2G5HC 5GT3A 3AV1B 1F66A 1P3KC 1BH9B 2W8SA 3C1BC 3REIB 4EO5B 3KWQC 3VH5A 5E5AC 2Y2IA 4CAYB 5CP6B 4H9OB 5AV8D 4WU8D 4Z5TB 4Z66D 1JFIB 4JJNC 2Y2GA 5B2ID 3MVDB 3AZKA 3R45A 3MVDC 3LZ0A 1P34A 3WTPE 5JRGC 1P3LA 4KGCC 3NQJB 1H3OA 3B6FD 5AV9B 2G5IC 5G49A 5F99C 2RIQA 4XUJD 3MGPD 1P3FD 3AZGA 3TU4C 5AV6D 3A6ND 1P3OB 4LD9B 4ZUXC 4X23B 5AV5D 3WAAA 3B0CT 1TZYC 3O62A 3NQUB 4H9NB 3AZFB 3W98C 5B33B 1EQZC 5B0ZB 3KXBC 1M19D 3AZHA 2CV5C 3EPHA 3UTBA 5KDMB 1S32B 2PYOD 1P3IA 3X1UC 5B24B 3RELD 5B24C 3X1SB 3X1SC 2HIOC 4WV4B 5CPID 1BH8B 4J8UD 3LELB 5AVCA 4QLCD 1R4VA 5B2JB 3AZIB 3FDDA 5B2JC 5DNMB 1T3UA 1PZRA 3LJAB 3KUYB 4R8PD 3AZMD 3AZIC 1KX3B 3WA9A 3WKJB 5B40A 1P3KD 1HQ3C 3REID 3UT9B 2NZDB 3KWQD 3UT9C 3B0CW 1P3BA 2HUEB 4WU9C 2NZDC 3REKB 1ZLAA 1M1AB 1KX4B 1M1AC 4JJND 3MGQC 3AZEC 5FUGB 3MVDD 1Q9CA 2Y2LA 5JRGD 4KHAA 1ULYA 5E5AA 5AVBB 4YS3C 1U35C 3W97B 5B32C 3X1VA 2YFWA 3W96B 3TU4D 2FJ7C 1ID3B 4H9PB 2XD1A 3P5JB 4J8VA 4LD9D 4ZUXD 5F99A 4CSRA 5B1MC 3EPJA 1TZYD 4M6BA 1F1EA 3UTAB 4Z66C 4J8XA 3AZLB 5GXQC 5GT3B 3W98D 1EQZD 3F6TA 5B0ZD 3LZ1C 2CV5D 3B6FC 2Y2HA 3AFAB 1P3GB 5B24D 1P3GC 3X1SD 3MGSA 3AZJA 2ZY5A 3MGPC 3AV2A 5CPJA 1P3FC 3AZKB 3R45B 1P3MC 1P34B 1P3LB 1Z2CB 5B2JD 3AZID 3LJAD 1H3OB 5B31B 5B31C 5G49B 2LY8A 5AV5C 1HQ3D 5CPKC 2HIOA 2RVQC 3UT9D 2NZDD 5B0YA 4WU9D 4AWLC 3AZGB 4KUDC 1M1AD 3C1CB 4G91B 3VH6T 5GSUB 3MGQD 3C1CC 3V9RA 3AZED 5CHLB 5JA4A 1M18C 3O62B 3B6GA 3AN2B 5CPIC 3AN2C 5B1LC 2J8PA 2BYKA 4YS3D 3WTPC 3A1KA 3AZNA 1U35D 1P3PA 3B0BA 5AY8A 3W97D 3MNNA 3REJC 2F2AC 3AZHB 3AV1C 3UTBB 1P3IB 2DF4C 4Z2MH 3REIC 4EO5C 3W99B 3H0LC 3W99C 5B1MD 2NQBA 5B32A 5AVCB 5DNNA 5CP6C 2FJ7A 4Z5TC 4H9QA 5GXQD 3VH6W 2XD5A 3LZ1D 4UUZA 1P3BB 5AV8A 4WU8A 1ZLAB 2F8NB 5AV9C 4Z66A 3AFAD 1P3GD 5B2IA 3AZKD 1AOIB 1P3MD 4J8WB 2AROB 4KHAB 2AROC 4LD9C 1P3OC 4YM6B 4XUJA 5B31D 2JCHA 4NE6A 2L5AA 4YM6C 4X23C 5BNVA 1TAFA 3REHB 5CPKD 2RVQD 1BFMA 3VH6A 3MGPA 3X1VB 3X1TB 4DRBA 2YFWB 2JE5A 3X1TC 5AV6A 4KUDD 1KX5B 3A6NA 3AZFC 1KX5C 3AYWB 4J8VB 3C1CD 5B33C 5GSUD 5B0ZC 4CSRB 5B32G 1M18D 3EG5B 1S32C 4J8XB 4H9RA 3AN2D 5B1LD 3WTPD 4XZQB 4HGAB 3LELC 4H9SC 1M19A 3REJD 5DNMC 1KX3C 3LJAC 3KUYC 3AV1D 3AZHD 4ZBJB 2PYOA 3RELA 3WKJC 5BS7C 3MGSB 3AZJB 2Y2KA 4J8UA 3AV2B 3W99D 2YFVA 5CPJB 2HUEC 5GT0B 4QLCA 4E44A 5GT0C 5CP6D 3REKC 1KX4C 3AZMA 4R8PA 4Z5TD 1P3KA 4DRAA 3C1BA 1BH9A 3REIA 3KSYA 3KWQA 1WWIA 5B0YB 2CWEA 4E45A 5AVBC 5AV9D 2F8ND 4JJNA 1P3AB 3MGRB 3V9RB 3W97C 3MVDA 3W96C 2VQRA 5JA4B 5JRGA 1AOID 4KGCA 4J8WD 1ID3C 2AROD 3B6GB 1P3OD 4YM6D 4X23D 2BYKB 3REHD 1P3PB 3AZNB 5AY8B 3AL0C 3TU4A 3MNNB 3UTAC 3X1TD 1F66B 3AZLC 1F66C 5GT3C 3AZFD 1KX5D 5BT1C 4LD9A 4ZUXA 5B33D 3AYWD 4WZSB 1TZYA 2NQBB 5DNNB 2Y2MA 1S32D 5BO0A 3AFAC 4H9QB 3W98A 1EQZA 3AZKC 5B0ZA 3LZ0B 4XZQD 3LELD 3LZ0C 3KXBA 2Y2QA 1P34C 4UUZB 5DNMD 2CV5A 1P3LC 1KX3D 3KUYD 5AV8B 4WU8B 5KDMA 3X1UA 3WKJD 5B24A 3X1SA 5B2IB 5CPJD 3AZGC 3REKD 5GT0D 1KX4D 5B2JA 3AZIA 4G91C 2ZM5A
chains in the Genus database with same CATH topology
5GSUC 4XUJB 2F8NH 1HQ3A 3WAAB 5BNVB 1TAFB 3WAAC 3UT9A 2NZDA 2ZY4A 4WU9A 3O62C 5C3IB 3IP4C 1M1AA 5AVBD 1B6WA 3A6NB 3MGQA 1P3AD 3AZEA 4WNNA 3MGRD 3W96D 3AZHC 1ID3D 3UTBC 2DQNC 1P3IC 4H9RB 2JSSA 4YS3A 1KU5A 3B0DB 3H0MC 1U35A 3W97A 1P3PD 5AVCC 2IO5B 3UTAD 1M19B 3WA9B 3WA9C 3AZLD 1F66D 5GT3D 2PYOB 5B40B 5BT1D 5B1MA 4J8UB 2YFVB 1P3BC 4QLCB 1ZLAC 1HTAA 5BNXA 5DNND 5GXQA 4R8PB 3AZMB 1P3KB 3C1BB 1AOIC 3LZ0D 3KWQB 3LZ1A 4J8WC 3H0RC 5E5AB 1P34D 1P3LD 3B6FA 2Y2JA 3AFAA 4G92B 4JJNB 4G92C 4NE3A 3REHC 1P3GA 1P3FA 3X1VC 1P3MA 3AZGD 5JRGB 4KGCB 4DQYB 3AYWC 4J8VC 5B31A 5AV5A 5F99B 5CPKA 3WAAD 1WWSA 2Y2NA 3O62D 3TU4B 4KUDA 4J8XC 2UWXA 3C1CA 1N1JA 5GSUA 4ZUXB 4XZQC 4HGAC 1TZYB 1M18A 4ZBJC 3UTBD 5BO0B 1P3ID 5CPIA 3AN2A 5B1LA 3W98B 3WTPA 3MGSC 2BYMA 3AZJC 3AV2C 5CPJC 1EQZB 5AVCD 3REJA 3KXBB 2CV5B 3AV1A 3WA9D 3X1UB 2Y2OA 5B40D 2HIOB 3W99A 2F8NK 5B0YC 4CAYA 1P3BD 5CP6A 4H9OA 1ZLAD 4Z5TA 1JFIA 1P3AC 3MGRC 5B31G 1HQ3B 3C1BD 4WU9B 5E5AD 3NQJA 4UPKA 3B6GC 5AV9A 2F8NA 3MGQB 3AZEB 3AZNC 4WNNB 1P3PC 1W2EA 5AY8C 3X1VD 3MNNC 1AOIA 4J8WA 2AROA 4KGCD 1P3OA 4J8VD 4YM6A 4X23A 4YS3B 5F99D 3REHA 4NFTA 1U35B 2NQBC 5B32B 5DNNC 3X1TA 2FJ7B 3NQUA 4J8XD 4H9NA 3AZFA 1KX5A 2ZY3A 5B33A 3AYWA 4NE5A 5B1MB 1S32A 5AV8C 4WU8C 4Z66B 5BNXB 5GXQB 1BH8A 3VH5T 3MGSD 5B2IC 3AZJD 1A7WA 3AV2D 3LELA 4XZQA 4H9SA 3LZ1B 3EPKA 5DNMA 1KX3A 3KXBD 3LJAA 3KUYA 2BG1A 3B6FB 2F8NG 3WKJA 4XUJC 3X1UD 5BS7A 3MGPB 2HIOD 1P3FB 2FFFB 2Y2PA 2ZY2A 5B0YD 5C3IC 5GT0A 3REKA 5AV6B 1P3MB 1KX4A 5AV6C 3A6NC 5AV5B 5FUGA 5CPKB 4AWLB 4KUDB 4Z2MG 5AVBA 3B6GD 3A1IA 1P3AA 3KFUG 3B0DC 1N1JB 3MGRA 3VH5W 3AZND 5AY8D 3W96A 2IO5C 3MNND 1M19C 1M18B 1ID3A 4H9PA 3RELB 2PYOC 4WJ3C 3RELC 5B40C 3EPLA 5CPIB 5B1LB 3WTPB 2BYMB 4J8UC 1B67A 2NQBD 5B32D 4QLCC 3UTAA 3REJB 2FJ7D 3AZLA 3AZMC 4R8PC 2G5HC 5GT3A 3AV1B 1F66A 1P3KC 1BH9B 2W8SA 3C1BC 3REIB 4EO5B 3KWQC 3VH5A 5E5AC 2Y2IA 4CAYB 5CP6B 4H9OB 5AV8D 4WU8D 4Z5TB 4Z66D 1JFIB 4JJNC 2Y2GA 5B2ID 3MVDB 3AZKA 3R45A 3MVDC 3LZ0A 1P34A 3WTPE 5JRGC 1P3LA 4KGCC 3NQJB 1H3OA 3B6FD 5AV9B 2G5IC 5G49A 5F99C 2RIQA 4XUJD 3MGPD 1P3FD 3AZGA 3TU4C 5AV6D 3A6ND 1P3OB 4LD9B 4ZUXC 4X23B 5AV5D 3WAAA 3B0CT 1TZYC 3O62A 3NQUB 4H9NB 3AZFB 3W98C 5B33B 1EQZC 5B0ZB 3KXBC 1M19D 3AZHA 2CV5C 3EPHA 3UTBA 5KDMB 1S32B 2PYOD 1P3IA 3X1UC 5B24B 3RELD 5B24C 3X1SB 3X1SC 2HIOC 4WV4B 5CPID 1BH8B 4J8UD 3LELB 5AVCA 4QLCD 1R4VA 5B2JB 3AZIB 3FDDA 5B2JC 5DNMB 1T3UA 1PZRA 3LJAB 3KUYB 4R8PD 3AZMD 3AZIC 1KX3B 3WA9A 3WKJB 5B40A 1P3KD 1HQ3C 3REID 3UT9B 2NZDB 3KWQD 3UT9C 3B0CW 1P3BA 2HUEB 4WU9C 2NZDC 3REKB 1ZLAA 1M1AB 1KX4B 1M1AC 4JJND 3MGQC 3AZEC 5FUGB 3MVDD 1Q9CA 2Y2LA 5JRGD 4KHAA 1ULYA 5E5AA 5AVBB 4YS3C 1U35C 3W97B 5B32C 3X1VA 2YFWA 3W96B 3TU4D 2FJ7C 1ID3B 4H9PB 2XD1A 3P5JB 4J8VA 4LD9D 4ZUXD 5F99A 4CSRA 5B1MC 3EPJA 1TZYD 4M6BA 1F1EA 3UTAB 4Z66C 4J8XA 3AZLB 5GXQC 5GT3B 3W98D 1EQZD 3F6TA 5B0ZD 3LZ1C 2CV5D 3B6FC 2Y2HA 3AFAB 1P3GB 5B24D 1P3GC 3X1SD 3MGSA 3AZJA 2ZY5A 3MGPC 3AV2A 5CPJA 1P3FC 3AZKB 3R45B 1P3MC 1P34B 1P3LB 1Z2CB 5B2JD 3AZID 3LJAD 1H3OB 5B31B 5B31C 5G49B 2LY8A 5AV5C 1HQ3D 5CPKC 2HIOA 2RVQC 3UT9D 2NZDD 5B0YA 4WU9D 4AWLC 3AZGB 4KUDC 1M1AD 3C1CB 4G91B 3VH6T 5GSUB 3MGQD 3C1CC 3V9RA 3AZED 5CHLB 5JA4A 1M18C 3O62B 3B6GA 3AN2B 5CPIC 3AN2C 5B1LC 2J8PA 2BYKA 4YS3D 3WTPC 3A1KA 3AZNA 1U35D 1P3PA 3B0BA 5AY8A 3W97D 3MNNA 3REJC 2F2AC 3AZHB 3AV1C 3UTBB 1P3IB 2DF4C 4Z2MH 3REIC 4EO5C 3W99B 3H0LC 3W99C 5B1MD 2NQBA 5B32A 5AVCB 5DNNA 5CP6C 2FJ7A 4Z5TC 4H9QA 5GXQD 3VH6W 2XD5A 3LZ1D 4UUZA 1P3BB 5AV8A 4WU8A 1ZLAB 2F8NB 5AV9C 4Z66A 3AFAD 1P3GD 5B2IA 3AZKD 1AOIB 1P3MD 4J8WB 2AROB 4KHAB 2AROC 4LD9C 1P3OC 4YM6B 4XUJA 5B31D 2JCHA 4NE6A 2L5AA 4YM6C 4X23C 5BNVA 1TAFA 3REHB 5CPKD 2RVQD 1BFMA 3VH6A 3MGPA 3X1VB 3X1TB 4DRBA 2YFWB 2JE5A 3X1TC 5AV6A 4KUDD 1KX5B 3A6NA 3AZFC 1KX5C 3AYWB 4J8VB 3C1CD 5B33C 5GSUD 5B0ZC 4CSRB 5B32G 1M18D 3EG5B 1S32C 4J8XB 4H9RA 3AN2D 5B1LD 3WTPD 4XZQB 4HGAB 3LELC 4H9SC 1M19A 3REJD 5DNMC 1KX3C 3LJAC 3KUYC 3AV1D 3AZHD 4ZBJB 2PYOA 3RELA 3WKJC 5BS7C 3MGSB 3AZJB 2Y2KA 4J8UA 3AV2B 3W99D 2YFVA 5CPJB 2HUEC 5GT0B 4QLCA 4E44A 5GT0C 5CP6D 3REKC 1KX4C 3AZMA 4R8PA 4Z5TD 1P3KA 4DRAA 3C1BA 1BH9A 3REIA 3KSYA 3KWQA 1WWIA 5B0YB 2CWEA 4E45A 5AVBC 5AV9D 2F8ND 4JJNA 1P3AB 3MGRB 3V9RB 3W97C 3MVDA 3W96C 2VQRA 5JA4B 5JRGA 1AOID 4KGCA 4J8WD 1ID3C 2AROD 3B6GB 1P3OD 4YM6D 4X23D 2BYKB 3REHD 1P3PB 3AZNB 5AY8B 3AL0C 3TU4A 3MNNB 3UTAC 3X1TD 1F66B 3AZLC 1F66C 5GT3C 3AZFD 1KX5D 5BT1C 4LD9A 4ZUXA 5B33D 3AYWD 4WZSB 1TZYA 2NQBB 5DNNB 2Y2MA 1S32D 5BO0A 3AFAC 4H9QB 3W98A 1EQZA 3AZKC 5B0ZA 3LZ0B 4XZQD 3LELD 3LZ0C 3KXBA 2Y2QA 1P34C 4UUZB 5DNMD 2CV5A 1P3LC 1KX3D 3KUYD 5AV8B 4WU8B 5KDMA 3X1UA 3WKJD 5B24A 3X1SA 5B2IB 5CPJD 3AZGC 3REKD 5GT0D 1KX4D 5B2JA 3AZIA 4G91C 2ZM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU C;  4XUJ B;  2F8N H;  1HQ3 A;  3WAA B;  5BNV B;  1TAF B;  3WAA C;  3UT9 A;  2NZD A;  4WU9 A;  3O62 C;  5C3I B;  1M1A A;  5AVB D;  1B6W A;  3A6N B;  3MGQ A;  1P3A D;  3AZE A;  4WNN A;  3MGR D;  3W96 D;  3AZH C;  1ID3 D;  3UTB C;  1P3I C;  4H9R B;  2JSS A;  4YS3 A;  1KU5 A;  3B0D B;  1U35 A;  3W97 A;  1P3P D;  5AVC C;  2IO5 B;  3UTA D;  1M19 B;  3WA9 B;  3WA9 C;  3AZL D;  1F66 D;  5GT3 D;  2PYO B;  5B40 B;  5BT1 D;  5B1M A;  4J8U B;  2YFV B;  1P3B C;  4QLC B;  1ZLA C;  1HTA A;  5BNX A;  5DNN D;  5GXQ A;  4R8P B;  3AZM B;  1P3K B;  3C1B B;  1AOI C;  3LZ0 D;  3KWQ B;  3LZ1 A;  4J8W C;  5E5A B;  1P34 D;  1P3L D;  3B6F A;  3AFA A;  4G92 B;  4JJN B;  4G92 C;  4NE3 A;  3REH C;  1P3G A;  1P3F A;  3X1V C;  1P3M A;  3AZG D;  5JRG B;  4KGC B;  3AYW C;  4J8V C;  5B31 A;  5AV5 A;  5F99 B;  5CPK A;  3WAA D;  1WWS A;  3O62 D;  3TU4 B;  4KUD A;  4J8X C;  3C1C A;  1N1J A;  5GSU A;  4ZUX B;  4XZQ C;  4HGA C;  1TZY B;  1M18 A;  4ZBJ C;  3UTB D;  5BO0 B;  1P3I D;  5CPI A;  3AN2 A;  5B1L A;  3W98 B;  3WTP A;  3MGS C;  2BYM A;  3AZJ C;  3AV2 C;  5CPJ C;  1EQZ B;  5AVC D;  3REJ A;  3KXB B;  2CV5 B;  3AV1 A;  3WA9 D;  3X1U B;  5B40 D;  2HIO B;  3W99 A;  2F8N K;  5B0Y C;  4CAY A;  1P3B D;  5CP6 A;  4H9O A;  1ZLA D;  4Z5T A;  1JFI A;  1P3A C;  3MGR C;  5B31 G;  1HQ3 B;  3C1B D;  4WU9 B;  5E5A D;  3NQJ A;  3B6G C;  5AV9 A;  2F8N A;  3MGQ B;  3AZE B;  3AZN C;  4WNN B;  1P3P C;  5AY8 C;  3X1V D;  3MNN C;  1AOI A;  4J8W A;  2ARO A;  4KGC D;  1P3O A;  4J8V D;  4YM6 A;  4X23 A;  4YS3 B;  5F99 D;  3REH A;  4NFT A;  1U35 B;  2NQB C;  5B32 B;  5DNN C;  3X1T A;  2FJ7 B;  3NQU A;  4J8X D;  4H9N A;  3AZF A;  1KX5 A;  5B33 A;  3AYW A;  4NE5 A;  5B1M B;  1S32 A;  5AV8 C;  4WU8 C;  4Z66 B;  5BNX B;  5GXQ B;  1BH8 A;  3VH5 T;  3MGS D;  5B2I C;  3AZJ D;  1A7W A;  3AV2 D;  3LEL A;  4XZQ A;  4H9S A;  3LZ1 B;  5DNM A;  1KX3 A;  3KXB D;  3LJA A;  3KUY A;  3B6F B;  2F8N G;  3WKJ A;  4XUJ C;  3X1U D;  5BS7 A;  3MGP B;  2HIO D;  1P3F B;  5B0Y D;  5C3I C;  5GT0 A;  3REK A;  5AV6 B;  1P3M B;  1KX4 A;  5AV6 C;  3A6N C;  5AV5 B;  5FUG A;  5CPK B;  4AWL B;  4KUD B;  4Z2M G;  5AVB A;  3B6G D;  1P3A A;  3B0D C;  1N1J B;  3MGR A;  3VH5 W;  3AZN D;  5AY8 D;  3W96 A;  2IO5 C;  3MNN D;  1M19 C;  1M18 B;  1ID3 A;  4H9P A;  3REL B;  2PYO C;  3REL C;  5B40 C;  5CPI B;  5B1L B;  3WTP B;  2BYM B;  4J8U C;  1B67 A;  2NQB D;  5B32 D;  4QLC C;  3UTA A;  3REJ B;  2FJ7 D;  3AZL A;  3AZM C;  4R8P C;  5GT3 A;  3AV1 B;  1F66 A;  1P3K C;  1BH9 B;  3C1B C;  3REI B;  4EO5 B;  3KWQ C;  3VH5 A;  5E5A C;  4CAY B;  5CP6 B;  4H9O B;  5AV8 D;  4WU8 D;  4Z5T B;  4Z66 D;  1JFI B;  4JJN C;  5B2I D;  3MVD B;  3AZK A;  3R45 A;  3MVD C;  3LZ0 A;  1P34 A;  3WTP E;  5JRG C;  1P3L A;  4KGC C;  3NQJ B;  1H3O A;  3B6F D;  5AV9 B;  5G49 A;  5F99 C;  4XUJ D;  3MGP D;  1P3F D;  3AZG A;  3TU4 C;  5AV6 D;  3A6N D;  1P3O B;  4LD9 B;  4ZUX C;  4X23 B;  5AV5 D;  3WAA A;  3B0C T;  1TZY C;  3O62 A;  3NQU B;  4H9N B;  3AZF B;  3W98 C;  5B33 B;  1EQZ C;  5B0Z B;  3KXB C;  1M19 D;  3AZH A;  2CV5 C;  3UTB A;  5KDM B;  1S32 B;  2PYO D;  1P3I A;  3X1U C;  5B24 B;  3REL D;  5B24 C;  3X1S B;  3X1S C;  2HIO C;  4WV4 B;  5CPI D;  1BH8 B;  4J8U D;  3LEL B;  5AVC A;  4QLC D;  1R4V A;  5B2J B;  3AZI B;  5B2J C;  5DNM B;  3AZI C;  3LJA B;  3KUY B;  3AZM D;  4R8P D;  1KX3 B;  3WA9 A;  3WKJ B;  5B40 A;  1P3K D;  1HQ3 C;  3REI D;  3UT9 B;  2NZD B;  3KWQ D;  3UT9 C;  3B0C W;  1P3B A;  2HUE B;  4WU9 C;  2NZD C;  3REK B;  1ZLA A;  1M1A B;  1KX4 B;  1M1A C;  4JJN D;  3MGQ C;  3AZE C;  5FUG B;  3MVD D;  1Q9C A;  5JRG D;  4KHA A;  1ULY A;  5E5A A;  5AVB B;  4YS3 C;  1U35 C;  3W97 B;  5B32 C;  3X1V A;  2YFW A;  3W96 B;  3TU4 D;  2FJ7 C;  1ID3 B;  4H9P B;  4J8V A;  4LD9 D;  4ZUX D;  5F99 A;  4CSR A;  5B1M C;  1TZY D;  4M6B A;  1F1E A;  3UTA B;  4Z66 C;  4J8X A;  3AZL B;  5GXQ C;  5GT3 B;  3W98 D;  1EQZ D;  5B0Z D;  3LZ1 C;  2CV5 D;  3B6F C;  3AFA B;  1P3G B;  5B24 D;  1P3G C;  3X1S D;  3MGS A;  3AZJ A;  3AV2 A;  3MGP C;  5CPJ A;  1P3F C;  3AZK B;  3R45 B;  1P3M C;  1P34 B;  1P3L B;  5B2J D;  3AZI D;  3LJA D;  1H3O B;  5B31 B;  5B31 C;  5G49 B;  2LY8 A;  5AV5 C;  1HQ3 D;  5CPK C;  2HIO A;  2RVQ C;  3UT9 D;  2NZD D;  5B0Y A;  4WU9 D;  4AWL C;  3AZG B;  4KUD C;  1M1A D;  3C1C B;  4G91 B;  3VH6 T;  5GSU B;  3MGQ D;  3C1C C;  3V9R A;  3AZE D;  5CHL B;  5JA4 A;  1M18 C;  3O62 B;  3B6G A;  3AN2 B;  5CPI C;  3AN2 C;  5B1L C;  4YS3 D;  2BYK A;  3WTP C;  1P3P A;  3AZN A;  1U35 D;  3B0B A;  5AY8 A;  3W97 D;  3MNN A;  3REJ C;  3AZH B;  3AV1 C;  3UTB B;  1P3I B;  4Z2M H;  3REI C;  4EO5 C;  3W99 B;  3W99 C;  2NQB A;  5B1M D;  5B32 A;  5AVC B;  5DNN A;  5CP6 C;  2FJ7 A;  4Z5T C;  4H9Q A;  5GXQ D;  3VH6 W;  3LZ1 D;  4UUZ A;  1P3B B;  5AV8 A;  4WU8 A;  1ZLA B;  2F8N B;  5AV9 C;  4Z66 A;  3AFA D;  1P3G D;  5B2I A;  3AZK D;  1AOI B;  1P3M D;  4J8W B;  2ARO B;  4KHA B;  2ARO C;  4LD9 C;  1P3O C;  4YM6 B;  4XUJ A;  5B31 D;  4NE6 A;  4YM6 C;  2L5A A;  4X23 C;  3REH B;  5BNV A;  1TAF A;  1BFM A;  5CPK D;  2RVQ D;  3VH6 A;  3MGP A;  3X1V B;  3X1T B;  4DRB A;  2YFW B;  3X1T C;  5AV6 A;  4KUD D;  1KX5 B;  3A6N A;  3AZF C;  1KX5 C;  3AYW B;  4J8V B;  3C1C D;  5B33 C;  5GSU D;  5B0Z C;  4CSR B;  5B32 G;  1M18 D;  1S32 C;  4J8X B;  4H9R A;  3AN2 D;  5B1L D;  3WTP D;  4XZQ B;  4HGA B;  3LEL C;  4H9S C;  1M19 A;  3REJ D;  5DNM C;  1KX3 C;  3LJA C;  3KUY C;  3AV1 D;  3AZH D;  4ZBJ B;  2PYO A;  3REL A;  3WKJ C;  5BS7 C;  3MGS B;  3AZJ B;  4J8U A;  3AV2 B;  5CPJ B;  3W99 D;  2YFV A;  2HUE C;  5GT0 B;  4QLC A;  4E44 A;  5GT0 C;  5CP6 D;  3REK C;  1KX4 C;  3AZM A;  4R8P A;  4Z5T D;  1P3K A;  4DRA A;  3C1B A;  1BH9 A;  3REI A;  3KSY A;  3KWQ A;  1WWI A;  5B0Y B;  2CWE A;  4E45 A;  5AVB C;  5AV9 D;  2F8N D;  4JJN A;  1P3A B;  3MGR B;  3V9R B;  3W97 C;  3MVD A;  3W96 C;  5JA4 B;  5JRG A;  1AOI D;  4KGC A;  4J8W D;  1ID3 C;  2ARO D;  3B6G B;  1P3O D;  4YM6 D;  4X23 D;  2BYK B;  3REH D;  1P3P B;  3AZN B;  5AY8 B;  3TU4 A;  3MNN B;  3UTA C;  3X1T D;  1F66 B;  3AZL C;  1F66 C;  5GT3 C;  3AZF D;  1KX5 D;  5BT1 C;  4LD9 A;  4ZUX A;  5B33 D;  3AYW D;  4WZS B;  1TZY A;  2NQB B;  5DNN B;  1S32 D;  5BO0 A;  3AFA C;  4H9Q B;  3W98 A;  1EQZ A;  3AZK C;  5B0Z A;  3LZ0 B;  4XZQ D;  3LEL D;  3LZ0 C;  3KXB A;  1P34 C;  4UUZ B;  5DNM D;  2CV5 A;  1P3L C;  1KX3 D;  3KUY D;  5AV8 B;  4WU8 B;  5KDM A;  3X1U A;  3WKJ D;  5B24 A;  3X1S A;  5B2I B;  5CPJ D;  3AZG C;  3REK D;  5GT0 D;  1KX4 D;  5B2J A;  3AZI A;  4G91 C; 
#chains in the Genus database with same CATH topology
 5GSU C;  4XUJ B;  2F8N H;  1HQ3 A;  3WAA B;  5BNV B;  1TAF B;  3WAA C;  3UT9 A;  2NZD A;  2ZY4 A;  4WU9 A;  3O62 C;  5C3I B;  3IP4 C;  1M1A A;  5AVB D;  1B6W A;  3A6N B;  3MGQ A;  1P3A D;  3AZE A;  4WNN A;  3MGR D;  3W96 D;  3AZH C;  1ID3 D;  3UTB C;  2DQN C;  1P3I C;  4H9R B;  2JSS A;  4YS3 A;  1KU5 A;  3B0D B;  3H0M C;  1U35 A;  3W97 A;  1P3P D;  5AVC C;  2IO5 B;  3UTA D;  1M19 B;  3WA9 B;  3WA9 C;  3AZL D;  1F66 D;  5GT3 D;  2PYO B;  5B40 B;  5BT1 D;  5B1M A;  4J8U B;  2YFV B;  1P3B C;  4QLC B;  1ZLA C;  1HTA A;  5BNX A;  5DNN D;  5GXQ A;  4R8P B;  3AZM B;  1P3K B;  3C1B B;  1AOI C;  3LZ0 D;  3KWQ B;  3LZ1 A;  4J8W C;  3H0R C;  5E5A B;  1P34 D;  1P3L D;  3B6F A;  2Y2J A;  3AFA A;  4G92 B;  4JJN B;  4G92 C;  4NE3 A;  3REH C;  1P3G A;  1P3F A;  3X1V C;  1P3M A;  3AZG D;  5JRG B;  4KGC B;  4DQY B;  3AYW C;  4J8V C;  5B31 A;  5AV5 A;  5F99 B;  5CPK A;  3WAA D;  1WWS A;  2Y2N A;  3O62 D;  3TU4 B;  4KUD A;  4J8X C;  2UWX A;  3C1C A;  1N1J A;  5GSU A;  4ZUX B;  4XZQ C;  4HGA C;  1TZY B;  1M18 A;  4ZBJ C;  3UTB D;  5BO0 B;  1P3I D;  5CPI A;  3AN2 A;  5B1L A;  3W98 B;  3WTP A;  3MGS C;  2BYM A;  3AZJ C;  3AV2 C;  5CPJ C;  1EQZ B;  5AVC D;  3REJ A;  3KXB B;  2CV5 B;  3AV1 A;  3WA9 D;  3X1U B;  2Y2O A;  5B40 D;  2HIO B;  3W99 A;  2F8N K;  5B0Y C;  4CAY A;  1P3B D;  5CP6 A;  4H9O A;  1ZLA D;  4Z5T A;  1JFI A;  1P3A C;  3MGR C;  5B31 G;  1HQ3 B;  3C1B D;  4WU9 B;  5E5A D;  3NQJ A;  4UPK A;  3B6G C;  5AV9 A;  2F8N A;  3MGQ B;  3AZE B;  3AZN C;  4WNN B;  1P3P C;  1W2E A;  5AY8 C;  3X1V D;  3MNN C;  1AOI A;  4J8W A;  2ARO A;  4KGC D;  1P3O A;  4J8V D;  4YM6 A;  4X23 A;  4YS3 B;  5F99 D;  3REH A;  4NFT A;  1U35 B;  2NQB C;  5B32 B;  5DNN C;  3X1T A;  2FJ7 B;  3NQU A;  4J8X D;  4H9N A;  3AZF A;  1KX5 A;  2ZY3 A;  5B33 A;  3AYW A;  4NE5 A;  5B1M B;  1S32 A;  5AV8 C;  4WU8 C;  4Z66 B;  5BNX B;  5GXQ B;  1BH8 A;  3VH5 T;  3MGS D;  5B2I C;  3AZJ D;  1A7W A;  3AV2 D;  3LEL A;  4XZQ A;  4H9S A;  3LZ1 B;  3EPK A;  5DNM A;  1KX3 A;  3KXB D;  3LJA A;  3KUY A;  2BG1 A;  3B6F B;  2F8N G;  3WKJ A;  4XUJ C;  3X1U D;  5BS7 A;  3MGP B;  2HIO D;  1P3F B;  2FFF B;  2Y2P A;  2ZY2 A;  5B0Y D;  5C3I C;  5GT0 A;  3REK A;  5AV6 B;  1P3M B;  1KX4 A;  5AV6 C;  3A6N C;  5AV5 B;  5FUG A;  5CPK B;  4AWL B;  4KUD B;  4Z2M G;  5AVB A;  3B6G D;  3A1I A;  1P3A A;  3KFU G;  3B0D C;  1N1J B;  3MGR A;  3VH5 W;  3AZN D;  5AY8 D;  3W96 A;  2IO5 C;  3MNN D;  1M19 C;  1M18 B;  1ID3 A;  4H9P A;  3REL B;  2PYO C;  4WJ3 C;  3REL C;  5B40 C;  3EPL A;  5CPI B;  5B1L B;  3WTP B;  2BYM B;  4J8U C;  1B67 A;  2NQB D;  5B32 D;  4QLC C;  3UTA A;  3REJ B;  2FJ7 D;  3AZL A;  3AZM C;  4R8P C;  2G5H C;  5GT3 A;  3AV1 B;  1F66 A;  1P3K C;  1BH9 B;  2W8S A;  3C1B C;  3REI B;  4EO5 B;  3KWQ C;  3VH5 A;  5E5A C;  2Y2I A;  4CAY B;  5CP6 B;  4H9O B;  5AV8 D;  4WU8 D;  4Z5T B;  4Z66 D;  1JFI B;  4JJN C;  2Y2G A;  5B2I D;  3MVD B;  3AZK A;  3R45 A;  3MVD C;  3LZ0 A;  1P34 A;  3WTP E;  5JRG C;  1P3L A;  4KGC C;  3NQJ B;  1H3O A;  3B6F D;  5AV9 B;  2G5I C;  5G49 A;  5F99 C;  2RIQ A;  4XUJ D;  3MGP D;  1P3F D;  3AZG A;  3TU4 C;  5AV6 D;  3A6N D;  1P3O B;  4LD9 B;  4ZUX C;  4X23 B;  5AV5 D;  3WAA A;  3B0C T;  1TZY C;  3O62 A;  3NQU B;  4H9N B;  3AZF B;  3W98 C;  5B33 B;  1EQZ C;  5B0Z B;  3KXB C;  1M19 D;  3AZH A;  2CV5 C;  3EPH A;  3UTB A;  5KDM B;  1S32 B;  2PYO D;  1P3I A;  3X1U C;  5B24 B;  3REL D;  5B24 C;  3X1S B;  3X1S C;  2HIO C;  4WV4 B;  5CPI D;  1BH8 B;  4J8U D;  3LEL B;  5AVC A;  4QLC D;  1R4V A;  5B2J B;  3AZI B;  3FDD A;  5B2J C;  5DNM B;  1T3U A;  1PZR A;  3LJA B;  3KUY B;  4R8P D;  3AZM D;  3AZI C;  1KX3 B;  3WA9 A;  3WKJ B;  5B40 A;  1P3K D;  1HQ3 C;  3REI D;  3UT9 B;  2NZD B;  3KWQ D;  3UT9 C;  3B0C W;  1P3B A;  2HUE B;  4WU9 C;  2NZD C;  3REK B;  1ZLA A;  1M1A B;  1KX4 B;  1M1A C;  4JJN D;  3MGQ C;  3AZE C;  5FUG B;  3MVD D;  1Q9C A;  2Y2L A;  5JRG D;  4KHA A;  1ULY A;  5E5A A;  5AVB B;  4YS3 C;  1U35 C;  3W97 B;  5B32 C;  3X1V A;  2YFW A;  3W96 B;  3TU4 D;  2FJ7 C;  1ID3 B;  4H9P B;  2XD1 A;  3P5J B;  4J8V A;  4LD9 D;  4ZUX D;  5F99 A;  4CSR A;  5B1M C;  3EPJ A;  1TZY D;  4M6B A;  1F1E A;  3UTA B;  4Z66 C;  4J8X A;  3AZL B;  5GXQ C;  5GT3 B;  3W98 D;  1EQZ D;  3F6T A;  5B0Z D;  3LZ1 C;  2CV5 D;  3B6F C;  2Y2H A;  3AFA B;  1P3G B;  5B24 D;  1P3G C;  3X1S D;  3MGS A;  3AZJ A;  2ZY5 A;  3MGP C;  3AV2 A;  5CPJ A;  1P3F C;  3AZK B;  3R45 B;  1P3M C;  1P34 B;  1P3L B;  1Z2C B;  5B2J D;  3AZI D;  3LJA D;  1H3O B;  5B31 B;  5B31 C;  5G49 B;  2LY8 A;  5AV5 C;  1HQ3 D;  5CPK C;  2HIO A;  2RVQ C;  3UT9 D;  2NZD D;  5B0Y A;  4WU9 D;  4AWL C;  3AZG B;  4KUD C;  1M1A D;  3C1C B;  4G91 B;  3VH6 T;  5GSU B;  3MGQ D;  3C1C C;  3V9R A;  3AZE D;  5CHL B;  5JA4 A;  1M18 C;  3O62 B;  3B6G A;  3AN2 B;  5CPI C;  3AN2 C;  5B1L C;  2J8P A;  2BYK A;  4YS3 D;  3WTP C;  3A1K A;  3AZN A;  1U35 D;  1P3P A;  3B0B A;  5AY8 A;  3W97 D;  3MNN A;  3REJ C;  2F2A C;  3AZH B;  3AV1 C;  3UTB B;  1P3I B;  2DF4 C;  4Z2M H;  3REI C;  4EO5 C;  3W99 B;  3H0L C;  3W99 C;  5B1M D;  2NQB A;  5B32 A;  5AVC B;  5DNN A;  5CP6 C;  2FJ7 A;  4Z5T C;  4H9Q A;  5GXQ D;  3VH6 W;  2XD5 A;  3LZ1 D;  4UUZ A;  1P3B B;  5AV8 A;  4WU8 A;  1ZLA B;  2F8N B;  5AV9 C;  4Z66 A;  3AFA D;  1P3G D;  5B2I A;  3AZK D;  1AOI B;  1P3M D;  4J8W B;  2ARO B;  4KHA B;  2ARO C;  4LD9 C;  1P3O C;  4YM6 B;  4XUJ A;  5B31 D;  2JCH A;  4NE6 A;  2L5A A;  4YM6 C;  4X23 C;  5BNV A;  1TAF A;  3REH B;  5CPK D;  2RVQ D;  1BFM A;  3VH6 A;  3MGP A;  3X1V B;  3X1T B;  4DRB A;  2YFW B;  2JE5 A;  3X1T C;  5AV6 A;  4KUD D;  1KX5 B;  3A6N A;  3AZF C;  1KX5 C;  3AYW B;  4J8V B;  3C1C D;  5B33 C;  5GSU D;  5B0Z C;  4CSR B;  5B32 G;  1M18 D;  3EG5 B;  1S32 C;  4J8X B;  4H9R A;  3AN2 D;  5B1L D;  3WTP D;  4XZQ B;  4HGA B;  3LEL C;  4H9S C;  1M19 A;  3REJ D;  5DNM C;  1KX3 C;  3LJA C;  3KUY C;  3AV1 D;  3AZH D;  4ZBJ B;  2PYO A;  3REL A;  3WKJ C;  5BS7 C;  3MGS B;  3AZJ B;  2Y2K A;  4J8U A;  3AV2 B;  3W99 D;  2YFV A;  5CPJ B;  2HUE C;  5GT0 B;  4QLC A;  4E44 A;  5GT0 C;  5CP6 D;  3REK C;  1KX4 C;  3AZM A;  4R8P A;  4Z5T D;  1P3K A;  4DRA A;  3C1B A;  1BH9 A;  3REI A;  3KSY A;  3KWQ A;  1WWI A;  5B0Y B;  2CWE A;  4E45 A;  5AVB C;  5AV9 D;  2F8N D;  4JJN A;  1P3A B;  3MGR B;  3V9R B;  3W97 C;  3MVD A;  3W96 C;  2VQR A;  5JA4 B;  5JRG A;  1AOI D;  4KGC A;  4J8W D;  1ID3 C;  2ARO D;  3B6G B;  1P3O D;  4YM6 D;  4X23 D;  2BYK B;  3REH D;  1P3P B;  3AZN B;  5AY8 B;  3AL0 C;  3TU4 A;  3MNN B;  3UTA C;  3X1T D;  1F66 B;  3AZL C;  1F66 C;  5GT3 C;  3AZF D;  1KX5 D;  5BT1 C;  4LD9 A;  4ZUX A;  5B33 D;  3AYW D;  4WZS B;  1TZY A;  2NQB B;  5DNN B;  2Y2M A;  1S32 D;  5BO0 A;  3AFA C;  4H9Q B;  3W98 A;  1EQZ A;  3AZK C;  5B0Z A;  3LZ0 B;  4XZQ D;  3LEL D;  3LZ0 C;  3KXB A;  2Y2Q A;  1P34 C;  4UUZ B;  5DNM D;  2CV5 A;  1P3L C;  1KX3 D;  3KUY D;  5AV8 B;  4WU8 B;  5KDM A;  3X1U A;  3WKJ D;  5B24 A;  3X1S A;  5B2I B;  5CPJ D;  3AZG C;  3REK D;  5GT0 D;  1KX4 D;  5B2J A;  3AZI A;  4G91 C;  2ZM5 A; 
#chains in the Genus database with same CATH homology
 5GSU C;  4XUJ B;  2F8N H;  1HQ3 A;  3WAA B;  5BNV B;  1TAF B;  3WAA C;  3UT9 A;  2NZD A;  2ZY4 A;  4WU9 A;  3O62 C;  5C3I B;  3IP4 C;  1M1A A;  5AVB D;  1B6W A;  3A6N B;  3MGQ A;  1P3A D;  3AZE A;  4WNN A;  3MGR D;  3W96 D;  3AZH C;  1ID3 D;  3UTB C;  2DQN C;  1P3I C;  4H9R B;  2JSS A;  4YS3 A;  1KU5 A;  3B0D B;  3H0M C;  1U35 A;  3W97 A;  1P3P D;  5AVC C;  2IO5 B;  3UTA D;  1M19 B;  3WA9 B;  3WA9 C;  3AZL D;  1F66 D;  5GT3 D;  2PYO B;  5B40 B;  5BT1 D;  5B1M A;  4J8U B;  2YFV B;  1P3B C;  4QLC B;  1ZLA C;  1HTA A;  5BNX A;  5DNN D;  5GXQ A;  4R8P B;  3AZM B;  1P3K B;  3C1B B;  1AOI C;  3LZ0 D;  3KWQ B;  3LZ1 A;  4J8W C;  3H0R C;  5E5A B;  1P34 D;  1P3L D;  3B6F A;  2Y2J A;  3AFA A;  4G92 B;  4JJN B;  4G92 C;  4NE3 A;  3REH C;  1P3G A;  1P3F A;  3X1V C;  1P3M A;  3AZG D;  5JRG B;  4KGC B;  4DQY B;  3AYW C;  4J8V C;  5B31 A;  5AV5 A;  5F99 B;  5CPK A;  3WAA D;  1WWS A;  2Y2N A;  3O62 D;  3TU4 B;  4KUD A;  4J8X C;  2UWX A;  3C1C A;  1N1J A;  5GSU A;  4ZUX B;  4XZQ C;  4HGA C;  1TZY B;  1M18 A;  4ZBJ C;  3UTB D;  5BO0 B;  1P3I D;  5CPI A;  3AN2 A;  5B1L A;  3W98 B;  3WTP A;  3MGS C;  2BYM A;  3AZJ C;  3AV2 C;  5CPJ C;  1EQZ B;  5AVC D;  3REJ A;  3KXB B;  2CV5 B;  3AV1 A;  3WA9 D;  3X1U B;  2Y2O A;  5B40 D;  2HIO B;  3W99 A;  2F8N K;  5B0Y C;  4CAY A;  1P3B D;  5CP6 A;  4H9O A;  1ZLA D;  4Z5T A;  1JFI A;  1P3A C;  3MGR C;  5B31 G;  1HQ3 B;  3C1B D;  4WU9 B;  5E5A D;  3NQJ A;  4UPK A;  3B6G C;  5AV9 A;  2F8N A;  3MGQ B;  3AZE B;  3AZN C;  4WNN B;  1P3P C;  1W2E A;  5AY8 C;  3X1V D;  3MNN C;  1AOI A;  4J8W A;  2ARO A;  4KGC D;  1P3O A;  4J8V D;  4YM6 A;  4X23 A;  4YS3 B;  5F99 D;  3REH A;  4NFT A;  1U35 B;  2NQB C;  5B32 B;  5DNN C;  3X1T A;  2FJ7 B;  3NQU A;  4J8X D;  4H9N A;  3AZF A;  1KX5 A;  2ZY3 A;  5B33 A;  3AYW A;  4NE5 A;  5B1M B;  1S32 A;  5AV8 C;  4WU8 C;  4Z66 B;  5BNX B;  5GXQ B;  1BH8 A;  3VH5 T;  3MGS D;  5B2I C;  3AZJ D;  1A7W A;  3AV2 D;  3LEL A;  4XZQ A;  4H9S A;  3LZ1 B;  3EPK A;  5DNM A;  1KX3 A;  3KXB D;  3LJA A;  3KUY A;  2BG1 A;  3B6F B;  2F8N G;  3WKJ A;  4XUJ C;  3X1U D;  5BS7 A;  3MGP B;  2HIO D;  1P3F B;  2FFF B;  2Y2P A;  2ZY2 A;  5B0Y D;  5C3I C;  5GT0 A;  3REK A;  5AV6 B;  1P3M B;  1KX4 A;  5AV6 C;  3A6N C;  5AV5 B;  5FUG A;  5CPK B;  4AWL B;  4KUD B;  4Z2M G;  5AVB A;  3B6G D;  3A1I A;  1P3A A;  3KFU G;  3B0D C;  1N1J B;  3MGR A;  3VH5 W;  3AZN D;  5AY8 D;  3W96 A;  2IO5 C;  3MNN D;  1M19 C;  1M18 B;  1ID3 A;  4H9P A;  3REL B;  2PYO C;  4WJ3 C;  3REL C;  5B40 C;  3EPL A;  5CPI B;  5B1L B;  3WTP B;  2BYM B;  4J8U C;  1B67 A;  2NQB D;  5B32 D;  4QLC C;  3UTA A;  3REJ B;  2FJ7 D;  3AZL A;  3AZM C;  4R8P C;  2G5H C;  5GT3 A;  3AV1 B;  1F66 A;  1P3K C;  1BH9 B;  2W8S A;  3C1B C;  3REI B;  4EO5 B;  3KWQ C;  3VH5 A;  5E5A C;  2Y2I A;  4CAY B;  5CP6 B;  4H9O B;  5AV8 D;  4WU8 D;  4Z5T B;  4Z66 D;  1JFI B;  4JJN C;  2Y2G A;  5B2I D;  3MVD B;  3AZK A;  3R45 A;  3MVD C;  3LZ0 A;  1P34 A;  3WTP E;  5JRG C;  1P3L A;  4KGC C;  3NQJ B;  1H3O A;  3B6F D;  5AV9 B;  2G5I C;  5G49 A;  5F99 C;  2RIQ A;  4XUJ D;  3MGP D;  1P3F D;  3AZG A;  3TU4 C;  5AV6 D;  3A6N D;  1P3O B;  4LD9 B;  4ZUX C;  4X23 B;  5AV5 D;  3WAA A;  3B0C T;  1TZY C;  3O62 A;  3NQU B;  4H9N B;  3AZF B;  3W98 C;  5B33 B;  1EQZ C;  5B0Z B;  3KXB C;  1M19 D;  3AZH A;  2CV5 C;  3EPH A;  3UTB A;  5KDM B;  1S32 B;  2PYO D;  1P3I A;  3X1U C;  5B24 B;  3REL D;  5B24 C;  3X1S B;  3X1S C;  2HIO C;  4WV4 B;  5CPI D;  1BH8 B;  4J8U D;  3LEL B;  5AVC A;  4QLC D;  1R4V A;  5B2J B;  3AZI B;  3FDD A;  5B2J C;  5DNM B;  1T3U A;  1PZR A;  3LJA B;  3KUY B;  4R8P D;  3AZM D;  3AZI C;  1KX3 B;  3WA9 A;  3WKJ B;  5B40 A;  1P3K D;  1HQ3 C;  3REI D;  3UT9 B;  2NZD B;  3KWQ D;  3UT9 C;  3B0C W;  1P3B A;  2HUE B;  4WU9 C;  2NZD C;  3REK B;  1ZLA A;  1M1A B;  1KX4 B;  1M1A C;  4JJN D;  3MGQ C;  3AZE C;  5FUG B;  3MVD D;  1Q9C A;  2Y2L A;  5JRG D;  4KHA A;  1ULY A;  5E5A A;  5AVB B;  4YS3 C;  1U35 C;  3W97 B;  5B32 C;  3X1V A;  2YFW A;  3W96 B;  3TU4 D;  2FJ7 C;  1ID3 B;  4H9P B;  2XD1 A;  3P5J B;  4J8V A;  4LD9 D;  4ZUX D;  5F99 A;  4CSR A;  5B1M C;  3EPJ A;  1TZY D;  4M6B A;  1F1E A;  3UTA B;  4Z66 C;  4J8X A;  3AZL B;  5GXQ C;  5GT3 B;  3W98 D;  1EQZ D;  3F6T A;  5B0Z D;  3LZ1 C;  2CV5 D;  3B6F C;  2Y2H A;  3AFA B;  1P3G B;  5B24 D;  1P3G C;  3X1S D;  3MGS A;  3AZJ A;  2ZY5 A;  3MGP C;  3AV2 A;  5CPJ A;  1P3F C;  3AZK B;  3R45 B;  1P3M C;  1P34 B;  1P3L B;  1Z2C B;  5B2J D;  3AZI D;  3LJA D;  1H3O B;  5B31 B;  5B31 C;  5G49 B;  2LY8 A;  5AV5 C;  1HQ3 D;  5CPK C;  2HIO A;  2RVQ C;  3UT9 D;  2NZD D;  5B0Y A;  4WU9 D;  4AWL C;  3AZG B;  4KUD C;  1M1A D;  3C1C B;  4G91 B;  3VH6 T;  5GSU B;  3MGQ D;  3C1C C;  3V9R A;  3AZE D;  5CHL B;  5JA4 A;  1M18 C;  3O62 B;  3B6G A;  3AN2 B;  5CPI C;  3AN2 C;  5B1L C;  2J8P A;  2BYK A;  4YS3 D;  3WTP C;  3A1K A;  3AZN A;  1U35 D;  1P3P A;  3B0B A;  5AY8 A;  3W97 D;  3MNN A;  3REJ C;  2F2A C;  3AZH B;  3AV1 C;  3UTB B;  1P3I B;  2DF4 C;  4Z2M H;  3REI C;  4EO5 C;  3W99 B;  3H0L C;  3W99 C;  5B1M D;  2NQB A;  5B32 A;  5AVC B;  5DNN A;  5CP6 C;  2FJ7 A;  4Z5T C;  4H9Q A;  5GXQ D;  3VH6 W;  2XD5 A;  3LZ1 D;  4UUZ A;  1P3B B;  5AV8 A;  4WU8 A;  1ZLA B;  2F8N B;  5AV9 C;  4Z66 A;  3AFA D;  1P3G D;  5B2I A;  3AZK D;  1AOI B;  1P3M D;  4J8W B;  2ARO B;  4KHA B;  2ARO C;  4LD9 C;  1P3O C;  4YM6 B;  4XUJ A;  5B31 D;  2JCH A;  4NE6 A;  2L5A A;  4YM6 C;  4X23 C;  5BNV A;  1TAF A;  3REH B;  5CPK D;  2RVQ D;  1BFM A;  3VH6 A;  3MGP A;  3X1V B;  3X1T B;  4DRB A;  2YFW B;  2JE5 A;  3X1T C;  5AV6 A;  4KUD D;  1KX5 B;  3A6N A;  3AZF C;  1KX5 C;  3AYW B;  4J8V B;  3C1C D;  5B33 C;  5GSU D;  5B0Z C;  4CSR B;  5B32 G;  1M18 D;  3EG5 B;  1S32 C;  4J8X B;  4H9R A;  3AN2 D;  5B1L D;  3WTP D;  4XZQ B;  4HGA B;  3LEL C;  4H9S C;  1M19 A;  3REJ D;  5DNM C;  1KX3 C;  3LJA C;  3KUY C;  3AV1 D;  3AZH D;  4ZBJ B;  2PYO A;  3REL A;  3WKJ C;  5BS7 C;  3MGS B;  3AZJ B;  2Y2K A;  4J8U A;  3AV2 B;  3W99 D;  2YFV A;  5CPJ B;  2HUE C;  5GT0 B;  4QLC A;  4E44 A;  5GT0 C;  5CP6 D;  3REK C;  1KX4 C;  3AZM A;  4R8P A;  4Z5T D;  1P3K A;  4DRA A;  3C1B A;  1BH9 A;  3REI A;  3KSY A;  3KWQ A;  1WWI A;  5B0Y B;  2CWE A;  4E45 A;  5AVB C;  5AV9 D;  2F8N D;  4JJN A;  1P3A B;  3MGR B;  3V9R B;  3W97 C;  3MVD A;  3W96 C;  2VQR A;  5JA4 B;  5JRG A;  1AOI D;  4KGC A;  4J8W D;  1ID3 C;  2ARO D;  3B6G B;  1P3O D;  4YM6 D;  4X23 D;  2BYK B;  3REH D;  1P3P B;  3AZN B;  5AY8 B;  3AL0 C;  3TU4 A;  3MNN B;  3UTA C;  3X1T D;  1F66 B;  3AZL C;  1F66 C;  5GT3 C;  3AZF D;  1KX5 D;  5BT1 C;  4LD9 A;  4ZUX A;  5B33 D;  3AYW D;  4WZS B;  1TZY A;  2NQB B;  5DNN B;  2Y2M A;  1S32 D;  5BO0 A;  3AFA C;  4H9Q B;  3W98 A;  1EQZ A;  3AZK C;  5B0Z A;  3LZ0 B;  4XZQ D;  3LEL D;  3LZ0 C;  3KXB A;  2Y2Q A;  1P34 C;  4UUZ B;  5DNM D;  2CV5 A;  1P3L C;  1KX3 D;  3KUY D;  5AV8 B;  4WU8 B;  5KDM A;  3X1U A;  3WKJ D;  5B24 A;  3X1S A;  5B2I B;  5CPJ D;  3AZG C;  3REK D;  5GT0 D;  1KX4 D;  5B2J A;  3AZI A;  4G91 C;  2ZM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...