4ZBJC

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zbjC00
2NZDC 3MVDA 5DNND 5B31B 3W97C 4JJND 1TAFB 5G49B 1HQ3B 3VH6T 4R8PB 5DNMC 5AY8B 5AV5B 3UTBB 3UT9C 1M19A 2BYMA 3MGRC 1P3OB 3REKD 5GT3C 3O62C 5AVCD 4WU8B 3AZKD 3WA9B 5DNNA 5GXQB 3C1CB 2F8NB 5GSUB 1P3AA 4JJNA 5BS7C 3X1SD 3KXBD 4XZQB 3AZMD 3WKJD 2BYKB 3MNNA 2HIOA 3B0BA 4AWLC 4H9SA 4HGAC 3REKA 4CSRA 2AROB 3A6NC 3AFAC 3TU4C 2FJ7A 5GT0D 4E44A 5AVCA 3WTPD 4KGCC 3C1BB 1P3FB 1KX3D 4ZBJC 1P3PD 4Z5TA 3X1SA 5CPKA 4KUDC 3KXBA 2NQBA 4ZUXC 4J8WB 2CV5A 3X1TC 5B0YB 3LZ0C 1H3OB 3KWQB 1U35B 3W96D 3AZFB 3B0CW 3AZID 4X23B 1B67A 2YFVB 1P3BD 1F66C 5GT0A 2F8NK 3WTPA 2JSSA 5B33B 4H9PB 5FUGB 5JA4B 4LD9D 3MGPC 1P3PA 4H9NB 3MGSD 5CPID 4Z66A 3AZHA 2PYOA 4Z2MH 5CP6A 5DNMB 5B24C 1ID3C 5F99C 3W96A 1M18C 1P34C 3AZIA 5B2ID 1P3BA 1P3LD 4YS3A 1BH8B 4LD9A 3AZGA 4E45A 1BH9A 5AV8C 3LZ1B 1P3MD 4XUJD 1M1AC 1F1EA 5B2JD 4CAYB 3LJAD 3B6FA 5B31C 4QLCD 4J8XD 3MGQA 2HUEC 4YM6A 4WNNB 5B40D 4AWLB 1HQ3C 4HGAB 3UTAD 1WWIA 4R8PC 1P3ID 1TZYD 1P3LA 3AFAB 4KGCB 4J8UD 3UTBC 3RELD 2IO5C 4UUZB 4DRBA 3AZLA 1R4VA 5B0ZC 1P3KB 1ZLAC 3W99C 3AV2A 5B1LD 3AZKB 1P3MA 4KUDB 1JFIA 4WU8C 4XUJA 1S32B 3X1TB 3WA9C 3C1CC 3X1UD 5GSUC 4KHAA 3VH5W 3AZMB 3WKJB 1KX4D 3AZNC 1TZYA 3AN2D 1F66B 4J8UA 3RELA 3LELA 5AVBA 2AROC 3REHA 4H9OB 1KX5C 3KSYA 1KX3B 3C1BC 3AYWC 1P3FC 1EQZA 3REJA 3KUYC 3AV1D 1ID3B 1A7WA 4H9QB 3X1VD 3VH6W 1N1JB 3V9RA 5BO0B 3AZFC 3W98A 1M19D 5BT1C 4NE6A 3B6GC 5AV8B 2YFWA 5JRGB 1M1AB 3AV1A 3AZED 1P3AD 1P3GA 2HUEB 5B0YA 3X1VA 3REIA 1AOID 1BFMA 3MNND 2HIOD 2IO5B 3WAAA 5B0ZB 1ZLAB 5GT3D 3W99B 2FJ7D 3AZJA 2NZDA 3AZEA 3W97A 3LZ1C 4Z5TD 5CPKD 2NQBD 5B2JB 3LJAB 2CV5D 5DNMA 3AZNB 4QLCB 1AOIA 4J8XB 4JJNC 5B40B 3UTAB 3UT9A 3MGRA 1P3IB 5KDMB 5GT3A 3O62A 3A6ND 1KX5B 4NE3A 4WU9D 4H9SC 3AYWB 3VH5A 3REKC 1BH8A 5B1LB 1P3KC 5AV9D 3KUYB 5AVCC 3AZKC 2LY8A 1S32C 4NFTA 4Z66D 3AZHD 3X1UB 2PYOD 3R45A 5CP6D 3X1SC 2F8NH 5AV6B 3KXBC 5B32D 4J8VD 4WNNA 3AZMC 4H9RA 3WKJC 3B0DB 3AN2B 5BNVA 3A6NA 5B1MB 3TU4A 4WU9A 3B6GB 4WV4B 4YS3D 5AV9A 4M6BA 3AZGD 3VH6A 1KX3C 3NQJB 4ZUXA 3LZ0A 3MVDB 1P3PC 3B6FD 4G91C 5B32A 2RVQD 4J8VA 3MGQD 4YM6D 1HTAA 5E5AD 1M19B 3AZIC 2BYMB 1P3BC 3AZLD 3WTPE 3MGPA 3AV2D 5CPJD 5BNXA 5JRGC 4LD9C 5DNNB 5B24A 1P3AB 3MGSC 4JJNB 4Z2MG 5F99A 5CPIC 1M18A 1P34A 5E5AA 2HIOB 5AY8D 5AV5D 3UTBD 5B2IC 3LELD 3REKB 5AVBD 4CSRB 1P3LC 1P3OD 2FJ7B 2CWEA 5AVCB 5CPJA 3REHD 3NQUA 1EQZD 3REJD 5GXQD 5B31A 3X1SB 5CPKB 1P3MC 3KXBB 2NQBB 2CV5B 1TAFA 5G49A 5B2JC 1HQ3A 4XZQD 3LJAC 4WZSB 4R8PA 4QLCC 4J8XC 4NE5A 5AY8A 5AV5A 3UTAC 3UTBA 5B40C 3W98D 1P3IC 1TZYC 1P3OA 5GT0B 2AROD 3WTPB 3RELC 4WU8A 3C1BD 1P3FD 5B1LC 3WA9A 1P3PB 5GXQA 3C1CA 2F8NA 5GSUA 4G91B 4Z66B 1P3GD 2PYOB 4XZQA 4J8WD 5B0YD 3X1UC 3KWQD 2BYKA 5AV6C 3REID 1U35D 3W96B 3AZIB 1KX4C 3B0DC 3AN2C 1P3BB 4X23D 3WAAD 2AROA 5B1MC 1KX5A 4YS3B 3C1BA 3AYWA 3AZJD 1P3FA 5B33D 1Q9CA 4LD9B 3AZGB 1BH9B 2NZDD 3MGSB 5CPIB 3W97D 4J8WA 3AV1C 3MVDC 3B6FB 1H3OA 5DNMD 3KWQA 1U35A 3MGQB 4YM6B 3AZFA 3UT9D 5B2IB 3X1VC 1KU5A 4X23A 5B32G 3MGRD 1P3LB 2YFVA 3O62D 1B6WA 1M19C 5B33A 4H9PA 3AZLB 5FUGA 3AV2B 5JA4A 1P3MB 4H9NA 4XUJB 3LZ1D 5DNNC 3AZEC 4KHAB 1P3AC 4G92B 1AOIC 1TZYB 3MNNC 4J8UB 3TU4D 3AFAD 3RELB 2HIOC 4KGCD 3LELB 5AVBB 5C3IC 1P3KD 3REHB 2FJ7C 3LZ1A 5BS7A 1EQZB 4KUDD 1S32D 3REJB 4ZUXD 3X1TD 3LZ0D 4CAYA 4Z5TC 5CPKC 2NQBC 2CV5C 5B31G 1KX4B 3AFAA 1F66D 3V9RB 4KGCA 3W98B 4UUZA 1P3KA 5GT0C 3WTPC 4WU9C 3MGPD 3AZKA 2YFWB 4KUDA 1ULYA 1S32A 5AV9C 3X1TA 3AV1B 5B24D 1P3GB 1ID3D 5F99D 4Z66C 2F8NG 3AZHC 3AZMA 1P34D 4DRAA 1M18D 2PYOC 3X1VB 5CP6C 3WKJA 3REIB 5B32C 4J8VC 1F66A 3W96C 4EO5B 3WAAB 4H9OA 2L5AA 3AZJB 4YS3C 5AV8D 1KX3A 5JRGD 2NZDB 3AZGC 5CHLB 3AZEB 1M1AD 3W97B 5B31D 1ID3A 4H9QA 1HQ3D 1AOIB 3B6FC 4R8PD 2RVQC 3MNNB 3B0CT 3MGQC 3UT9B 4YM6C 1N1JA 5BO0A 3MGRB 5GT3B 3O62B 5C3IB 5B0ZD 5E5AC 1ZLAD 3W99D 5AV8A 5JRGA 4WU8D 3AZLC 3AV2C 5CPJC 1M1AA 3WA9D 3MGSA 2F8ND 4Z5TB 3C1CD 5GSUD 5CPIA 4XUJC 3R45B 3AZND 4G92C 4H9RB 5B2IA 5BNVB 3A6NB 5B0ZA 3TU4B 1ZLAA 3W99A 5AY8C 5AV5C 4J8UC 4WU9B 1KX5D 3LELC 5AVBC 1P3OC 4ZBJB 3AYWD 5AV9B 3REHC 3KUYD 1EQZC 4ZUXB 3REJC 3AZHB 5B2JA 3LZ0B 3LJAA 5GXQC 5CP6B 3AZNA 4QLCA 4J8XA 5B32B 4J8VB 5AV6D 5B40A 4XZQC 3UTAA 3AZFD 1P3IA 5KDMA 5BT1D 5B1MD 3W98C 3B6GD 5B1LA 3MGPB 3KUYA 5BNXB 1WWSA 5B24B 3X1UA 3VH5T 3MVDD 5F99B 5AV6A 1P3GC 1M18B 4J8WC 1P34B 5B0YC 1KX4A 3AN2A 3KWQC 3REIC 1U35C 5B1MA 5E5AB 3B6GA 4EO5C 4X23C 3WAAC 5CPJB 3AZJC 3NQUB 5B33C 1JFIB 3NQJA
chains in the Genus database with same CATH superfamily
2NZDC 3MVDA 5DNND 5B31B 2VQRA 3W97C 4JJND 2ZM5A 1TAFB 5G49B 1HQ3B 3VH6T 4R8PB 5DNMC 5AY8B 4UPKA 5AV5B 3UTBB 3UT9C 1M19A 2BYMA 3MGRC 1P3OB 3REKD 5GT3C 3O62C 2Y2HA 5AVCD 4WU8B 3AZKD 3WA9B 5DNNA 5GXQB 3C1CB 2F8NB 5GSUB 1P3AA 4JJNA 5BS7C 3X1SD 3KXBD 4XZQB 3AZMD 3WKJD 2BYKB 3MNNA 2HIOA 3B0BA 4AWLC 2Y2NA 4H9SA 4HGAC 3REKA 4CSRA 2AROB 3A6NC 2Y2JA 3AFAC 3TU4C 2FJ7A 5GT0D 4E44A 5AVCA 3WTPD 4KGCC 3C1BB 1P3FB 1KX3D 4ZBJC 3H0LC 1P3PD 4Z5TA 3X1SA 5CPKA 4KUDC 3KXBA 2NQBA 4ZUXC 4J8WB 2CV5A 3X1TC 5B0YB 3LZ0C 1H3OB 3KWQB 1U35B 3EPKA 3W96D 3AZFB 3B0CW 3AZID 2JCHA 4X23B 1B67A 2YFVB 1P3BD 1F66C 5GT0A 2F8NK 3WTPA 2JSSA 3IP4C 5B33B 4H9PB 3A1IA 5FUGB 5JA4B 4LD9D 3MGPC 1P3PA 2ZY4A 4H9NB 3MGSD 5CPID 4Z66A 3AZHA 2PYOA 4Z2MH 5CP6A 5DNMB 5B24C 1ID3C 5F99C 3W96A 1M18C 1P34C 3AZIA 5B2ID 1P3BA 1P3LD 4YS3A 2Y2MA 1BH8B 4LD9A 3AZGA 4E45A 1BH9A 2BG1A 5AV8C 3LZ1B 1T3UA 1P3MD 4XUJD 1M1AC 1F1EA 5B2JD 4CAYB 3LJAD 3B6FA 5B31C 2XD5A 4QLCD 4J8XD 3MGQA 2HUEC 4YM6A 4WNNB 5B40D 4AWLB 1HQ3C 4HGAB 3UTAD 1WWIA 4R8PC 2DF4C 1P3ID 1TZYD 1P3LA 3AFAB 4KGCB 4J8UD 3UTBC 3RELD 2IO5C 4UUZB 4DRBA 3AZLA 1R4VA 5B0ZC 1P3KB 1ZLAC 3W99C 3AV2A 5B1LD 3AZKB 1P3MA 4KUDB 1JFIA 4WU8C 4XUJA 1S32B 3X1TB 3WA9C 3C1CC 3X1UD 5GSUC 4KHAA 3VH5W 3AZMB 3WKJB 1KX4D 3AZNC 1TZYA 3AN2D 1F66B 4J8UA 3RELA 3LELA 5AVBA 3P5JB 2AROC 3EG5B 4H9OB 3REHA 3KSYA 1KX5C 1KX3B 3C1BC 3AYWC 1P3FC 1EQZA 3REJA 3KUYC 3AV1D 2Y2QA 1ID3B 1A7WA 4H9QB 3X1VD 3VH6W 1N1JB 3V9RA 5BO0B 3AZFC 3W98A 1M19D 5BT1C 4NE6A 3B6GC 5AV8B 2Y2OA 2YFWA 5JRGB 1M1AB 3AV1A 3AZED 1P3AD 1P3GA 2HUEB 5B0YA 3X1VA 3REIA 1AOID 1BFMA 3MNND 2HIOD 2IO5B 3WAAA 5B0ZB 1ZLAB 5GT3D 3W99B 2FJ7D 3AZJA 2Y2GA 2NZDA 3AZEA 3W97A 3LZ1C 4Z5TD 5CPKD 2NQBD 5B2JB 3LJAB 2CV5D 5DNMA 3AZNB 4QLCB 1AOIA 4J8XB 4JJNC 5B40B 3UTAB 3UT9A 3MGRA 1P3IB 5KDMB 5GT3A 3O62A 3A6ND 1KX5B 4NE3A 4WU9D 4H9SC 3AYWB 3VH5A 3REKC 1BH8A 5B1LB 1P3KC 2Y2LA 5AV9D 3KUYB 5AVCC 3AZKC 2LY8A 1S32C 4NFTA 4Z66D 3AZHD 3X1UB 2PYOD 3R45A 5CP6D 3X1SC 2F8NH 5AV6B 3KXBC 5B32D 4J8VD 4WNNA 3AZMC 4H9RA 3WKJC 3B0DB 3AN2B 5BNVA 3A6NA 5B1MB 3TU4A 3A1KA 4WU9A 3B6GB 4WV4B 4YS3D 3AL0C 5AV9A 4M6BA 3AZGD 2G5IC 3VH6A 1KX3C 3NQJB 4DQYB 4ZUXA 3LZ0A 3MVDB 1P3PC 3B6FD 4G91C 2JE5A 2RVQD 5B32A 4J8VA 3MGQD 4YM6D 1HTAA 5E5AD 1M19B 3AZIC 2BYMB 1P3BC 3AZLD 3WTPE 3MGPA 3AV2D 5CPJD 5BNXA 5JRGC 4LD9C 5DNNB 5B24A 1P3AB 3MGSC 4JJNB 4Z2MG 5F99A 5CPIC 1M18A 1P34A 5E5AA 2HIOB 5AY8D 5AV5D 3UTBD 5B2IC 3LELD 3REKB 5AVBD 4CSRB 1P3LC 1P3OD 2FJ7B 2CWEA 5AVCB 5CPJA 3REHD 3NQUA 1EQZD 3REJD 5GXQD 5B31A 3X1SB 5CPKB 1P3MC 3KXBB 2NQBB 2CV5B 1TAFA 5G49A 5B2JC 1HQ3A 4XZQD 3LJAC 1PZRA 4WZSB 4R8PA 4QLCC 4J8XC 4NE5A 3H0RC 5AY8A 5AV5A 3UTAC 3UTBA 5B40C 3W98D 1P3IC 1TZYC 1P3OA 5GT0B 2AROD 3WTPB 3RELC 4WU8A 3C1BD 1P3FD 5B1LC 3WA9A 1P3PB 5GXQA 3C1CA 2F8NA 5GSUA 4G91B 4Z66B 1P3GD 2PYOB 4XZQA 4J8WD 5B0YD 3X1UC 3KWQD 2BYKA 5AV6C 3REID 1U35D 3W96B 3AZIB 1KX4C 3B0DC 3AN2C 1P3BB 4X23D 3EPLA 3WAAD 2AROA 5B1MC 1KX5A 4YS3B 3C1BA 3AYWA 3AZJD 1P3FA 5B33D 1Q9CA 4LD9B 3AZGB 1BH9B 2NZDD 2G5HC 3MGSB 5CPIB 3W97D 4J8WA 3AV1C 3MVDC 3B6FB 1H3OA 5DNMD 3KWQA 1U35A 3MGQB 4YM6B 3AZFA 3UT9D 5B2IB 3X1VC 4WJ3C 1KU5A 4X23A 5B32G 3MGRD 1P3LB 2YFVA 3O62D 1B6WA 2RIQA 1M19C 2FFFB 5B33A 4H9PA 3AZLB 5FUGA 3AV2B 5JA4A 1P3MB 4H9NA 4XUJB 2ZY5A 3LZ1D 5DNNC 3AZEC 4KHAB 1P3AC 4G92B 1AOIC 1TZYB 3MNNC 4J8UB 3TU4D 3AFAD 3RELB 2HIOC 4KGCD 3LELB 1W2EA 5AVBB 5C3IC 1P3KD 3REHB 2FJ7C 3LZ1A 5BS7A 2J8PA 1EQZB 4KUDD 1S32D 3REJB 4ZUXD 3X1TD 3LZ0D 4CAYA 3EPJA 4Z5TC 5CPKC 2NQBC 2CV5C 5B31G 1KX4B 3AFAA 1F66D 3V9RB 4KGCA 3W98B 4UUZA 3KFUG 1P3KA 5GT0C 3WTPC 4WU9C 3MGPD 3AZKA 2YFWB 4KUDA 1ULYA 1S32A 5AV9C 3X1TA 3AV1B 5B24D 1P3GB 1ID3D 5F99D 4Z66C 2F8NG 3AZHC 3AZMA 1P34D 4DRAA 1M18D 2PYOC 3X1VB 5CP6C 3WKJA 3REIB 5B32C 4J8VC 1F66A 3W96C 4EO5B 3WAAB 3EPHA 2Y2PA 4H9OA 2L5AA 3AZJB 4YS3C 5AV8D 1KX3A 5JRGD 2NZDB 3AZGC 5CHLB 3AZEB 2F2AC 1M1AD 3H0MC 3W97B 5B31D 1ID3A 4H9QA 1HQ3D 1AOIB 3B6FC 4R8PD 2RVQC 3MNNB 3B0CT 3MGQC 3UT9B 4YM6C 1N1JA 5BO0A 3MGRB 2W8SA 5GT3B 3O62B 5C3IB 5B0ZD 5E5AC 1ZLAD 3W99D 5AV8A 2UWXA 5JRGA 4WU8D 3AZLC 3AV2C 5CPJC 1M1AA 3WA9D 3MGSA 2F8ND 4Z5TB 3C1CD 5GSUD 5CPIA 4XUJC 3R45B 3FDDA 1Z2CB 3AZND 4G92C 2ZY3A 4H9RB 5B2IA 5BNVB 3A6NB 5B0ZA 3TU4B 1ZLAA 3W99A 5AY8C 5AV5C 4J8UC 4WU9B 1KX5D 3LELC 5AVBC 1P3OC 4ZBJB 3AYWD 5AV9B 3REHC 3KUYD 1EQZC 4ZUXB 3REJC 3AZHB 5B2JA 3LZ0B 3LJAA 5GXQC 5CP6B 3AZNA 4QLCA 4J8XA 5B32B 4J8VB 5AV6D 2DQNC 5B40A 4XZQC 3UTAA 3AZFD 1P3IA 5KDMA 5BT1D 5B1MD 3W98C 2Y2KA 3B6GD 5B1LA 3MGPB 3KUYA 5BNXB 1WWSA 5B24B 3X1UA 3VH5T 2Y2IA 3MVDD 3F6TA 2XD1A 5F99B 5AV6A 1P3GC 1M18B 4J8WC 1P34B 5B0YC 1KX4A 3AN2A 3KWQC 3REIC 1U35C 5B1MA 5E5AB 2ZY2A 3B6GA 4EO5C 4X23C 3WAAC 5CPJB 3AZJC 3NQUB 5B33C 1JFIB 3NQJA
chains in the Genus database with same CATH topology
2NZDC 3MVDA 5DNND 5B31B 2VQRA 3W97C 4JJND 2ZM5A 1TAFB 5G49B 1HQ3B 3VH6T 4R8PB 5DNMC 5AY8B 4UPKA 5AV5B 3UTBB 3UT9C 1M19A 2BYMA 3MGRC 1P3OB 3REKD 5GT3C 3O62C 2Y2HA 5AVCD 4WU8B 3AZKD 3WA9B 5DNNA 5GXQB 3C1CB 2F8NB 5GSUB 1P3AA 4JJNA 5BS7C 3X1SD 3KXBD 4XZQB 3AZMD 3WKJD 2BYKB 3MNNA 2HIOA 3B0BA 4AWLC 2Y2NA 4H9SA 4HGAC 3REKA 4CSRA 2AROB 3A6NC 2Y2JA 3AFAC 3TU4C 2FJ7A 5GT0D 4E44A 5AVCA 3WTPD 4KGCC 3C1BB 1P3FB 1KX3D 4ZBJC 3H0LC 1P3PD 4Z5TA 3X1SA 5CPKA 4KUDC 3KXBA 2NQBA 4ZUXC 4J8WB 2CV5A 3X1TC 5B0YB 3LZ0C 1H3OB 3KWQB 1U35B 3EPKA 3W96D 3AZFB 3B0CW 3AZID 2JCHA 4X23B 1B67A 2YFVB 1P3BD 1F66C 5GT0A 2F8NK 3WTPA 2JSSA 3IP4C 5B33B 4H9PB 3A1IA 5FUGB 5JA4B 4LD9D 3MGPC 1P3PA 2ZY4A 4H9NB 3MGSD 5CPID 4Z66A 3AZHA 2PYOA 4Z2MH 5CP6A 5DNMB 5B24C 1ID3C 5F99C 3W96A 1M18C 1P34C 3AZIA 5B2ID 1P3BA 1P3LD 4YS3A 2Y2MA 1BH8B 4LD9A 3AZGA 4E45A 1BH9A 2BG1A 5AV8C 3LZ1B 1T3UA 1P3MD 4XUJD 1M1AC 1F1EA 5B2JD 4CAYB 3LJAD 3B6FA 5B31C 2XD5A 4QLCD 4J8XD 3MGQA 2HUEC 4YM6A 4WNNB 5B40D 4AWLB 1HQ3C 4HGAB 3UTAD 1WWIA 4R8PC 2DF4C 1P3ID 1TZYD 1P3LA 3AFAB 4KGCB 4J8UD 3UTBC 3RELD 2IO5C 4UUZB 4DRBA 3AZLA 1R4VA 5B0ZC 1P3KB 1ZLAC 3W99C 3AV2A 5B1LD 3AZKB 1P3MA 4KUDB 1JFIA 4WU8C 4XUJA 1S32B 3X1TB 3WA9C 3C1CC 3X1UD 5GSUC 4KHAA 3VH5W 3AZMB 3WKJB 1KX4D 3AZNC 1TZYA 3AN2D 1F66B 4J8UA 3RELA 3LELA 5AVBA 3P5JB 2AROC 3EG5B 4H9OB 3REHA 3KSYA 1KX5C 1KX3B 3C1BC 3AYWC 1P3FC 1EQZA 3REJA 3KUYC 3AV1D 2Y2QA 1ID3B 1A7WA 4H9QB 3X1VD 3VH6W 1N1JB 3V9RA 5BO0B 3AZFC 3W98A 1M19D 5BT1C 4NE6A 3B6GC 5AV8B 2Y2OA 2YFWA 5JRGB 1M1AB 3AV1A 3AZED 1P3AD 1P3GA 2HUEB 5B0YA 3X1VA 3REIA 1AOID 1BFMA 3MNND 2HIOD 2IO5B 3WAAA 5B0ZB 1ZLAB 5GT3D 3W99B 2FJ7D 3AZJA 2Y2GA 2NZDA 3AZEA 3W97A 3LZ1C 4Z5TD 5CPKD 2NQBD 5B2JB 3LJAB 2CV5D 5DNMA 3AZNB 4QLCB 1AOIA 4J8XB 4JJNC 5B40B 3UTAB 3UT9A 3MGRA 1P3IB 5KDMB 5GT3A 3O62A 3A6ND 1KX5B 4NE3A 4WU9D 4H9SC 3AYWB 3VH5A 3REKC 1BH8A 5B1LB 1P3KC 2Y2LA 5AV9D 3KUYB 5AVCC 3AZKC 2LY8A 1S32C 4NFTA 4Z66D 3AZHD 3X1UB 2PYOD 3R45A 5CP6D 3X1SC 2F8NH 5AV6B 3KXBC 5B32D 4J8VD 4WNNA 3AZMC 4H9RA 3WKJC 3B0DB 3AN2B 5BNVA 3A6NA 5B1MB 3TU4A 3A1KA 4WU9A 3B6GB 4WV4B 4YS3D 3AL0C 5AV9A 4M6BA 3AZGD 2G5IC 3VH6A 1KX3C 3NQJB 4DQYB 4ZUXA 3LZ0A 3MVDB 1P3PC 3B6FD 4G91C 2JE5A 2RVQD 5B32A 4J8VA 3MGQD 4YM6D 1HTAA 5E5AD 1M19B 3AZIC 2BYMB 1P3BC 3AZLD 3WTPE 3MGPA 3AV2D 5CPJD 5BNXA 5JRGC 4LD9C 5DNNB 5B24A 1P3AB 3MGSC 4JJNB 4Z2MG 5F99A 5CPIC 1M18A 1P34A 5E5AA 2HIOB 5AY8D 5AV5D 3UTBD 5B2IC 3LELD 3REKB 5AVBD 4CSRB 1P3LC 1P3OD 2FJ7B 2CWEA 5AVCB 5CPJA 3REHD 3NQUA 1EQZD 3REJD 5GXQD 5B31A 3X1SB 5CPKB 1P3MC 3KXBB 2NQBB 2CV5B 1TAFA 5G49A 5B2JC 1HQ3A 4XZQD 3LJAC 1PZRA 4WZSB 4R8PA 4QLCC 4J8XC 4NE5A 3H0RC 5AY8A 5AV5A 3UTAC 3UTBA 5B40C 3W98D 1P3IC 1TZYC 1P3OA 5GT0B 2AROD 3WTPB 3RELC 4WU8A 3C1BD 1P3FD 5B1LC 3WA9A 1P3PB 5GXQA 3C1CA 2F8NA 5GSUA 4G91B 4Z66B 1P3GD 2PYOB 4XZQA 4J8WD 5B0YD 3X1UC 3KWQD 2BYKA 5AV6C 3REID 1U35D 3W96B 3AZIB 1KX4C 3B0DC 3AN2C 1P3BB 4X23D 3EPLA 3WAAD 2AROA 5B1MC 1KX5A 4YS3B 3C1BA 3AYWA 3AZJD 1P3FA 5B33D 1Q9CA 4LD9B 3AZGB 1BH9B 2NZDD 2G5HC 3MGSB 5CPIB 3W97D 4J8WA 3AV1C 3MVDC 3B6FB 1H3OA 5DNMD 3KWQA 1U35A 3MGQB 4YM6B 3AZFA 3UT9D 5B2IB 3X1VC 4WJ3C 1KU5A 4X23A 5B32G 3MGRD 1P3LB 2YFVA 3O62D 1B6WA 2RIQA 1M19C 2FFFB 5B33A 4H9PA 3AZLB 5FUGA 3AV2B 5JA4A 1P3MB 4H9NA 4XUJB 2ZY5A 3LZ1D 5DNNC 3AZEC 4KHAB 1P3AC 4G92B 1AOIC 1TZYB 3MNNC 4J8UB 3TU4D 3AFAD 3RELB 2HIOC 4KGCD 3LELB 1W2EA 5AVBB 5C3IC 1P3KD 3REHB 2FJ7C 3LZ1A 5BS7A 2J8PA 1EQZB 4KUDD 1S32D 3REJB 4ZUXD 3X1TD 3LZ0D 4CAYA 3EPJA 4Z5TC 5CPKC 2NQBC 2CV5C 5B31G 1KX4B 3AFAA 1F66D 3V9RB 4KGCA 3W98B 4UUZA 3KFUG 1P3KA 5GT0C 3WTPC 4WU9C 3MGPD 3AZKA 2YFWB 4KUDA 1ULYA 1S32A 5AV9C 3X1TA 3AV1B 5B24D 1P3GB 1ID3D 5F99D 4Z66C 2F8NG 3AZHC 3AZMA 1P34D 4DRAA 1M18D 2PYOC 3X1VB 5CP6C 3WKJA 3REIB 5B32C 4J8VC 1F66A 3W96C 4EO5B 3WAAB 3EPHA 2Y2PA 4H9OA 2L5AA 3AZJB 4YS3C 5AV8D 1KX3A 5JRGD 2NZDB 3AZGC 5CHLB 3AZEB 2F2AC 1M1AD 3H0MC 3W97B 5B31D 1ID3A 4H9QA 1HQ3D 1AOIB 3B6FC 4R8PD 2RVQC 3MNNB 3B0CT 3MGQC 3UT9B 4YM6C 1N1JA 5BO0A 3MGRB 2W8SA 5GT3B 3O62B 5C3IB 5B0ZD 5E5AC 1ZLAD 3W99D 5AV8A 2UWXA 5JRGA 4WU8D 3AZLC 3AV2C 5CPJC 1M1AA 3WA9D 3MGSA 2F8ND 4Z5TB 3C1CD 5GSUD 5CPIA 4XUJC 3R45B 3FDDA 1Z2CB 3AZND 4G92C 2ZY3A 4H9RB 5B2IA 5BNVB 3A6NB 5B0ZA 3TU4B 1ZLAA 3W99A 5AY8C 5AV5C 4J8UC 4WU9B 1KX5D 3LELC 5AVBC 1P3OC 4ZBJB 3AYWD 5AV9B 3REHC 3KUYD 1EQZC 4ZUXB 3REJC 3AZHB 5B2JA 3LZ0B 3LJAA 5GXQC 5CP6B 3AZNA 4QLCA 4J8XA 5B32B 4J8VB 5AV6D 2DQNC 5B40A 4XZQC 3UTAA 3AZFD 1P3IA 5KDMA 5BT1D 5B1MD 3W98C 2Y2KA 3B6GD 5B1LA 3MGPB 3KUYA 5BNXB 1WWSA 5B24B 3X1UA 3VH5T 2Y2IA 3MVDD 3F6TA 2XD1A 5F99B 5AV6A 1P3GC 1M18B 4J8WC 1P34B 5B0YC 1KX4A 3AN2A 3KWQC 3REIC 1U35C 5B1MA 5E5AB 2ZY2A 3B6GA 4EO5C 4X23C 3WAAC 5CPJB 3AZJC 3NQUB 5B33C 1JFIB 3NQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZD C;  3MVD A;  5DNN D;  5B31 B;  3W97 C;  4JJN D;  1TAF B;  5G49 B;  1HQ3 B;  3VH6 T;  4R8P B;  5DNM C;  5AY8 B;  5AV5 B;  3UTB B;  3UT9 C;  1M19 A;  2BYM A;  3MGR C;  1P3O B;  3REK D;  5GT3 C;  3O62 C;  5AVC D;  4WU8 B;  3AZK D;  3WA9 B;  5DNN A;  5GXQ B;  3C1C B;  2F8N B;  5GSU B;  1P3A A;  4JJN A;  5BS7 C;  3X1S D;  3KXB D;  4XZQ B;  3AZM D;  3WKJ D;  2BYK B;  3MNN A;  2HIO A;  3B0B A;  4AWL C;  4H9S A;  4HGA C;  3REK A;  4CSR A;  2ARO B;  3A6N C;  3AFA C;  3TU4 C;  2FJ7 A;  5GT0 D;  4E44 A;  5AVC A;  3WTP D;  4KGC C;  3C1B B;  1P3F B;  1KX3 D;  4ZBJ C;  1P3P D;  4Z5T A;  3X1S A;  5CPK A;  4KUD C;  3KXB A;  2NQB A;  4ZUX C;  4J8W B;  2CV5 A;  3X1T C;  5B0Y B;  3LZ0 C;  1H3O B;  3KWQ B;  1U35 B;  3W96 D;  3AZF B;  3B0C W;  3AZI D;  4X23 B;  1B67 A;  2YFV B;  1P3B D;  1F66 C;  5GT0 A;  2F8N K;  3WTP A;  2JSS A;  5B33 B;  4H9P B;  5FUG B;  5JA4 B;  4LD9 D;  3MGP C;  1P3P A;  4H9N B;  3MGS D;  5CPI D;  4Z66 A;  3AZH A;  2PYO A;  4Z2M H;  5CP6 A;  5DNM B;  5B24 C;  1ID3 C;  5F99 C;  3W96 A;  1M18 C;  1P34 C;  3AZI A;  5B2I D;  1P3B A;  1P3L D;  4YS3 A;  1BH8 B;  4LD9 A;  3AZG A;  4E45 A;  1BH9 A;  5AV8 C;  3LZ1 B;  1P3M D;  4XUJ D;  1M1A C;  1F1E A;  5B2J D;  4CAY B;  3LJA D;  3B6F A;  5B31 C;  4QLC D;  4J8X D;  3MGQ A;  2HUE C;  4YM6 A;  4WNN B;  5B40 D;  4AWL B;  1HQ3 C;  4HGA B;  3UTA D;  1WWI A;  4R8P C;  1P3I D;  1TZY D;  1P3L A;  3AFA B;  4KGC B;  4J8U D;  3UTB C;  3REL D;  2IO5 C;  4UUZ B;  4DRB A;  3AZL A;  1R4V A;  5B0Z C;  1P3K B;  1ZLA C;  3W99 C;  3AV2 A;  5B1L D;  3AZK B;  1P3M A;  4KUD B;  1JFI A;  4WU8 C;  4XUJ A;  1S32 B;  3X1T B;  3WA9 C;  3C1C C;  3X1U D;  5GSU C;  4KHA A;  3VH5 W;  3AZM B;  3WKJ B;  1KX4 D;  3AZN C;  1TZY A;  3AN2 D;  1F66 B;  4J8U A;  3REL A;  3LEL A;  5AVB A;  2ARO C;  3REH A;  4H9O B;  1KX5 C;  3KSY A;  1KX3 B;  3C1B C;  3AYW C;  1P3F C;  1EQZ A;  3REJ A;  3KUY C;  3AV1 D;  1ID3 B;  1A7W A;  4H9Q B;  3X1V D;  3VH6 W;  1N1J B;  3V9R A;  5BO0 B;  3AZF C;  3W98 A;  1M19 D;  5BT1 C;  4NE6 A;  3B6G C;  5AV8 B;  2YFW A;  5JRG B;  1M1A B;  3AV1 A;  3AZE D;  1P3A D;  1P3G A;  2HUE B;  5B0Y A;  3X1V A;  3REI A;  1AOI D;  1BFM A;  3MNN D;  2HIO D;  2IO5 B;  3WAA A;  5B0Z B;  1ZLA B;  5GT3 D;  3W99 B;  2FJ7 D;  3AZJ A;  2NZD A;  3AZE A;  3W97 A;  3LZ1 C;  4Z5T D;  5CPK D;  2NQB D;  5B2J B;  3LJA B;  2CV5 D;  5DNM A;  3AZN B;  4QLC B;  1AOI A;  4J8X B;  4JJN C;  5B40 B;  3UTA B;  3UT9 A;  3MGR A;  1P3I B;  5KDM B;  5GT3 A;  3O62 A;  3A6N D;  1KX5 B;  4NE3 A;  4WU9 D;  4H9S C;  3AYW B;  3VH5 A;  3REK C;  1BH8 A;  5B1L B;  1P3K C;  5AV9 D;  3KUY B;  5AVC C;  3AZK C;  2LY8 A;  1S32 C;  4NFT A;  4Z66 D;  3AZH D;  3X1U B;  2PYO D;  3R45 A;  5CP6 D;  3X1S C;  2F8N H;  5AV6 B;  3KXB C;  5B32 D;  4J8V D;  4WNN A;  3AZM C;  4H9R A;  3WKJ C;  3B0D B;  3AN2 B;  5BNV A;  3A6N A;  5B1M B;  3TU4 A;  4WU9 A;  3B6G B;  4WV4 B;  4YS3 D;  5AV9 A;  4M6B A;  3AZG D;  3VH6 A;  1KX3 C;  3NQJ B;  4ZUX A;  3LZ0 A;  3MVD B;  1P3P C;  3B6F D;  4G91 C;  5B32 A;  2RVQ D;  4J8V A;  3MGQ D;  4YM6 D;  1HTA A;  5E5A D;  1M19 B;  3AZI C;  2BYM B;  1P3B C;  3AZL D;  3WTP E;  3MGP A;  3AV2 D;  5CPJ D;  5BNX A;  5JRG C;  4LD9 C;  5DNN B;  5B24 A;  1P3A B;  3MGS C;  4JJN B;  4Z2M G;  5F99 A;  5CPI C;  1M18 A;  1P34 A;  5E5A A;  2HIO B;  5AY8 D;  5AV5 D;  3UTB D;  5B2I C;  3LEL D;  3REK B;  5AVB D;  4CSR B;  1P3L C;  1P3O D;  2FJ7 B;  2CWE A;  5AVC B;  5CPJ A;  3REH D;  3NQU A;  1EQZ D;  3REJ D;  5GXQ D;  5B31 A;  3X1S B;  5CPK B;  1P3M C;  3KXB B;  2NQB B;  2CV5 B;  1TAF A;  5G49 A;  5B2J C;  1HQ3 A;  4XZQ D;  3LJA C;  4WZS B;  4R8P A;  4QLC C;  4J8X C;  4NE5 A;  5AY8 A;  5AV5 A;  3UTA C;  3UTB A;  5B40 C;  3W98 D;  1P3I C;  1TZY C;  1P3O A;  5GT0 B;  2ARO D;  3WTP B;  3REL C;  4WU8 A;  3C1B D;  1P3F D;  5B1L C;  3WA9 A;  1P3P B;  5GXQ A;  3C1C A;  2F8N A;  5GSU A;  4G91 B;  4Z66 B;  1P3G D;  2PYO B;  4XZQ A;  4J8W D;  5B0Y D;  3X1U C;  3KWQ D;  2BYK A;  5AV6 C;  3REI D;  1U35 D;  3W96 B;  3AZI B;  1KX4 C;  3B0D C;  3AN2 C;  1P3B B;  4X23 D;  3WAA D;  2ARO A;  5B1M C;  1KX5 A;  4YS3 B;  3C1B A;  3AYW A;  3AZJ D;  1P3F A;  5B33 D;  1Q9C A;  4LD9 B;  3AZG B;  1BH9 B;  2NZD D;  3MGS B;  5CPI B;  3W97 D;  4J8W A;  3AV1 C;  3MVD C;  3B6F B;  1H3O A;  5DNM D;  3KWQ A;  1U35 A;  3MGQ B;  4YM6 B;  3AZF A;  3UT9 D;  5B2I B;  3X1V C;  1KU5 A;  4X23 A;  5B32 G;  3MGR D;  1P3L B;  2YFV A;  3O62 D;  1B6W A;  1M19 C;  5B33 A;  4H9P A;  3AZL B;  5FUG A;  3AV2 B;  5JA4 A;  1P3M B;  4H9N A;  4XUJ B;  3LZ1 D;  5DNN C;  3AZE C;  4KHA B;  1P3A C;  4G92 B;  1AOI C;  1TZY B;  3MNN C;  4J8U B;  3TU4 D;  3AFA D;  3REL B;  2HIO C;  4KGC D;  3LEL B;  5AVB B;  5C3I C;  1P3K D;  3REH B;  2FJ7 C;  3LZ1 A;  5BS7 A;  1EQZ B;  4KUD D;  1S32 D;  3REJ B;  4ZUX D;  3X1T D;  3LZ0 D;  4CAY A;  4Z5T C;  5CPK C;  2NQB C;  2CV5 C;  5B31 G;  1KX4 B;  3AFA A;  1F66 D;  3V9R B;  4KGC A;  3W98 B;  4UUZ A;  1P3K A;  5GT0 C;  3WTP C;  4WU9 C;  3MGP D;  3AZK A;  2YFW B;  4KUD A;  1ULY A;  1S32 A;  5AV9 C;  3X1T A;  3AV1 B;  5B24 D;  1P3G B;  1ID3 D;  5F99 D;  4Z66 C;  2F8N G;  3AZH C;  3AZM A;  1P34 D;  4DRA A;  1M18 D;  2PYO C;  3X1V B;  5CP6 C;  3WKJ A;  3REI B;  5B32 C;  4J8V C;  1F66 A;  3W96 C;  4EO5 B;  3WAA B;  4H9O A;  2L5A A;  3AZJ B;  4YS3 C;  5AV8 D;  1KX3 A;  5JRG D;  2NZD B;  3AZG C;  5CHL B;  3AZE B;  1M1A D;  3W97 B;  5B31 D;  1ID3 A;  4H9Q A;  1HQ3 D;  1AOI B;  3B6F C;  4R8P D;  2RVQ C;  3MNN B;  3B0C T;  3MGQ C;  3UT9 B;  4YM6 C;  1N1J A;  5BO0 A;  3MGR B;  5GT3 B;  3O62 B;  5C3I B;  5B0Z D;  5E5A C;  1ZLA D;  3W99 D;  5AV8 A;  5JRG A;  4WU8 D;  3AZL C;  3AV2 C;  5CPJ C;  1M1A A;  3WA9 D;  3MGS A;  2F8N D;  4Z5T B;  3C1C D;  5GSU D;  5CPI A;  4XUJ C;  3R45 B;  3AZN D;  4G92 C;  4H9R B;  5B2I A;  5BNV B;  3A6N B;  5B0Z A;  3TU4 B;  1ZLA A;  3W99 A;  5AY8 C;  5AV5 C;  4J8U C;  4WU9 B;  1KX5 D;  3LEL C;  5AVB C;  1P3O C;  4ZBJ B;  3AYW D;  5AV9 B;  3REH C;  3KUY D;  1EQZ C;  4ZUX B;  3REJ C;  3AZH B;  5B2J A;  3LZ0 B;  3LJA A;  5GXQ C;  5CP6 B;  3AZN A;  4QLC A;  4J8X A;  5B32 B;  4J8V B;  5AV6 D;  5B40 A;  4XZQ C;  3UTA A;  3AZF D;  1P3I A;  5KDM A;  5BT1 D;  5B1M D;  3W98 C;  3B6G D;  5B1L A;  3MGP B;  3KUY A;  5BNX B;  1WWS A;  5B24 B;  3X1U A;  3VH5 T;  3MVD D;  5F99 B;  5AV6 A;  1P3G C;  1M18 B;  4J8W C;  1P34 B;  5B0Y C;  1KX4 A;  3AN2 A;  3KWQ C;  3REI C;  1U35 C;  5B1M A;  5E5A B;  3B6G A;  4EO5 C;  4X23 C;  3WAA C;  5CPJ B;  3AZJ C;  3NQU B;  5B33 C;  1JFI B;  3NQJ A; 
#chains in the Genus database with same CATH topology
 2NZD C;  3MVD A;  5DNN D;  5B31 B;  2VQR A;  3W97 C;  4JJN D;  2ZM5 A;  1TAF B;  5G49 B;  1HQ3 B;  3VH6 T;  4R8P B;  5DNM C;  5AY8 B;  4UPK A;  5AV5 B;  3UTB B;  3UT9 C;  1M19 A;  2BYM A;  3MGR C;  1P3O B;  3REK D;  5GT3 C;  3O62 C;  2Y2H A;  5AVC D;  4WU8 B;  3AZK D;  3WA9 B;  5DNN A;  5GXQ B;  3C1C B;  2F8N B;  5GSU B;  1P3A A;  4JJN A;  5BS7 C;  3X1S D;  3KXB D;  4XZQ B;  3AZM D;  3WKJ D;  2BYK B;  3MNN A;  2HIO A;  3B0B A;  4AWL C;  2Y2N A;  4H9S A;  4HGA C;  3REK A;  4CSR A;  2ARO B;  3A6N C;  2Y2J A;  3AFA C;  3TU4 C;  2FJ7 A;  5GT0 D;  4E44 A;  5AVC A;  3WTP D;  4KGC C;  3C1B B;  1P3F B;  1KX3 D;  4ZBJ C;  3H0L C;  1P3P D;  4Z5T A;  3X1S A;  5CPK A;  4KUD C;  3KXB A;  2NQB A;  4ZUX C;  4J8W B;  2CV5 A;  3X1T C;  5B0Y B;  3LZ0 C;  1H3O B;  3KWQ B;  1U35 B;  3EPK A;  3W96 D;  3AZF B;  3B0C W;  3AZI D;  2JCH A;  4X23 B;  1B67 A;  2YFV B;  1P3B D;  1F66 C;  5GT0 A;  2F8N K;  3WTP A;  2JSS A;  3IP4 C;  5B33 B;  4H9P B;  3A1I A;  5FUG B;  5JA4 B;  4LD9 D;  3MGP C;  1P3P A;  2ZY4 A;  4H9N B;  3MGS D;  5CPI D;  4Z66 A;  3AZH A;  2PYO A;  4Z2M H;  5CP6 A;  5DNM B;  5B24 C;  1ID3 C;  5F99 C;  3W96 A;  1M18 C;  1P34 C;  3AZI A;  5B2I D;  1P3B A;  1P3L D;  4YS3 A;  2Y2M A;  1BH8 B;  4LD9 A;  3AZG A;  4E45 A;  1BH9 A;  2BG1 A;  5AV8 C;  3LZ1 B;  1T3U A;  1P3M D;  4XUJ D;  1M1A C;  1F1E A;  5B2J D;  4CAY B;  3LJA D;  3B6F A;  5B31 C;  2XD5 A;  4QLC D;  4J8X D;  3MGQ A;  2HUE C;  4YM6 A;  4WNN B;  5B40 D;  4AWL B;  1HQ3 C;  4HGA B;  3UTA D;  1WWI A;  4R8P C;  2DF4 C;  1P3I D;  1TZY D;  1P3L A;  3AFA B;  4KGC B;  4J8U D;  3UTB C;  3REL D;  2IO5 C;  4UUZ B;  4DRB A;  3AZL A;  1R4V A;  5B0Z C;  1P3K B;  1ZLA C;  3W99 C;  3AV2 A;  5B1L D;  3AZK B;  1P3M A;  4KUD B;  1JFI A;  4WU8 C;  4XUJ A;  1S32 B;  3X1T B;  3WA9 C;  3C1C C;  3X1U D;  5GSU C;  4KHA A;  3VH5 W;  3AZM B;  3WKJ B;  1KX4 D;  3AZN C;  1TZY A;  3AN2 D;  1F66 B;  4J8U A;  3REL A;  3LEL A;  5AVB A;  3P5J B;  2ARO C;  3EG5 B;  4H9O B;  3REH A;  3KSY A;  1KX5 C;  1KX3 B;  3C1B C;  3AYW C;  1P3F C;  1EQZ A;  3REJ A;  3KUY C;  3AV1 D;  2Y2Q A;  1ID3 B;  1A7W A;  4H9Q B;  3X1V D;  3VH6 W;  1N1J B;  3V9R A;  5BO0 B;  3AZF C;  3W98 A;  1M19 D;  5BT1 C;  4NE6 A;  3B6G C;  5AV8 B;  2Y2O A;  2YFW A;  5JRG B;  1M1A B;  3AV1 A;  3AZE D;  1P3A D;  1P3G A;  2HUE B;  5B0Y A;  3X1V A;  3REI A;  1AOI D;  1BFM A;  3MNN D;  2HIO D;  2IO5 B;  3WAA A;  5B0Z B;  1ZLA B;  5GT3 D;  3W99 B;  2FJ7 D;  3AZJ A;  2Y2G A;  2NZD A;  3AZE A;  3W97 A;  3LZ1 C;  4Z5T D;  5CPK D;  2NQB D;  5B2J B;  3LJA B;  2CV5 D;  5DNM A;  3AZN B;  4QLC B;  1AOI A;  4J8X B;  4JJN C;  5B40 B;  3UTA B;  3UT9 A;  3MGR A;  1P3I B;  5KDM B;  5GT3 A;  3O62 A;  3A6N D;  1KX5 B;  4NE3 A;  4WU9 D;  4H9S C;  3AYW B;  3VH5 A;  3REK C;  1BH8 A;  5B1L B;  1P3K C;  2Y2L A;  5AV9 D;  3KUY B;  5AVC C;  3AZK C;  2LY8 A;  1S32 C;  4NFT A;  4Z66 D;  3AZH D;  3X1U B;  2PYO D;  3R45 A;  5CP6 D;  3X1S C;  2F8N H;  5AV6 B;  3KXB C;  5B32 D;  4J8V D;  4WNN A;  3AZM C;  4H9R A;  3WKJ C;  3B0D B;  3AN2 B;  5BNV A;  3A6N A;  5B1M B;  3TU4 A;  3A1K A;  4WU9 A;  3B6G B;  4WV4 B;  4YS3 D;  3AL0 C;  5AV9 A;  4M6B A;  3AZG D;  2G5I C;  3VH6 A;  1KX3 C;  3NQJ B;  4DQY B;  4ZUX A;  3LZ0 A;  3MVD B;  1P3P C;  3B6F D;  4G91 C;  2JE5 A;  2RVQ D;  5B32 A;  4J8V A;  3MGQ D;  4YM6 D;  1HTA A;  5E5A D;  1M19 B;  3AZI C;  2BYM B;  1P3B C;  3AZL D;  3WTP E;  3MGP A;  3AV2 D;  5CPJ D;  5BNX A;  5JRG C;  4LD9 C;  5DNN B;  5B24 A;  1P3A B;  3MGS C;  4JJN B;  4Z2M G;  5F99 A;  5CPI C;  1M18 A;  1P34 A;  5E5A A;  2HIO B;  5AY8 D;  5AV5 D;  3UTB D;  5B2I C;  3LEL D;  3REK B;  5AVB D;  4CSR B;  1P3L C;  1P3O D;  2FJ7 B;  2CWE A;  5AVC B;  5CPJ A;  3REH D;  3NQU A;  1EQZ D;  3REJ D;  5GXQ D;  5B31 A;  3X1S B;  5CPK B;  1P3M C;  3KXB B;  2NQB B;  2CV5 B;  1TAF A;  5G49 A;  5B2J C;  1HQ3 A;  4XZQ D;  3LJA C;  1PZR A;  4WZS B;  4R8P A;  4QLC C;  4J8X C;  4NE5 A;  3H0R C;  5AY8 A;  5AV5 A;  3UTA C;  3UTB A;  5B40 C;  3W98 D;  1P3I C;  1TZY C;  1P3O A;  5GT0 B;  2ARO D;  3WTP B;  3REL C;  4WU8 A;  3C1B D;  1P3F D;  5B1L C;  3WA9 A;  1P3P B;  5GXQ A;  3C1C A;  2F8N A;  5GSU A;  4G91 B;  4Z66 B;  1P3G D;  2PYO B;  4XZQ A;  4J8W D;  5B0Y D;  3X1U C;  3KWQ D;  2BYK A;  5AV6 C;  3REI D;  1U35 D;  3W96 B;  3AZI B;  1KX4 C;  3B0D C;  3AN2 C;  1P3B B;  4X23 D;  3EPL A;  3WAA D;  2ARO A;  5B1M C;  1KX5 A;  4YS3 B;  3C1B A;  3AYW A;  3AZJ D;  1P3F A;  5B33 D;  1Q9C A;  4LD9 B;  3AZG B;  1BH9 B;  2NZD D;  2G5H C;  3MGS B;  5CPI B;  3W97 D;  4J8W A;  3AV1 C;  3MVD C;  3B6F B;  1H3O A;  5DNM D;  3KWQ A;  1U35 A;  3MGQ B;  4YM6 B;  3AZF A;  3UT9 D;  5B2I B;  3X1V C;  4WJ3 C;  1KU5 A;  4X23 A;  5B32 G;  3MGR D;  1P3L B;  2YFV A;  3O62 D;  1B6W A;  2RIQ A;  1M19 C;  2FFF B;  5B33 A;  4H9P A;  3AZL B;  5FUG A;  3AV2 B;  5JA4 A;  1P3M B;  4H9N A;  4XUJ B;  2ZY5 A;  3LZ1 D;  5DNN C;  3AZE C;  4KHA B;  1P3A C;  4G92 B;  1AOI C;  1TZY B;  3MNN C;  4J8U B;  3TU4 D;  3AFA D;  3REL B;  2HIO C;  4KGC D;  3LEL B;  1W2E A;  5AVB B;  5C3I C;  1P3K D;  3REH B;  2FJ7 C;  3LZ1 A;  5BS7 A;  2J8P A;  1EQZ B;  4KUD D;  1S32 D;  3REJ B;  4ZUX D;  3X1T D;  3LZ0 D;  4CAY A;  3EPJ A;  4Z5T C;  5CPK C;  2NQB C;  2CV5 C;  5B31 G;  1KX4 B;  3AFA A;  1F66 D;  3V9R B;  4KGC A;  3W98 B;  4UUZ A;  3KFU G;  1P3K A;  5GT0 C;  3WTP C;  4WU9 C;  3MGP D;  3AZK A;  2YFW B;  4KUD A;  1ULY A;  1S32 A;  5AV9 C;  3X1T A;  3AV1 B;  5B24 D;  1P3G B;  1ID3 D;  5F99 D;  4Z66 C;  2F8N G;  3AZH C;  3AZM A;  1P34 D;  4DRA A;  1M18 D;  2PYO C;  3X1V B;  5CP6 C;  3WKJ A;  3REI B;  5B32 C;  4J8V C;  1F66 A;  3W96 C;  4EO5 B;  3WAA B;  3EPH A;  2Y2P A;  4H9O A;  2L5A A;  3AZJ B;  4YS3 C;  5AV8 D;  1KX3 A;  5JRG D;  2NZD B;  3AZG C;  5CHL B;  3AZE B;  2F2A C;  1M1A D;  3H0M C;  3W97 B;  5B31 D;  1ID3 A;  4H9Q A;  1HQ3 D;  1AOI B;  3B6F C;  4R8P D;  2RVQ C;  3MNN B;  3B0C T;  3MGQ C;  3UT9 B;  4YM6 C;  1N1J A;  5BO0 A;  3MGR B;  2W8S A;  5GT3 B;  3O62 B;  5C3I B;  5B0Z D;  5E5A C;  1ZLA D;  3W99 D;  5AV8 A;  2UWX A;  5JRG A;  4WU8 D;  3AZL C;  3AV2 C;  5CPJ C;  1M1A A;  3WA9 D;  3MGS A;  2F8N D;  4Z5T B;  3C1C D;  5GSU D;  5CPI A;  4XUJ C;  3R45 B;  3FDD A;  1Z2C B;  3AZN D;  4G92 C;  2ZY3 A;  4H9R B;  5B2I A;  5BNV B;  3A6N B;  5B0Z A;  3TU4 B;  1ZLA A;  3W99 A;  5AY8 C;  5AV5 C;  4J8U C;  4WU9 B;  1KX5 D;  3LEL C;  5AVB C;  1P3O C;  4ZBJ B;  3AYW D;  5AV9 B;  3REH C;  3KUY D;  1EQZ C;  4ZUX B;  3REJ C;  3AZH B;  5B2J A;  3LZ0 B;  3LJA A;  5GXQ C;  5CP6 B;  3AZN A;  4QLC A;  4J8X A;  5B32 B;  4J8V B;  5AV6 D;  2DQN C;  5B40 A;  4XZQ C;  3UTA A;  3AZF D;  1P3I A;  5KDM A;  5BT1 D;  5B1M D;  3W98 C;  2Y2K A;  3B6G D;  5B1L A;  3MGP B;  3KUY A;  5BNX B;  1WWS A;  5B24 B;  3X1U A;  3VH5 T;  2Y2I A;  3MVD D;  3F6T A;  2XD1 A;  5F99 B;  5AV6 A;  1P3G C;  1M18 B;  4J8W C;  1P34 B;  5B0Y C;  1KX4 A;  3AN2 A;  3KWQ C;  3REI C;  1U35 C;  5B1M A;  5E5A B;  2ZY2 A;  3B6G A;  4EO5 C;  4X23 C;  3WAA C;  5CPJ B;  3AZJ C;  3NQU B;  5B33 C;  1JFI B;  3NQJ A; 
#chains in the Genus database with same CATH homology
 2NZD C;  3MVD A;  5DNN D;  5B31 B;  2VQR A;  3W97 C;  4JJN D;  2ZM5 A;  1TAF B;  5G49 B;  1HQ3 B;  3VH6 T;  4R8P B;  5DNM C;  5AY8 B;  4UPK A;  5AV5 B;  3UTB B;  3UT9 C;  1M19 A;  2BYM A;  3MGR C;  1P3O B;  3REK D;  5GT3 C;  3O62 C;  2Y2H A;  5AVC D;  4WU8 B;  3AZK D;  3WA9 B;  5DNN A;  5GXQ B;  3C1C B;  2F8N B;  5GSU B;  1P3A A;  4JJN A;  5BS7 C;  3X1S D;  3KXB D;  4XZQ B;  3AZM D;  3WKJ D;  2BYK B;  3MNN A;  2HIO A;  3B0B A;  4AWL C;  2Y2N A;  4H9S A;  4HGA C;  3REK A;  4CSR A;  2ARO B;  3A6N C;  2Y2J A;  3AFA C;  3TU4 C;  2FJ7 A;  5GT0 D;  4E44 A;  5AVC A;  3WTP D;  4KGC C;  3C1B B;  1P3F B;  1KX3 D;  4ZBJ C;  3H0L C;  1P3P D;  4Z5T A;  3X1S A;  5CPK A;  4KUD C;  3KXB A;  2NQB A;  4ZUX C;  4J8W B;  2CV5 A;  3X1T C;  5B0Y B;  3LZ0 C;  1H3O B;  3KWQ B;  1U35 B;  3EPK A;  3W96 D;  3AZF B;  3B0C W;  3AZI D;  2JCH A;  4X23 B;  1B67 A;  2YFV B;  1P3B D;  1F66 C;  5GT0 A;  2F8N K;  3WTP A;  2JSS A;  3IP4 C;  5B33 B;  4H9P B;  3A1I A;  5FUG B;  5JA4 B;  4LD9 D;  3MGP C;  1P3P A;  2ZY4 A;  4H9N B;  3MGS D;  5CPI D;  4Z66 A;  3AZH A;  2PYO A;  4Z2M H;  5CP6 A;  5DNM B;  5B24 C;  1ID3 C;  5F99 C;  3W96 A;  1M18 C;  1P34 C;  3AZI A;  5B2I D;  1P3B A;  1P3L D;  4YS3 A;  2Y2M A;  1BH8 B;  4LD9 A;  3AZG A;  4E45 A;  1BH9 A;  2BG1 A;  5AV8 C;  3LZ1 B;  1T3U A;  1P3M D;  4XUJ D;  1M1A C;  1F1E A;  5B2J D;  4CAY B;  3LJA D;  3B6F A;  5B31 C;  2XD5 A;  4QLC D;  4J8X D;  3MGQ A;  2HUE C;  4YM6 A;  4WNN B;  5B40 D;  4AWL B;  1HQ3 C;  4HGA B;  3UTA D;  1WWI A;  4R8P C;  2DF4 C;  1P3I D;  1TZY D;  1P3L A;  3AFA B;  4KGC B;  4J8U D;  3UTB C;  3REL D;  2IO5 C;  4UUZ B;  4DRB A;  3AZL A;  1R4V A;  5B0Z C;  1P3K B;  1ZLA C;  3W99 C;  3AV2 A;  5B1L D;  3AZK B;  1P3M A;  4KUD B;  1JFI A;  4WU8 C;  4XUJ A;  1S32 B;  3X1T B;  3WA9 C;  3C1C C;  3X1U D;  5GSU C;  4KHA A;  3VH5 W;  3AZM B;  3WKJ B;  1KX4 D;  3AZN C;  1TZY A;  3AN2 D;  1F66 B;  4J8U A;  3REL A;  3LEL A;  5AVB A;  3P5J B;  2ARO C;  3EG5 B;  4H9O B;  3REH A;  3KSY A;  1KX5 C;  1KX3 B;  3C1B C;  3AYW C;  1P3F C;  1EQZ A;  3REJ A;  3KUY C;  3AV1 D;  2Y2Q A;  1ID3 B;  1A7W A;  4H9Q B;  3X1V D;  3VH6 W;  1N1J B;  3V9R A;  5BO0 B;  3AZF C;  3W98 A;  1M19 D;  5BT1 C;  4NE6 A;  3B6G C;  5AV8 B;  2Y2O A;  2YFW A;  5JRG B;  1M1A B;  3AV1 A;  3AZE D;  1P3A D;  1P3G A;  2HUE B;  5B0Y A;  3X1V A;  3REI A;  1AOI D;  1BFM A;  3MNN D;  2HIO D;  2IO5 B;  3WAA A;  5B0Z B;  1ZLA B;  5GT3 D;  3W99 B;  2FJ7 D;  3AZJ A;  2Y2G A;  2NZD A;  3AZE A;  3W97 A;  3LZ1 C;  4Z5T D;  5CPK D;  2NQB D;  5B2J B;  3LJA B;  2CV5 D;  5DNM A;  3AZN B;  4QLC B;  1AOI A;  4J8X B;  4JJN C;  5B40 B;  3UTA B;  3UT9 A;  3MGR A;  1P3I B;  5KDM B;  5GT3 A;  3O62 A;  3A6N D;  1KX5 B;  4NE3 A;  4WU9 D;  4H9S C;  3AYW B;  3VH5 A;  3REK C;  1BH8 A;  5B1L B;  1P3K C;  2Y2L A;  5AV9 D;  3KUY B;  5AVC C;  3AZK C;  2LY8 A;  1S32 C;  4NFT A;  4Z66 D;  3AZH D;  3X1U B;  2PYO D;  3R45 A;  5CP6 D;  3X1S C;  2F8N H;  5AV6 B;  3KXB C;  5B32 D;  4J8V D;  4WNN A;  3AZM C;  4H9R A;  3WKJ C;  3B0D B;  3AN2 B;  5BNV A;  3A6N A;  5B1M B;  3TU4 A;  3A1K A;  4WU9 A;  3B6G B;  4WV4 B;  4YS3 D;  3AL0 C;  5AV9 A;  4M6B A;  3AZG D;  2G5I C;  3VH6 A;  1KX3 C;  3NQJ B;  4DQY B;  4ZUX A;  3LZ0 A;  3MVD B;  1P3P C;  3B6F D;  4G91 C;  2JE5 A;  2RVQ D;  5B32 A;  4J8V A;  3MGQ D;  4YM6 D;  1HTA A;  5E5A D;  1M19 B;  3AZI C;  2BYM B;  1P3B C;  3AZL D;  3WTP E;  3MGP A;  3AV2 D;  5CPJ D;  5BNX A;  5JRG C;  4LD9 C;  5DNN B;  5B24 A;  1P3A B;  3MGS C;  4JJN B;  4Z2M G;  5F99 A;  5CPI C;  1M18 A;  1P34 A;  5E5A A;  2HIO B;  5AY8 D;  5AV5 D;  3UTB D;  5B2I C;  3LEL D;  3REK B;  5AVB D;  4CSR B;  1P3L C;  1P3O D;  2FJ7 B;  2CWE A;  5AVC B;  5CPJ A;  3REH D;  3NQU A;  1EQZ D;  3REJ D;  5GXQ D;  5B31 A;  3X1S B;  5CPK B;  1P3M C;  3KXB B;  2NQB B;  2CV5 B;  1TAF A;  5G49 A;  5B2J C;  1HQ3 A;  4XZQ D;  3LJA C;  1PZR A;  4WZS B;  4R8P A;  4QLC C;  4J8X C;  4NE5 A;  3H0R C;  5AY8 A;  5AV5 A;  3UTA C;  3UTB A;  5B40 C;  3W98 D;  1P3I C;  1TZY C;  1P3O A;  5GT0 B;  2ARO D;  3WTP B;  3REL C;  4WU8 A;  3C1B D;  1P3F D;  5B1L C;  3WA9 A;  1P3P B;  5GXQ A;  3C1C A;  2F8N A;  5GSU A;  4G91 B;  4Z66 B;  1P3G D;  2PYO B;  4XZQ A;  4J8W D;  5B0Y D;  3X1U C;  3KWQ D;  2BYK A;  5AV6 C;  3REI D;  1U35 D;  3W96 B;  3AZI B;  1KX4 C;  3B0D C;  3AN2 C;  1P3B B;  4X23 D;  3EPL A;  3WAA D;  2ARO A;  5B1M C;  1KX5 A;  4YS3 B;  3C1B A;  3AYW A;  3AZJ D;  1P3F A;  5B33 D;  1Q9C A;  4LD9 B;  3AZG B;  1BH9 B;  2NZD D;  2G5H C;  3MGS B;  5CPI B;  3W97 D;  4J8W A;  3AV1 C;  3MVD C;  3B6F B;  1H3O A;  5DNM D;  3KWQ A;  1U35 A;  3MGQ B;  4YM6 B;  3AZF A;  3UT9 D;  5B2I B;  3X1V C;  4WJ3 C;  1KU5 A;  4X23 A;  5B32 G;  3MGR D;  1P3L B;  2YFV A;  3O62 D;  1B6W A;  2RIQ A;  1M19 C;  2FFF B;  5B33 A;  4H9P A;  3AZL B;  5FUG A;  3AV2 B;  5JA4 A;  1P3M B;  4H9N A;  4XUJ B;  2ZY5 A;  3LZ1 D;  5DNN C;  3AZE C;  4KHA B;  1P3A C;  4G92 B;  1AOI C;  1TZY B;  3MNN C;  4J8U B;  3TU4 D;  3AFA D;  3REL B;  2HIO C;  4KGC D;  3LEL B;  1W2E A;  5AVB B;  5C3I C;  1P3K D;  3REH B;  2FJ7 C;  3LZ1 A;  5BS7 A;  2J8P A;  1EQZ B;  4KUD D;  1S32 D;  3REJ B;  4ZUX D;  3X1T D;  3LZ0 D;  4CAY A;  3EPJ A;  4Z5T C;  5CPK C;  2NQB C;  2CV5 C;  5B31 G;  1KX4 B;  3AFA A;  1F66 D;  3V9R B;  4KGC A;  3W98 B;  4UUZ A;  3KFU G;  1P3K A;  5GT0 C;  3WTP C;  4WU9 C;  3MGP D;  3AZK A;  2YFW B;  4KUD A;  1ULY A;  1S32 A;  5AV9 C;  3X1T A;  3AV1 B;  5B24 D;  1P3G B;  1ID3 D;  5F99 D;  4Z66 C;  2F8N G;  3AZH C;  3AZM A;  1P34 D;  4DRA A;  1M18 D;  2PYO C;  3X1V B;  5CP6 C;  3WKJ A;  3REI B;  5B32 C;  4J8V C;  1F66 A;  3W96 C;  4EO5 B;  3WAA B;  3EPH A;  2Y2P A;  4H9O A;  2L5A A;  3AZJ B;  4YS3 C;  5AV8 D;  1KX3 A;  5JRG D;  2NZD B;  3AZG C;  5CHL B;  3AZE B;  2F2A C;  1M1A D;  3H0M C;  3W97 B;  5B31 D;  1ID3 A;  4H9Q A;  1HQ3 D;  1AOI B;  3B6F C;  4R8P D;  2RVQ C;  3MNN B;  3B0C T;  3MGQ C;  3UT9 B;  4YM6 C;  1N1J A;  5BO0 A;  3MGR B;  2W8S A;  5GT3 B;  3O62 B;  5C3I B;  5B0Z D;  5E5A C;  1ZLA D;  3W99 D;  5AV8 A;  2UWX A;  5JRG A;  4WU8 D;  3AZL C;  3AV2 C;  5CPJ C;  1M1A A;  3WA9 D;  3MGS A;  2F8N D;  4Z5T B;  3C1C D;  5GSU D;  5CPI A;  4XUJ C;  3R45 B;  3FDD A;  1Z2C B;  3AZN D;  4G92 C;  2ZY3 A;  4H9R B;  5B2I A;  5BNV B;  3A6N B;  5B0Z A;  3TU4 B;  1ZLA A;  3W99 A;  5AY8 C;  5AV5 C;  4J8U C;  4WU9 B;  1KX5 D;  3LEL C;  5AVB C;  1P3O C;  4ZBJ B;  3AYW D;  5AV9 B;  3REH C;  3KUY D;  1EQZ C;  4ZUX B;  3REJ C;  3AZH B;  5B2J A;  3LZ0 B;  3LJA A;  5GXQ C;  5CP6 B;  3AZN A;  4QLC A;  4J8X A;  5B32 B;  4J8V B;  5AV6 D;  2DQN C;  5B40 A;  4XZQ C;  3UTA A;  3AZF D;  1P3I A;  5KDM A;  5BT1 D;  5B1M D;  3W98 C;  2Y2K A;  3B6G D;  5B1L A;  3MGP B;  3KUY A;  5BNX B;  1WWS A;  5B24 B;  3X1U A;  3VH5 T;  2Y2I A;  3MVD D;  3F6T A;  2XD1 A;  5F99 B;  5AV6 A;  1P3G C;  1M18 B;  4J8W C;  1P34 B;  5B0Y C;  1KX4 A;  3AN2 A;  3KWQ C;  3REI C;  1U35 C;  5B1M A;  5E5A B;  2ZY2 A;  3B6G A;  4EO5 C;  4X23 C;  3WAA C;  5CPJ B;  3AZJ C;  3NQU B;  5B33 C;  1JFI B;  3NQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...