4Z5TD

The nucleosome containing human h3.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tD00
4J8UD 5AVCC 5C3IB 2F8NK 2NQBB 5B1LD 1P3GA 5CP6A 1U35B 1M18A 1KX4B 4Z5TB 3LJAD 3B0DB 4XUJA 5AV9D 3C1BA 3MNNC 3W96D 1S32A 5B0ZC 3AN2C 5AV6B 5GT0B 1M1AC 2IO5B 3W98A 1KX3C 5GSUC 3KUYA 3AZLC 5GXQB 3X1VD 1B6WA 4XZQA 5B2IB 5AVBA 3AZMC 1ID3D 5AY8A 3UT9A 4JJNB 3X1UD 1N1JB 3NQJA 4Z66C 1P3PB 4H9NA 4WNNA 2HUEB 5CPKC 3AZEC 5CPJD 4UUZA 1P3IA 2F8NB 4QLCB 1KX5B 1P3LC 5CPIB 1P3KB 4KUDD 3C1CB 5DNNA 3V9RB 1P3MD 5B2JB 3LZ0D 3REHD 1P34D 3WAAA 5AVCB 2YFVB 3REJC 1P3AC 2NQBA 1P3GD 3AZKD 1U35A 1M18D 3WTPE 1KX4A 3MNNB 2YFWB 4Z5TA 5B0YC 5B0ZB 4LD9C 4E45A 4XUJD 3C1BD 4H9SC 3AN2B 1S32D 4J8XD 1M1AB 3AZNA 5AV6A 5BNVA 1KX3B 3LELC 5GSUB 3AZLB 3W98D 3W97B 2NZDC 5GXQA 4KHAB 4XZQD 3AZMB 3LZ1C 2CV5C 3WTPC 2BYKB 5AY8D 5G49B 4Z66B 5B31C 5AV5C 3UT9D 1P3PA 5CPKB 4KGCC 3KXBC 3AZEB 3AZGC 3NQUA 5F99A 3AZJC 1P3LB 1P3ID 2F8NA 4QLCA 1KX5A 5CPIA 1P3OC 3UTBC 1P3KA 5DNND 3V9RA 3W96A 5AVCA 3X1SD 3WAAD 3REJB 1P3AB 1BFMA 1HQ3C 2NQBD 3AYWC 1U35D 5B0YB 3KWQC 4YM6C 1KX4D 4LD9B 2YFWA 4Z5TD 5B0ZA 4CAYB 3AV2C 1M1AA 3MVDC 4R8PC 3LELB 5AV6D 5GT0D 5BS7C 3X1TC 1KX3A 2NZDB 5AV8C 3AZLA 3VH5A 1Q9CA 3MGQC 5GXQD 4KHAA 3LZ1B 2CV5B 5B2ID 3WTPB 3AZMA 5CPJA 5B31B 2LY8A 2BYKA 5AV5B 2AROC 4Z66A 4JJND 4KGCB 3KXBB 3AFAB 1P3PD 3WKJC 3AZGB 5CPKA 1EQZC 3AZEA 3VH6A 1TZYC 1P34A 5B32G 3AZJB 2HIOC 5B33C 3WA9C 4H9PB 3KSYA 3UTBB 1P3OB 2F8ND 4QLCD 1KX5D 5CPID 4J8WC 1P3KD 3C1CD 4X23C 3AZKA 3MGRC 1HTAA 5B2JD 4WV4B 5AVCD 3A6NC 1HQ3B 4J8XA 4DRBA 3TU4C 1P3AA 3AYWB 3KWQB 4YM6B 4Z2MH 4LD9A 4NFTA 3RELC 4H9SA 3W97C 3MNND 1H3OA 5B0ZD 1R4VA 3AN2D 3AV2B 3MVDB 4R8PB 4CAYA 5BO0A 5GT3C 3X1TB 2CWEA 3LELA 1M1AD 5AV8B 3MGQB 1KX3D 2NZDA 5GSUD 3AZLD 1BH8B 3WTPA 4H9QB 3AZMD 2AROB 3AZFC 2BYMB 4H9RA 4Z66D 3B6FC 3WKJB 1P3BC 1EQZB 4KGCA 3KXBA 3AZGA 5CPKD 5JRGC 1TZYB 3AZED 3R45A 2HIOB 5B33B 3WA9B 3AZJA 3X1SA 4H9PA 1P3LD 3UTBA 1P3OA 4J8WB 4WU8C 4X23B 3MGRB 3AZIC 3MGPC 3A6NB 5BNXB 5DNMC 3TU4B 3B0BA 1HQ3A 3AV1C 4M6BA 3REJD 1P3AD 5GT0A 3AYWA 4YM6A 3RELB 5CP6C 3VH6W 5B0YD 4LD9D 3W99C 5B2IA 5GT3B 2L5AA 4WU9C 3MVDA 3LELD 4JJNA 3MGQA 2NZDD 1N1JA 4Z2MG 1BH8A 3AFAC 5JA4B 3KUYC 3LZ1D 3AZFB 2CV5D 1M19C 3WTPD 4H9QA 4AWLC 2AROA 5B31D 2BYMA 5AV5D 3B6FB 1P3BB 5AVBC 3REIC 5BT1C 3WKJA 1EQZA 4KGCD 5JRGB 3KXBD 3C1CA 3AZGD 1TZYA 2HIOA 5B2JA 3AZJD 4WU8B 1P3OD 3UTBD 4J8WA 2F8NH 5B40C 4X23A 2YFVA 5CHLB 2PYOC 3MGRA 3O62C 3AZIB 4J8VC 2RVQC 3MGPB 5DNMB 1ZLAC 3MNNA 1P3FC 3A6NA 3AV1B 1WWIA 5BNXA 3TU4A 3AN2A 1JFIB 1HQ3D 3AZHC 3B6GC 3AYWD 5CP6B 1F66C 5GSUA 3KWQD 4YM6D 3W97A 3RELA 3W99B 4HGAC 1BH9B 1F1EA 4WU9B 1AOIC 5GT3A 3AV2D 3MVDD 4R8PD 4WZSB 3UTAC 4G91C 5B24C 3X1TD 2FJ7C 5B32C 5AV8D 2JSSA 5G49A 3MGQD 4YS3C 3KUYB 1M19B 3VH5T 5JA4A 4AWLB 5B1MC 2AROD 5AVBB 3REIB 3REKC 3B6FA 4E44A 1P3LA 3NQJB 3WKJD 1EQZD 5FUGB 5JRGA 3MGSC 3B0CT 1TZYD 2HIOD 5E5AC 5B33D 3WA9D 3VH6T 4ZUXC 4WU8A 5B40B 3REJA 2PYOB 4J8WD 3O62B 4J8UC 4X23D 4J8VB 3MGRD 5B1LC 3MGPA 1ZLAB 1P3FB 5B0YA 3A6ND 3AV1A 3AZHB 3TU4D 1JFIA 3LJAC 3B6GB 5AV9C 2F8NG 4EO5C 3W96C 1F66B 5KDMB 4HGAB 3RELD 3W97D 1AOIB 3W99A 1BH9A 4WU9A 3X1VC 3LZ1A 1A7WA 3UTAB 2CV5A 4G91B 5GT3D 5B24B 2FJ7B 5B32B 5B31A 5AV5A 3AZNB 4NE3A 4YS3B 5BNVB 1ID3C 3X1UC 3AFAA 1KU5A 5B1MB 1M19A 3AZFD 4NE5A 3REKB 1ULYA 3REIA 5CPJC 3B6FD 1P3BD 4ZBJC 3MGSB 5FUGA 3VH5W 5JRGD 5E5AB 4CSRB 4KUDC 1B67A 3NQUB 5F99B 1P3MC 4ZUXB 3LZ0C 3REHC 1P34C 4WU8D 5B40A 4J8UB 2PYOA 3B0CW 3O62A 5B1LB 4J8VA 3KWQA 3AZID 1P3GC 3MGPD 1ZLAA 4NE6A 1P3FA 3AZKC 5DNMD 1M18C 3LJAB 5AV9B 4EO5B 3AV2A 3AV1D 3AZHA 3B6GA 3W96B 4R8PA 4XUJC 3C1BC 5BS7A 3X1TA 1S32C 4J8XC 1F66A 5AV8A 5KDMA 5CP6D 3W99D 3X1VB 1AOIA 1WWSA 3W98C 4WU9D 3UTAA 2FJ7A 5B24A 4G92C 4XZQC 5B32A 1ID3B 4YS3A 3X1UB 1TAFB 5AY8C 3UT9C 3AFAD 3KUYD 5B1MA 1M19D 4H9OB 5B33A 3WA9A 5CPJB 3REKA 5AVBD 3REID 4ZBJB 4DRAA 5BT1D 3MGSA 1P3IC 4KUDB 5E5AA 4CSRA 1P3MB 3LZ0B 5DNNC 3REHB 1P34B 5B31G 4ZUXA 4J8UA 5B40D 3WAAC 3X1SC 2PYOD 3O62D 5B1LA 4J8VD 2RVQD 1P3GB 5C3IC 2NQBC 3AZKB 1M18B 1ZLAD 1P3FD 1U35C 1KX4C 3LJAA 5AV9A 4XUJB 3C1BB 3AZHD 1S32B 4Z5TC 3B6GD 4J8XB 3B0DC 1F66D 3AZNC 5AV6C 3W98B 5GT0C 2IO5C 3X1VA 1AOID 4G92B 4XZQB 1H3OB 5GXQC 3AZFA 3UTAD 2FJ7D 5B24D 5BO0B 5B32D 5B2IC 1ID3A 3AZND 5AY8B 1P3BA 4YS3D 3X1UA 3UT9B 1TAFA 4JJNC 4H9NB 4WNNB 1P3PC 5B1MD 4H9OA 3REKD 2HUEC 5F99C 4UUZB 4H9RB 1P3IB 3MGSD 4KUDA 4QLCC 1KX5C 5DNNB 5CPIC 3AZIA 5E5AD 1P3KC 3C1CC 3R45B 1P3MA 3LZ0A 5F99D 3REHA 5DNMA 5B2JC 4ZUXD 3WAAB 3X1SB
chains in the Genus database with same CATH superfamily
2VQRA 2FFFB 4J8UD 5AVCC 5C3IB 2F8NK 2NQBB 5B1LD 1P3GA 5CP6A 1U35B 1M18A 1KX4B 4Z5TB 3LJAD 3B0DB 4XUJA 5AV9D 3C1BA 3MNNC 3W96D 1S32A 3H0RC 5B0ZC 3AN2C 5AV6B 5GT0B 1M1AC 2IO5B 3FDDA 3A1KA 3W98A 1KX3C 5GSUC 3KUYA 3AZLC 5GXQB 3X1VD 1B6WA 4XZQA 5B2IB 5AVBA 3AZMC 1ID3D 5AY8A 3UT9A 4JJNB 3X1UD 1N1JB 3NQJA 4Z66C 1P3PB 4H9NA 4WNNA 2HUEB 5CPKC 3AZEC 5CPJD 4UUZA 1P3IA 2F8NB 4QLCB 1KX5B 1P3LC 5CPIB 1P3KB 4KUDD 2G5HC 3C1CB 5DNNA 3V9RB 1P3MD 2ZY4A 5B2JB 3LZ0D 3REHD 1P34D 2Y2KA 3WAAA 5AVCB 2YFVB 2XD5A 3REJC 1P3AC 2NQBA 1P3GD 3AZKD 1U35A 1M18D 3WTPE 1KX4A 3MNNB 2YFWB 5B0YC 4Z5TA 5B0ZB 4LD9C 4E45A 4XUJD 3C1BD 4H9SC 3AN2B 1S32D 4J8XD 1M1AB 3AZNA 5AV6A 5BNVA 1KX3B 3LELC 2F2AC 5GSUB 3AZLB 3W98D 3W97B 2NZDC 5GXQA 4KHAB 4XZQD 3AZMB 3LZ1C 2CV5C 3WTPC 2BYKB 5AY8D 5G49B 4Z66B 5B31C 5AV5C 3UT9D 3F6TA 1P3PA 5CPKB 4KGCC 3KXBC 3AZEB 3AZGC 3NQUA 2W8SA 5F99A 3AZJC 1P3LB 1P3ID 2F8NA 4QLCA 2Y2QA 1KX5A 5CPIA 1P3OC 3UTBC 1P3KA 5DNND 3V9RA 3H0LC 3W96A 5AVCA 3X1SD 3WAAD 3H0MC 3REJB 1P3AB 1BFMA 1HQ3C 2NQBD 3AYWC 1U35D 1T3UA 5B0YB 4YM6C 3KWQC 1KX4D 4LD9B 2YFWA 4Z5TD 5B0ZA 4CAYB 3AV2C 1M1AA 3MVDC 4R8PC 3LELB 5AV6D 5GT0D 5BS7C 3X1TC 1KX3A 2NZDB 5AV8C 3AZLA 3VH5A 1Q9CA 3MGQC 5GXQD 4KHAA 3LZ1B 2CV5B 5B2ID 3WTPB 3AZMA 5CPJA 5B31B 2LY8A 2BYKA 5AV5B 2AROC 4Z66A 4JJND 4KGCB 3KXBB 3AFAB 1P3PD 3WKJC 3AZGB 5CPKA 1EQZC 3AZEA 2G5IC 2ZY5A 3VH6A 1TZYC 1P34A 5B32G 3AZJB 2HIOC 5B33C 3WA9C 4H9PB 3KSYA 3UTBB 1P3OB 2F8ND 4QLCD 1KX5D 5CPID 3EPJA 4J8WC 3C1CD 1P3KD 4X23C 2Y2NA 3AZKA 3MGRC 1HTAA 5B2JD 4WV4B 5AVCD 3A6NC 1HQ3B 4J8XA 4DRBA 3TU4C 1P3AA 3AYWB 3KWQB 4YM6B 4Z2MH 4LD9A 4NFTA 3RELC 4H9SA 3W97C 3MNND 3IP4C 1H3OA 5B0ZD 1R4VA 3AN2D 3AV2B 3MVDB 4R8PB 4CAYA 5BO0A 5GT3C 3X1TB 2CWEA 3LELA 1M1AD 5AV8B 3MGQB 1KX3D 2NZDA 5GSUD 3AZLD 1BH8B 4UPKA 2ZY2A 2DF4C 3WTPA 4H9QB 3AZMD 2AROB 3AZFC 2BYMB 4H9RA 4Z66D 3B6FC 3WKJB 1P3BC 1EQZB 4KGCA 3KXBA 3AZGA 5CPKD 5JRGC 1TZYB 3AZED 3R45A 2HIOB 5B33B 3WA9B 3AZJA 3X1SA 2JE5A 3AL0C 4H9PA 1P3LD 3UTBA 1P3OA 4J8WB 4WU8C 4X23B 3MGRB 3AZIC 3KFUG 3MGPC 3A6NB 5BNXB 5DNMC 3TU4B 3X1SB 3B0BA 1HQ3A 3AV1C 4M6BA 3REJD 1P3AD 5GT0A 3AYWA 4YM6A 3RELB 5CP6C 3VH6W 5B0YD 4LD9D 3W99C 5B2IA 5GT3B 2L5AA 4WU9C 3MVDA 3LELD 2Y2PA 4JJNA 3MGQA 2NZDD 1N1JA 4Z2MG 1BH8A 3AFAC 5JA4B 3KUYC 3LZ1D 3AZFB 2CV5D 1M19C 3WTPD 4H9QA 4AWLC 2AROA 5B31D 2BYMA 3EPKA 5AV5D 3B6FB 1P3BB 5AVBC 3REIC 5BT1C 3WKJA 1EQZA 4KGCD 5JRGB 3KXBD 3C1CA 3AZGD 1TZYA 2HIOA 5B2JA 3AZJD 2Y2GA 4WU8B 1P3OD 3UTBD 4J8WA 2F8NH 5B40C 4X23A 2YFVA 5CHLB 2PYOC 3MGRA 3O62C 3AZIB 4J8VC 2RVQC 3MGPB 2DQNC 5DNMB 1ZLAC 3MNNA 1P3FC 3A6NA 3AV1B 1WWIA 5BNXA 3TU4A 3AN2A 2Y2JA 1JFIB 1HQ3D 3AZHC 3B6GC 2RIQA 3AYWD 2J8PA 5CP6B 1F66C 5GSUA 3KWQD 4YM6D 3W97A 3RELA 3W99B 4HGAC 1BH9B 1F1EA 4WU9B 1AOIC 5GT3A 3AV2D 3MVDD 4R8PD 4WZSB 3UTAC 4G91C 2Y2HA 5B24C 3X1TD 2FJ7C 5B32C 5AV8D 2JSSA 5G49A 3MGQD 3P5JB 4YS3C 3KUYB 1M19B 3VH5T 5JA4A 4AWLB 5B1MC 2AROD 5AVBB 3REIB 3REKC 3B6FA 4E44A 1P3LA 3NQJB 3WKJD 1EQZD 5FUGB 5JRGA 3MGSC 3B0CT 1TZYD 2HIOD 5E5AC 5B33D 3WA9D 3VH6T 4ZUXC 4WU8A 5B40B 3REJA 2PYOB 4J8WD 3O62B 4J8UC 4X23D 4J8VB 3MGRD 5B1LC 3MGPA 1ZLAB 1P3FB 5B0YA 3A6ND 3AV1A 3AZHB 3A1IA 3TU4D 3LJAC 1JFIA 5AV9C 2ZM5A 2F8NG 4EO5C 3B6GB 3W96C 1F66B 5KDMB 4HGAB 3RELD 3W97D 1AOIB 3W99A 1BH9A 4WU9A 3X1VC 3LZ1A 1A7WA 3UTAB 2CV5A 4G91B 5GT3D 5B24B 2FJ7B 5B32B 5B31A 5AV5A 3AZNB 4NE3A 4YS3B 5BNVB 1ID3C 3X1UC 3AFAA 1KU5A 5B1MB 1M19A 2Y2MA 3AZFD 4NE5A 3REKB 1ULYA 2BG1A 3REIA 5CPJC 3B6FD 1P3BD 4ZBJC 3MGSB 5FUGA 3VH5W 5JRGD 5E5AB 4CSRB 4KUDC 1B67A 3NQUB 5F99B 1P3MC 4ZUXB 3LZ0C 3REHC 1P34C 4WU8D 5B40A 4J8UB 2PYOA 3B0CW 3O62A 5B1LB 4J8VA 3KWQA 3AZID 1PZRA 1P3GC 3MGPD 1ZLAA 4NE6A 1P3FA 3AZKC 5DNMD 1M18C 3LJAB 5AV9B 4EO5B 3AV2A 3AV1D 3AZHA 3B6GA 3W96B 4R8PA 4XUJC 3C1BC 4DQYB 5BS7A 3X1TA 1S32C 3EPLA 4J8XC 1F66A 5AV8A 5KDMA 5CP6D 3EG5B 3EPHA 3W99D 2ZY3A 3X1VB 1WWSA 1AOIA 3W98C 4WU9D 2UWXA 3UTAA 2FJ7A 5B24A 4G92C 4XZQC 5B32A 1ID3B 4YS3A 3X1UB 1TAFB 5AY8C 3UT9C 3AFAD 3KUYD 5B1MA 1M19D 4H9OB 5B33A 3WA9A 2Y2LA 5CPJB 3REKA 5AVBD 3REID 4ZBJB 4DRAA 5BT1D 3MGSA 1P3IC 4KUDB 5E5AA 4CSRA 1P3MB 3LZ0B 5DNNC 3REHB 1P34B 5B31G 4ZUXA 4J8UA 5B40D 3WAAC 3X1SC 2PYOD 3O62D 5B1LA 4J8VD 2RVQD 1P3GB 5C3IC 2NQBC 3AZKB 1M18B 1ZLAD 1P3FD 1U35C 1KX4C 3LJAA 5AV9A 4XUJB 3C1BB 3AZHD 1S32B 4Z5TC 3B6GD 4J8XB 3B0DC 1F66D 3AZNC 5AV6C 3W98B 5GT0C 2IO5C 2Y2IA 3X1VA 1AOID 4G92B 4XZQB 1H3OB 5GXQC 3AZFA 3UTAD 2FJ7D 5B24D 1W2EA 5BO0B 5B32D 5B2IC 1ID3A 3AZND 5AY8B 1P3BA 4YS3D 3X1UA 3UT9B 4WJ3C 1TAFA 4JJNC 4H9NB 4WNNB 1Z2CB 5B1MD 4H9OA 1P3PC 3REKD 2HUEC 5F99C 4UUZB 2Y2OA 4H9RB 1P3IB 3MGSD 4KUDA 4QLCC 1KX5C 5DNNB 5CPIC 3AZIA 5E5AD 1P3KC 3C1CC 3R45B 1P3MA 3LZ0A 5F99D 3REHA 5DNMA 5B2JC 4ZUXD 2XD1A 3WAAB 2JCHA
chains in the Genus database with same CATH topology
2VQRA 2FFFB 4J8UD 5AVCC 5C3IB 2F8NK 2NQBB 5B1LD 1P3GA 5CP6A 1U35B 1M18A 1KX4B 4Z5TB 3LJAD 3B0DB 4XUJA 5AV9D 3C1BA 3MNNC 3W96D 1S32A 3H0RC 5B0ZC 3AN2C 5AV6B 5GT0B 1M1AC 2IO5B 3FDDA 3A1KA 3W98A 1KX3C 5GSUC 3KUYA 3AZLC 5GXQB 3X1VD 1B6WA 4XZQA 5B2IB 5AVBA 3AZMC 1ID3D 5AY8A 3UT9A 4JJNB 3X1UD 1N1JB 3NQJA 4Z66C 1P3PB 4H9NA 4WNNA 2HUEB 5CPKC 3AZEC 5CPJD 4UUZA 1P3IA 2F8NB 4QLCB 1KX5B 1P3LC 5CPIB 1P3KB 4KUDD 2G5HC 3C1CB 5DNNA 3V9RB 1P3MD 2ZY4A 5B2JB 3LZ0D 3REHD 1P34D 2Y2KA 3WAAA 5AVCB 2YFVB 2XD5A 3REJC 1P3AC 2NQBA 1P3GD 3AZKD 1U35A 1M18D 3WTPE 1KX4A 3MNNB 2YFWB 5B0YC 4Z5TA 5B0ZB 4LD9C 4E45A 4XUJD 3C1BD 4H9SC 3AN2B 1S32D 4J8XD 1M1AB 3AZNA 5AV6A 5BNVA 1KX3B 3LELC 2F2AC 5GSUB 3AZLB 3W98D 3W97B 2NZDC 5GXQA 4KHAB 4XZQD 3AZMB 3LZ1C 2CV5C 3WTPC 2BYKB 5AY8D 5G49B 4Z66B 5B31C 5AV5C 3UT9D 3F6TA 1P3PA 5CPKB 4KGCC 3KXBC 3AZEB 3AZGC 3NQUA 2W8SA 5F99A 3AZJC 1P3LB 1P3ID 2F8NA 4QLCA 2Y2QA 1KX5A 5CPIA 1P3OC 3UTBC 1P3KA 5DNND 3V9RA 3H0LC 3W96A 5AVCA 3X1SD 3WAAD 3H0MC 3REJB 1P3AB 1BFMA 1HQ3C 2NQBD 3AYWC 1U35D 1T3UA 5B0YB 4YM6C 3KWQC 1KX4D 4LD9B 2YFWA 4Z5TD 5B0ZA 4CAYB 3AV2C 1M1AA 3MVDC 4R8PC 3LELB 5AV6D 5GT0D 5BS7C 3X1TC 1KX3A 2NZDB 5AV8C 3AZLA 3VH5A 1Q9CA 3MGQC 5GXQD 4KHAA 3LZ1B 2CV5B 5B2ID 3WTPB 3AZMA 5CPJA 5B31B 2LY8A 2BYKA 5AV5B 2AROC 4Z66A 4JJND 4KGCB 3KXBB 3AFAB 1P3PD 3WKJC 3AZGB 5CPKA 1EQZC 3AZEA 2G5IC 2ZY5A 3VH6A 1TZYC 1P34A 5B32G 3AZJB 2HIOC 5B33C 3WA9C 4H9PB 3KSYA 3UTBB 1P3OB 2F8ND 4QLCD 1KX5D 5CPID 3EPJA 4J8WC 3C1CD 1P3KD 4X23C 2Y2NA 3AZKA 3MGRC 1HTAA 5B2JD 4WV4B 5AVCD 3A6NC 1HQ3B 4J8XA 4DRBA 3TU4C 1P3AA 3AYWB 3KWQB 4YM6B 4Z2MH 4LD9A 4NFTA 3RELC 4H9SA 3W97C 3MNND 3IP4C 1H3OA 5B0ZD 1R4VA 3AN2D 3AV2B 3MVDB 4R8PB 4CAYA 5BO0A 5GT3C 3X1TB 2CWEA 3LELA 1M1AD 5AV8B 3MGQB 1KX3D 2NZDA 5GSUD 3AZLD 1BH8B 4UPKA 2ZY2A 2DF4C 3WTPA 4H9QB 3AZMD 2AROB 3AZFC 2BYMB 4H9RA 4Z66D 3B6FC 3WKJB 1P3BC 1EQZB 4KGCA 3KXBA 3AZGA 5CPKD 5JRGC 1TZYB 3AZED 3R45A 2HIOB 5B33B 3WA9B 3AZJA 3X1SA 2JE5A 3AL0C 4H9PA 1P3LD 3UTBA 1P3OA 4J8WB 4WU8C 4X23B 3MGRB 3AZIC 3KFUG 3MGPC 3A6NB 5BNXB 5DNMC 3TU4B 3X1SB 3B0BA 1HQ3A 3AV1C 4M6BA 3REJD 1P3AD 5GT0A 3AYWA 4YM6A 3RELB 5CP6C 3VH6W 5B0YD 4LD9D 3W99C 5B2IA 5GT3B 2L5AA 4WU9C 3MVDA 3LELD 2Y2PA 4JJNA 3MGQA 2NZDD 1N1JA 4Z2MG 1BH8A 3AFAC 5JA4B 3KUYC 3LZ1D 3AZFB 2CV5D 1M19C 3WTPD 4H9QA 4AWLC 2AROA 5B31D 2BYMA 3EPKA 5AV5D 3B6FB 1P3BB 5AVBC 3REIC 5BT1C 3WKJA 1EQZA 4KGCD 5JRGB 3KXBD 3C1CA 3AZGD 1TZYA 2HIOA 5B2JA 3AZJD 2Y2GA 4WU8B 1P3OD 3UTBD 4J8WA 2F8NH 5B40C 4X23A 2YFVA 5CHLB 2PYOC 3MGRA 3O62C 3AZIB 4J8VC 2RVQC 3MGPB 2DQNC 5DNMB 1ZLAC 3MNNA 1P3FC 3A6NA 3AV1B 1WWIA 5BNXA 3TU4A 3AN2A 2Y2JA 1JFIB 1HQ3D 3AZHC 3B6GC 2RIQA 3AYWD 2J8PA 5CP6B 1F66C 5GSUA 3KWQD 4YM6D 3W97A 3RELA 3W99B 4HGAC 1BH9B 1F1EA 4WU9B 1AOIC 5GT3A 3AV2D 3MVDD 4R8PD 4WZSB 3UTAC 4G91C 2Y2HA 5B24C 3X1TD 2FJ7C 5B32C 5AV8D 2JSSA 5G49A 3MGQD 3P5JB 4YS3C 3KUYB 1M19B 3VH5T 5JA4A 4AWLB 5B1MC 2AROD 5AVBB 3REIB 3REKC 3B6FA 4E44A 1P3LA 3NQJB 3WKJD 1EQZD 5FUGB 5JRGA 3MGSC 3B0CT 1TZYD 2HIOD 5E5AC 5B33D 3WA9D 3VH6T 4ZUXC 4WU8A 5B40B 3REJA 2PYOB 4J8WD 3O62B 4J8UC 4X23D 4J8VB 3MGRD 5B1LC 3MGPA 1ZLAB 1P3FB 5B0YA 3A6ND 3AV1A 3AZHB 3A1IA 3TU4D 3LJAC 1JFIA 5AV9C 2ZM5A 2F8NG 4EO5C 3B6GB 3W96C 1F66B 5KDMB 4HGAB 3RELD 3W97D 1AOIB 3W99A 1BH9A 4WU9A 3X1VC 3LZ1A 1A7WA 3UTAB 2CV5A 4G91B 5GT3D 5B24B 2FJ7B 5B32B 5B31A 5AV5A 3AZNB 4NE3A 4YS3B 5BNVB 1ID3C 3X1UC 3AFAA 1KU5A 5B1MB 1M19A 2Y2MA 3AZFD 4NE5A 3REKB 1ULYA 2BG1A 3REIA 5CPJC 3B6FD 1P3BD 4ZBJC 3MGSB 5FUGA 3VH5W 5JRGD 5E5AB 4CSRB 4KUDC 1B67A 3NQUB 5F99B 1P3MC 4ZUXB 3LZ0C 3REHC 1P34C 4WU8D 5B40A 4J8UB 2PYOA 3B0CW 3O62A 5B1LB 4J8VA 3KWQA 3AZID 1PZRA 1P3GC 3MGPD 1ZLAA 4NE6A 1P3FA 3AZKC 5DNMD 1M18C 3LJAB 5AV9B 4EO5B 3AV2A 3AV1D 3AZHA 3B6GA 3W96B 4R8PA 4XUJC 3C1BC 4DQYB 5BS7A 3X1TA 1S32C 3EPLA 4J8XC 1F66A 5AV8A 5KDMA 5CP6D 3EG5B 3EPHA 3W99D 2ZY3A 3X1VB 1WWSA 1AOIA 3W98C 4WU9D 2UWXA 3UTAA 2FJ7A 5B24A 4G92C 4XZQC 5B32A 1ID3B 4YS3A 3X1UB 1TAFB 5AY8C 3UT9C 3AFAD 3KUYD 5B1MA 1M19D 4H9OB 5B33A 3WA9A 2Y2LA 5CPJB 3REKA 5AVBD 3REID 4ZBJB 4DRAA 5BT1D 3MGSA 1P3IC 4KUDB 5E5AA 4CSRA 1P3MB 3LZ0B 5DNNC 3REHB 1P34B 5B31G 4ZUXA 4J8UA 5B40D 3WAAC 3X1SC 2PYOD 3O62D 5B1LA 4J8VD 2RVQD 1P3GB 5C3IC 2NQBC 3AZKB 1M18B 1ZLAD 1P3FD 1U35C 1KX4C 3LJAA 5AV9A 4XUJB 3C1BB 3AZHD 1S32B 4Z5TC 3B6GD 4J8XB 3B0DC 1F66D 3AZNC 5AV6C 3W98B 5GT0C 2IO5C 2Y2IA 3X1VA 1AOID 4G92B 4XZQB 1H3OB 5GXQC 3AZFA 3UTAD 2FJ7D 5B24D 1W2EA 5BO0B 5B32D 5B2IC 1ID3A 3AZND 5AY8B 1P3BA 4YS3D 3X1UA 3UT9B 4WJ3C 1TAFA 4JJNC 4H9NB 4WNNB 1Z2CB 5B1MD 4H9OA 1P3PC 3REKD 2HUEC 5F99C 4UUZB 2Y2OA 4H9RB 1P3IB 3MGSD 4KUDA 4QLCC 1KX5C 5DNNB 5CPIC 3AZIA 5E5AD 1P3KC 3C1CC 3R45B 1P3MA 3LZ0A 5F99D 3REHA 5DNMA 5B2JC 4ZUXD 2XD1A 3WAAB 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U D;  5AVC C;  5C3I B;  2F8N K;  2NQB B;  5B1L D;  1P3G A;  5CP6 A;  1U35 B;  1M18 A;  1KX4 B;  4Z5T B;  3LJA D;  3B0D B;  4XUJ A;  5AV9 D;  3C1B A;  3MNN C;  3W96 D;  1S32 A;  5B0Z C;  3AN2 C;  5AV6 B;  5GT0 B;  1M1A C;  2IO5 B;  3W98 A;  1KX3 C;  5GSU C;  3KUY A;  3AZL C;  5GXQ B;  3X1V D;  1B6W A;  4XZQ A;  5B2I B;  5AVB A;  3AZM C;  1ID3 D;  5AY8 A;  3UT9 A;  4JJN B;  3X1U D;  1N1J B;  3NQJ A;  4Z66 C;  1P3P B;  4H9N A;  4WNN A;  2HUE B;  5CPK C;  3AZE C;  5CPJ D;  4UUZ A;  1P3I A;  2F8N B;  4QLC B;  1KX5 B;  1P3L C;  5CPI B;  1P3K B;  4KUD D;  3C1C B;  5DNN A;  3V9R B;  1P3M D;  5B2J B;  3LZ0 D;  3REH D;  1P34 D;  3WAA A;  5AVC B;  2YFV B;  3REJ C;  1P3A C;  2NQB A;  1P3G D;  3AZK D;  1U35 A;  1M18 D;  3WTP E;  1KX4 A;  3MNN B;  2YFW B;  4Z5T A;  5B0Y C;  5B0Z B;  4LD9 C;  4E45 A;  4XUJ D;  3C1B D;  4H9S C;  3AN2 B;  1S32 D;  4J8X D;  1M1A B;  3AZN A;  5AV6 A;  5BNV A;  1KX3 B;  3LEL C;  5GSU B;  3AZL B;  3W98 D;  3W97 B;  2NZD C;  5GXQ A;  4KHA B;  4XZQ D;  3AZM B;  3LZ1 C;  2CV5 C;  3WTP C;  2BYK B;  5AY8 D;  5G49 B;  4Z66 B;  5B31 C;  5AV5 C;  3UT9 D;  1P3P A;  5CPK B;  4KGC C;  3KXB C;  3AZE B;  3AZG C;  3NQU A;  5F99 A;  3AZJ C;  1P3L B;  1P3I D;  2F8N A;  4QLC A;  1KX5 A;  5CPI A;  1P3O C;  3UTB C;  1P3K A;  5DNN D;  3V9R A;  3W96 A;  5AVC A;  3X1S D;  3WAA D;  3REJ B;  1P3A B;  1BFM A;  1HQ3 C;  2NQB D;  3AYW C;  1U35 D;  5B0Y B;  3KWQ C;  4YM6 C;  1KX4 D;  4LD9 B;  2YFW A;  4Z5T D;  5B0Z A;  4CAY B;  3AV2 C;  1M1A A;  3MVD C;  4R8P C;  3LEL B;  5AV6 D;  5GT0 D;  5BS7 C;  3X1T C;  1KX3 A;  2NZD B;  5AV8 C;  3AZL A;  3VH5 A;  1Q9C A;  3MGQ C;  5GXQ D;  4KHA A;  3LZ1 B;  2CV5 B;  5B2I D;  3WTP B;  3AZM A;  5CPJ A;  5B31 B;  2LY8 A;  2BYK A;  5AV5 B;  2ARO C;  4Z66 A;  4JJN D;  4KGC B;  3KXB B;  3AFA B;  1P3P D;  3WKJ C;  3AZG B;  5CPK A;  1EQZ C;  3AZE A;  3VH6 A;  1TZY C;  1P34 A;  5B32 G;  3AZJ B;  2HIO C;  5B33 C;  3WA9 C;  4H9P B;  3KSY A;  3UTB B;  1P3O B;  2F8N D;  4QLC D;  1KX5 D;  5CPI D;  4J8W C;  1P3K D;  3C1C D;  4X23 C;  3AZK A;  3MGR C;  1HTA A;  5B2J D;  4WV4 B;  5AVC D;  3A6N C;  1HQ3 B;  4J8X A;  4DRB A;  3TU4 C;  1P3A A;  3AYW B;  3KWQ B;  4YM6 B;  4Z2M H;  4LD9 A;  4NFT A;  3REL C;  4H9S A;  3W97 C;  3MNN D;  1H3O A;  5B0Z D;  1R4V A;  3AN2 D;  3AV2 B;  3MVD B;  4R8P B;  4CAY A;  5BO0 A;  5GT3 C;  3X1T B;  2CWE A;  3LEL A;  1M1A D;  5AV8 B;  3MGQ B;  1KX3 D;  2NZD A;  5GSU D;  3AZL D;  1BH8 B;  3WTP A;  4H9Q B;  3AZM D;  2ARO B;  3AZF C;  2BYM B;  4H9R A;  4Z66 D;  3B6F C;  3WKJ B;  1P3B C;  1EQZ B;  4KGC A;  3KXB A;  3AZG A;  5CPK D;  5JRG C;  1TZY B;  3AZE D;  3R45 A;  2HIO B;  5B33 B;  3WA9 B;  3AZJ A;  3X1S A;  4H9P A;  1P3L D;  3UTB A;  1P3O A;  4J8W B;  4WU8 C;  4X23 B;  3MGR B;  3AZI C;  3MGP C;  3A6N B;  5BNX B;  5DNM C;  3TU4 B;  3B0B A;  1HQ3 A;  3AV1 C;  4M6B A;  3REJ D;  1P3A D;  5GT0 A;  3AYW A;  4YM6 A;  3REL B;  5CP6 C;  3VH6 W;  5B0Y D;  4LD9 D;  3W99 C;  5B2I A;  5GT3 B;  2L5A A;  4WU9 C;  3MVD A;  3LEL D;  4JJN A;  3MGQ A;  2NZD D;  1N1J A;  4Z2M G;  1BH8 A;  3AFA C;  5JA4 B;  3KUY C;  3LZ1 D;  3AZF B;  2CV5 D;  1M19 C;  3WTP D;  4H9Q A;  4AWL C;  2ARO A;  5B31 D;  2BYM A;  5AV5 D;  3B6F B;  1P3B B;  5AVB C;  3REI C;  5BT1 C;  3WKJ A;  1EQZ A;  4KGC D;  5JRG B;  3KXB D;  3C1C A;  3AZG D;  1TZY A;  2HIO A;  5B2J A;  3AZJ D;  4WU8 B;  1P3O D;  3UTB D;  4J8W A;  2F8N H;  5B40 C;  4X23 A;  2YFV A;  5CHL B;  2PYO C;  3MGR A;  3O62 C;  3AZI B;  4J8V C;  2RVQ C;  3MGP B;  5DNM B;  1ZLA C;  3MNN A;  1P3F C;  3A6N A;  3AV1 B;  1WWI A;  5BNX A;  3TU4 A;  3AN2 A;  1JFI B;  1HQ3 D;  3AZH C;  3B6G C;  3AYW D;  5CP6 B;  1F66 C;  5GSU A;  3KWQ D;  4YM6 D;  3W97 A;  3REL A;  3W99 B;  4HGA C;  1BH9 B;  1F1E A;  4WU9 B;  1AOI C;  5GT3 A;  3AV2 D;  3MVD D;  4R8P D;  4WZS B;  3UTA C;  4G91 C;  5B24 C;  3X1T D;  2FJ7 C;  5B32 C;  5AV8 D;  2JSS A;  5G49 A;  3MGQ D;  4YS3 C;  3KUY B;  1M19 B;  3VH5 T;  5JA4 A;  4AWL B;  5B1M C;  2ARO D;  5AVB B;  3REI B;  3REK C;  3B6F A;  4E44 A;  1P3L A;  3NQJ B;  3WKJ D;  1EQZ D;  5FUG B;  5JRG A;  3MGS C;  3B0C T;  1TZY D;  2HIO D;  5E5A C;  5B33 D;  3WA9 D;  3VH6 T;  4ZUX C;  4WU8 A;  5B40 B;  3REJ A;  2PYO B;  4J8W D;  3O62 B;  4J8U C;  4X23 D;  4J8V B;  3MGR D;  5B1L C;  3MGP A;  1ZLA B;  1P3F B;  5B0Y A;  3A6N D;  3AV1 A;  3AZH B;  3TU4 D;  1JFI A;  3LJA C;  3B6G B;  5AV9 C;  2F8N G;  4EO5 C;  3W96 C;  1F66 B;  5KDM B;  4HGA B;  3REL D;  3W97 D;  1AOI B;  3W99 A;  1BH9 A;  4WU9 A;  3X1V C;  3LZ1 A;  1A7W A;  3UTA B;  2CV5 A;  4G91 B;  5GT3 D;  5B24 B;  2FJ7 B;  5B32 B;  5B31 A;  5AV5 A;  3AZN B;  4NE3 A;  4YS3 B;  5BNV B;  1ID3 C;  3X1U C;  3AFA A;  1KU5 A;  5B1M B;  1M19 A;  3AZF D;  4NE5 A;  3REK B;  1ULY A;  3REI A;  5CPJ C;  3B6F D;  1P3B D;  4ZBJ C;  3MGS B;  5FUG A;  3VH5 W;  5JRG D;  5E5A B;  4CSR B;  4KUD C;  1B67 A;  3NQU B;  5F99 B;  1P3M C;  4ZUX B;  3LZ0 C;  3REH C;  1P34 C;  4WU8 D;  5B40 A;  4J8U B;  2PYO A;  3B0C W;  3O62 A;  5B1L B;  4J8V A;  3KWQ A;  3AZI D;  1P3G C;  3MGP D;  1ZLA A;  4NE6 A;  1P3F A;  3AZK C;  5DNM D;  1M18 C;  3LJA B;  5AV9 B;  4EO5 B;  3AV2 A;  3AV1 D;  3AZH A;  3B6G A;  3W96 B;  4R8P A;  4XUJ C;  3C1B C;  5BS7 A;  3X1T A;  1S32 C;  4J8X C;  1F66 A;  5AV8 A;  5KDM A;  5CP6 D;  3W99 D;  3X1V B;  1AOI A;  1WWS A;  3W98 C;  4WU9 D;  3UTA A;  2FJ7 A;  5B24 A;  4G92 C;  4XZQ C;  5B32 A;  1ID3 B;  4YS3 A;  3X1U B;  1TAF B;  5AY8 C;  3UT9 C;  3AFA D;  3KUY D;  5B1M A;  1M19 D;  4H9O B;  5B33 A;  3WA9 A;  5CPJ B;  3REK A;  5AVB D;  3REI D;  4ZBJ B;  4DRA A;  5BT1 D;  3MGS A;  1P3I C;  4KUD B;  5E5A A;  4CSR A;  1P3M B;  3LZ0 B;  5DNN C;  3REH B;  1P34 B;  5B31 G;  4ZUX A;  4J8U A;  5B40 D;  3WAA C;  3X1S C;  2PYO D;  3O62 D;  5B1L A;  4J8V D;  2RVQ D;  1P3G B;  5C3I C;  2NQB C;  3AZK B;  1M18 B;  1ZLA D;  1P3F D;  1U35 C;  1KX4 C;  3LJA A;  5AV9 A;  4XUJ B;  3C1B B;  3AZH D;  1S32 B;  4Z5T C;  3B6G D;  4J8X B;  3B0D C;  1F66 D;  3AZN C;  5AV6 C;  3W98 B;  5GT0 C;  2IO5 C;  3X1V A;  1AOI D;  4G92 B;  4XZQ B;  1H3O B;  5GXQ C;  3AZF A;  3UTA D;  2FJ7 D;  5B24 D;  5BO0 B;  5B32 D;  5B2I C;  1ID3 A;  3AZN D;  5AY8 B;  1P3B A;  4YS3 D;  3X1U A;  3UT9 B;  1TAF A;  4JJN C;  4H9N B;  4WNN B;  1P3P C;  5B1M D;  4H9O A;  3REK D;  2HUE C;  5F99 C;  4UUZ B;  4H9R B;  1P3I B;  3MGS D;  4KUD A;  4QLC C;  1KX5 C;  5DNN B;  5CPI C;  3AZI A;  5E5A D;  1P3K C;  3C1C C;  3R45 B;  1P3M A;  3LZ0 A;  5F99 D;  3REH A;  5DNM A;  5B2J C;  4ZUX D;  3WAA B;  3X1S B; 
#chains in the Genus database with same CATH topology
 2VQR A;  2FFF B;  4J8U D;  5AVC C;  5C3I B;  2F8N K;  2NQB B;  5B1L D;  1P3G A;  5CP6 A;  1U35 B;  1M18 A;  1KX4 B;  4Z5T B;  3LJA D;  3B0D B;  4XUJ A;  5AV9 D;  3C1B A;  3MNN C;  3W96 D;  1S32 A;  3H0R C;  5B0Z C;  3AN2 C;  5AV6 B;  5GT0 B;  1M1A C;  2IO5 B;  3FDD A;  3A1K A;  3W98 A;  1KX3 C;  5GSU C;  3KUY A;  3AZL C;  5GXQ B;  3X1V D;  1B6W A;  4XZQ A;  5B2I B;  5AVB A;  3AZM C;  1ID3 D;  5AY8 A;  3UT9 A;  4JJN B;  3X1U D;  1N1J B;  3NQJ A;  4Z66 C;  1P3P B;  4H9N A;  4WNN A;  2HUE B;  5CPK C;  3AZE C;  5CPJ D;  4UUZ A;  1P3I A;  2F8N B;  4QLC B;  1KX5 B;  1P3L C;  5CPI B;  1P3K B;  4KUD D;  2G5H C;  3C1C B;  5DNN A;  3V9R B;  1P3M D;  2ZY4 A;  5B2J B;  3LZ0 D;  3REH D;  1P34 D;  2Y2K A;  3WAA A;  5AVC B;  2YFV B;  2XD5 A;  3REJ C;  1P3A C;  2NQB A;  1P3G D;  3AZK D;  1U35 A;  1M18 D;  3WTP E;  1KX4 A;  3MNN B;  2YFW B;  5B0Y C;  4Z5T A;  5B0Z B;  4LD9 C;  4E45 A;  4XUJ D;  3C1B D;  4H9S C;  3AN2 B;  1S32 D;  4J8X D;  1M1A B;  3AZN A;  5AV6 A;  5BNV A;  1KX3 B;  3LEL C;  2F2A C;  5GSU B;  3AZL B;  3W98 D;  3W97 B;  2NZD C;  5GXQ A;  4KHA B;  4XZQ D;  3AZM B;  3LZ1 C;  2CV5 C;  3WTP C;  2BYK B;  5AY8 D;  5G49 B;  4Z66 B;  5B31 C;  5AV5 C;  3UT9 D;  3F6T A;  1P3P A;  5CPK B;  4KGC C;  3KXB C;  3AZE B;  3AZG C;  3NQU A;  2W8S A;  5F99 A;  3AZJ C;  1P3L B;  1P3I D;  2F8N A;  4QLC A;  2Y2Q A;  1KX5 A;  5CPI A;  1P3O C;  3UTB C;  1P3K A;  5DNN D;  3V9R A;  3H0L C;  3W96 A;  5AVC A;  3X1S D;  3WAA D;  3H0M C;  3REJ B;  1P3A B;  1BFM A;  1HQ3 C;  2NQB D;  3AYW C;  1U35 D;  1T3U A;  5B0Y B;  4YM6 C;  3KWQ C;  1KX4 D;  4LD9 B;  2YFW A;  4Z5T D;  5B0Z A;  4CAY B;  3AV2 C;  1M1A A;  3MVD C;  4R8P C;  3LEL B;  5AV6 D;  5GT0 D;  5BS7 C;  3X1T C;  1KX3 A;  2NZD B;  5AV8 C;  3AZL A;  3VH5 A;  1Q9C A;  3MGQ C;  5GXQ D;  4KHA A;  3LZ1 B;  2CV5 B;  5B2I D;  3WTP B;  3AZM A;  5CPJ A;  5B31 B;  2LY8 A;  2BYK A;  5AV5 B;  2ARO C;  4Z66 A;  4JJN D;  4KGC B;  3KXB B;  3AFA B;  1P3P D;  3WKJ C;  3AZG B;  5CPK A;  1EQZ C;  3AZE A;  2G5I C;  2ZY5 A;  3VH6 A;  1TZY C;  1P34 A;  5B32 G;  3AZJ B;  2HIO C;  5B33 C;  3WA9 C;  4H9P B;  3KSY A;  3UTB B;  1P3O B;  2F8N D;  4QLC D;  1KX5 D;  5CPI D;  3EPJ A;  4J8W C;  3C1C D;  1P3K D;  4X23 C;  2Y2N A;  3AZK A;  3MGR C;  1HTA A;  5B2J D;  4WV4 B;  5AVC D;  3A6N C;  1HQ3 B;  4J8X A;  4DRB A;  3TU4 C;  1P3A A;  3AYW B;  3KWQ B;  4YM6 B;  4Z2M H;  4LD9 A;  4NFT A;  3REL C;  4H9S A;  3W97 C;  3MNN D;  3IP4 C;  1H3O A;  5B0Z D;  1R4V A;  3AN2 D;  3AV2 B;  3MVD B;  4R8P B;  4CAY A;  5BO0 A;  5GT3 C;  3X1T B;  2CWE A;  3LEL A;  1M1A D;  5AV8 B;  3MGQ B;  1KX3 D;  2NZD A;  5GSU D;  3AZL D;  1BH8 B;  4UPK A;  2ZY2 A;  2DF4 C;  3WTP A;  4H9Q B;  3AZM D;  2ARO B;  3AZF C;  2BYM B;  4H9R A;  4Z66 D;  3B6F C;  3WKJ B;  1P3B C;  1EQZ B;  4KGC A;  3KXB A;  3AZG A;  5CPK D;  5JRG C;  1TZY B;  3AZE D;  3R45 A;  2HIO B;  5B33 B;  3WA9 B;  3AZJ A;  3X1S A;  2JE5 A;  3AL0 C;  4H9P A;  1P3L D;  3UTB A;  1P3O A;  4J8W B;  4WU8 C;  4X23 B;  3MGR B;  3AZI C;  3KFU G;  3MGP C;  3A6N B;  5BNX B;  5DNM C;  3TU4 B;  3X1S B;  3B0B A;  1HQ3 A;  3AV1 C;  4M6B A;  3REJ D;  1P3A D;  5GT0 A;  3AYW A;  4YM6 A;  3REL B;  5CP6 C;  3VH6 W;  5B0Y D;  4LD9 D;  3W99 C;  5B2I A;  5GT3 B;  2L5A A;  4WU9 C;  3MVD A;  3LEL D;  2Y2P A;  4JJN A;  3MGQ A;  2NZD D;  1N1J A;  4Z2M G;  1BH8 A;  3AFA C;  5JA4 B;  3KUY C;  3LZ1 D;  3AZF B;  2CV5 D;  1M19 C;  3WTP D;  4H9Q A;  4AWL C;  2ARO A;  5B31 D;  2BYM A;  3EPK A;  5AV5 D;  3B6F B;  1P3B B;  5AVB C;  3REI C;  5BT1 C;  3WKJ A;  1EQZ A;  4KGC D;  5JRG B;  3KXB D;  3C1C A;  3AZG D;  1TZY A;  2HIO A;  5B2J A;  3AZJ D;  2Y2G A;  4WU8 B;  1P3O D;  3UTB D;  4J8W A;  2F8N H;  5B40 C;  4X23 A;  2YFV A;  5CHL B;  2PYO C;  3MGR A;  3O62 C;  3AZI B;  4J8V C;  2RVQ C;  3MGP B;  2DQN C;  5DNM B;  1ZLA C;  3MNN A;  1P3F C;  3A6N A;  3AV1 B;  1WWI A;  5BNX A;  3TU4 A;  3AN2 A;  2Y2J A;  1JFI B;  1HQ3 D;  3AZH C;  3B6G C;  2RIQ A;  3AYW D;  2J8P A;  5CP6 B;  1F66 C;  5GSU A;  3KWQ D;  4YM6 D;  3W97 A;  3REL A;  3W99 B;  4HGA C;  1BH9 B;  1F1E A;  4WU9 B;  1AOI C;  5GT3 A;  3AV2 D;  3MVD D;  4R8P D;  4WZS B;  3UTA C;  4G91 C;  2Y2H A;  5B24 C;  3X1T D;  2FJ7 C;  5B32 C;  5AV8 D;  2JSS A;  5G49 A;  3MGQ D;  3P5J B;  4YS3 C;  3KUY B;  1M19 B;  3VH5 T;  5JA4 A;  4AWL B;  5B1M C;  2ARO D;  5AVB B;  3REI B;  3REK C;  3B6F A;  4E44 A;  1P3L A;  3NQJ B;  3WKJ D;  1EQZ D;  5FUG B;  5JRG A;  3MGS C;  3B0C T;  1TZY D;  2HIO D;  5E5A C;  5B33 D;  3WA9 D;  3VH6 T;  4ZUX C;  4WU8 A;  5B40 B;  3REJ A;  2PYO B;  4J8W D;  3O62 B;  4J8U C;  4X23 D;  4J8V B;  3MGR D;  5B1L C;  3MGP A;  1ZLA B;  1P3F B;  5B0Y A;  3A6N D;  3AV1 A;  3AZH B;  3A1I A;  3TU4 D;  3LJA C;  1JFI A;  5AV9 C;  2ZM5 A;  2F8N G;  4EO5 C;  3B6G B;  3W96 C;  1F66 B;  5KDM B;  4HGA B;  3REL D;  3W97 D;  1AOI B;  3W99 A;  1BH9 A;  4WU9 A;  3X1V C;  3LZ1 A;  1A7W A;  3UTA B;  2CV5 A;  4G91 B;  5GT3 D;  5B24 B;  2FJ7 B;  5B32 B;  5B31 A;  5AV5 A;  3AZN B;  4NE3 A;  4YS3 B;  5BNV B;  1ID3 C;  3X1U C;  3AFA A;  1KU5 A;  5B1M B;  1M19 A;  2Y2M A;  3AZF D;  4NE5 A;  3REK B;  1ULY A;  2BG1 A;  3REI A;  5CPJ C;  3B6F D;  1P3B D;  4ZBJ C;  3MGS B;  5FUG A;  3VH5 W;  5JRG D;  5E5A B;  4CSR B;  4KUD C;  1B67 A;  3NQU B;  5F99 B;  1P3M C;  4ZUX B;  3LZ0 C;  3REH C;  1P34 C;  4WU8 D;  5B40 A;  4J8U B;  2PYO A;  3B0C W;  3O62 A;  5B1L B;  4J8V A;  3KWQ A;  3AZI D;  1PZR A;  1P3G C;  3MGP D;  1ZLA A;  4NE6 A;  1P3F A;  3AZK C;  5DNM D;  1M18 C;  3LJA B;  5AV9 B;  4EO5 B;  3AV2 A;  3AV1 D;  3AZH A;  3B6G A;  3W96 B;  4R8P A;  4XUJ C;  3C1B C;  4DQY B;  5BS7 A;  3X1T A;  1S32 C;  3EPL A;  4J8X C;  1F66 A;  5AV8 A;  5KDM A;  5CP6 D;  3EG5 B;  3EPH A;  3W99 D;  2ZY3 A;  3X1V B;  1WWS A;  1AOI A;  3W98 C;  4WU9 D;  2UWX A;  3UTA A;  2FJ7 A;  5B24 A;  4G92 C;  4XZQ C;  5B32 A;  1ID3 B;  4YS3 A;  3X1U B;  1TAF B;  5AY8 C;  3UT9 C;  3AFA D;  3KUY D;  5B1M A;  1M19 D;  4H9O B;  5B33 A;  3WA9 A;  2Y2L A;  5CPJ B;  3REK A;  5AVB D;  3REI D;  4ZBJ B;  4DRA A;  5BT1 D;  3MGS A;  1P3I C;  4KUD B;  5E5A A;  4CSR A;  1P3M B;  3LZ0 B;  5DNN C;  3REH B;  1P34 B;  5B31 G;  4ZUX A;  4J8U A;  5B40 D;  3WAA C;  3X1S C;  2PYO D;  3O62 D;  5B1L A;  4J8V D;  2RVQ D;  1P3G B;  5C3I C;  2NQB C;  3AZK B;  1M18 B;  1ZLA D;  1P3F D;  1U35 C;  1KX4 C;  3LJA A;  5AV9 A;  4XUJ B;  3C1B B;  3AZH D;  1S32 B;  4Z5T C;  3B6G D;  4J8X B;  3B0D C;  1F66 D;  3AZN C;  5AV6 C;  3W98 B;  5GT0 C;  2IO5 C;  2Y2I A;  3X1V A;  1AOI D;  4G92 B;  4XZQ B;  1H3O B;  5GXQ C;  3AZF A;  3UTA D;  2FJ7 D;  5B24 D;  1W2E A;  5BO0 B;  5B32 D;  5B2I C;  1ID3 A;  3AZN D;  5AY8 B;  1P3B A;  4YS3 D;  3X1U A;  3UT9 B;  4WJ3 C;  1TAF A;  4JJN C;  4H9N B;  4WNN B;  1Z2C B;  5B1M D;  4H9O A;  1P3P C;  3REK D;  2HUE C;  5F99 C;  4UUZ B;  2Y2O A;  4H9R B;  1P3I B;  3MGS D;  4KUD A;  4QLC C;  1KX5 C;  5DNN B;  5CPI C;  3AZI A;  5E5A D;  1P3K C;  3C1C C;  3R45 B;  1P3M A;  3LZ0 A;  5F99 D;  3REH A;  5DNM A;  5B2J C;  4ZUX D;  2XD1 A;  3WAA B;  2JCH A; 
#chains in the Genus database with same CATH homology
 2VQR A;  2FFF B;  4J8U D;  5AVC C;  5C3I B;  2F8N K;  2NQB B;  5B1L D;  1P3G A;  5CP6 A;  1U35 B;  1M18 A;  1KX4 B;  4Z5T B;  3LJA D;  3B0D B;  4XUJ A;  5AV9 D;  3C1B A;  3MNN C;  3W96 D;  1S32 A;  3H0R C;  5B0Z C;  3AN2 C;  5AV6 B;  5GT0 B;  1M1A C;  2IO5 B;  3FDD A;  3A1K A;  3W98 A;  1KX3 C;  5GSU C;  3KUY A;  3AZL C;  5GXQ B;  3X1V D;  1B6W A;  4XZQ A;  5B2I B;  5AVB A;  3AZM C;  1ID3 D;  5AY8 A;  3UT9 A;  4JJN B;  3X1U D;  1N1J B;  3NQJ A;  4Z66 C;  1P3P B;  4H9N A;  4WNN A;  2HUE B;  5CPK C;  3AZE C;  5CPJ D;  4UUZ A;  1P3I A;  2F8N B;  4QLC B;  1KX5 B;  1P3L C;  5CPI B;  1P3K B;  4KUD D;  2G5H C;  3C1C B;  5DNN A;  3V9R B;  1P3M D;  2ZY4 A;  5B2J B;  3LZ0 D;  3REH D;  1P34 D;  2Y2K A;  3WAA A;  5AVC B;  2YFV B;  2XD5 A;  3REJ C;  1P3A C;  2NQB A;  1P3G D;  3AZK D;  1U35 A;  1M18 D;  3WTP E;  1KX4 A;  3MNN B;  2YFW B;  5B0Y C;  4Z5T A;  5B0Z B;  4LD9 C;  4E45 A;  4XUJ D;  3C1B D;  4H9S C;  3AN2 B;  1S32 D;  4J8X D;  1M1A B;  3AZN A;  5AV6 A;  5BNV A;  1KX3 B;  3LEL C;  2F2A C;  5GSU B;  3AZL B;  3W98 D;  3W97 B;  2NZD C;  5GXQ A;  4KHA B;  4XZQ D;  3AZM B;  3LZ1 C;  2CV5 C;  3WTP C;  2BYK B;  5AY8 D;  5G49 B;  4Z66 B;  5B31 C;  5AV5 C;  3UT9 D;  3F6T A;  1P3P A;  5CPK B;  4KGC C;  3KXB C;  3AZE B;  3AZG C;  3NQU A;  2W8S A;  5F99 A;  3AZJ C;  1P3L B;  1P3I D;  2F8N A;  4QLC A;  2Y2Q A;  1KX5 A;  5CPI A;  1P3O C;  3UTB C;  1P3K A;  5DNN D;  3V9R A;  3H0L C;  3W96 A;  5AVC A;  3X1S D;  3WAA D;  3H0M C;  3REJ B;  1P3A B;  1BFM A;  1HQ3 C;  2NQB D;  3AYW C;  1U35 D;  1T3U A;  5B0Y B;  4YM6 C;  3KWQ C;  1KX4 D;  4LD9 B;  2YFW A;  4Z5T D;  5B0Z A;  4CAY B;  3AV2 C;  1M1A A;  3MVD C;  4R8P C;  3LEL B;  5AV6 D;  5GT0 D;  5BS7 C;  3X1T C;  1KX3 A;  2NZD B;  5AV8 C;  3AZL A;  3VH5 A;  1Q9C A;  3MGQ C;  5GXQ D;  4KHA A;  3LZ1 B;  2CV5 B;  5B2I D;  3WTP B;  3AZM A;  5CPJ A;  5B31 B;  2LY8 A;  2BYK A;  5AV5 B;  2ARO C;  4Z66 A;  4JJN D;  4KGC B;  3KXB B;  3AFA B;  1P3P D;  3WKJ C;  3AZG B;  5CPK A;  1EQZ C;  3AZE A;  2G5I C;  2ZY5 A;  3VH6 A;  1TZY C;  1P34 A;  5B32 G;  3AZJ B;  2HIO C;  5B33 C;  3WA9 C;  4H9P B;  3KSY A;  3UTB B;  1P3O B;  2F8N D;  4QLC D;  1KX5 D;  5CPI D;  3EPJ A;  4J8W C;  3C1C D;  1P3K D;  4X23 C;  2Y2N A;  3AZK A;  3MGR C;  1HTA A;  5B2J D;  4WV4 B;  5AVC D;  3A6N C;  1HQ3 B;  4J8X A;  4DRB A;  3TU4 C;  1P3A A;  3AYW B;  3KWQ B;  4YM6 B;  4Z2M H;  4LD9 A;  4NFT A;  3REL C;  4H9S A;  3W97 C;  3MNN D;  3IP4 C;  1H3O A;  5B0Z D;  1R4V A;  3AN2 D;  3AV2 B;  3MVD B;  4R8P B;  4CAY A;  5BO0 A;  5GT3 C;  3X1T B;  2CWE A;  3LEL A;  1M1A D;  5AV8 B;  3MGQ B;  1KX3 D;  2NZD A;  5GSU D;  3AZL D;  1BH8 B;  4UPK A;  2ZY2 A;  2DF4 C;  3WTP A;  4H9Q B;  3AZM D;  2ARO B;  3AZF C;  2BYM B;  4H9R A;  4Z66 D;  3B6F C;  3WKJ B;  1P3B C;  1EQZ B;  4KGC A;  3KXB A;  3AZG A;  5CPK D;  5JRG C;  1TZY B;  3AZE D;  3R45 A;  2HIO B;  5B33 B;  3WA9 B;  3AZJ A;  3X1S A;  2JE5 A;  3AL0 C;  4H9P A;  1P3L D;  3UTB A;  1P3O A;  4J8W B;  4WU8 C;  4X23 B;  3MGR B;  3AZI C;  3KFU G;  3MGP C;  3A6N B;  5BNX B;  5DNM C;  3TU4 B;  3X1S B;  3B0B A;  1HQ3 A;  3AV1 C;  4M6B A;  3REJ D;  1P3A D;  5GT0 A;  3AYW A;  4YM6 A;  3REL B;  5CP6 C;  3VH6 W;  5B0Y D;  4LD9 D;  3W99 C;  5B2I A;  5GT3 B;  2L5A A;  4WU9 C;  3MVD A;  3LEL D;  2Y2P A;  4JJN A;  3MGQ A;  2NZD D;  1N1J A;  4Z2M G;  1BH8 A;  3AFA C;  5JA4 B;  3KUY C;  3LZ1 D;  3AZF B;  2CV5 D;  1M19 C;  3WTP D;  4H9Q A;  4AWL C;  2ARO A;  5B31 D;  2BYM A;  3EPK A;  5AV5 D;  3B6F B;  1P3B B;  5AVB C;  3REI C;  5BT1 C;  3WKJ A;  1EQZ A;  4KGC D;  5JRG B;  3KXB D;  3C1C A;  3AZG D;  1TZY A;  2HIO A;  5B2J A;  3AZJ D;  2Y2G A;  4WU8 B;  1P3O D;  3UTB D;  4J8W A;  2F8N H;  5B40 C;  4X23 A;  2YFV A;  5CHL B;  2PYO C;  3MGR A;  3O62 C;  3AZI B;  4J8V C;  2RVQ C;  3MGP B;  2DQN C;  5DNM B;  1ZLA C;  3MNN A;  1P3F C;  3A6N A;  3AV1 B;  1WWI A;  5BNX A;  3TU4 A;  3AN2 A;  2Y2J A;  1JFI B;  1HQ3 D;  3AZH C;  3B6G C;  2RIQ A;  3AYW D;  2J8P A;  5CP6 B;  1F66 C;  5GSU A;  3KWQ D;  4YM6 D;  3W97 A;  3REL A;  3W99 B;  4HGA C;  1BH9 B;  1F1E A;  4WU9 B;  1AOI C;  5GT3 A;  3AV2 D;  3MVD D;  4R8P D;  4WZS B;  3UTA C;  4G91 C;  2Y2H A;  5B24 C;  3X1T D;  2FJ7 C;  5B32 C;  5AV8 D;  2JSS A;  5G49 A;  3MGQ D;  3P5J B;  4YS3 C;  3KUY B;  1M19 B;  3VH5 T;  5JA4 A;  4AWL B;  5B1M C;  2ARO D;  5AVB B;  3REI B;  3REK C;  3B6F A;  4E44 A;  1P3L A;  3NQJ B;  3WKJ D;  1EQZ D;  5FUG B;  5JRG A;  3MGS C;  3B0C T;  1TZY D;  2HIO D;  5E5A C;  5B33 D;  3WA9 D;  3VH6 T;  4ZUX C;  4WU8 A;  5B40 B;  3REJ A;  2PYO B;  4J8W D;  3O62 B;  4J8U C;  4X23 D;  4J8V B;  3MGR D;  5B1L C;  3MGP A;  1ZLA B;  1P3F B;  5B0Y A;  3A6N D;  3AV1 A;  3AZH B;  3A1I A;  3TU4 D;  3LJA C;  1JFI A;  5AV9 C;  2ZM5 A;  2F8N G;  4EO5 C;  3B6G B;  3W96 C;  1F66 B;  5KDM B;  4HGA B;  3REL D;  3W97 D;  1AOI B;  3W99 A;  1BH9 A;  4WU9 A;  3X1V C;  3LZ1 A;  1A7W A;  3UTA B;  2CV5 A;  4G91 B;  5GT3 D;  5B24 B;  2FJ7 B;  5B32 B;  5B31 A;  5AV5 A;  3AZN B;  4NE3 A;  4YS3 B;  5BNV B;  1ID3 C;  3X1U C;  3AFA A;  1KU5 A;  5B1M B;  1M19 A;  2Y2M A;  3AZF D;  4NE5 A;  3REK B;  1ULY A;  2BG1 A;  3REI A;  5CPJ C;  3B6F D;  1P3B D;  4ZBJ C;  3MGS B;  5FUG A;  3VH5 W;  5JRG D;  5E5A B;  4CSR B;  4KUD C;  1B67 A;  3NQU B;  5F99 B;  1P3M C;  4ZUX B;  3LZ0 C;  3REH C;  1P34 C;  4WU8 D;  5B40 A;  4J8U B;  2PYO A;  3B0C W;  3O62 A;  5B1L B;  4J8V A;  3KWQ A;  3AZI D;  1PZR A;  1P3G C;  3MGP D;  1ZLA A;  4NE6 A;  1P3F A;  3AZK C;  5DNM D;  1M18 C;  3LJA B;  5AV9 B;  4EO5 B;  3AV2 A;  3AV1 D;  3AZH A;  3B6G A;  3W96 B;  4R8P A;  4XUJ C;  3C1B C;  4DQY B;  5BS7 A;  3X1T A;  1S32 C;  3EPL A;  4J8X C;  1F66 A;  5AV8 A;  5KDM A;  5CP6 D;  3EG5 B;  3EPH A;  3W99 D;  2ZY3 A;  3X1V B;  1WWS A;  1AOI A;  3W98 C;  4WU9 D;  2UWX A;  3UTA A;  2FJ7 A;  5B24 A;  4G92 C;  4XZQ C;  5B32 A;  1ID3 B;  4YS3 A;  3X1U B;  1TAF B;  5AY8 C;  3UT9 C;  3AFA D;  3KUY D;  5B1M A;  1M19 D;  4H9O B;  5B33 A;  3WA9 A;  2Y2L A;  5CPJ B;  3REK A;  5AVB D;  3REI D;  4ZBJ B;  4DRA A;  5BT1 D;  3MGS A;  1P3I C;  4KUD B;  5E5A A;  4CSR A;  1P3M B;  3LZ0 B;  5DNN C;  3REH B;  1P34 B;  5B31 G;  4ZUX A;  4J8U A;  5B40 D;  3WAA C;  3X1S C;  2PYO D;  3O62 D;  5B1L A;  4J8V D;  2RVQ D;  1P3G B;  5C3I C;  2NQB C;  3AZK B;  1M18 B;  1ZLA D;  1P3F D;  1U35 C;  1KX4 C;  3LJA A;  5AV9 A;  4XUJ B;  3C1B B;  3AZH D;  1S32 B;  4Z5T C;  3B6G D;  4J8X B;  3B0D C;  1F66 D;  3AZN C;  5AV6 C;  3W98 B;  5GT0 C;  2IO5 C;  2Y2I A;  3X1V A;  1AOI D;  4G92 B;  4XZQ B;  1H3O B;  5GXQ C;  3AZF A;  3UTA D;  2FJ7 D;  5B24 D;  1W2E A;  5BO0 B;  5B32 D;  5B2I C;  1ID3 A;  3AZN D;  5AY8 B;  1P3B A;  4YS3 D;  3X1U A;  3UT9 B;  4WJ3 C;  1TAF A;  4JJN C;  4H9N B;  4WNN B;  1Z2C B;  5B1M D;  4H9O A;  1P3P C;  3REK D;  2HUE C;  5F99 C;  4UUZ B;  2Y2O A;  4H9R B;  1P3I B;  3MGS D;  4KUD A;  4QLC C;  1KX5 C;  5DNN B;  5CPI C;  3AZI A;  5E5A D;  1P3K C;  3C1C C;  3R45 B;  1P3M A;  3LZ0 A;  5F99 D;  3REH A;  5DNM A;  5B2J C;  4ZUX D;  2XD1 A;  3WAA B;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...