2HUEC

Structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Anti-silencing protein 1
publication title Structural basis for the histone chaperone activity of asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hueC00
4M6BA 5AV9A 5GT3C 5BO0B 5B32G 5AV8A 3LZ1C 4YS3D 3UT9A 5AVBD 5B0YA 3MVDA 4Z2MG 5B33D 5AV5D 3O62C 3KWQD 3X1VB 3W97D 5JRGA 4EO5B 4WZSB 3AZFD 1KX4C 1KX5A 2F8NB 3UTBC 1N1JB 3REIB 4J8VC 1P3GB 1EQZA 3MGRD 3AV1A 3AN2D 4NE6A 2JSSA 5F99B 4X23A 1U35B 4WV4B 5B31G 1P3KD 4R8PB 1Q9CA 2NQBC 2CV5A 1F66D 4WU9C 4CAYA 1P3BD 3VH6W 3AV2A 1P3ID 4H9QA 1P3MD 3LELB 3WTPE 3KXBA 4XZQB 3WTPD 5GXQC 4Z66A 3AFAB 5BNXB 2BYMA 3X1TA 5AVCC 4JJND 2AROD 3LJAA 3MGQD 5GT0D 5B40B 1M19C 3W96C 1M18A 3C1CC 3MGSA 5AV9D 2NZDA 3RELB 5AV8D 3REKA 3UT9D 3B6FC 5B0YD 3MVDD 3NQJA 5G49A 5JRGD 3AYWA 3VH6T 5GSUB 1KX5D 5B2JA 4ZUXC 3UTAC 1EQZD 5B24B 2F8NG 3AV1D 3MGPB 2HIOA 4X23D 3AZGA 1H3OA 1ZLAB 3MNNC 4J8XA 2CV5D 3AZEB 1B67A 4KUDC 3AZLC 3AV2D 2L5AA 1M1AC 3W99C 5B2IC 2F8NK 4WU8B 3KXBD 4J8WA 3WKJB 3KUYC 5AY8B 5CPKC 4Z5TA 4Z66D 1ULYA 3X1TD 3LZ0B 5DNNB 3X1UC 2HUEB 2PYOC 3LJAD 4XUJA 5CPIB 5DNMA 1M18D 1BH8A 3MGSD 3C1BC 5BNVA 4LD9A 3B6GA 2NZDD 5JA4A 3REKD 4YS3B 5AVBB 5B33B 5AV5B 1KX3C 3W97B 3KWQB 3AYWD 2BYKB 3AZFB 1TZYC 1P3LA 5B2JD 5B0ZC 3AZHA 5FUGA 3REHC 3MGRB 3X1SC 3B0DC 3AN2B 2HIOD 3AZGD 3B0CW 2FJ7C 4J8XD 4H9NB 2PYOA 1F66B 3VH6A 5CPJA 4QLCA 1P3BB 1P3IB 1P3FC 3R45A 5GT3A 1P3MB 3LZ1A 3O62A 3WTPB 4J8WD 5BT1D 4Z5TD 5CP6C 1KX4A 4H9RB 1JFIB 3UTBA 4JJNB 4J8VA 2AROB 3A6NC 1P3AC 3MGQB 3W98C 4J8UC 5GT0B 1ID3C 4XUJD 4CSRA 5DNMD 3V9RA 2RVQC 2NQBA 4LD9D 3B6GD 5B32C 5AV9B 4WU9A 1WWIA 3B0CT 5AV8B 3KSYA 3WA9C 1P3OC 3NQUA 4HGAB 3UT9B 5B0YB 3MVDB 5JRGB 5E5AC 1KX5B 1P3LD 5GXQA 3AZHD 4G92B 1EQZB 3AZNC 1AOIC 1P3PC 3AV1B 5B31C 5AV6C 5AVCA 4X23B 4H9PA 1P34C 1P3KC 2PYOD 2LY8A 2CV5B 1M19A 4CAYB 5CPJD 3W96A 4QLCD 3AZKC 1HQ3C 3WAAC 5BS7C 3C1CA 3AV2B 1BH9A 5GT3D 4H9QB 5B1MC 3REJC 3LZ1D 3KXBB 3B6FA 3O62D 5B1LC 4Z66B 3AZIC 1KX4D 3UTBD 2BYMB 3X1TB 2F8NH 4ZUXA 3UTAA 4J8VD 3TU4C 3AZMC 4AWLC 3LJAB 4DRAA 4KGCC 1M18B 5C3IB 3MNNA 3MGSB 3AZJC 2NQBD 2NZDB 4WU9D 2IO5B 4G91B 4KUDA 3REKB 3AZLA 3NQJB 1M1AA 5G49B 3W99A 5B2IA 3AYWB 3X1VC 4EO5C 5B2JB 3KUYA 5GXQD 5CHLB 5AVCD 3X1UA 2HIOB 3REIC 1A7WA 3AZGB 1TAFA 1H3OB 4YM6A 1P3GC 1U35C 5F99C 4J8XB 4WNNA 1M19D 3W96D 4R8PC 1S32A 3C1CD 3C1BA 3B6FD 1KX3A 3LELC 4J8WB 4Z5TB 4XZQC 1TZYA 4Z66C 4ZUXD 3AFAC 3UTAD 5B0ZA 3REHA 3X1SA 4ZBJB 4XUJB 5DNMB 1M18C 1BH8B 3MNND 5B40C 5BNVB 2FJ7A 4LD9B 3B6GB 3MGSC 4H9OA 5JA4B 4KUDD 2IO5C 3VH5W 3AZLD 1P3FA 3RELC 1M1AD 3W99D 5B2ID 1P3LB 3KUYD 5CPKD 5GSUC 5CP6A 3AZHB 5FUGB 3X1UD 5B24C 4YM6D 3MGPC 3A6NA 1P3AA 3W98A 4J8UA 2PYOB 1ID3A 1ZLAC 5CPJB 4QLCB 1S32D 3AZEC 3C1BD 3R45B 5B32A 5GT3B 5KDMA 3WA9A 3LZ1B 4Z2MH 1P3OA 4UUZA 1KX3D 3O62B 4WU8C 2YFWA 5E5AA 1KX4B 1TZYD 3WKJC 4KHAA 5AY8C 3UTBB 5B0ZD 4J8VB 3LZ0C 3X1SD 5DNNC 3REHD 3AZNA 1P3PA 1AOIA 5AV6A 2HUEC 2YFVA 4CSRB 3V9RB 1P34A 2FJ7D 2NQBB 5CPIC 4WU9B 1R4VA 3AZKA 1HQ3A 5BS7A 3WAAA 3NQUB 1P3FD 1WWSA 1BFMA 5B1MA 4YS3C 3REJA 5AVBC 5AV5C 5B33C 3W97C 3KWQC 5B1LA 3AZFC 5GXQB 5CP6D 3AZIA 5AVCB 3MGRC 4H9PB 3TU4A 3AN2C 3A6ND 4NE5A 3AZMA 1P3AD 3W98D 4J8UD 4KGCA 1M19B 1ID3D 3W96B 3C1CB 3AZJA 2RVQD 1F66C 1BH9B 5B32D 1P3BC 4NE3A 1P3IC 3WA9D 1P3OD 3B6FB 1P3MC 5BO0A 3X1VA 5E5AD 3WTPC 4ZUXB 3UTAB 2F8NA 3AZND 1AOID 4JJNC 1P3PD 1N1JA 5B31D 5AV6D 3REIA 1P3GA 2AROC 3MGQC 5GT0C 4H9SC 5F99A 3MNNB 1U35A 1P34D 3VH5A 3AZKD 4R8PA 4KUDB 1HQ3D 3AZLB 3WAAD 5AV9C 2CWEA 1M1AB 5AV8C 3W99B 5B2IB 4HGAC 5B1MD 3REJD 3UT9C 5B0YC 3MVDC 5JRGC 3LELA 5B1LD 3KUYB 5CPKB 1KX5C 4XZQA 3AZID 5CPKA 3X1UB 3AFAA 4G92C 1EQZC 1TAFB 5BNXA 4YM6B 3TU4D 3AV1C 3AZMD 4X23C 4KGCD 4E44A 4WNNB 1S32B 2CV5C 5B40A 3AZJD 3C1BB 3AV2C 3RELA 1B6WA 1KX3B 3KXBC 5CPID 3X1VD 1TZYB 4NFTA 5GSUA 5B0ZB 2F8ND 3REHB 3X1SB 3X1TC 3B0DB 3REID 1P3GD 5B24A 3LJAC 3MGPA 1U35D 5F99D 2FJ7B 1ZLAA 4H9OB 5C3IC 3B0BA 4R8PD 3AZEA 2NZDC 1P3FB 4G91C 3REKC 3AYWC 3LELD 4WU8A 5CP6B 4XZQD 5B2JC 3WKJA 5AY8A 1F1EA 3AFAD 4YM6C 3LZ0A 5DNNA 3A6NB 1HTAA 2HIOC 3AZGC 1P3AB 4J8UB 3W98B 1ID3B 4J8XC 5B40D 1S32C 5CPIA 5B32B 5KDMB 4E45A 3WA9B 1P3OB 4UUZB 3RELD 4YS3A 2YFWB 5AVBA 5AV5A 5B33A 5E5AB 3W97A 3VH5T 3KWQA 4J8WC 4KHAB 5BT1C 2BYKA 4Z5TC 3AZFA 5GSUD 3AZNB 1AOIB 1P3PB 5B31B 5AV6B 5B24D 2YFVB 5B31A 3MGRA 4ZBJC 3MGPD 3AN2A 1P34B 4XUJC 1P3KB 5DNMC 1ZLAD 3AZKB 1P3KA 1HQ3B 4H9NA 3WAAB 3B6GC 4LD9C 3AZED 1F66A 4DRBA 1P3BA 1P3IA 5B1MB 3REJB 1KU5A 1P3MA 4WU8D 5B1LB 1P3LC 3AZIB 3WTPA 3WKJD 5AY8D 3AZHC 4H9RA 1JFIA 3TU4B 3LZ0D 5DNND 4JJNA 3AZMB 4AWLB 4KGCB 2AROA 3MGQA 5GT0A 4H9SA 3AZJB 5CPJC 4QLCC
chains in the Genus database with same CATH superfamily
4M6BA 5AV9A 5GT3C 5BO0B 5B32G 5AV8A 3LZ1C 4YS3D 3UT9A 5AVBD 5B0YA 3MVDA 4Z2MG 5B33D 5AV5D 3O62C 3KWQD 3X1VB 3W97D 5JRGA 4EO5B 4WZSB 3AZFD 1KX4C 1KX5A 2F8NB 3UTBC 1N1JB 3REIB 4J8VC 1P3GB 1EQZA 3MGRD 3AV1A 3AN2D 4NE6A 2JSSA 5F99B 4X23A 1U35B 4WV4B 1Z2CB 5B31G 1P3KD 4R8PB 1Q9CA 2NQBC 2Y2OA 2CV5A 1F66D 4WU9C 4CAYA 2Y2JA 1P3BD 3VH6W 3AV2A 1P3ID 4H9QA 1P3MD 3LELB 3WTPE 3KXBA 4XZQB 3WTPD 5GXQC 4Z66A 3AFAB 4UPKA 5BNXB 2BYMA 3X1TA 5AVCC 4JJND 2AROD 3LJAA 3MGQD 5GT0D 2G5IC 5B40B 1M19C 3W96C 1M18A 3C1CC 3MGSA 5AV9D 2NZDA 3RELB 5AV8D 3REKA 3UT9D 3B6FC 5B0YD 3MVDD 3NQJA 5G49A 5JRGD 3AYWA 3VH6T 5GSUB 1KX5D 5B2JA 4ZUXC 3UTAC 4DQYB 1EQZD 5B24B 2F8NG 3AV1D 3MGPB 2HIOA 4X23D 3AZGA 1H3OA 1ZLAB 3MNNC 4J8XA 2CV5D 3AZEB 1B67A 4KUDC 3AZLC 3AV2D 2L5AA 1M1AC 3W99C 5B2IC 2F8NK 4WU8B 3KXBD 4J8WA 3WKJB 3KUYC 5AY8B 5CPKC 4Z5TA 4Z66D 1ULYA 3X1TD 3LZ0B 5DNNB 3X1UC 2HUEB 2PYOC 3LJAD 2ZY4A 4XUJA 5CPIB 5DNMA 1M18D 1BH8A 3MGSD 3C1BC 5BNVA 4LD9A 3B6GA 2NZDD 5JA4A 3REKD 4YS3B 5AVBB 1W2EA 1T3UA 5B33B 5AV5B 1KX3C 3KWQB 3W97B 3AYWD 2BYKB 3AZFB 1TZYC 2ZM5A 1P3LA 5B2JD 5B0ZC 3AZHA 5FUGA 3REHC 3MGRB 3X1SC 3B0DC 3AN2B 2HIOD 3AZGD 3B0CW 2BG1A 2FJ7C 4J8XD 4H9NB 2PYOA 1F66B 3VH6A 5CPJA 4QLCA 1P3BB 1P3IB 1P3FC 3R45A 5GT3A 1P3MB 2Y2KA 3LZ1A 3O62A 3WTPB 4J8WD 5BT1D 2FFFB 4Z5TD 5CP6C 1KX4A 4H9RB 1JFIB 3UTBA 4JJNB 4J8VA 2AROB 3A6NC 1P3AC 3MGQB 3W98C 4J8UC 5GT0B 1ID3C 4XUJD 4CSRA 5DNMD 3V9RA 2RVQC 2NQBA 4LD9D 3B6GD 5B32C 5AV9B 4WU9A 1WWIA 3B0CT 5AV8B 3KSYA 3WA9C 1P3OC 3NQUA 4HGAB 3UT9B 5B0YB 3MVDB 3A1IA 5JRGB 5E5AC 2VQRA 1KX5B 1P3LD 3EPKA 5GXQA 3AZHD 4G92B 1EQZB 3AZNC 1AOIC 1P3PC 3AV1B 5B31C 5AV6C 5AVCA 4X23B 4H9PA 1P34C 1P3KC 2PYOD 2LY8A 2CV5B 1M19A 4CAYB 5CPJD 3W96A 4QLCD 3AZKC 1HQ3C 5BS7C 3WAAC 3C1CA 3AV2B 1BH9A 5GT3D 4H9QB 5B1MC 3REJC 3LZ1D 3KXBB 3B6FA 3O62D 5B1LC 4Z66B 3AZIC 1KX4D 3UTBD 2BYMB 3X1TB 2F8NH 4ZUXA 3UTAA 4J8VD 3TU4C 3AZMC 4AWLC 3LJAB 4DRAA 4KGCC 1M18B 5C3IB 3MNNA 3MGSB 2Y2HA 2J8PA 3AZJC 2NQBD 2NZDB 4WU9D 2IO5B 2ZY3A 4G91B 4KUDA 3REKB 3AZLA 2Y2LA 3NQJB 1M1AA 5G49B 3W99A 5B2IA 3AYWB 3X1VC 4EO5C 5B2JB 3KUYA 5GXQD 2DF4C 5CHLB 5AVCD 3X1UA 2HIOB 3REIC 1A7WA 3AZGB 1TAFA 1H3OB 4YM6A 1P3GC 1U35C 5F99C 4J8XB 4WNNA 1M19D 2ZY5A 3W96D 4R8PC 1S32A 3C1CD 3C1BA 2UWXA 2XD5A 3B6FD 1KX3A 3LELC 4J8WB 4Z5TB 4XZQC 1TZYA 4Z66C 4ZUXD 3AFAC 3UTAD 5B0ZA 3REHA 3X1SA 4ZBJB 4XUJB 5DNMB 1M18C 1BH8B 3MNND 5B40C 5BNVB 2FJ7A 4LD9B 3B6GB 3MGSC 3KFUG 4H9OA 5JA4B 2JCHA 3A1KA 4KUDD 2IO5C 3VH5W 3AZLD 1P3FA 3RELC 1M1AD 3W99D 5B2ID 1P3LB 3KUYD 5CPKD 5GSUC 5CP6A 3AZHB 5FUGB 3X1UD 5B24C 4YM6D 3AL0C 3MGPC 3A6NA 1P3AA 3W98A 4J8UA 2PYOB 1ID3A 1ZLAC 5CPJB 4QLCB 1S32D 3AZEC 3C1BD 3R45B 5B32A 5GT3B 5KDMA 3WA9A 2ZY2A 3LZ1B 4Z2MH 1P3OA 4WJ3C 4UUZA 1KX3D 3O62B 4WU8C 2YFWA 5E5AA 1KX4B 1TZYD 3WKJC 4KHAA 5AY8C 3UTBB 5B0ZD 4J8VB 3LZ0C 3X1SD 5DNNC 3REHD 3AZNA 1P3PA 1AOIA 5AV6A 2JE5A 2HUEC 2YFVA 4CSRB 2W8SA 3V9RB 1P34A 2FJ7D 2NQBB 5CPIC 4WU9B 1R4VA 3AZKA 1HQ3A 2G5HC 5BS7A 2XD1A 3WAAA 3NQUB 1P3FD 1WWSA 1BFMA 5B1MA 4YS3C 3REJA 5AVBC 5AV5C 5B33C 3W97C 3KWQC 5B1LA 3AZFC 5GXQB 5CP6D 3AZIA 5AVCB 2F2AC 3EPLA 3MGRC 2Y2NA 4H9PB 3TU4A 3AN2C 3A6ND 4NE5A 3AZMA 1P3AD 3W98D 4J8UD 4KGCA 1M19B 1ID3D 3W96B 3C1CB 3AZJA 2RVQD 1F66C 1BH9B 5B32D 1P3BC 4NE3A 1P3IC 3WA9D 3H0RC 1P3OD 3B6FB 1P3MC 5BO0A 3X1VA 5E5AD 3WTPC 4ZUXB 3UTAB 2DQNC 2F8NA 3AZND 1AOID 4JJNC 1P3PD 1N1JA 5B31D 5AV6D 3REIA 1P3GA 2AROC 3MGQC 5GT0C 4H9SC 5F99A 3MNNB 1U35A 1P34D 3VH5A 3AZKD 4R8PA 4KUDB 1HQ3D 3AZLB 3WAAD 5AV9C 1PZRA 2CWEA 1M1AB 5AV8C 3W99B 5B2IB 2RIQA 4HGAC 5B1MD 3REJD 3UT9C 5B0YC 3MVDC 5JRGC 3LELA 5B1LD 3KUYB 5CPKB 1KX5C 4XZQA 3AZID 5CPKA 3X1UB 3AFAA 4G92C 1EQZC 1TAFB 5BNXA 4YM6B 3TU4D 3AV1C 3FDDA 3AZMD 4X23C 4KGCD 4E44A 4WNNB 1S32B 2CV5C 5B40A 3AZJD 3C1BB 3EPHA 3AV2C 3RELA 1B6WA 1KX3B 3KXBC 5CPID 3X1VD 1TZYB 3H0LC 4NFTA 5GSUA 5B0ZB 2F8ND 3REHB 3X1SB 3X1TC 3B0DB 3EG5B 3REID 1P3GD 5B24A 3LJAC 3MGPA 3F6TA 1U35D 5F99D 2FJ7B 1ZLAA 4H9OB 5C3IC 3B0BA 4R8PD 3AZEA 2NZDC 3EPJA 1P3FB 2Y2GA 4G91C 3REKC 3AYWC 3LELD 4WU8A 5CP6B 4XZQD 5B2JC 3WKJA 5AY8A 1F1EA 3AFAD 4YM6C 2Y2IA 5DNNA 3LZ0A 1HTAA 2HIOC 3A6NB 3AZGC 4J8UB 1P3AB 3W98B 1ID3B 4J8XC 5B40D 1S32C 5CPIA 5B32B 3IP4C 5KDMB 4E45A 3WA9B 1P3OB 4UUZB 3RELD 4YS3A 2YFWB 5AVBA 2Y2QA 5AV5A 5B33A 5E5AB 3W97A 3VH5T 3KWQA 4J8WC 4KHAB 5BT1C 2BYKA 4Z5TC 3AZFA 5GSUD 3AZNB 1AOIB 1P3PB 5B31B 5AV6B 5B24D 2YFVB 5B31A 3MGRA 4ZBJC 3MGPD 3AN2A 1P34B 4XUJC 1P3KB 5DNMC 1ZLAD 3AZKB 1P3KA 1HQ3B 4H9NA 3WAAB 3B6GC 4LD9C 3AZED 1F66A 4DRBA 2Y2MA 1P3BA 1P3IA 5B1MB 3REJB 1KU5A 1P3MA 4WU8D 5B1LB 3H0MC 1P3LC 3AZIB 3WTPA 3WKJD 5AY8D 3AZHC 4H9RA 1JFIA 3TU4B 3P5JB 3LZ0D 5DNND 2Y2PA 4JJNA 4AWLB 3AZMB 4KGCB 2AROA 3MGQA 5GT0A 4H9SA 3AZJB 5CPJC 4QLCC
chains in the Genus database with same CATH topology
4M6BA 5AV9A 5GT3C 5BO0B 5B32G 5AV8A 3LZ1C 4YS3D 3UT9A 5AVBD 5B0YA 3MVDA 4Z2MG 5B33D 5AV5D 3O62C 3KWQD 3X1VB 3W97D 5JRGA 4EO5B 4WZSB 3AZFD 1KX4C 1KX5A 2F8NB 3UTBC 1N1JB 3REIB 4J8VC 1P3GB 1EQZA 3MGRD 3AV1A 3AN2D 4NE6A 2JSSA 5F99B 4X23A 1U35B 4WV4B 1Z2CB 5B31G 1P3KD 4R8PB 1Q9CA 2NQBC 2Y2OA 2CV5A 1F66D 4WU9C 4CAYA 2Y2JA 1P3BD 3VH6W 3AV2A 1P3ID 4H9QA 1P3MD 3LELB 3WTPE 3KXBA 4XZQB 3WTPD 5GXQC 4Z66A 3AFAB 4UPKA 5BNXB 2BYMA 3X1TA 5AVCC 4JJND 2AROD 3LJAA 3MGQD 5GT0D 2G5IC 5B40B 1M19C 3W96C 1M18A 3C1CC 3MGSA 5AV9D 2NZDA 3RELB 5AV8D 3REKA 3UT9D 3B6FC 5B0YD 3MVDD 3NQJA 5G49A 5JRGD 3AYWA 3VH6T 5GSUB 1KX5D 5B2JA 4ZUXC 3UTAC 4DQYB 1EQZD 5B24B 2F8NG 3AV1D 3MGPB 2HIOA 4X23D 3AZGA 1H3OA 1ZLAB 3MNNC 4J8XA 2CV5D 3AZEB 1B67A 4KUDC 3AZLC 3AV2D 2L5AA 1M1AC 3W99C 5B2IC 2F8NK 4WU8B 3KXBD 4J8WA 3WKJB 3KUYC 5AY8B 5CPKC 4Z5TA 4Z66D 1ULYA 3X1TD 3LZ0B 5DNNB 3X1UC 2HUEB 2PYOC 3LJAD 2ZY4A 4XUJA 5CPIB 5DNMA 1M18D 1BH8A 3MGSD 3C1BC 5BNVA 4LD9A 3B6GA 2NZDD 5JA4A 3REKD 4YS3B 5AVBB 1W2EA 1T3UA 5B33B 5AV5B 1KX3C 3KWQB 3W97B 3AYWD 2BYKB 3AZFB 1TZYC 2ZM5A 1P3LA 5B2JD 5B0ZC 3AZHA 5FUGA 3REHC 3MGRB 3X1SC 3B0DC 3AN2B 2HIOD 3AZGD 3B0CW 2BG1A 2FJ7C 4J8XD 4H9NB 2PYOA 1F66B 3VH6A 5CPJA 4QLCA 1P3BB 1P3IB 1P3FC 3R45A 5GT3A 1P3MB 2Y2KA 3LZ1A 3O62A 3WTPB 4J8WD 5BT1D 2FFFB 4Z5TD 5CP6C 1KX4A 4H9RB 1JFIB 3UTBA 4JJNB 4J8VA 2AROB 3A6NC 1P3AC 3MGQB 3W98C 4J8UC 5GT0B 1ID3C 4XUJD 4CSRA 5DNMD 3V9RA 2RVQC 2NQBA 4LD9D 3B6GD 5B32C 5AV9B 4WU9A 1WWIA 3B0CT 5AV8B 3KSYA 3WA9C 1P3OC 3NQUA 4HGAB 3UT9B 5B0YB 3MVDB 3A1IA 5JRGB 5E5AC 2VQRA 1KX5B 1P3LD 3EPKA 5GXQA 3AZHD 4G92B 1EQZB 3AZNC 1AOIC 1P3PC 3AV1B 5B31C 5AV6C 5AVCA 4X23B 4H9PA 1P34C 1P3KC 2PYOD 2LY8A 2CV5B 1M19A 4CAYB 5CPJD 3W96A 4QLCD 3AZKC 1HQ3C 5BS7C 3WAAC 3C1CA 3AV2B 1BH9A 5GT3D 4H9QB 5B1MC 3REJC 3LZ1D 3KXBB 3B6FA 3O62D 5B1LC 4Z66B 3AZIC 1KX4D 3UTBD 2BYMB 3X1TB 2F8NH 4ZUXA 3UTAA 4J8VD 3TU4C 3AZMC 4AWLC 3LJAB 4DRAA 4KGCC 1M18B 5C3IB 3MNNA 3MGSB 2Y2HA 2J8PA 3AZJC 2NQBD 2NZDB 4WU9D 2IO5B 2ZY3A 4G91B 4KUDA 3REKB 3AZLA 2Y2LA 3NQJB 1M1AA 5G49B 3W99A 5B2IA 3AYWB 3X1VC 4EO5C 5B2JB 3KUYA 5GXQD 2DF4C 5CHLB 5AVCD 3X1UA 2HIOB 3REIC 1A7WA 3AZGB 1TAFA 1H3OB 4YM6A 1P3GC 1U35C 5F99C 4J8XB 4WNNA 1M19D 2ZY5A 3W96D 4R8PC 1S32A 3C1CD 3C1BA 2UWXA 2XD5A 3B6FD 1KX3A 3LELC 4J8WB 4Z5TB 4XZQC 1TZYA 4Z66C 4ZUXD 3AFAC 3UTAD 5B0ZA 3REHA 3X1SA 4ZBJB 4XUJB 5DNMB 1M18C 1BH8B 3MNND 5B40C 5BNVB 2FJ7A 4LD9B 3B6GB 3MGSC 3KFUG 4H9OA 5JA4B 2JCHA 3A1KA 4KUDD 2IO5C 3VH5W 3AZLD 1P3FA 3RELC 1M1AD 3W99D 5B2ID 1P3LB 3KUYD 5CPKD 5GSUC 5CP6A 3AZHB 5FUGB 3X1UD 5B24C 4YM6D 3AL0C 3MGPC 3A6NA 1P3AA 3W98A 4J8UA 2PYOB 1ID3A 1ZLAC 5CPJB 4QLCB 1S32D 3AZEC 3C1BD 3R45B 5B32A 5GT3B 5KDMA 3WA9A 2ZY2A 3LZ1B 4Z2MH 1P3OA 4WJ3C 4UUZA 1KX3D 3O62B 4WU8C 2YFWA 5E5AA 1KX4B 1TZYD 3WKJC 4KHAA 5AY8C 3UTBB 5B0ZD 4J8VB 3LZ0C 3X1SD 5DNNC 3REHD 3AZNA 1P3PA 1AOIA 5AV6A 2JE5A 2HUEC 2YFVA 4CSRB 2W8SA 3V9RB 1P34A 2FJ7D 2NQBB 5CPIC 4WU9B 1R4VA 3AZKA 1HQ3A 2G5HC 5BS7A 2XD1A 3WAAA 3NQUB 1P3FD 1WWSA 1BFMA 5B1MA 4YS3C 3REJA 5AVBC 5AV5C 5B33C 3W97C 3KWQC 5B1LA 3AZFC 5GXQB 5CP6D 3AZIA 5AVCB 2F2AC 3EPLA 3MGRC 2Y2NA 4H9PB 3TU4A 3AN2C 3A6ND 4NE5A 3AZMA 1P3AD 3W98D 4J8UD 4KGCA 1M19B 1ID3D 3W96B 3C1CB 3AZJA 2RVQD 1F66C 1BH9B 5B32D 1P3BC 4NE3A 1P3IC 3WA9D 3H0RC 1P3OD 3B6FB 1P3MC 5BO0A 3X1VA 5E5AD 3WTPC 4ZUXB 3UTAB 2DQNC 2F8NA 3AZND 1AOID 4JJNC 1P3PD 1N1JA 5B31D 5AV6D 3REIA 1P3GA 2AROC 3MGQC 5GT0C 4H9SC 5F99A 3MNNB 1U35A 1P34D 3VH5A 3AZKD 4R8PA 4KUDB 1HQ3D 3AZLB 3WAAD 5AV9C 1PZRA 2CWEA 1M1AB 5AV8C 3W99B 5B2IB 2RIQA 4HGAC 5B1MD 3REJD 3UT9C 5B0YC 3MVDC 5JRGC 3LELA 5B1LD 3KUYB 5CPKB 1KX5C 4XZQA 3AZID 5CPKA 3X1UB 3AFAA 4G92C 1EQZC 1TAFB 5BNXA 4YM6B 3TU4D 3AV1C 3FDDA 3AZMD 4X23C 4KGCD 4E44A 4WNNB 1S32B 2CV5C 5B40A 3AZJD 3C1BB 3EPHA 3AV2C 3RELA 1B6WA 1KX3B 3KXBC 5CPID 3X1VD 1TZYB 3H0LC 4NFTA 5GSUA 5B0ZB 2F8ND 3REHB 3X1SB 3X1TC 3B0DB 3EG5B 3REID 1P3GD 5B24A 3LJAC 3MGPA 3F6TA 1U35D 5F99D 2FJ7B 1ZLAA 4H9OB 5C3IC 3B0BA 4R8PD 3AZEA 2NZDC 3EPJA 1P3FB 2Y2GA 4G91C 3REKC 3AYWC 3LELD 4WU8A 5CP6B 4XZQD 5B2JC 3WKJA 5AY8A 1F1EA 3AFAD 4YM6C 2Y2IA 5DNNA 3LZ0A 1HTAA 2HIOC 3A6NB 3AZGC 4J8UB 1P3AB 3W98B 1ID3B 4J8XC 5B40D 1S32C 5CPIA 5B32B 3IP4C 5KDMB 4E45A 3WA9B 1P3OB 4UUZB 3RELD 4YS3A 2YFWB 5AVBA 2Y2QA 5AV5A 5B33A 5E5AB 3W97A 3VH5T 3KWQA 4J8WC 4KHAB 5BT1C 2BYKA 4Z5TC 3AZFA 5GSUD 3AZNB 1AOIB 1P3PB 5B31B 5AV6B 5B24D 2YFVB 5B31A 3MGRA 4ZBJC 3MGPD 3AN2A 1P34B 4XUJC 1P3KB 5DNMC 1ZLAD 3AZKB 1P3KA 1HQ3B 4H9NA 3WAAB 3B6GC 4LD9C 3AZED 1F66A 4DRBA 2Y2MA 1P3BA 1P3IA 5B1MB 3REJB 1KU5A 1P3MA 4WU8D 5B1LB 3H0MC 1P3LC 3AZIB 3WTPA 3WKJD 5AY8D 3AZHC 4H9RA 1JFIA 3TU4B 3P5JB 3LZ0D 5DNND 2Y2PA 4JJNA 4AWLB 3AZMB 4KGCB 2AROA 3MGQA 5GT0A 4H9SA 3AZJB 5CPJC 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  5AV9 A;  5GT3 C;  5BO0 B;  5B32 G;  5AV8 A;  3LZ1 C;  4YS3 D;  3UT9 A;  5AVB D;  5B0Y A;  3MVD A;  4Z2M G;  5B33 D;  5AV5 D;  3O62 C;  3KWQ D;  3X1V B;  3W97 D;  5JRG A;  4EO5 B;  4WZS B;  3AZF D;  1KX4 C;  1KX5 A;  2F8N B;  3UTB C;  1N1J B;  3REI B;  4J8V C;  1P3G B;  1EQZ A;  3MGR D;  3AV1 A;  3AN2 D;  4NE6 A;  2JSS A;  5F99 B;  4X23 A;  1U35 B;  4WV4 B;  5B31 G;  1P3K D;  4R8P B;  1Q9C A;  2NQB C;  2CV5 A;  1F66 D;  4WU9 C;  4CAY A;  1P3B D;  3VH6 W;  3AV2 A;  1P3I D;  4H9Q A;  1P3M D;  3LEL B;  3WTP E;  3KXB A;  4XZQ B;  3WTP D;  5GXQ C;  4Z66 A;  3AFA B;  5BNX B;  2BYM A;  3X1T A;  5AVC C;  4JJN D;  2ARO D;  3LJA A;  3MGQ D;  5GT0 D;  5B40 B;  1M19 C;  3W96 C;  1M18 A;  3C1C C;  3MGS A;  5AV9 D;  2NZD A;  3REL B;  5AV8 D;  3REK A;  3UT9 D;  3B6F C;  5B0Y D;  3MVD D;  3NQJ A;  5G49 A;  5JRG D;  3AYW A;  3VH6 T;  5GSU B;  1KX5 D;  5B2J A;  4ZUX C;  3UTA C;  1EQZ D;  5B24 B;  2F8N G;  3AV1 D;  3MGP B;  2HIO A;  4X23 D;  3AZG A;  1H3O A;  1ZLA B;  3MNN C;  4J8X A;  2CV5 D;  3AZE B;  1B67 A;  4KUD C;  3AZL C;  3AV2 D;  2L5A A;  1M1A C;  3W99 C;  5B2I C;  2F8N K;  4WU8 B;  3KXB D;  4J8W A;  3WKJ B;  3KUY C;  5AY8 B;  5CPK C;  4Z5T A;  4Z66 D;  1ULY A;  3X1T D;  3LZ0 B;  5DNN B;  3X1U C;  2HUE B;  2PYO C;  3LJA D;  4XUJ A;  5CPI B;  5DNM A;  1M18 D;  1BH8 A;  3MGS D;  3C1B C;  5BNV A;  4LD9 A;  3B6G A;  2NZD D;  5JA4 A;  3REK D;  4YS3 B;  5AVB B;  5B33 B;  5AV5 B;  1KX3 C;  3W97 B;  3KWQ B;  3AYW D;  2BYK B;  3AZF B;  1TZY C;  1P3L A;  5B2J D;  5B0Z C;  3AZH A;  5FUG A;  3REH C;  3MGR B;  3X1S C;  3B0D C;  3AN2 B;  2HIO D;  3AZG D;  3B0C W;  2FJ7 C;  4J8X D;  4H9N B;  2PYO A;  1F66 B;  3VH6 A;  5CPJ A;  4QLC A;  1P3B B;  1P3I B;  1P3F C;  3R45 A;  5GT3 A;  1P3M B;  3LZ1 A;  3O62 A;  3WTP B;  4J8W D;  5BT1 D;  4Z5T D;  5CP6 C;  1KX4 A;  4H9R B;  1JFI B;  3UTB A;  4JJN B;  4J8V A;  2ARO B;  3A6N C;  1P3A C;  3MGQ B;  3W98 C;  4J8U C;  5GT0 B;  1ID3 C;  4XUJ D;  4CSR A;  5DNM D;  3V9R A;  2RVQ C;  2NQB A;  4LD9 D;  3B6G D;  5B32 C;  5AV9 B;  4WU9 A;  1WWI A;  3B0C T;  5AV8 B;  3KSY A;  3WA9 C;  1P3O C;  3NQU A;  4HGA B;  3UT9 B;  5B0Y B;  3MVD B;  5JRG B;  5E5A C;  1KX5 B;  1P3L D;  5GXQ A;  3AZH D;  4G92 B;  1EQZ B;  3AZN C;  1AOI C;  1P3P C;  3AV1 B;  5B31 C;  5AV6 C;  5AVC A;  4X23 B;  4H9P A;  1P34 C;  1P3K C;  2PYO D;  2LY8 A;  2CV5 B;  1M19 A;  4CAY B;  5CPJ D;  3W96 A;  4QLC D;  3AZK C;  1HQ3 C;  3WAA C;  5BS7 C;  3C1C A;  3AV2 B;  1BH9 A;  5GT3 D;  4H9Q B;  5B1M C;  3REJ C;  3LZ1 D;  3KXB B;  3B6F A;  3O62 D;  5B1L C;  4Z66 B;  3AZI C;  1KX4 D;  3UTB D;  2BYM B;  3X1T B;  2F8N H;  4ZUX A;  3UTA A;  4J8V D;  3TU4 C;  3AZM C;  4AWL C;  3LJA B;  4DRA A;  4KGC C;  1M18 B;  5C3I B;  3MNN A;  3MGS B;  3AZJ C;  2NQB D;  2NZD B;  4WU9 D;  2IO5 B;  4G91 B;  4KUD A;  3REK B;  3AZL A;  3NQJ B;  1M1A A;  5G49 B;  3W99 A;  5B2I A;  3AYW B;  3X1V C;  4EO5 C;  5B2J B;  3KUY A;  5GXQ D;  5CHL B;  5AVC D;  3X1U A;  2HIO B;  3REI C;  1A7W A;  3AZG B;  1TAF A;  1H3O B;  4YM6 A;  1P3G C;  1U35 C;  5F99 C;  4J8X B;  4WNN A;  1M19 D;  3W96 D;  4R8P C;  1S32 A;  3C1C D;  3C1B A;  3B6F D;  1KX3 A;  3LEL C;  4J8W B;  4Z5T B;  4XZQ C;  1TZY A;  4Z66 C;  4ZUX D;  3AFA C;  3UTA D;  5B0Z A;  3REH A;  3X1S A;  4ZBJ B;  4XUJ B;  5DNM B;  1M18 C;  1BH8 B;  3MNN D;  5B40 C;  5BNV B;  2FJ7 A;  4LD9 B;  3B6G B;  3MGS C;  4H9O A;  5JA4 B;  4KUD D;  2IO5 C;  3VH5 W;  3AZL D;  1P3F A;  3REL C;  1M1A D;  3W99 D;  5B2I D;  1P3L B;  3KUY D;  5CPK D;  5GSU C;  5CP6 A;  3AZH B;  5FUG B;  3X1U D;  5B24 C;  4YM6 D;  3MGP C;  3A6N A;  1P3A A;  3W98 A;  4J8U A;  2PYO B;  1ID3 A;  1ZLA C;  5CPJ B;  4QLC B;  1S32 D;  3AZE C;  3C1B D;  3R45 B;  5B32 A;  5GT3 B;  5KDM A;  3WA9 A;  3LZ1 B;  4Z2M H;  1P3O A;  4UUZ A;  1KX3 D;  3O62 B;  4WU8 C;  2YFW A;  5E5A A;  1KX4 B;  1TZY D;  3WKJ C;  4KHA A;  5AY8 C;  3UTB B;  5B0Z D;  4J8V B;  3LZ0 C;  3X1S D;  5DNN C;  3REH D;  3AZN A;  1P3P A;  1AOI A;  5AV6 A;  2HUE C;  2YFV A;  4CSR B;  3V9R B;  1P34 A;  2FJ7 D;  2NQB B;  5CPI C;  4WU9 B;  1R4V A;  3AZK A;  1HQ3 A;  5BS7 A;  3WAA A;  3NQU B;  1P3F D;  1WWS A;  1BFM A;  5B1M A;  4YS3 C;  3REJ A;  5AVB C;  5AV5 C;  5B33 C;  3W97 C;  3KWQ C;  5B1L A;  3AZF C;  5GXQ B;  5CP6 D;  3AZI A;  5AVC B;  3MGR C;  4H9P B;  3TU4 A;  3AN2 C;  3A6N D;  4NE5 A;  3AZM A;  1P3A D;  3W98 D;  4J8U D;  4KGC A;  1M19 B;  1ID3 D;  3W96 B;  3C1C B;  3AZJ A;  2RVQ D;  1F66 C;  1BH9 B;  5B32 D;  1P3B C;  4NE3 A;  1P3I C;  3WA9 D;  1P3O D;  3B6F B;  1P3M C;  5BO0 A;  3X1V A;  5E5A D;  3WTP C;  4ZUX B;  3UTA B;  2F8N A;  3AZN D;  1AOI D;  4JJN C;  1P3P D;  1N1J A;  5B31 D;  5AV6 D;  3REI A;  1P3G A;  2ARO C;  3MGQ C;  5GT0 C;  4H9S C;  5F99 A;  3MNN B;  1U35 A;  1P34 D;  3VH5 A;  3AZK D;  4R8P A;  4KUD B;  1HQ3 D;  3AZL B;  3WAA D;  5AV9 C;  2CWE A;  1M1A B;  5AV8 C;  3W99 B;  5B2I B;  4HGA C;  5B1M D;  3REJ D;  3UT9 C;  5B0Y C;  3MVD C;  5JRG C;  3LEL A;  5B1L D;  3KUY B;  5CPK B;  1KX5 C;  4XZQ A;  3AZI D;  5CPK A;  3X1U B;  3AFA A;  4G92 C;  1EQZ C;  1TAF B;  5BNX A;  4YM6 B;  3TU4 D;  3AV1 C;  3AZM D;  4X23 C;  4KGC D;  4E44 A;  4WNN B;  1S32 B;  2CV5 C;  5B40 A;  3AZJ D;  3C1B B;  3AV2 C;  3REL A;  1B6W A;  1KX3 B;  3KXB C;  5CPI D;  3X1V D;  1TZY B;  4NFT A;  5GSU A;  5B0Z B;  2F8N D;  3REH B;  3X1S B;  3X1T C;  3B0D B;  3REI D;  1P3G D;  5B24 A;  3LJA C;  3MGP A;  1U35 D;  5F99 D;  2FJ7 B;  1ZLA A;  4H9O B;  5C3I C;  3B0B A;  4R8P D;  3AZE A;  2NZD C;  1P3F B;  4G91 C;  3REK C;  3AYW C;  3LEL D;  4WU8 A;  5CP6 B;  4XZQ D;  5B2J C;  3WKJ A;  5AY8 A;  1F1E A;  3AFA D;  4YM6 C;  3LZ0 A;  5DNN A;  3A6N B;  1HTA A;  2HIO C;  3AZG C;  1P3A B;  4J8U B;  3W98 B;  1ID3 B;  4J8X C;  5B40 D;  1S32 C;  5CPI A;  5B32 B;  5KDM B;  4E45 A;  3WA9 B;  1P3O B;  4UUZ B;  3REL D;  4YS3 A;  2YFW B;  5AVB A;  5AV5 A;  5B33 A;  5E5A B;  3W97 A;  3VH5 T;  3KWQ A;  4J8W C;  4KHA B;  5BT1 C;  2BYK A;  4Z5T C;  3AZF A;  5GSU D;  3AZN B;  1AOI B;  1P3P B;  5B31 B;  5AV6 B;  5B24 D;  2YFV B;  5B31 A;  3MGR A;  4ZBJ C;  3MGP D;  3AN2 A;  1P34 B;  4XUJ C;  1P3K B;  5DNM C;  1ZLA D;  3AZK B;  1P3K A;  1HQ3 B;  4H9N A;  3WAA B;  3B6G C;  4LD9 C;  3AZE D;  1F66 A;  4DRB A;  1P3B A;  1P3I A;  5B1M B;  3REJ B;  1KU5 A;  1P3M A;  4WU8 D;  5B1L B;  1P3L C;  3AZI B;  3WTP A;  3WKJ D;  5AY8 D;  3AZH C;  4H9R A;  1JFI A;  3TU4 B;  3LZ0 D;  5DNN D;  4JJN A;  3AZM B;  4AWL B;  4KGC B;  2ARO A;  3MGQ A;  5GT0 A;  4H9S A;  3AZJ B;  5CPJ C;  4QLC C; 
#chains in the Genus database with same CATH topology
 4M6B A;  5AV9 A;  5GT3 C;  5BO0 B;  5B32 G;  5AV8 A;  3LZ1 C;  4YS3 D;  3UT9 A;  5AVB D;  5B0Y A;  3MVD A;  4Z2M G;  5B33 D;  5AV5 D;  3O62 C;  3KWQ D;  3X1V B;  3W97 D;  5JRG A;  4EO5 B;  4WZS B;  3AZF D;  1KX4 C;  1KX5 A;  2F8N B;  3UTB C;  1N1J B;  3REI B;  4J8V C;  1P3G B;  1EQZ A;  3MGR D;  3AV1 A;  3AN2 D;  4NE6 A;  2JSS A;  5F99 B;  4X23 A;  1U35 B;  4WV4 B;  1Z2C B;  5B31 G;  1P3K D;  4R8P B;  1Q9C A;  2NQB C;  2Y2O A;  2CV5 A;  1F66 D;  4WU9 C;  4CAY A;  2Y2J A;  1P3B D;  3VH6 W;  3AV2 A;  1P3I D;  4H9Q A;  1P3M D;  3LEL B;  3WTP E;  3KXB A;  4XZQ B;  3WTP D;  5GXQ C;  4Z66 A;  3AFA B;  4UPK A;  5BNX B;  2BYM A;  3X1T A;  5AVC C;  4JJN D;  2ARO D;  3LJA A;  3MGQ D;  5GT0 D;  2G5I C;  5B40 B;  1M19 C;  3W96 C;  1M18 A;  3C1C C;  3MGS A;  5AV9 D;  2NZD A;  3REL B;  5AV8 D;  3REK A;  3UT9 D;  3B6F C;  5B0Y D;  3MVD D;  3NQJ A;  5G49 A;  5JRG D;  3AYW A;  3VH6 T;  5GSU B;  1KX5 D;  5B2J A;  4ZUX C;  3UTA C;  4DQY B;  1EQZ D;  5B24 B;  2F8N G;  3AV1 D;  3MGP B;  2HIO A;  4X23 D;  3AZG A;  1H3O A;  1ZLA B;  3MNN C;  4J8X A;  2CV5 D;  3AZE B;  1B67 A;  4KUD C;  3AZL C;  3AV2 D;  2L5A A;  1M1A C;  3W99 C;  5B2I C;  2F8N K;  4WU8 B;  3KXB D;  4J8W A;  3WKJ B;  3KUY C;  5AY8 B;  5CPK C;  4Z5T A;  4Z66 D;  1ULY A;  3X1T D;  3LZ0 B;  5DNN B;  3X1U C;  2HUE B;  2PYO C;  3LJA D;  2ZY4 A;  4XUJ A;  5CPI B;  5DNM A;  1M18 D;  1BH8 A;  3MGS D;  3C1B C;  5BNV A;  4LD9 A;  3B6G A;  2NZD D;  5JA4 A;  3REK D;  4YS3 B;  5AVB B;  1W2E A;  1T3U A;  5B33 B;  5AV5 B;  1KX3 C;  3KWQ B;  3W97 B;  3AYW D;  2BYK B;  3AZF B;  1TZY C;  2ZM5 A;  1P3L A;  5B2J D;  5B0Z C;  3AZH A;  5FUG A;  3REH C;  3MGR B;  3X1S C;  3B0D C;  3AN2 B;  2HIO D;  3AZG D;  3B0C W;  2BG1 A;  2FJ7 C;  4J8X D;  4H9N B;  2PYO A;  1F66 B;  3VH6 A;  5CPJ A;  4QLC A;  1P3B B;  1P3I B;  1P3F C;  3R45 A;  5GT3 A;  1P3M B;  2Y2K A;  3LZ1 A;  3O62 A;  3WTP B;  4J8W D;  5BT1 D;  2FFF B;  4Z5T D;  5CP6 C;  1KX4 A;  4H9R B;  1JFI B;  3UTB A;  4JJN B;  4J8V A;  2ARO B;  3A6N C;  1P3A C;  3MGQ B;  3W98 C;  4J8U C;  5GT0 B;  1ID3 C;  4XUJ D;  4CSR A;  5DNM D;  3V9R A;  2RVQ C;  2NQB A;  4LD9 D;  3B6G D;  5B32 C;  5AV9 B;  4WU9 A;  1WWI A;  3B0C T;  5AV8 B;  3KSY A;  3WA9 C;  1P3O C;  3NQU A;  4HGA B;  3UT9 B;  5B0Y B;  3MVD B;  3A1I A;  5JRG B;  5E5A C;  2VQR A;  1KX5 B;  1P3L D;  3EPK A;  5GXQ A;  3AZH D;  4G92 B;  1EQZ B;  3AZN C;  1AOI C;  1P3P C;  3AV1 B;  5B31 C;  5AV6 C;  5AVC A;  4X23 B;  4H9P A;  1P34 C;  1P3K C;  2PYO D;  2LY8 A;  2CV5 B;  1M19 A;  4CAY B;  5CPJ D;  3W96 A;  4QLC D;  3AZK C;  1HQ3 C;  5BS7 C;  3WAA C;  3C1C A;  3AV2 B;  1BH9 A;  5GT3 D;  4H9Q B;  5B1M C;  3REJ C;  3LZ1 D;  3KXB B;  3B6F A;  3O62 D;  5B1L C;  4Z66 B;  3AZI C;  1KX4 D;  3UTB D;  2BYM B;  3X1T B;  2F8N H;  4ZUX A;  3UTA A;  4J8V D;  3TU4 C;  3AZM C;  4AWL C;  3LJA B;  4DRA A;  4KGC C;  1M18 B;  5C3I B;  3MNN A;  3MGS B;  2Y2H A;  2J8P A;  3AZJ C;  2NQB D;  2NZD B;  4WU9 D;  2IO5 B;  2ZY3 A;  4G91 B;  4KUD A;  3REK B;  3AZL A;  2Y2L A;  3NQJ B;  1M1A A;  5G49 B;  3W99 A;  5B2I A;  3AYW B;  3X1V C;  4EO5 C;  5B2J B;  3KUY A;  5GXQ D;  2DF4 C;  5CHL B;  5AVC D;  3X1U A;  2HIO B;  3REI C;  1A7W A;  3AZG B;  1TAF A;  1H3O B;  4YM6 A;  1P3G C;  1U35 C;  5F99 C;  4J8X B;  4WNN A;  1M19 D;  2ZY5 A;  3W96 D;  4R8P C;  1S32 A;  3C1C D;  3C1B A;  2UWX A;  2XD5 A;  3B6F D;  1KX3 A;  3LEL C;  4J8W B;  4Z5T B;  4XZQ C;  1TZY A;  4Z66 C;  4ZUX D;  3AFA C;  3UTA D;  5B0Z A;  3REH A;  3X1S A;  4ZBJ B;  4XUJ B;  5DNM B;  1M18 C;  1BH8 B;  3MNN D;  5B40 C;  5BNV B;  2FJ7 A;  4LD9 B;  3B6G B;  3MGS C;  3KFU G;  4H9O A;  5JA4 B;  2JCH A;  3A1K A;  4KUD D;  2IO5 C;  3VH5 W;  3AZL D;  1P3F A;  3REL C;  1M1A D;  3W99 D;  5B2I D;  1P3L B;  3KUY D;  5CPK D;  5GSU C;  5CP6 A;  3AZH B;  5FUG B;  3X1U D;  5B24 C;  4YM6 D;  3AL0 C;  3MGP C;  3A6N A;  1P3A A;  3W98 A;  4J8U A;  2PYO B;  1ID3 A;  1ZLA C;  5CPJ B;  4QLC B;  1S32 D;  3AZE C;  3C1B D;  3R45 B;  5B32 A;  5GT3 B;  5KDM A;  3WA9 A;  2ZY2 A;  3LZ1 B;  4Z2M H;  1P3O A;  4WJ3 C;  4UUZ A;  1KX3 D;  3O62 B;  4WU8 C;  2YFW A;  5E5A A;  1KX4 B;  1TZY D;  3WKJ C;  4KHA A;  5AY8 C;  3UTB B;  5B0Z D;  4J8V B;  3LZ0 C;  3X1S D;  5DNN C;  3REH D;  3AZN A;  1P3P A;  1AOI A;  5AV6 A;  2JE5 A;  2HUE C;  2YFV A;  4CSR B;  2W8S A;  3V9R B;  1P34 A;  2FJ7 D;  2NQB B;  5CPI C;  4WU9 B;  1R4V A;  3AZK A;  1HQ3 A;  2G5H C;  5BS7 A;  2XD1 A;  3WAA A;  3NQU B;  1P3F D;  1WWS A;  1BFM A;  5B1M A;  4YS3 C;  3REJ A;  5AVB C;  5AV5 C;  5B33 C;  3W97 C;  3KWQ C;  5B1L A;  3AZF C;  5GXQ B;  5CP6 D;  3AZI A;  5AVC B;  2F2A C;  3EPL A;  3MGR C;  2Y2N A;  4H9P B;  3TU4 A;  3AN2 C;  3A6N D;  4NE5 A;  3AZM A;  1P3A D;  3W98 D;  4J8U D;  4KGC A;  1M19 B;  1ID3 D;  3W96 B;  3C1C B;  3AZJ A;  2RVQ D;  1F66 C;  1BH9 B;  5B32 D;  1P3B C;  4NE3 A;  1P3I C;  3WA9 D;  3H0R C;  1P3O D;  3B6F B;  1P3M C;  5BO0 A;  3X1V A;  5E5A D;  3WTP C;  4ZUX B;  3UTA B;  2DQN C;  2F8N A;  3AZN D;  1AOI D;  4JJN C;  1P3P D;  1N1J A;  5B31 D;  5AV6 D;  3REI A;  1P3G A;  2ARO C;  3MGQ C;  5GT0 C;  4H9S C;  5F99 A;  3MNN B;  1U35 A;  1P34 D;  3VH5 A;  3AZK D;  4R8P A;  4KUD B;  1HQ3 D;  3AZL B;  3WAA D;  5AV9 C;  1PZR A;  2CWE A;  1M1A B;  5AV8 C;  3W99 B;  5B2I B;  2RIQ A;  4HGA C;  5B1M D;  3REJ D;  3UT9 C;  5B0Y C;  3MVD C;  5JRG C;  3LEL A;  5B1L D;  3KUY B;  5CPK B;  1KX5 C;  4XZQ A;  3AZI D;  5CPK A;  3X1U B;  3AFA A;  4G92 C;  1EQZ C;  1TAF B;  5BNX A;  4YM6 B;  3TU4 D;  3AV1 C;  3FDD A;  3AZM D;  4X23 C;  4KGC D;  4E44 A;  4WNN B;  1S32 B;  2CV5 C;  5B40 A;  3AZJ D;  3C1B B;  3EPH A;  3AV2 C;  3REL A;  1B6W A;  1KX3 B;  3KXB C;  5CPI D;  3X1V D;  1TZY B;  3H0L C;  4NFT A;  5GSU A;  5B0Z B;  2F8N D;  3REH B;  3X1S B;  3X1T C;  3B0D B;  3EG5 B;  3REI D;  1P3G D;  5B24 A;  3LJA C;  3MGP A;  3F6T A;  1U35 D;  5F99 D;  2FJ7 B;  1ZLA A;  4H9O B;  5C3I C;  3B0B A;  4R8P D;  3AZE A;  2NZD C;  3EPJ A;  1P3F B;  2Y2G A;  4G91 C;  3REK C;  3AYW C;  3LEL D;  4WU8 A;  5CP6 B;  4XZQ D;  5B2J C;  3WKJ A;  5AY8 A;  1F1E A;  3AFA D;  4YM6 C;  2Y2I A;  5DNN A;  3LZ0 A;  1HTA A;  2HIO C;  3A6N B;  3AZG C;  4J8U B;  1P3A B;  3W98 B;  1ID3 B;  4J8X C;  5B40 D;  1S32 C;  5CPI A;  5B32 B;  3IP4 C;  5KDM B;  4E45 A;  3WA9 B;  1P3O B;  4UUZ B;  3REL D;  4YS3 A;  2YFW B;  5AVB A;  2Y2Q A;  5AV5 A;  5B33 A;  5E5A B;  3W97 A;  3VH5 T;  3KWQ A;  4J8W C;  4KHA B;  5BT1 C;  2BYK A;  4Z5T C;  3AZF A;  5GSU D;  3AZN B;  1AOI B;  1P3P B;  5B31 B;  5AV6 B;  5B24 D;  2YFV B;  5B31 A;  3MGR A;  4ZBJ C;  3MGP D;  3AN2 A;  1P34 B;  4XUJ C;  1P3K B;  5DNM C;  1ZLA D;  3AZK B;  1P3K A;  1HQ3 B;  4H9N A;  3WAA B;  3B6G C;  4LD9 C;  3AZE D;  1F66 A;  4DRB A;  2Y2M A;  1P3B A;  1P3I A;  5B1M B;  3REJ B;  1KU5 A;  1P3M A;  4WU8 D;  5B1L B;  3H0M C;  1P3L C;  3AZI B;  3WTP A;  3WKJ D;  5AY8 D;  3AZH C;  4H9R A;  1JFI A;  3TU4 B;  3P5J B;  3LZ0 D;  5DNN D;  2Y2P A;  4JJN A;  4AWL B;  3AZM B;  4KGC B;  2ARO A;  3MGQ A;  5GT0 A;  4H9S A;  3AZJ B;  5CPJ C;  4QLC C; 
#chains in the Genus database with same CATH homology
 4M6B A;  5AV9 A;  5GT3 C;  5BO0 B;  5B32 G;  5AV8 A;  3LZ1 C;  4YS3 D;  3UT9 A;  5AVB D;  5B0Y A;  3MVD A;  4Z2M G;  5B33 D;  5AV5 D;  3O62 C;  3KWQ D;  3X1V B;  3W97 D;  5JRG A;  4EO5 B;  4WZS B;  3AZF D;  1KX4 C;  1KX5 A;  2F8N B;  3UTB C;  1N1J B;  3REI B;  4J8V C;  1P3G B;  1EQZ A;  3MGR D;  3AV1 A;  3AN2 D;  4NE6 A;  2JSS A;  5F99 B;  4X23 A;  1U35 B;  4WV4 B;  1Z2C B;  5B31 G;  1P3K D;  4R8P B;  1Q9C A;  2NQB C;  2Y2O A;  2CV5 A;  1F66 D;  4WU9 C;  4CAY A;  2Y2J A;  1P3B D;  3VH6 W;  3AV2 A;  1P3I D;  4H9Q A;  1P3M D;  3LEL B;  3WTP E;  3KXB A;  4XZQ B;  3WTP D;  5GXQ C;  4Z66 A;  3AFA B;  4UPK A;  5BNX B;  2BYM A;  3X1T A;  5AVC C;  4JJN D;  2ARO D;  3LJA A;  3MGQ D;  5GT0 D;  2G5I C;  5B40 B;  1M19 C;  3W96 C;  1M18 A;  3C1C C;  3MGS A;  5AV9 D;  2NZD A;  3REL B;  5AV8 D;  3REK A;  3UT9 D;  3B6F C;  5B0Y D;  3MVD D;  3NQJ A;  5G49 A;  5JRG D;  3AYW A;  3VH6 T;  5GSU B;  1KX5 D;  5B2J A;  4ZUX C;  3UTA C;  4DQY B;  1EQZ D;  5B24 B;  2F8N G;  3AV1 D;  3MGP B;  2HIO A;  4X23 D;  3AZG A;  1H3O A;  1ZLA B;  3MNN C;  4J8X A;  2CV5 D;  3AZE B;  1B67 A;  4KUD C;  3AZL C;  3AV2 D;  2L5A A;  1M1A C;  3W99 C;  5B2I C;  2F8N K;  4WU8 B;  3KXB D;  4J8W A;  3WKJ B;  3KUY C;  5AY8 B;  5CPK C;  4Z5T A;  4Z66 D;  1ULY A;  3X1T D;  3LZ0 B;  5DNN B;  3X1U C;  2HUE B;  2PYO C;  3LJA D;  2ZY4 A;  4XUJ A;  5CPI B;  5DNM A;  1M18 D;  1BH8 A;  3MGS D;  3C1B C;  5BNV A;  4LD9 A;  3B6G A;  2NZD D;  5JA4 A;  3REK D;  4YS3 B;  5AVB B;  1W2E A;  1T3U A;  5B33 B;  5AV5 B;  1KX3 C;  3KWQ B;  3W97 B;  3AYW D;  2BYK B;  3AZF B;  1TZY C;  2ZM5 A;  1P3L A;  5B2J D;  5B0Z C;  3AZH A;  5FUG A;  3REH C;  3MGR B;  3X1S C;  3B0D C;  3AN2 B;  2HIO D;  3AZG D;  3B0C W;  2BG1 A;  2FJ7 C;  4J8X D;  4H9N B;  2PYO A;  1F66 B;  3VH6 A;  5CPJ A;  4QLC A;  1P3B B;  1P3I B;  1P3F C;  3R45 A;  5GT3 A;  1P3M B;  2Y2K A;  3LZ1 A;  3O62 A;  3WTP B;  4J8W D;  5BT1 D;  2FFF B;  4Z5T D;  5CP6 C;  1KX4 A;  4H9R B;  1JFI B;  3UTB A;  4JJN B;  4J8V A;  2ARO B;  3A6N C;  1P3A C;  3MGQ B;  3W98 C;  4J8U C;  5GT0 B;  1ID3 C;  4XUJ D;  4CSR A;  5DNM D;  3V9R A;  2RVQ C;  2NQB A;  4LD9 D;  3B6G D;  5B32 C;  5AV9 B;  4WU9 A;  1WWI A;  3B0C T;  5AV8 B;  3KSY A;  3WA9 C;  1P3O C;  3NQU A;  4HGA B;  3UT9 B;  5B0Y B;  3MVD B;  3A1I A;  5JRG B;  5E5A C;  2VQR A;  1KX5 B;  1P3L D;  3EPK A;  5GXQ A;  3AZH D;  4G92 B;  1EQZ B;  3AZN C;  1AOI C;  1P3P C;  3AV1 B;  5B31 C;  5AV6 C;  5AVC A;  4X23 B;  4H9P A;  1P34 C;  1P3K C;  2PYO D;  2LY8 A;  2CV5 B;  1M19 A;  4CAY B;  5CPJ D;  3W96 A;  4QLC D;  3AZK C;  1HQ3 C;  5BS7 C;  3WAA C;  3C1C A;  3AV2 B;  1BH9 A;  5GT3 D;  4H9Q B;  5B1M C;  3REJ C;  3LZ1 D;  3KXB B;  3B6F A;  3O62 D;  5B1L C;  4Z66 B;  3AZI C;  1KX4 D;  3UTB D;  2BYM B;  3X1T B;  2F8N H;  4ZUX A;  3UTA A;  4J8V D;  3TU4 C;  3AZM C;  4AWL C;  3LJA B;  4DRA A;  4KGC C;  1M18 B;  5C3I B;  3MNN A;  3MGS B;  2Y2H A;  2J8P A;  3AZJ C;  2NQB D;  2NZD B;  4WU9 D;  2IO5 B;  2ZY3 A;  4G91 B;  4KUD A;  3REK B;  3AZL A;  2Y2L A;  3NQJ B;  1M1A A;  5G49 B;  3W99 A;  5B2I A;  3AYW B;  3X1V C;  4EO5 C;  5B2J B;  3KUY A;  5GXQ D;  2DF4 C;  5CHL B;  5AVC D;  3X1U A;  2HIO B;  3REI C;  1A7W A;  3AZG B;  1TAF A;  1H3O B;  4YM6 A;  1P3G C;  1U35 C;  5F99 C;  4J8X B;  4WNN A;  1M19 D;  2ZY5 A;  3W96 D;  4R8P C;  1S32 A;  3C1C D;  3C1B A;  2UWX A;  2XD5 A;  3B6F D;  1KX3 A;  3LEL C;  4J8W B;  4Z5T B;  4XZQ C;  1TZY A;  4Z66 C;  4ZUX D;  3AFA C;  3UTA D;  5B0Z A;  3REH A;  3X1S A;  4ZBJ B;  4XUJ B;  5DNM B;  1M18 C;  1BH8 B;  3MNN D;  5B40 C;  5BNV B;  2FJ7 A;  4LD9 B;  3B6G B;  3MGS C;  3KFU G;  4H9O A;  5JA4 B;  2JCH A;  3A1K A;  4KUD D;  2IO5 C;  3VH5 W;  3AZL D;  1P3F A;  3REL C;  1M1A D;  3W99 D;  5B2I D;  1P3L B;  3KUY D;  5CPK D;  5GSU C;  5CP6 A;  3AZH B;  5FUG B;  3X1U D;  5B24 C;  4YM6 D;  3AL0 C;  3MGP C;  3A6N A;  1P3A A;  3W98 A;  4J8U A;  2PYO B;  1ID3 A;  1ZLA C;  5CPJ B;  4QLC B;  1S32 D;  3AZE C;  3C1B D;  3R45 B;  5B32 A;  5GT3 B;  5KDM A;  3WA9 A;  2ZY2 A;  3LZ1 B;  4Z2M H;  1P3O A;  4WJ3 C;  4UUZ A;  1KX3 D;  3O62 B;  4WU8 C;  2YFW A;  5E5A A;  1KX4 B;  1TZY D;  3WKJ C;  4KHA A;  5AY8 C;  3UTB B;  5B0Z D;  4J8V B;  3LZ0 C;  3X1S D;  5DNN C;  3REH D;  3AZN A;  1P3P A;  1AOI A;  5AV6 A;  2JE5 A;  2HUE C;  2YFV A;  4CSR B;  2W8S A;  3V9R B;  1P34 A;  2FJ7 D;  2NQB B;  5CPI C;  4WU9 B;  1R4V A;  3AZK A;  1HQ3 A;  2G5H C;  5BS7 A;  2XD1 A;  3WAA A;  3NQU B;  1P3F D;  1WWS A;  1BFM A;  5B1M A;  4YS3 C;  3REJ A;  5AVB C;  5AV5 C;  5B33 C;  3W97 C;  3KWQ C;  5B1L A;  3AZF C;  5GXQ B;  5CP6 D;  3AZI A;  5AVC B;  2F2A C;  3EPL A;  3MGR C;  2Y2N A;  4H9P B;  3TU4 A;  3AN2 C;  3A6N D;  4NE5 A;  3AZM A;  1P3A D;  3W98 D;  4J8U D;  4KGC A;  1M19 B;  1ID3 D;  3W96 B;  3C1C B;  3AZJ A;  2RVQ D;  1F66 C;  1BH9 B;  5B32 D;  1P3B C;  4NE3 A;  1P3I C;  3WA9 D;  3H0R C;  1P3O D;  3B6F B;  1P3M C;  5BO0 A;  3X1V A;  5E5A D;  3WTP C;  4ZUX B;  3UTA B;  2DQN C;  2F8N A;  3AZN D;  1AOI D;  4JJN C;  1P3P D;  1N1J A;  5B31 D;  5AV6 D;  3REI A;  1P3G A;  2ARO C;  3MGQ C;  5GT0 C;  4H9S C;  5F99 A;  3MNN B;  1U35 A;  1P34 D;  3VH5 A;  3AZK D;  4R8P A;  4KUD B;  1HQ3 D;  3AZL B;  3WAA D;  5AV9 C;  1PZR A;  2CWE A;  1M1A B;  5AV8 C;  3W99 B;  5B2I B;  2RIQ A;  4HGA C;  5B1M D;  3REJ D;  3UT9 C;  5B0Y C;  3MVD C;  5JRG C;  3LEL A;  5B1L D;  3KUY B;  5CPK B;  1KX5 C;  4XZQ A;  3AZI D;  5CPK A;  3X1U B;  3AFA A;  4G92 C;  1EQZ C;  1TAF B;  5BNX A;  4YM6 B;  3TU4 D;  3AV1 C;  3FDD A;  3AZM D;  4X23 C;  4KGC D;  4E44 A;  4WNN B;  1S32 B;  2CV5 C;  5B40 A;  3AZJ D;  3C1B B;  3EPH A;  3AV2 C;  3REL A;  1B6W A;  1KX3 B;  3KXB C;  5CPI D;  3X1V D;  1TZY B;  3H0L C;  4NFT A;  5GSU A;  5B0Z B;  2F8N D;  3REH B;  3X1S B;  3X1T C;  3B0D B;  3EG5 B;  3REI D;  1P3G D;  5B24 A;  3LJA C;  3MGP A;  3F6T A;  1U35 D;  5F99 D;  2FJ7 B;  1ZLA A;  4H9O B;  5C3I C;  3B0B A;  4R8P D;  3AZE A;  2NZD C;  3EPJ A;  1P3F B;  2Y2G A;  4G91 C;  3REK C;  3AYW C;  3LEL D;  4WU8 A;  5CP6 B;  4XZQ D;  5B2J C;  3WKJ A;  5AY8 A;  1F1E A;  3AFA D;  4YM6 C;  2Y2I A;  5DNN A;  3LZ0 A;  1HTA A;  2HIO C;  3A6N B;  3AZG C;  4J8U B;  1P3A B;  3W98 B;  1ID3 B;  4J8X C;  5B40 D;  1S32 C;  5CPI A;  5B32 B;  3IP4 C;  5KDM B;  4E45 A;  3WA9 B;  1P3O B;  4UUZ B;  3REL D;  4YS3 A;  2YFW B;  5AVB A;  2Y2Q A;  5AV5 A;  5B33 A;  5E5A B;  3W97 A;  3VH5 T;  3KWQ A;  4J8W C;  4KHA B;  5BT1 C;  2BYK A;  4Z5T C;  3AZF A;  5GSU D;  3AZN B;  1AOI B;  1P3P B;  5B31 B;  5AV6 B;  5B24 D;  2YFV B;  5B31 A;  3MGR A;  4ZBJ C;  3MGP D;  3AN2 A;  1P34 B;  4XUJ C;  1P3K B;  5DNM C;  1ZLA D;  3AZK B;  1P3K A;  1HQ3 B;  4H9N A;  3WAA B;  3B6G C;  4LD9 C;  3AZE D;  1F66 A;  4DRB A;  2Y2M A;  1P3B A;  1P3I A;  5B1M B;  3REJ B;  1KU5 A;  1P3M A;  4WU8 D;  5B1L B;  3H0M C;  1P3L C;  3AZI B;  3WTP A;  3WKJ D;  5AY8 D;  3AZH C;  4H9R A;  1JFI A;  3TU4 B;  3P5J B;  3LZ0 D;  5DNN D;  2Y2P A;  4JJN A;  4AWL B;  3AZM B;  4KGC B;  2ARO A;  3MGQ A;  5GT0 A;  4H9S A;  3AZJ B;  5CPJ C;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...