4ZBJC

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zbjC00
1AOID 4H9NA 2IO5C 3RELD 3REIC 3AZKD 5AVBD 3MGQD 1F66D 2F8NB 4EO5B 3LZ1D 5CPJA 2HIOC 5F99A 3B6FD 1P3BC 3W97D 3W96B 1S32A 3AFAB 1KX4C 3MNNB 3X1SA 5B32G 1KX3D 5CPKD 3W98A 3UTAC 3B6GD 5B2JA 3C1CC 3X1TB 3AN2D 3WTPE 4AWLB 3LZ0B 3AZHA 1ZLAC 5DNMC 5B1MD 5JRGB 3MVDC 3W96D 4J8XB 3AZIC 4KGCC 3B6GB 5GXQB 3WA9B 1TAFB 3REJC 5B31A 4J8UC 4KUDC 1P34A 4YM6D 3AZMA 1N1JB 3VH5T 2FJ7B 3AV2C 4WU8C 2BYKA 4UUZA 3KXBA 4R8PC 4WU9C 3V9RB 4J8WC 4HGAB 1P3IC 3LJAC 5GSUD 5B2IA 5B1LC 5GXQD 1U35B 1S32B 1P3FA 1WWSA 2PYOD 4NE6A 3W99C 4DRAA 3X1SB 4Z66C 3WTPA 3AZEC 3KUYC 4H9SA 5FUGA 3UT9D 1P3KC 3TU4C 2FJ7D 5B2JB 3MGPC 5CP6D 5AV9D 3AZFA 1P3GA 2NZDC 5B40C 4ZBJC 1M18D 3KWQD 5B24B 4ZUXA 5B32A 4WV4B 3UTBC 1U35D 5AVCC 3A6NC 5AV6C 3VH5W 4XZQA 3AZJC 5E5AC 4J8VC 3WAAC 5DNNA 5JA4A 1EQZC 3AZGD 3AYWD 3X1VC 1P3MD 4X23A 2BYKB 3KXBB 5B24D 1AOIC 2CWEA 3AZKC 5AVBC 3MGQC 1F66C 1P3OA 3LZ1C 1F1EA 1P3FB 5C3IB 4Z5TA 2NQBA 3C1BB 5CPIA 3B6FC 3W97C 4CAYA 3WTPB 3AV1A 1KU5A 4G91C 4Z5TC 1H3OB 1KX3C 5CPKC 3KSYA 5B31G 3AZFB 4KHAA 1M19A 3R45A 5AY8C 4G92B 4YS3A 3AN2C 1ID3B 1TZYA 1HQ3A 4ZUXB 1KX5A 3REHA 5BS7C 5B32B 3MGRA 2AROA 2RVQD 3AZND 1P3AB 4EO5C 4QLCA 5B1MC 3C1BD 3W96C 3O62D 4JJNA 5BNXA 4XZQB 1M1AA 4LD9B 2BYMB 3AZLA 5DNNB 3REIA 5B0YB 4YM6C 1P3PB 4Z2MH 1BFMA 2HIOA 1ID3D 1P3BA 1P3AD 5B33B 3LELB 1KX4A 1P3OB 5AV5B 5GSUC 1Q9CA 5B0ZA 5CPIB 5GXQC 4CAYB 3UTAA 4LD9D 3AV1B 2PYOC 2CV5B 5B0ZC 3C1CA 2L5AA 3VH5A 5B0YD 3UT9C 3B0DC 1P3PD 2FJ7C 4H9QA 5GT0B 3WKJB 1M19B 3R45B 1ZLAA 5DNMA 5CP6C 2F8ND 3MVDA 5AV9C 4YS3B 1P3LA 3AZIA 4H9OB 5BNVA 1KX5B 1M18C 4KGCA 5B33D 2AROB 3LELD 1P3LC 3KWQC 5AV5D 3AFAD 2YFWA 1BH9A 3NQUA 3REJA 4E45A 3MNND 4J8UA 4KUDA 1R4VA 4JJNB 1U35C 2CV5D 3AV2A 4WU8A 3X1UB 5AV8B 2IO5B 4R8PA 3REIB 1JFIA 3X1TD 4WU9A 5GT0D 4J8WA 3WKJD 4H9NB 3LJAA 1P3IA 4M6BA 3AZGC 3AYWC 1P3MC 1A7WA 3LZ0D 5B1LA 1P3BB 5CPJB 5JRGD 1KX4B 3W99A 5F99B 4J8XD 4Z66A 3AZEA 3KUYA 3WA9D 1P3KA 3TU4A 3W98B 3X1UD 3MGSA 3MGPA 3C1CB 2NZDA 5AV8D 5B40A 5GT3A 3MGSC 4H9QB 5GT3C 4E44A 1ZLAB 5DNMB 3MVDB 4WNNA 3UTBA 3REKA 5CPJD 3AZIB 5BNVB 4KGCB 5AVCA 3AZHB 3A6NA 5F99D 5AV6A 3REKC 1S32D 3AZJA 2RVQC 5E5AA 2F8NK 3X1SD 4J8UB 4J8VA 3AZNC 3WAAA 4Z2MG 5BO0A 1EQZA 3W98D 5B31B 3C1BC 3X1VA 3O62C 1P34B 3AZMB 5B2JD 4R8PB 1JFIB 4XUJA 1B6WA 4WU9B 1AOIA 4UUZB 3LJAB 1P3IB 1ZLAD 3RELA 3AZKA 4XUJC 5AVBA 3MGQA 1F66A 3AZHD 3LZ1A 3RELC 5B2IB 1ID3C 3W99B 3B6FA 3W97A 4Z66B 3KUYB 1P3AC 3B0BA 5B31D 1KX3A 5CPKA 5FUGB 1P34D 3AZMD 4LD9C 2NZDB 5B40B 4ZBJB 5AY8A 2F8NH 1P3GB 3AN2A 3KXBD 3B6GC 5BS7A 5B0YC 3UTBB 1P3PC 5B2ID 3A6NB 5B1MA 5AV6B 3W96A 1P3FD 3AZJB 5B33C 5E5AB 4J8VB 3WAAB 5AV5C 3WTPD 3VH6T 4DRBA 3AFAC 3MNNC 4YM6A 5JA4B 2YFVA 1P3GD 3AZFD 4X23B 1AOIB 3AZKB 5G49A 3MGQB 3X1TC 1F66B 4ZUXD 3WKJC 5B32D 3LZ1B 5GSUA 4AWLC 3NQJA 3LZ0C 3B6FB 3W97B 5GXQA 5JRGC 2PYOA 4G91B 4Z5TB 2NQBB 4J8XC 4XZQD 1KX3B 3WA9C 1WWIA 2JSSA 5DNND 3UT9A 2FJ7A 5AY8B 4X23D 5CP6A 1BH8A 4H9PA 4KHAB 5AV9A 3AN2B 5AV8C 2HUEB 1M18A 3V9RA 3KWQA 1TZYB 1HQ3B 3REHB 3MGRB 5B1MB 4HGAC 4QLCB 1P3OD 3VH6W 1U35A 5CPJC 4Z5TD 2NQBD 5F99C 5CPID 5BNXB 1S32C 3AV1D 5KDMA 1M1AB 3X1SC 4H9RA 3AZLB 4YM6B 2YFVB 5AY8D 3W98C 4XUJD 3AZGA 3AYWA 1P3MA 1M19D 5B2JC 2HIOB 5BT1D 5B24A 5G49B 4YS3D 1TZYD 1HQ3D 1KX5D 3REHD 3MGRD 2AROD 5GSUB 5B24C 3B0CT 4QLCD 3NQJB 3AZHC 2F8NG 2PYOB 4JJND 5B0ZB 3UTAB 1M1AD 3AZLD 3UT9B 3B0DB 5B31C 3REID 1P34C 5CP6B 1BH8B 4H9PB 5AV9B 3AZMC 2HIOD 1M18B 1P3LB 3KWQB 1P3BD 3KXBC 1KX4D 3AZNA 2YFWB 1ULYA 1BH9B 3NQUB 5B2IC 3REJB 5B0ZD 3C1BA 4KUDB 3O62A 3UTAD 5KDMB 1P3FC 5C3IC 3C1CD 3AV2B 4WU8B 4H9RB 1H3OA 3WTPC 4H9SC 3AZGB 3AYWB 1P3MB 1HTAA 4J8WB 1B67A 3B0CW 5DNMD 3MVDD 1P3GC 3AZFC 1P3LD 1ID3A 3AZID 5B1LB 4KGCD 4G92C 4NE3A 1P3AA 4ZUXC 3REJD 5B32C 3AZEB 4J8UD 4KUDD 4WZSB 1P3KB 3VH6A 3TU4B 4LD9A 3AV2D 2BYMA 2LY8A 4CSRA 4WU8D 3MGSB 3MGPB 4XZQC 4NFTA 5GT3B 4R8PD 3B6GA 4WU9D 5B0YA 5DNNC 4J8WD 1P3ID 3LJAD 1P3PA 4NE5A 4X23C 4WNNB 5B1LD 2F8NA 3REKB 5AVCB 3W99D 5B33A 3LELA 3AZNB 5AV5A 4Z66D 3AFAA 3KUYD 3AZED 3LELC 3MNNA 1P3OC 1P3KD 3O62B 3TU4D 5BO0B 1EQZB 3MGSD 3MGPD 2CV5A 2NQBC 5CPIC 3X1VB 2NZDD 5B40D 3AV1C 5GT3D 2CV5C 5CHLB 4XUJB 3X1TA 5GT0A 3WKJA 3RELB 3UTBD 5AVBB 3REKD 5GT0C 3LZ0A 4H9OA 2HUEC 5AVCD 3A6ND 1M19C 5AV6D 5JRGA 5BT1C 4YS3C 1TZYC 4J8XA 1HQ3C 1KX5C 3REHC 3MGRC 3AZJD 2AROC 5E5AD 4J8VD 3WA9A 3WAAD 4QLCC 1TAFA 1EQZD 4CSRB 5CPKB 3X1VD 3X1UA 4JJNC 1N1JA 1M1AC 5AV8A 3X1UC 3AZLC
chains in the Genus database with same CATH superfamily
1AOID 4H9NA 2IO5C 3RELD 3REIC 3AZKD 5AVBD 3MGQD 2UWXA 2ZY5A 2BG1A 2ZM5A 1F66D 2F8NB 4EO5B 3LZ1D 5CPJA 2HIOC 5F99A 3B6FD 1P3BC 3W97D 3W96B 1S32A 3AFAB 1KX4C 3MNNB 3X1SA 5B32G 1KX3D 5CPKD 3W98A 3UTAC 3B6GD 5B2JA 3C1CC 3X1TB 3AN2D 3WTPE 2Y2GA 4AWLB 3LZ0B 2JE5A 3AZHA 1ZLAC 5DNMC 5B1MD 5JRGB 2ZY2A 3MVDC 3W96D 4J8XB 3AZIC 4KGCC 3B6GB 5GXQB 3WA9B 1TAFB 3REJC 5B31A 4J8UC 4KUDC 1P34A 4YM6D 3AZMA 1N1JB 3VH5T 2FJ7B 3AV2C 4WU8C 2F2AC 2BYKA 4UUZA 3KXBA 4R8PC 4WU9C 3V9RB 4J8WC 4HGAB 1P3IC 3LJAC 5GSUD 5B2IA 5B1LC 5GXQD 1U35B 1S32B 1P3FA 1WWSA 2PYOD 4NE6A 3W99C 4DRAA 3X1SB 4Z66C 3WTPA 3AZEC 3KUYC 4H9SA 5FUGA 3KFUG 3UT9D 1P3KC 3TU4C 2FJ7D 2DQNC 5B2JB 3MGPC 5CP6D 1T3UA 5AV9D 3AZFA 1P3GA 2NZDC 5B40C 4ZBJC 1M18D 2Y2LA 5B24B 3KWQD 4ZUXA 5B32A 4WV4B 3UTBC 1U35D 2Y2NA 5AVCC 3A6NC 5AV6C 3VH5W 2J8PA 4XZQA 3AZJC 5E5AC 4J8VC 3WAAC 5DNNA 5JA4A 1EQZC 3AZGD 3AYWD 3X1VC 1P3MD 4X23A 2BYKB 3KXBB 5B24D 1AOIC 2CWEA 3AZKC 5AVBC 2VQRA 3MGQC 1F66C 1P3OA 3LZ1C 1F1EA 1P3FB 3IP4C 5C3IB 4Z5TA 2NQBA 3C1BB 5CPIA 3B6FC 3W97C 4CAYA 3WTPB 3AV1A 1KU5A 4G91C 4Z5TC 3P5JB 1H3OB 1KX3C 5CPKC 3KSYA 5B31G 3AZFB 4KHAA 1M19A 3R45A 5AY8C 4G92B 4YS3A 3AN2C 1ID3B 1TZYA 1HQ3A 4ZUXB 1KX5A 3REHA 5BS7C 5B32B 3MGRA 2AROA 2RVQD 3EG5B 3AZND 1P3AB 4EO5C 4QLCA 5B1MC 3C1BD 2Y2PA 3FDDA 3W96C 3O62D 5BNXA 4JJNA 4XZQB 1M1AA 4LD9B 2BYMB 3H0RC 3AZLA 5DNNB 3REIA 5B0YB 4YM6C 1P3PB 4Z2MH 1BFMA 2HIOA 1ID3D 1P3BA 1P3AD 5B33B 3LELB 1KX4A 1P3OB 5AV5B 4UPKA 5GSUC 1Q9CA 5B0ZA 5CPIB 5GXQC 4CAYB 3UTAA 4LD9D 3AV1B 2PYOC 2CV5B 5B0ZC 3C1CA 2L5AA 3VH5A 5B0YD 3UT9C 3B0DC 1P3PD 2FJ7C 4H9QA 5GT0B 3WKJB 1M19B 3R45B 1ZLAA 1Z2CB 5DNMA 5CP6C 2F8ND 3MVDA 5AV9C 4YS3B 1P3LA 3AZIA 4H9OB 5BNVA 1KX5B 1M18C 4KGCA 5B33D 2AROB 3LELD 1P3LC 3KWQC 5AV5D 3AFAD 2YFWA 1BH9A 3NQUA 3REJA 4E45A 3MNND 4J8UA 4KUDA 1R4VA 4JJNB 1U35C 2CV5D 3AV2A 4WU8A 3X1UB 5AV8B 2IO5B 4R8PA 3REIB 1JFIA 3X1TD 4WU9A 5GT0D 4J8WA 3WKJD 4H9NB 3LJAA 1P3IA 4M6BA 3AZGC 3AYWC 1P3MC 1A7WA 3LZ0D 5B1LA 1P3BB 5CPJB 5JRGD 1KX4B 3W99A 5F99B 4J8XD 2W8SA 4Z66A 3AZEA 3KUYA 3WA9D 2Y2HA 1P3KA 3TU4A 2Y2MA 3W98B 3X1UD 3MGSA 3MGPA 3C1CB 3F6TA 2NZDA 5AV8D 5B40A 5GT3A 3MGSC 4H9QB 5GT3C 4E44A 1ZLAB 5DNMB 3MVDB 4WNNA 3UTBA 3REKA 5CPJD 2Y2IA 5BNVB 3EPJA 5AVCA 3AZHB 3AZIB 3A6NA 4KGCB 5F99D 5AV6A 3REKC 1S32D 3AZJA 2RVQC 5E5AA 2F8NK 3X1SD 4J8UB 4J8VA 3AZNC 3WAAA 4Z2MG 5BO0A 1EQZA 3W98D 5B31B 3C1BC 3X1VA 3O62C 1P34B 3AZMB 5B2JD 3EPLA 4R8PB 1JFIB 4XUJA 1B6WA 4WU9B 2JCHA 1AOIA 4UUZB 3LJAB 1P3IB 1ZLAD 3RELA 3AZKA 4XUJC 5AVBA 3MGQA 1F66A 3AZHD 3LZ1A 3RELC 5B2IB 1ID3C 3W99B 3B6FA 3W97A 4Z66B 3KUYB 1P3AC 3B0BA 5B31D 1KX3A 3A1IA 5CPKA 5FUGB 1P34D 3AZMD 4LD9C 2NZDB 5B40B 2G5IC 4ZBJB 5AY8A 2F8NH 1P3GB 3AN2A 3KXBD 3B6GC 5BS7A 5B0YC 3UTBB 1P3PC 3EPKA 5B2ID 3A6NB 5B1MA 5AV6B 2ZY3A 3W96A 1P3FD 3AZJB 5B33C 5E5AB 4J8VB 3WAAB 5AV5C 3WTPD 3VH6T 4DRBA 3AFAC 2Y2KA 3MNNC 4YM6A 5JA4B 2YFVA 1P3GD 3AZFD 4X23B 1AOIB 3AZKB 5G49A 3MGQB 3X1TC 1F66B 4ZUXD 3WKJC 5B32D 3LZ1B 5GSUA 4AWLC 3NQJA 3LZ0C 3B6FB 3W97B 5GXQA 5JRGC 2PYOA 4G91B 4Z5TB 2NQBB 4J8XC 4XZQD 1KX3B 3WA9C 1WWIA 2JSSA 5DNND 3UT9A 2FJ7A 5AY8B 4X23D 5CP6A 1BH8A 4H9PA 4KHAB 5AV9A 1W2EA 3AN2B 5AV8C 2HUEB 1M18A 3V9RA 3KWQA 1TZYB 1HQ3B 3REHB 3MGRB 5B1MB 4HGAC 4QLCB 1P3OD 3VH6W 1U35A 5CPJC 4Z5TD 2NQBD 5F99C 5CPID 5BNXB 1S32C 3AV1D 5KDMA 2G5HC 1M1AB 3X1SC 4H9RA 3AZLB 4YM6B 2YFVB 5AY8D 3W98C 3AZGA 3AYWA 1P3MA 2Y2OA 1M19D 2RIQA 5B2JC 2HIOB 5BT1D 5G49B 5B24A 4YS3D 1TZYD 1HQ3D 1KX5D 3REHD 3MGRD 2AROD 5GSUB 5B24C 3B0CT 4QLCD 3NQJB 2Y2QA 3AZHC 2F8NG 3X1UC 2PYOB 4JJND 5B0ZB 3UTAB 1M1AD 3A1KA 1PZRA 3AZLD 3UT9B 3B0DB 5B31C 3REID 1P34C 5CP6B 1BH8B 4H9PB 5AV9B 3AZMC 2HIOD 1M18B 1P3LB 3KWQB 1P3BD 3KXBC 1KX4D 3AZNA 2XD5A 2YFWB 1ULYA 1BH9B 3NQUB 5B2IC 3REJB 5B0ZD 3C1BA 4KUDB 3O62A 3UTAD 5KDMB 1P3FC 5C3IC 2DF4C 3C1CD 3AV2B 4WU8B 3H0LC 4H9RB 1H3OA 3WTPC 4H9SC 3AZGB 3AYWB 1P3MB 1HTAA 4J8WB 1B67A 2XD1A 3B0CW 5DNMD 3MVDD 1P3GC 3AZFC 1P3LD 1ID3A 3AZID 5B1LB 4KGCD 4G92C 4NE3A 1P3AA 4ZUXC 3REJD 5B32C 3AZEB 4J8UD 4KUDD 4WZSB 1P3KB 3VH6A 3TU4B 4LD9A 3AV2D 2BYMA 2LY8A 4CSRA 4WU8D 3MGSB 3MGPB 3H0MC 4XZQC 4WJ3C 2Y2JA 4NFTA 5GT3B 4R8PD 3B6GA 4WU9D 5B0YA 5DNNC 4J8WD 1P3ID 3LJAD 1P3PA 4NE5A 4X23C 4WNNB 5B1LD 2F8NA 3REKB 5AVCB 3W99D 5B33A 3LELA 3AZNB 5AV5A 4Z66D 3AFAA 3KUYD 3AZED 3LELC 3MNNA 1P3OC 1P3KD 3O62B 3TU4D 5BO0B 1EQZB 3AL0C 3MGSD 3MGPD 2CV5A 2NQBC 5CPIC 2ZY4A 4DQYB 3X1VB 2NZDD 5B40D 3AV1C 5GT3D 2CV5C 5CHLB 4XUJB 3X1TA 5GT0A 3WKJA 3RELB 3UTBD 5AVBB 3REKD 5GT0C 3LZ0A 4H9OA 2HUEC 5AVCD 3A6ND 1M19C 5AV6D 5JRGA 5BT1C 4YS3C 1TZYC 4J8XA 1HQ3C 1KX5C 3REHC 3MGRC 3AZJD 3EPHA 2AROC 5E5AD 4J8VD 3WA9A 3WAAD 2FFFB 4QLCC 1TAFA 1EQZD 4CSRB 5CPKB 3X1VD 3X1UA 4JJNC 1N1JA 1M1AC 5AV8A 4XUJD 3AZLC
chains in the Genus database with same CATH topology
1AOID 4H9NA 2IO5C 3RELD 3REIC 3AZKD 5AVBD 3MGQD 2UWXA 2ZY5A 2BG1A 2ZM5A 1F66D 2F8NB 4EO5B 3LZ1D 5CPJA 2HIOC 5F99A 3B6FD 1P3BC 3W97D 3W96B 1S32A 3AFAB 1KX4C 3MNNB 3X1SA 5B32G 1KX3D 5CPKD 3W98A 3UTAC 3B6GD 5B2JA 3C1CC 3X1TB 3AN2D 3WTPE 2Y2GA 4AWLB 3LZ0B 2JE5A 3AZHA 1ZLAC 5DNMC 5B1MD 5JRGB 2ZY2A 3MVDC 3W96D 4J8XB 3AZIC 4KGCC 3B6GB 5GXQB 3WA9B 1TAFB 3REJC 5B31A 4J8UC 4KUDC 1P34A 4YM6D 3AZMA 1N1JB 3VH5T 2FJ7B 3AV2C 4WU8C 2F2AC 2BYKA 4UUZA 3KXBA 4R8PC 4WU9C 3V9RB 4J8WC 4HGAB 1P3IC 3LJAC 5GSUD 5B2IA 5B1LC 5GXQD 1U35B 1S32B 1P3FA 1WWSA 2PYOD 4NE6A 3W99C 4DRAA 3X1SB 4Z66C 3WTPA 3AZEC 3KUYC 4H9SA 5FUGA 3KFUG 3UT9D 1P3KC 3TU4C 2FJ7D 2DQNC 5B2JB 3MGPC 5CP6D 1T3UA 5AV9D 3AZFA 1P3GA 2NZDC 5B40C 4ZBJC 1M18D 2Y2LA 5B24B 3KWQD 4ZUXA 5B32A 4WV4B 3UTBC 1U35D 2Y2NA 5AVCC 3A6NC 5AV6C 3VH5W 2J8PA 4XZQA 3AZJC 5E5AC 4J8VC 3WAAC 5DNNA 5JA4A 1EQZC 3AZGD 3AYWD 3X1VC 1P3MD 4X23A 2BYKB 3KXBB 5B24D 1AOIC 2CWEA 3AZKC 5AVBC 2VQRA 3MGQC 1F66C 1P3OA 3LZ1C 1F1EA 1P3FB 3IP4C 5C3IB 4Z5TA 2NQBA 3C1BB 5CPIA 3B6FC 3W97C 4CAYA 3WTPB 3AV1A 1KU5A 4G91C 4Z5TC 3P5JB 1H3OB 1KX3C 5CPKC 3KSYA 5B31G 3AZFB 4KHAA 1M19A 3R45A 5AY8C 4G92B 4YS3A 3AN2C 1ID3B 1TZYA 1HQ3A 4ZUXB 1KX5A 3REHA 5BS7C 5B32B 3MGRA 2AROA 2RVQD 3EG5B 3AZND 1P3AB 4EO5C 4QLCA 5B1MC 3C1BD 2Y2PA 3FDDA 3W96C 3O62D 5BNXA 4JJNA 4XZQB 1M1AA 4LD9B 2BYMB 3H0RC 3AZLA 5DNNB 3REIA 5B0YB 4YM6C 1P3PB 4Z2MH 1BFMA 2HIOA 1ID3D 1P3BA 1P3AD 5B33B 3LELB 1KX4A 1P3OB 5AV5B 4UPKA 5GSUC 1Q9CA 5B0ZA 5CPIB 5GXQC 4CAYB 3UTAA 4LD9D 3AV1B 2PYOC 2CV5B 5B0ZC 3C1CA 2L5AA 3VH5A 5B0YD 3UT9C 3B0DC 1P3PD 2FJ7C 4H9QA 5GT0B 3WKJB 1M19B 3R45B 1ZLAA 1Z2CB 5DNMA 5CP6C 2F8ND 3MVDA 5AV9C 4YS3B 1P3LA 3AZIA 4H9OB 5BNVA 1KX5B 1M18C 4KGCA 5B33D 2AROB 3LELD 1P3LC 3KWQC 5AV5D 3AFAD 2YFWA 1BH9A 3NQUA 3REJA 4E45A 3MNND 4J8UA 4KUDA 1R4VA 4JJNB 1U35C 2CV5D 3AV2A 4WU8A 3X1UB 5AV8B 2IO5B 4R8PA 3REIB 1JFIA 3X1TD 4WU9A 5GT0D 4J8WA 3WKJD 4H9NB 3LJAA 1P3IA 4M6BA 3AZGC 3AYWC 1P3MC 1A7WA 3LZ0D 5B1LA 1P3BB 5CPJB 5JRGD 1KX4B 3W99A 5F99B 4J8XD 2W8SA 4Z66A 3AZEA 3KUYA 3WA9D 2Y2HA 1P3KA 3TU4A 2Y2MA 3W98B 3X1UD 3MGSA 3MGPA 3C1CB 3F6TA 2NZDA 5AV8D 5B40A 5GT3A 3MGSC 4H9QB 5GT3C 4E44A 1ZLAB 5DNMB 3MVDB 4WNNA 3UTBA 3REKA 5CPJD 2Y2IA 5BNVB 3EPJA 5AVCA 3AZHB 3AZIB 3A6NA 4KGCB 5F99D 5AV6A 3REKC 1S32D 3AZJA 2RVQC 5E5AA 2F8NK 3X1SD 4J8UB 4J8VA 3AZNC 3WAAA 4Z2MG 5BO0A 1EQZA 3W98D 5B31B 3C1BC 3X1VA 3O62C 1P34B 3AZMB 5B2JD 3EPLA 4R8PB 1JFIB 4XUJA 1B6WA 4WU9B 2JCHA 1AOIA 4UUZB 3LJAB 1P3IB 1ZLAD 3RELA 3AZKA 4XUJC 5AVBA 3MGQA 1F66A 3AZHD 3LZ1A 3RELC 5B2IB 1ID3C 3W99B 3B6FA 3W97A 4Z66B 3KUYB 1P3AC 3B0BA 5B31D 1KX3A 3A1IA 5CPKA 5FUGB 1P34D 3AZMD 4LD9C 2NZDB 5B40B 2G5IC 4ZBJB 5AY8A 2F8NH 1P3GB 3AN2A 3KXBD 3B6GC 5BS7A 5B0YC 3UTBB 1P3PC 3EPKA 5B2ID 3A6NB 5B1MA 5AV6B 2ZY3A 3W96A 1P3FD 3AZJB 5B33C 5E5AB 4J8VB 3WAAB 5AV5C 3WTPD 3VH6T 4DRBA 3AFAC 2Y2KA 3MNNC 4YM6A 5JA4B 2YFVA 1P3GD 3AZFD 4X23B 1AOIB 3AZKB 5G49A 3MGQB 3X1TC 1F66B 4ZUXD 3WKJC 5B32D 3LZ1B 5GSUA 4AWLC 3NQJA 3LZ0C 3B6FB 3W97B 5GXQA 5JRGC 2PYOA 4G91B 4Z5TB 2NQBB 4J8XC 4XZQD 1KX3B 3WA9C 1WWIA 2JSSA 5DNND 3UT9A 2FJ7A 5AY8B 4X23D 5CP6A 1BH8A 4H9PA 4KHAB 5AV9A 1W2EA 3AN2B 5AV8C 2HUEB 1M18A 3V9RA 3KWQA 1TZYB 1HQ3B 3REHB 3MGRB 5B1MB 4HGAC 4QLCB 1P3OD 3VH6W 1U35A 5CPJC 4Z5TD 2NQBD 5F99C 5CPID 5BNXB 1S32C 3AV1D 5KDMA 2G5HC 1M1AB 3X1SC 4H9RA 3AZLB 4YM6B 2YFVB 5AY8D 3W98C 3AZGA 3AYWA 1P3MA 2Y2OA 1M19D 2RIQA 5B2JC 2HIOB 5BT1D 5G49B 5B24A 4YS3D 1TZYD 1HQ3D 1KX5D 3REHD 3MGRD 2AROD 5GSUB 5B24C 3B0CT 4QLCD 3NQJB 2Y2QA 3AZHC 2F8NG 3X1UC 2PYOB 4JJND 5B0ZB 3UTAB 1M1AD 3A1KA 1PZRA 3AZLD 3UT9B 3B0DB 5B31C 3REID 1P34C 5CP6B 1BH8B 4H9PB 5AV9B 3AZMC 2HIOD 1M18B 1P3LB 3KWQB 1P3BD 3KXBC 1KX4D 3AZNA 2XD5A 2YFWB 1ULYA 1BH9B 3NQUB 5B2IC 3REJB 5B0ZD 3C1BA 4KUDB 3O62A 3UTAD 5KDMB 1P3FC 5C3IC 2DF4C 3C1CD 3AV2B 4WU8B 3H0LC 4H9RB 1H3OA 3WTPC 4H9SC 3AZGB 3AYWB 1P3MB 1HTAA 4J8WB 1B67A 2XD1A 3B0CW 5DNMD 3MVDD 1P3GC 3AZFC 1P3LD 1ID3A 3AZID 5B1LB 4KGCD 4G92C 4NE3A 1P3AA 4ZUXC 3REJD 5B32C 3AZEB 4J8UD 4KUDD 4WZSB 1P3KB 3VH6A 3TU4B 4LD9A 3AV2D 2BYMA 2LY8A 4CSRA 4WU8D 3MGSB 3MGPB 3H0MC 4XZQC 4WJ3C 2Y2JA 4NFTA 5GT3B 4R8PD 3B6GA 4WU9D 5B0YA 5DNNC 4J8WD 1P3ID 3LJAD 1P3PA 4NE5A 4X23C 4WNNB 5B1LD 2F8NA 3REKB 5AVCB 3W99D 5B33A 3LELA 3AZNB 5AV5A 4Z66D 3AFAA 3KUYD 3AZED 3LELC 3MNNA 1P3OC 1P3KD 3O62B 3TU4D 5BO0B 1EQZB 3AL0C 3MGSD 3MGPD 2CV5A 2NQBC 5CPIC 2ZY4A 4DQYB 3X1VB 2NZDD 5B40D 3AV1C 5GT3D 2CV5C 5CHLB 4XUJB 3X1TA 5GT0A 3WKJA 3RELB 3UTBD 5AVBB 3REKD 5GT0C 3LZ0A 4H9OA 2HUEC 5AVCD 3A6ND 1M19C 5AV6D 5JRGA 5BT1C 4YS3C 1TZYC 4J8XA 1HQ3C 1KX5C 3REHC 3MGRC 3AZJD 3EPHA 2AROC 5E5AD 4J8VD 3WA9A 3WAAD 2FFFB 4QLCC 1TAFA 1EQZD 4CSRB 5CPKB 3X1VD 3X1UA 4JJNC 1N1JA 1M1AC 5AV8A 4XUJD 3AZLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI D;  4H9N A;  2IO5 C;  3REL D;  3REI C;  3AZK D;  5AVB D;  3MGQ D;  1F66 D;  2F8N B;  4EO5 B;  3LZ1 D;  5CPJ A;  2HIO C;  5F99 A;  3B6F D;  1P3B C;  3W97 D;  3W96 B;  1S32 A;  3AFA B;  1KX4 C;  3MNN B;  3X1S A;  5B32 G;  1KX3 D;  5CPK D;  3W98 A;  3UTA C;  3B6G D;  5B2J A;  3C1C C;  3X1T B;  3AN2 D;  3WTP E;  4AWL B;  3LZ0 B;  3AZH A;  1ZLA C;  5DNM C;  5B1M D;  5JRG B;  3MVD C;  3W96 D;  4J8X B;  3AZI C;  4KGC C;  3B6G B;  5GXQ B;  3WA9 B;  1TAF B;  3REJ C;  5B31 A;  4J8U C;  4KUD C;  1P34 A;  4YM6 D;  3AZM A;  1N1J B;  3VH5 T;  2FJ7 B;  3AV2 C;  4WU8 C;  2BYK A;  4UUZ A;  3KXB A;  4R8P C;  4WU9 C;  3V9R B;  4J8W C;  4HGA B;  1P3I C;  3LJA C;  5GSU D;  5B2I A;  5B1L C;  5GXQ D;  1U35 B;  1S32 B;  1P3F A;  1WWS A;  2PYO D;  4NE6 A;  3W99 C;  4DRA A;  3X1S B;  4Z66 C;  3WTP A;  3AZE C;  3KUY C;  4H9S A;  5FUG A;  3UT9 D;  1P3K C;  3TU4 C;  2FJ7 D;  5B2J B;  3MGP C;  5CP6 D;  5AV9 D;  3AZF A;  1P3G A;  2NZD C;  5B40 C;  4ZBJ C;  1M18 D;  3KWQ D;  5B24 B;  4ZUX A;  5B32 A;  4WV4 B;  3UTB C;  1U35 D;  5AVC C;  3A6N C;  5AV6 C;  3VH5 W;  4XZQ A;  3AZJ C;  5E5A C;  4J8V C;  3WAA C;  5DNN A;  5JA4 A;  1EQZ C;  3AZG D;  3AYW D;  3X1V C;  1P3M D;  4X23 A;  2BYK B;  3KXB B;  5B24 D;  1AOI C;  2CWE A;  3AZK C;  5AVB C;  3MGQ C;  1F66 C;  1P3O A;  3LZ1 C;  1F1E A;  1P3F B;  5C3I B;  4Z5T A;  2NQB A;  3C1B B;  5CPI A;  3B6F C;  3W97 C;  4CAY A;  3WTP B;  3AV1 A;  1KU5 A;  4G91 C;  4Z5T C;  1H3O B;  1KX3 C;  5CPK C;  3KSY A;  5B31 G;  3AZF B;  4KHA A;  1M19 A;  3R45 A;  5AY8 C;  4G92 B;  4YS3 A;  3AN2 C;  1ID3 B;  1TZY A;  1HQ3 A;  4ZUX B;  1KX5 A;  3REH A;  5BS7 C;  5B32 B;  3MGR A;  2ARO A;  2RVQ D;  3AZN D;  1P3A B;  4EO5 C;  4QLC A;  5B1M C;  3C1B D;  3W96 C;  3O62 D;  4JJN A;  5BNX A;  4XZQ B;  1M1A A;  4LD9 B;  2BYM B;  3AZL A;  5DNN B;  3REI A;  5B0Y B;  4YM6 C;  1P3P B;  4Z2M H;  1BFM A;  2HIO A;  1ID3 D;  1P3B A;  1P3A D;  5B33 B;  3LEL B;  1KX4 A;  1P3O B;  5AV5 B;  5GSU C;  1Q9C A;  5B0Z A;  5CPI B;  5GXQ C;  4CAY B;  3UTA A;  4LD9 D;  3AV1 B;  2PYO C;  2CV5 B;  5B0Z C;  3C1C A;  2L5A A;  3VH5 A;  5B0Y D;  3UT9 C;  3B0D C;  1P3P D;  2FJ7 C;  4H9Q A;  5GT0 B;  3WKJ B;  1M19 B;  3R45 B;  1ZLA A;  5DNM A;  5CP6 C;  2F8N D;  3MVD A;  5AV9 C;  4YS3 B;  1P3L A;  3AZI A;  4H9O B;  5BNV A;  1KX5 B;  1M18 C;  4KGC A;  5B33 D;  2ARO B;  3LEL D;  1P3L C;  3KWQ C;  5AV5 D;  3AFA D;  2YFW A;  1BH9 A;  3NQU A;  3REJ A;  4E45 A;  3MNN D;  4J8U A;  4KUD A;  1R4V A;  4JJN B;  1U35 C;  2CV5 D;  3AV2 A;  4WU8 A;  3X1U B;  5AV8 B;  2IO5 B;  4R8P A;  3REI B;  1JFI A;  3X1T D;  4WU9 A;  5GT0 D;  4J8W A;  3WKJ D;  4H9N B;  3LJA A;  1P3I A;  4M6B A;  3AZG C;  3AYW C;  1P3M C;  1A7W A;  3LZ0 D;  5B1L A;  1P3B B;  5CPJ B;  5JRG D;  1KX4 B;  3W99 A;  5F99 B;  4J8X D;  4Z66 A;  3AZE A;  3KUY A;  3WA9 D;  1P3K A;  3TU4 A;  3W98 B;  3X1U D;  3MGS A;  3MGP A;  3C1C B;  2NZD A;  5AV8 D;  5B40 A;  5GT3 A;  3MGS C;  4H9Q B;  5GT3 C;  4E44 A;  1ZLA B;  5DNM B;  3MVD B;  4WNN A;  3UTB A;  3REK A;  5CPJ D;  3AZI B;  5BNV B;  4KGC B;  5AVC A;  3AZH B;  3A6N A;  5F99 D;  5AV6 A;  3REK C;  1S32 D;  3AZJ A;  2RVQ C;  5E5A A;  2F8N K;  3X1S D;  4J8U B;  4J8V A;  3AZN C;  3WAA A;  4Z2M G;  5BO0 A;  1EQZ A;  3W98 D;  5B31 B;  3C1B C;  3X1V A;  3O62 C;  1P34 B;  3AZM B;  5B2J D;  4R8P B;  1JFI B;  4XUJ A;  1B6W A;  4WU9 B;  1AOI A;  4UUZ B;  3LJA B;  1P3I B;  1ZLA D;  3REL A;  3AZK A;  4XUJ C;  5AVB A;  3MGQ A;  1F66 A;  3AZH D;  3LZ1 A;  3REL C;  5B2I B;  1ID3 C;  3W99 B;  3B6F A;  3W97 A;  4Z66 B;  3KUY B;  1P3A C;  3B0B A;  5B31 D;  1KX3 A;  5CPK A;  5FUG B;  1P34 D;  3AZM D;  4LD9 C;  2NZD B;  5B40 B;  4ZBJ B;  5AY8 A;  2F8N H;  1P3G B;  3AN2 A;  3KXB D;  3B6G C;  5BS7 A;  5B0Y C;  3UTB B;  1P3P C;  5B2I D;  3A6N B;  5B1M A;  5AV6 B;  3W96 A;  1P3F D;  3AZJ B;  5B33 C;  5E5A B;  4J8V B;  3WAA B;  5AV5 C;  3WTP D;  3VH6 T;  4DRB A;  3AFA C;  3MNN C;  4YM6 A;  5JA4 B;  2YFV A;  1P3G D;  3AZF D;  4X23 B;  1AOI B;  3AZK B;  5G49 A;  3MGQ B;  3X1T C;  1F66 B;  4ZUX D;  3WKJ C;  5B32 D;  3LZ1 B;  5GSU A;  4AWL C;  3NQJ A;  3LZ0 C;  3B6F B;  3W97 B;  5GXQ A;  5JRG C;  2PYO A;  4G91 B;  4Z5T B;  2NQB B;  4J8X C;  4XZQ D;  1KX3 B;  3WA9 C;  1WWI A;  2JSS A;  5DNN D;  3UT9 A;  2FJ7 A;  5AY8 B;  4X23 D;  5CP6 A;  1BH8 A;  4H9P A;  4KHA B;  5AV9 A;  3AN2 B;  5AV8 C;  2HUE B;  1M18 A;  3V9R A;  3KWQ A;  1TZY B;  1HQ3 B;  3REH B;  3MGR B;  5B1M B;  4HGA C;  4QLC B;  1P3O D;  3VH6 W;  1U35 A;  5CPJ C;  4Z5T D;  2NQB D;  5F99 C;  5CPI D;  5BNX B;  1S32 C;  3AV1 D;  5KDM A;  1M1A B;  3X1S C;  4H9R A;  3AZL B;  4YM6 B;  2YFV B;  5AY8 D;  3W98 C;  4XUJ D;  3AZG A;  3AYW A;  1P3M A;  1M19 D;  5B2J C;  2HIO B;  5BT1 D;  5B24 A;  5G49 B;  4YS3 D;  1TZY D;  1HQ3 D;  1KX5 D;  3REH D;  3MGR D;  2ARO D;  5GSU B;  5B24 C;  3B0C T;  4QLC D;  3NQJ B;  3AZH C;  2F8N G;  2PYO B;  4JJN D;  5B0Z B;  3UTA B;  1M1A D;  3AZL D;  3UT9 B;  3B0D B;  5B31 C;  3REI D;  1P34 C;  5CP6 B;  1BH8 B;  4H9P B;  5AV9 B;  3AZM C;  2HIO D;  1M18 B;  1P3L B;  3KWQ B;  1P3B D;  3KXB C;  1KX4 D;  3AZN A;  2YFW B;  1ULY A;  1BH9 B;  3NQU B;  5B2I C;  3REJ B;  5B0Z D;  3C1B A;  4KUD B;  3O62 A;  3UTA D;  5KDM B;  1P3F C;  5C3I C;  3C1C D;  3AV2 B;  4WU8 B;  4H9R B;  1H3O A;  3WTP C;  4H9S C;  3AZG B;  3AYW B;  1P3M B;  1HTA A;  4J8W B;  1B67 A;  3B0C W;  5DNM D;  3MVD D;  1P3G C;  3AZF C;  1P3L D;  1ID3 A;  3AZI D;  5B1L B;  4KGC D;  4G92 C;  4NE3 A;  1P3A A;  4ZUX C;  3REJ D;  5B32 C;  3AZE B;  4J8U D;  4KUD D;  4WZS B;  1P3K B;  3VH6 A;  3TU4 B;  4LD9 A;  3AV2 D;  2BYM A;  2LY8 A;  4CSR A;  4WU8 D;  3MGS B;  3MGP B;  4XZQ C;  4NFT A;  5GT3 B;  4R8P D;  3B6G A;  4WU9 D;  5B0Y A;  5DNN C;  4J8W D;  1P3I D;  3LJA D;  1P3P A;  4NE5 A;  4X23 C;  4WNN B;  5B1L D;  2F8N A;  3REK B;  5AVC B;  3W99 D;  5B33 A;  3LEL A;  3AZN B;  5AV5 A;  4Z66 D;  3AFA A;  3KUY D;  3AZE D;  3LEL C;  3MNN A;  1P3O C;  1P3K D;  3O62 B;  3TU4 D;  5BO0 B;  1EQZ B;  3MGS D;  3MGP D;  2CV5 A;  2NQB C;  5CPI C;  3X1V B;  2NZD D;  5B40 D;  3AV1 C;  5GT3 D;  2CV5 C;  5CHL B;  4XUJ B;  3X1T A;  5GT0 A;  3WKJ A;  3REL B;  3UTB D;  5AVB B;  3REK D;  5GT0 C;  3LZ0 A;  4H9O A;  2HUE C;  5AVC D;  3A6N D;  1M19 C;  5AV6 D;  5JRG A;  5BT1 C;  4YS3 C;  1TZY C;  4J8X A;  1HQ3 C;  1KX5 C;  3REH C;  3MGR C;  3AZJ D;  2ARO C;  5E5A D;  4J8V D;  3WA9 A;  3WAA D;  4QLC C;  1TAF A;  1EQZ D;  4CSR B;  5CPK B;  3X1V D;  3X1U A;  4JJN C;  1N1J A;  1M1A C;  5AV8 A;  3X1U C;  3AZL C; 
#chains in the Genus database with same CATH topology
 1AOI D;  4H9N A;  2IO5 C;  3REL D;  3REI C;  3AZK D;  5AVB D;  3MGQ D;  2UWX A;  2ZY5 A;  2BG1 A;  2ZM5 A;  1F66 D;  2F8N B;  4EO5 B;  3LZ1 D;  5CPJ A;  2HIO C;  5F99 A;  3B6F D;  1P3B C;  3W97 D;  3W96 B;  1S32 A;  3AFA B;  1KX4 C;  3MNN B;  3X1S A;  5B32 G;  1KX3 D;  5CPK D;  3W98 A;  3UTA C;  3B6G D;  5B2J A;  3C1C C;  3X1T B;  3AN2 D;  3WTP E;  2Y2G A;  4AWL B;  3LZ0 B;  2JE5 A;  3AZH A;  1ZLA C;  5DNM C;  5B1M D;  5JRG B;  2ZY2 A;  3MVD C;  3W96 D;  4J8X B;  3AZI C;  4KGC C;  3B6G B;  5GXQ B;  3WA9 B;  1TAF B;  3REJ C;  5B31 A;  4J8U C;  4KUD C;  1P34 A;  4YM6 D;  3AZM A;  1N1J B;  3VH5 T;  2FJ7 B;  3AV2 C;  4WU8 C;  2F2A C;  2BYK A;  4UUZ A;  3KXB A;  4R8P C;  4WU9 C;  3V9R B;  4J8W C;  4HGA B;  1P3I C;  3LJA C;  5GSU D;  5B2I A;  5B1L C;  5GXQ D;  1U35 B;  1S32 B;  1P3F A;  1WWS A;  2PYO D;  4NE6 A;  3W99 C;  4DRA A;  3X1S B;  4Z66 C;  3WTP A;  3AZE C;  3KUY C;  4H9S A;  5FUG A;  3KFU G;  3UT9 D;  1P3K C;  3TU4 C;  2FJ7 D;  2DQN C;  5B2J B;  3MGP C;  5CP6 D;  1T3U A;  5AV9 D;  3AZF A;  1P3G A;  2NZD C;  5B40 C;  4ZBJ C;  1M18 D;  2Y2L A;  5B24 B;  3KWQ D;  4ZUX A;  5B32 A;  4WV4 B;  3UTB C;  1U35 D;  2Y2N A;  5AVC C;  3A6N C;  5AV6 C;  3VH5 W;  2J8P A;  4XZQ A;  3AZJ C;  5E5A C;  4J8V C;  3WAA C;  5DNN A;  5JA4 A;  1EQZ C;  3AZG D;  3AYW D;  3X1V C;  1P3M D;  4X23 A;  2BYK B;  3KXB B;  5B24 D;  1AOI C;  2CWE A;  3AZK C;  5AVB C;  2VQR A;  3MGQ C;  1F66 C;  1P3O A;  3LZ1 C;  1F1E A;  1P3F B;  3IP4 C;  5C3I B;  4Z5T A;  2NQB A;  3C1B B;  5CPI A;  3B6F C;  3W97 C;  4CAY A;  3WTP B;  3AV1 A;  1KU5 A;  4G91 C;  4Z5T C;  3P5J B;  1H3O B;  1KX3 C;  5CPK C;  3KSY A;  5B31 G;  3AZF B;  4KHA A;  1M19 A;  3R45 A;  5AY8 C;  4G92 B;  4YS3 A;  3AN2 C;  1ID3 B;  1TZY A;  1HQ3 A;  4ZUX B;  1KX5 A;  3REH A;  5BS7 C;  5B32 B;  3MGR A;  2ARO A;  2RVQ D;  3EG5 B;  3AZN D;  1P3A B;  4EO5 C;  4QLC A;  5B1M C;  3C1B D;  2Y2P A;  3FDD A;  3W96 C;  3O62 D;  5BNX A;  4JJN A;  4XZQ B;  1M1A A;  4LD9 B;  2BYM B;  3H0R C;  3AZL A;  5DNN B;  3REI A;  5B0Y B;  4YM6 C;  1P3P B;  4Z2M H;  1BFM A;  2HIO A;  1ID3 D;  1P3B A;  1P3A D;  5B33 B;  3LEL B;  1KX4 A;  1P3O B;  5AV5 B;  4UPK A;  5GSU C;  1Q9C A;  5B0Z A;  5CPI B;  5GXQ C;  4CAY B;  3UTA A;  4LD9 D;  3AV1 B;  2PYO C;  2CV5 B;  5B0Z C;  3C1C A;  2L5A A;  3VH5 A;  5B0Y D;  3UT9 C;  3B0D C;  1P3P D;  2FJ7 C;  4H9Q A;  5GT0 B;  3WKJ B;  1M19 B;  3R45 B;  1ZLA A;  1Z2C B;  5DNM A;  5CP6 C;  2F8N D;  3MVD A;  5AV9 C;  4YS3 B;  1P3L A;  3AZI A;  4H9O B;  5BNV A;  1KX5 B;  1M18 C;  4KGC A;  5B33 D;  2ARO B;  3LEL D;  1P3L C;  3KWQ C;  5AV5 D;  3AFA D;  2YFW A;  1BH9 A;  3NQU A;  3REJ A;  4E45 A;  3MNN D;  4J8U A;  4KUD A;  1R4V A;  4JJN B;  1U35 C;  2CV5 D;  3AV2 A;  4WU8 A;  3X1U B;  5AV8 B;  2IO5 B;  4R8P A;  3REI B;  1JFI A;  3X1T D;  4WU9 A;  5GT0 D;  4J8W A;  3WKJ D;  4H9N B;  3LJA A;  1P3I A;  4M6B A;  3AZG C;  3AYW C;  1P3M C;  1A7W A;  3LZ0 D;  5B1L A;  1P3B B;  5CPJ B;  5JRG D;  1KX4 B;  3W99 A;  5F99 B;  4J8X D;  2W8S A;  4Z66 A;  3AZE A;  3KUY A;  3WA9 D;  2Y2H A;  1P3K A;  3TU4 A;  2Y2M A;  3W98 B;  3X1U D;  3MGS A;  3MGP A;  3C1C B;  3F6T A;  2NZD A;  5AV8 D;  5B40 A;  5GT3 A;  3MGS C;  4H9Q B;  5GT3 C;  4E44 A;  1ZLA B;  5DNM B;  3MVD B;  4WNN A;  3UTB A;  3REK A;  5CPJ D;  2Y2I A;  5BNV B;  3EPJ A;  5AVC A;  3AZH B;  3AZI B;  3A6N A;  4KGC B;  5F99 D;  5AV6 A;  3REK C;  1S32 D;  3AZJ A;  2RVQ C;  5E5A A;  2F8N K;  3X1S D;  4J8U B;  4J8V A;  3AZN C;  3WAA A;  4Z2M G;  5BO0 A;  1EQZ A;  3W98 D;  5B31 B;  3C1B C;  3X1V A;  3O62 C;  1P34 B;  3AZM B;  5B2J D;  3EPL A;  4R8P B;  1JFI B;  4XUJ A;  1B6W A;  4WU9 B;  2JCH A;  1AOI A;  4UUZ B;  3LJA B;  1P3I B;  1ZLA D;  3REL A;  3AZK A;  4XUJ C;  5AVB A;  3MGQ A;  1F66 A;  3AZH D;  3LZ1 A;  3REL C;  5B2I B;  1ID3 C;  3W99 B;  3B6F A;  3W97 A;  4Z66 B;  3KUY B;  1P3A C;  3B0B A;  5B31 D;  1KX3 A;  3A1I A;  5CPK A;  5FUG B;  1P34 D;  3AZM D;  4LD9 C;  2NZD B;  5B40 B;  2G5I C;  4ZBJ B;  5AY8 A;  2F8N H;  1P3G B;  3AN2 A;  3KXB D;  3B6G C;  5BS7 A;  5B0Y C;  3UTB B;  1P3P C;  3EPK A;  5B2I D;  3A6N B;  5B1M A;  5AV6 B;  2ZY3 A;  3W96 A;  1P3F D;  3AZJ B;  5B33 C;  5E5A B;  4J8V B;  3WAA B;  5AV5 C;  3WTP D;  3VH6 T;  4DRB A;  3AFA C;  2Y2K A;  3MNN C;  4YM6 A;  5JA4 B;  2YFV A;  1P3G D;  3AZF D;  4X23 B;  1AOI B;  3AZK B;  5G49 A;  3MGQ B;  3X1T C;  1F66 B;  4ZUX D;  3WKJ C;  5B32 D;  3LZ1 B;  5GSU A;  4AWL C;  3NQJ A;  3LZ0 C;  3B6F B;  3W97 B;  5GXQ A;  5JRG C;  2PYO A;  4G91 B;  4Z5T B;  2NQB B;  4J8X C;  4XZQ D;  1KX3 B;  3WA9 C;  1WWI A;  2JSS A;  5DNN D;  3UT9 A;  2FJ7 A;  5AY8 B;  4X23 D;  5CP6 A;  1BH8 A;  4H9P A;  4KHA B;  5AV9 A;  1W2E A;  3AN2 B;  5AV8 C;  2HUE B;  1M18 A;  3V9R A;  3KWQ A;  1TZY B;  1HQ3 B;  3REH B;  3MGR B;  5B1M B;  4HGA C;  4QLC B;  1P3O D;  3VH6 W;  1U35 A;  5CPJ C;  4Z5T D;  2NQB D;  5F99 C;  5CPI D;  5BNX B;  1S32 C;  3AV1 D;  5KDM A;  2G5H C;  1M1A B;  3X1S C;  4H9R A;  3AZL B;  4YM6 B;  2YFV B;  5AY8 D;  3W98 C;  3AZG A;  3AYW A;  1P3M A;  2Y2O A;  1M19 D;  2RIQ A;  5B2J C;  2HIO B;  5BT1 D;  5G49 B;  5B24 A;  4YS3 D;  1TZY D;  1HQ3 D;  1KX5 D;  3REH D;  3MGR D;  2ARO D;  5GSU B;  5B24 C;  3B0C T;  4QLC D;  3NQJ B;  2Y2Q A;  3AZH C;  2F8N G;  3X1U C;  2PYO B;  4JJN D;  5B0Z B;  3UTA B;  1M1A D;  3A1K A;  1PZR A;  3AZL D;  3UT9 B;  3B0D B;  5B31 C;  3REI D;  1P34 C;  5CP6 B;  1BH8 B;  4H9P B;  5AV9 B;  3AZM C;  2HIO D;  1M18 B;  1P3L B;  3KWQ B;  1P3B D;  3KXB C;  1KX4 D;  3AZN A;  2XD5 A;  2YFW B;  1ULY A;  1BH9 B;  3NQU B;  5B2I C;  3REJ B;  5B0Z D;  3C1B A;  4KUD B;  3O62 A;  3UTA D;  5KDM B;  1P3F C;  5C3I C;  2DF4 C;  3C1C D;  3AV2 B;  4WU8 B;  3H0L C;  4H9R B;  1H3O A;  3WTP C;  4H9S C;  3AZG B;  3AYW B;  1P3M B;  1HTA A;  4J8W B;  1B67 A;  2XD1 A;  3B0C W;  5DNM D;  3MVD D;  1P3G C;  3AZF C;  1P3L D;  1ID3 A;  3AZI D;  5B1L B;  4KGC D;  4G92 C;  4NE3 A;  1P3A A;  4ZUX C;  3REJ D;  5B32 C;  3AZE B;  4J8U D;  4KUD D;  4WZS B;  1P3K B;  3VH6 A;  3TU4 B;  4LD9 A;  3AV2 D;  2BYM A;  2LY8 A;  4CSR A;  4WU8 D;  3MGS B;  3MGP B;  3H0M C;  4XZQ C;  4WJ3 C;  2Y2J A;  4NFT A;  5GT3 B;  4R8P D;  3B6G A;  4WU9 D;  5B0Y A;  5DNN C;  4J8W D;  1P3I D;  3LJA D;  1P3P A;  4NE5 A;  4X23 C;  4WNN B;  5B1L D;  2F8N A;  3REK B;  5AVC B;  3W99 D;  5B33 A;  3LEL A;  3AZN B;  5AV5 A;  4Z66 D;  3AFA A;  3KUY D;  3AZE D;  3LEL C;  3MNN A;  1P3O C;  1P3K D;  3O62 B;  3TU4 D;  5BO0 B;  1EQZ B;  3AL0 C;  3MGS D;  3MGP D;  2CV5 A;  2NQB C;  5CPI C;  2ZY4 A;  4DQY B;  3X1V B;  2NZD D;  5B40 D;  3AV1 C;  5GT3 D;  2CV5 C;  5CHL B;  4XUJ B;  3X1T A;  5GT0 A;  3WKJ A;  3REL B;  3UTB D;  5AVB B;  3REK D;  5GT0 C;  3LZ0 A;  4H9O A;  2HUE C;  5AVC D;  3A6N D;  1M19 C;  5AV6 D;  5JRG A;  5BT1 C;  4YS3 C;  1TZY C;  4J8X A;  1HQ3 C;  1KX5 C;  3REH C;  3MGR C;  3AZJ D;  3EPH A;  2ARO C;  5E5A D;  4J8V D;  3WA9 A;  3WAA D;  2FFF B;  4QLC C;  1TAF A;  1EQZ D;  4CSR B;  5CPK B;  3X1V D;  3X1U A;  4JJN C;  1N1J A;  1M1A C;  5AV8 A;  4XUJ D;  3AZL C; 
#chains in the Genus database with same CATH homology
 1AOI D;  4H9N A;  2IO5 C;  3REL D;  3REI C;  3AZK D;  5AVB D;  3MGQ D;  2UWX A;  2ZY5 A;  2BG1 A;  2ZM5 A;  1F66 D;  2F8N B;  4EO5 B;  3LZ1 D;  5CPJ A;  2HIO C;  5F99 A;  3B6F D;  1P3B C;  3W97 D;  3W96 B;  1S32 A;  3AFA B;  1KX4 C;  3MNN B;  3X1S A;  5B32 G;  1KX3 D;  5CPK D;  3W98 A;  3UTA C;  3B6G D;  5B2J A;  3C1C C;  3X1T B;  3AN2 D;  3WTP E;  2Y2G A;  4AWL B;  3LZ0 B;  2JE5 A;  3AZH A;  1ZLA C;  5DNM C;  5B1M D;  5JRG B;  2ZY2 A;  3MVD C;  3W96 D;  4J8X B;  3AZI C;  4KGC C;  3B6G B;  5GXQ B;  3WA9 B;  1TAF B;  3REJ C;  5B31 A;  4J8U C;  4KUD C;  1P34 A;  4YM6 D;  3AZM A;  1N1J B;  3VH5 T;  2FJ7 B;  3AV2 C;  4WU8 C;  2F2A C;  2BYK A;  4UUZ A;  3KXB A;  4R8P C;  4WU9 C;  3V9R B;  4J8W C;  4HGA B;  1P3I C;  3LJA C;  5GSU D;  5B2I A;  5B1L C;  5GXQ D;  1U35 B;  1S32 B;  1P3F A;  1WWS A;  2PYO D;  4NE6 A;  3W99 C;  4DRA A;  3X1S B;  4Z66 C;  3WTP A;  3AZE C;  3KUY C;  4H9S A;  5FUG A;  3KFU G;  3UT9 D;  1P3K C;  3TU4 C;  2FJ7 D;  2DQN C;  5B2J B;  3MGP C;  5CP6 D;  1T3U A;  5AV9 D;  3AZF A;  1P3G A;  2NZD C;  5B40 C;  4ZBJ C;  1M18 D;  2Y2L A;  5B24 B;  3KWQ D;  4ZUX A;  5B32 A;  4WV4 B;  3UTB C;  1U35 D;  2Y2N A;  5AVC C;  3A6N C;  5AV6 C;  3VH5 W;  2J8P A;  4XZQ A;  3AZJ C;  5E5A C;  4J8V C;  3WAA C;  5DNN A;  5JA4 A;  1EQZ C;  3AZG D;  3AYW D;  3X1V C;  1P3M D;  4X23 A;  2BYK B;  3KXB B;  5B24 D;  1AOI C;  2CWE A;  3AZK C;  5AVB C;  2VQR A;  3MGQ C;  1F66 C;  1P3O A;  3LZ1 C;  1F1E A;  1P3F B;  3IP4 C;  5C3I B;  4Z5T A;  2NQB A;  3C1B B;  5CPI A;  3B6F C;  3W97 C;  4CAY A;  3WTP B;  3AV1 A;  1KU5 A;  4G91 C;  4Z5T C;  3P5J B;  1H3O B;  1KX3 C;  5CPK C;  3KSY A;  5B31 G;  3AZF B;  4KHA A;  1M19 A;  3R45 A;  5AY8 C;  4G92 B;  4YS3 A;  3AN2 C;  1ID3 B;  1TZY A;  1HQ3 A;  4ZUX B;  1KX5 A;  3REH A;  5BS7 C;  5B32 B;  3MGR A;  2ARO A;  2RVQ D;  3EG5 B;  3AZN D;  1P3A B;  4EO5 C;  4QLC A;  5B1M C;  3C1B D;  2Y2P A;  3FDD A;  3W96 C;  3O62 D;  5BNX A;  4JJN A;  4XZQ B;  1M1A A;  4LD9 B;  2BYM B;  3H0R C;  3AZL A;  5DNN B;  3REI A;  5B0Y B;  4YM6 C;  1P3P B;  4Z2M H;  1BFM A;  2HIO A;  1ID3 D;  1P3B A;  1P3A D;  5B33 B;  3LEL B;  1KX4 A;  1P3O B;  5AV5 B;  4UPK A;  5GSU C;  1Q9C A;  5B0Z A;  5CPI B;  5GXQ C;  4CAY B;  3UTA A;  4LD9 D;  3AV1 B;  2PYO C;  2CV5 B;  5B0Z C;  3C1C A;  2L5A A;  3VH5 A;  5B0Y D;  3UT9 C;  3B0D C;  1P3P D;  2FJ7 C;  4H9Q A;  5GT0 B;  3WKJ B;  1M19 B;  3R45 B;  1ZLA A;  1Z2C B;  5DNM A;  5CP6 C;  2F8N D;  3MVD A;  5AV9 C;  4YS3 B;  1P3L A;  3AZI A;  4H9O B;  5BNV A;  1KX5 B;  1M18 C;  4KGC A;  5B33 D;  2ARO B;  3LEL D;  1P3L C;  3KWQ C;  5AV5 D;  3AFA D;  2YFW A;  1BH9 A;  3NQU A;  3REJ A;  4E45 A;  3MNN D;  4J8U A;  4KUD A;  1R4V A;  4JJN B;  1U35 C;  2CV5 D;  3AV2 A;  4WU8 A;  3X1U B;  5AV8 B;  2IO5 B;  4R8P A;  3REI B;  1JFI A;  3X1T D;  4WU9 A;  5GT0 D;  4J8W A;  3WKJ D;  4H9N B;  3LJA A;  1P3I A;  4M6B A;  3AZG C;  3AYW C;  1P3M C;  1A7W A;  3LZ0 D;  5B1L A;  1P3B B;  5CPJ B;  5JRG D;  1KX4 B;  3W99 A;  5F99 B;  4J8X D;  2W8S A;  4Z66 A;  3AZE A;  3KUY A;  3WA9 D;  2Y2H A;  1P3K A;  3TU4 A;  2Y2M A;  3W98 B;  3X1U D;  3MGS A;  3MGP A;  3C1C B;  3F6T A;  2NZD A;  5AV8 D;  5B40 A;  5GT3 A;  3MGS C;  4H9Q B;  5GT3 C;  4E44 A;  1ZLA B;  5DNM B;  3MVD B;  4WNN A;  3UTB A;  3REK A;  5CPJ D;  2Y2I A;  5BNV B;  3EPJ A;  5AVC A;  3AZH B;  3AZI B;  3A6N A;  4KGC B;  5F99 D;  5AV6 A;  3REK C;  1S32 D;  3AZJ A;  2RVQ C;  5E5A A;  2F8N K;  3X1S D;  4J8U B;  4J8V A;  3AZN C;  3WAA A;  4Z2M G;  5BO0 A;  1EQZ A;  3W98 D;  5B31 B;  3C1B C;  3X1V A;  3O62 C;  1P34 B;  3AZM B;  5B2J D;  3EPL A;  4R8P B;  1JFI B;  4XUJ A;  1B6W A;  4WU9 B;  2JCH A;  1AOI A;  4UUZ B;  3LJA B;  1P3I B;  1ZLA D;  3REL A;  3AZK A;  4XUJ C;  5AVB A;  3MGQ A;  1F66 A;  3AZH D;  3LZ1 A;  3REL C;  5B2I B;  1ID3 C;  3W99 B;  3B6F A;  3W97 A;  4Z66 B;  3KUY B;  1P3A C;  3B0B A;  5B31 D;  1KX3 A;  3A1I A;  5CPK A;  5FUG B;  1P34 D;  3AZM D;  4LD9 C;  2NZD B;  5B40 B;  2G5I C;  4ZBJ B;  5AY8 A;  2F8N H;  1P3G B;  3AN2 A;  3KXB D;  3B6G C;  5BS7 A;  5B0Y C;  3UTB B;  1P3P C;  3EPK A;  5B2I D;  3A6N B;  5B1M A;  5AV6 B;  2ZY3 A;  3W96 A;  1P3F D;  3AZJ B;  5B33 C;  5E5A B;  4J8V B;  3WAA B;  5AV5 C;  3WTP D;  3VH6 T;  4DRB A;  3AFA C;  2Y2K A;  3MNN C;  4YM6 A;  5JA4 B;  2YFV A;  1P3G D;  3AZF D;  4X23 B;  1AOI B;  3AZK B;  5G49 A;  3MGQ B;  3X1T C;  1F66 B;  4ZUX D;  3WKJ C;  5B32 D;  3LZ1 B;  5GSU A;  4AWL C;  3NQJ A;  3LZ0 C;  3B6F B;  3W97 B;  5GXQ A;  5JRG C;  2PYO A;  4G91 B;  4Z5T B;  2NQB B;  4J8X C;  4XZQ D;  1KX3 B;  3WA9 C;  1WWI A;  2JSS A;  5DNN D;  3UT9 A;  2FJ7 A;  5AY8 B;  4X23 D;  5CP6 A;  1BH8 A;  4H9P A;  4KHA B;  5AV9 A;  1W2E A;  3AN2 B;  5AV8 C;  2HUE B;  1M18 A;  3V9R A;  3KWQ A;  1TZY B;  1HQ3 B;  3REH B;  3MGR B;  5B1M B;  4HGA C;  4QLC B;  1P3O D;  3VH6 W;  1U35 A;  5CPJ C;  4Z5T D;  2NQB D;  5F99 C;  5CPI D;  5BNX B;  1S32 C;  3AV1 D;  5KDM A;  2G5H C;  1M1A B;  3X1S C;  4H9R A;  3AZL B;  4YM6 B;  2YFV B;  5AY8 D;  3W98 C;  3AZG A;  3AYW A;  1P3M A;  2Y2O A;  1M19 D;  2RIQ A;  5B2J C;  2HIO B;  5BT1 D;  5G49 B;  5B24 A;  4YS3 D;  1TZY D;  1HQ3 D;  1KX5 D;  3REH D;  3MGR D;  2ARO D;  5GSU B;  5B24 C;  3B0C T;  4QLC D;  3NQJ B;  2Y2Q A;  3AZH C;  2F8N G;  3X1U C;  2PYO B;  4JJN D;  5B0Z B;  3UTA B;  1M1A D;  3A1K A;  1PZR A;  3AZL D;  3UT9 B;  3B0D B;  5B31 C;  3REI D;  1P34 C;  5CP6 B;  1BH8 B;  4H9P B;  5AV9 B;  3AZM C;  2HIO D;  1M18 B;  1P3L B;  3KWQ B;  1P3B D;  3KXB C;  1KX4 D;  3AZN A;  2XD5 A;  2YFW B;  1ULY A;  1BH9 B;  3NQU B;  5B2I C;  3REJ B;  5B0Z D;  3C1B A;  4KUD B;  3O62 A;  3UTA D;  5KDM B;  1P3F C;  5C3I C;  2DF4 C;  3C1C D;  3AV2 B;  4WU8 B;  3H0L C;  4H9R B;  1H3O A;  3WTP C;  4H9S C;  3AZG B;  3AYW B;  1P3M B;  1HTA A;  4J8W B;  1B67 A;  2XD1 A;  3B0C W;  5DNM D;  3MVD D;  1P3G C;  3AZF C;  1P3L D;  1ID3 A;  3AZI D;  5B1L B;  4KGC D;  4G92 C;  4NE3 A;  1P3A A;  4ZUX C;  3REJ D;  5B32 C;  3AZE B;  4J8U D;  4KUD D;  4WZS B;  1P3K B;  3VH6 A;  3TU4 B;  4LD9 A;  3AV2 D;  2BYM A;  2LY8 A;  4CSR A;  4WU8 D;  3MGS B;  3MGP B;  3H0M C;  4XZQ C;  4WJ3 C;  2Y2J A;  4NFT A;  5GT3 B;  4R8P D;  3B6G A;  4WU9 D;  5B0Y A;  5DNN C;  4J8W D;  1P3I D;  3LJA D;  1P3P A;  4NE5 A;  4X23 C;  4WNN B;  5B1L D;  2F8N A;  3REK B;  5AVC B;  3W99 D;  5B33 A;  3LEL A;  3AZN B;  5AV5 A;  4Z66 D;  3AFA A;  3KUY D;  3AZE D;  3LEL C;  3MNN A;  1P3O C;  1P3K D;  3O62 B;  3TU4 D;  5BO0 B;  1EQZ B;  3AL0 C;  3MGS D;  3MGP D;  2CV5 A;  2NQB C;  5CPI C;  2ZY4 A;  4DQY B;  3X1V B;  2NZD D;  5B40 D;  3AV1 C;  5GT3 D;  2CV5 C;  5CHL B;  4XUJ B;  3X1T A;  5GT0 A;  3WKJ A;  3REL B;  3UTB D;  5AVB B;  3REK D;  5GT0 C;  3LZ0 A;  4H9O A;  2HUE C;  5AVC D;  3A6N D;  1M19 C;  5AV6 D;  5JRG A;  5BT1 C;  4YS3 C;  1TZY C;  4J8X A;  1HQ3 C;  1KX5 C;  3REH C;  3MGR C;  3AZJ D;  3EPH A;  2ARO C;  5E5A D;  4J8V D;  3WA9 A;  3WAA D;  2FFF B;  4QLC C;  1TAF A;  1EQZ D;  4CSR B;  5CPK B;  3X1V D;  3X1U A;  4JJN C;  1N1J A;  1M1A C;  5AV8 A;  4XUJ D;  3AZL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...