2HUEC

Structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structural basis for the histone chaperone activity of asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 27
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hueC00
3WA9A 2FJ7A 1P3MA 3NQUA 5CPJC 4H9PB 5AV8A 1P3OA 5B33A 4J8VB 5CPJD 5CPKB 4KGCA 3AZKA 4EO5C 3AZIA 1P3AB 5F99B 3AYWA 1A7WA 5GT3B 3AZFA 3WA9D 5AV8C 1P3OC 2FJ7D 3REKB 1P3MD 3LELA 4J8WA 5AV5B 4KGCC 5AV8D 1P3OD 5B33D 4YM6C 3AV2B 3AZIC 4KGCD 3AYWC 3AZKD 3REIC 3AZFC 5B32A 5B40A 3AFAB 3REHB 3AZID 2BYKB 5CP6A 1S32A 3B6GA 3LELC 3AYWD 3AZFD 4LD9C 3X1SC 1M19A 4H9QA 3LELD 4J8WD 3WKJA 5CPJB 5B32C 3B6FA 5B40C 4E45A 5CP6C 2BYMA 3WAAA 5B32D 5B40D 5CP6D 1S32D 1M19C 1P34C 3B6GD 4EO5B 3WA9B 3WKJC 1P3MB 5B1MA 1M19D 3NQUB 5CPIA 3B6FC 5AV8B 1P3OB 3WKJD 3WAAC 3B6FD 4Z66A 3MGRA 4KGCB 3TU4A 4YM6B 3WAAD 3AZIB 1AOIA 4H9SA 3AYWB 5B1MC 3REIB 3AZFB 5CPIC 3W96A 3LELB 4R8PA 5B1MD 4H9NA 5GSUA 5CPID 3MGRC 5AVCA 3TU4C 3MGSA 4LD9B 4Z66D 3MGRD 1AOIC 3TU4D 5B32B 5B40B 5BNXA 1AOID 4XZQC 5CP6B 1S32B 3B6GB 1KU5A 3B0DC 3X1TA 2HIOC 5GSUC 1JFIA 5B2JA 5AVCC 3MGSC 3W96D 1M19B 1F66A 4H9QB 4R8PD 5GSUD 3WKJB 5B32G 5AVCD 3MGSD 3B6FB 1B6WA 3LZ1A 2BYMB 4WNNA 3X1TC 3WAAB 5B2JC 3X1TD 5B2JD 5B1MB 1F66D 5CPIB 3WTPD 3LZ1C 3VH5T 3MGRB 4AWLC 4HGAC 3TU4B 4G92B 4NE6A 3LZ1D 4G91C 3VH6W 3MGPA 1AOIB 2F8NK 1BH9B 5GT3A 4KUDA 5B24A 4Z2MG 1M1AC 5B1LC 3B0DB 4R8PB 2HIOB 4H9NB 3W97A 5GSUB 1R4VA 3AV2A 5AVCB 3MGSB 3AZMA 3MGPC 5DNMC 3AFAA 2JSSA 4KUDC 2BYKA 4H9OA 1KX5A 4WU8A 3MVDA 4CAYA 3MGPD 3VH5A 5GT3D 4KUDD 3X1TB 3B0BA 3W97C 5B24D 1JFIB 5B2JB 3AZMC 3W97D 3AV2D 3UTBC 5GT0A 3AZMD 2YFVA 3MVDC 4DRAA 3LZ1B 3AFAD 4WNNB 3B0CT 1WWSA 4AWLB 3AZNA 3MVDD 4HGAB 4WU8D 1KX5D 3W99C 4G91B 1P3GA 1P3IA 5GT0C 1ZLAC 3C1BA 1M1AB 1P3PA 5GT0D 3LJAC 4WZSB 4YM6A 3AZNC 5B31A 4DRBA 1P3GC 3MGPB 2HUEC 3AZND 3REIA 1P3IC 1KX4A 4JJNA 4KUDB 3AZJA 5B24B 1P3GD 3C1BC 1P3ID 3REJC 1P3PC 3W97B 4LD9A 3X1SA 5B31C 3C1BD 3AZMB 3RELA 1P3PD 4YM6D 1KX4C 5B31D 4JJNC 4H9OB 1KX5B 4WU8B 3MVDB 4CAYB 3AZGA 3AZJC 3REID 1KX4D 4JJND 1N1JA 3AZJD 3KSYA 4WU9A 1P34A 3KUYA 3RELC 2CWEA 3A6NA 4LD9D 3X1SD 5GT0B 1ZLAB 3RELD 2YFVB 1P3BA 3AZGC 3LJAB 5JRGA 5GXQA 3AZNB 3AZGD 4WU9C 3KUYC 3W98A 1P3GB 2HUEB 3A6NC 1P3IB 4WU9D 1P34D 3KUYD 5B0YA 4NFTA 1P3BC 3C1BB 3A6ND 1P3PB 5JRGC 5GXQC 1P3BD 5B31B 3W98C 5JRGD 5GXQD 1BH9A 3MNNC 1KX4B 4JJNB 4CSRA 4J8XA 3W98D 5B0YC 4XZQA 3AZJB 2HIOA 5B31G 5B0YD 3X1SB 3RELB 5AV6A 1BFMA 4J8XC 3AZEC 3X1UA 3AZGB 3UT9A 1N1JB 4J8XD 4XZQD 4WU9B 1P34B 3KUYB 2HIOD 5AV6C 5KDMA 3A6NB 4WV4B 3X1UC 4NE5A 2YFWA 1P3BB 5BO0A 5AV6D 5C3IC 3UT9C 5JRGB 5GXQB 3LZ0A 3X1UD 3UT9D 3W98B 3MNNB 5AY8A 3C1CA 5CHLB 1M1AA 5B0YB 5B1LA 1P3KC 4UUZA 3NQJA 3LZ0C 4E44A 1P3LC 5AY8C 5DNMA 3LZ0D 3C1CC 4CSRB 4J8XB 4M6BA 4XZQB 5AY8D 3C1CD 1ID3A 2PYOC 1M1AD 5B1LD 3UTBA 5AV6B 1ULYA 3AZHA 3X1UB 4NE3A 5DNMD 5C3IB 3UT9B 1ID3C 4QLCA 3R45A 1HQ3A 3W99A 5B2IA 1ID3D 5KDMB 1ZLAA 2IO5C 3AZHC 2YFWB 3UTBD 5BO0B 1P3KB 3LJAA 3V9RA 4ZUXA 3AZHD 4QLCC 4H9RA 3LZ0B 1HQ3C 2CV5A 5B2IC 3AN2A 1P3LB 4QLCD 5AY8B 1HQ3D 1TZYA 1B67A 3W99D 5B2ID 3C1CB 3X1VA 1HTAA 3UTAA 4XUJA 5AV5C 5B1LB 3REJA 1ZLAD 5FUGA 4UUZB 4ZUXC 1U35A 2PYOB 3NQJB 2CV5C 3AN2C 3LJAD 4ZUXD 5DNMB 1TZYC 3X1VC 2CV5D 4X23A 3AN2D 3UTAC 4XUJC 3KWQA 1TAFA 4J8UA 1TZYD 3X1VD 1ID3B 1U35C 3UTAD 4XUJD 2NQBA 3REJD 1U35D 3UTBB 5JA4A 2IO5B 4X23C 3AZHB 3AZLA 3KWQC 3KXBA 4J8UC 2F8NH 4X23D 4QLCB 3R45B 1HQ3B 3W99B 3KWQD 3WA9C 5B2IB 2NQBC 2FJ7C 4J8UD 1P3MC 2NQBD 5B33C 5B0ZA 3AZLC 3VH5W 3KXBC 3V9RB 4ZUXB 3AZKC 4H9RB 4Z2MH 3AZLD 2CV5B 3KXBD 3AN2B 3MNNA 5BNVA 3VH6T 1TZYB 3X1VB 4YS3A 3UTAB 1EQZA 4XUJB 5AV9A 5B0ZC 4J8WC 3REJB 5FUGB 1U35B 5AVBA 5B0ZD 1F1EA 3AZEA 2F8NA 4X23B 4YS3C 1S32C 3MNND 5E5AA 1EQZC 3B6GC 5AV9C 2AROA 3KWQB 1TAFB 4J8UB 4YS3D 1EQZD 5AV9D 3VH6A 5AVBC 2NQBB 2FJ7B 2NZDA 5AVBD 5JA4B 2RVQC 5B33B 5E5AC 3B0CW 2AROC 3AZLB 1H3OA 3KXBB 3AZED 2F8ND 2RVQD 3AZKB 5E5AD 2AROD 5BS7A 2NZDC 1M18A 1P3KA 4J8WB 5B0ZB 2NZDD 4Z66C 4G92C 3MGQA 1P3LA 1WWIA 2L5AA 5BNVB 4H9SC 5BS7C 1BH8A 4Z5TA 3W96C 4YS3B 1M18C 1EQZB 4R8PC 5DNNA 5AV9B 2PYOA 1M18D 3O62A 3WTPE 1P3KD 3MGQC 5AVBB 3WTPA 5BT1C 4KHAA 5G49A 3MGQD 1KX3A 2LY8A 1P3FA 3AZEB 2F8NB 4Z5TC 5BT1D 3AV1A 1P3LD 5E5AB 5DNNC 2AROB 4ZBJC 4Z5TD 1F66C 3O62C 5DNND 3WTPC 2PYOD 4H9PA 3O62D 2F8NG 2NZDB 1KX3C 1P3FC 4J8VA 3AV1C 5CPKA 1H3OB 1KX3D 4Z66B 1P3FD 3AV1D 1P3AA 5F99A 3REKA 4J8VC 3W96B 5AV5A 1M18B 5CPKC 4J8VD 5CPKD 1P3AC 3MGQB 5F99C 5GT3C 3REHA 1BH8B 1P3AD 5BNXB 5B24C 5F99D 3REKC 4Z5TB 5DNNB 3REKD 3AV2C 4ZBJB 5AV5D 3O62B 1F66B 3WTPB 5CPJA 4KHAB 3AFAC 5G49B 3REHC 1KX3B 1KX5C 4WU8C 1P3FB 3AV1B 1Q9CA 3REHD
chains in the Genus database with same CATH superfamily
3WA9A 2FJ7A 1P3MA 3NQUA 5CPJC 4H9PB 5AV8A 1P3OA 5B33A 2BG1A 4J8VB 5CPJD 5CPKB 4KGCA 3AZKA 4EO5C 3AZIA 1P3AB 5F99B 3AYWA 1A7WA 2JCHA 5GT3B 3AZFA 3WA9D 5AV8C 1P3OC 2FJ7D 3REKB 1P3MD 3LELA 4J8WA 5AV5B 4KGCC 5AV8D 1P3OD 5B33D 4YM6C 3AV2B 3AZIC 4KGCD 2G5IC 3AYWC 3AZKD 3REIC 3AZFC 5B32A 5B40A 3AFAB 3REHB 3AZID 2BYKB 5CP6A 1S32A 3B6GA 3LELC 3AYWD 3AZFD 2W8SA 4LD9C 3X1SC 1M19A 4H9QA 3LELD 4J8WD 3WKJA 5CPJB 2Y2HA 5B32C 5B40C 3B6FA 4E45A 5CP6C 3EPJA 2BYMA 3WAAA 5B32D 5B40D 5CP6D 1S32D 1M19C 1P34C 3B6GD 4EO5B 3WA9B 3WKJC 1P3MB 5B1MA 1M19D 3NQUB 5CPIA 3B6FC 5AV8B 1P3OB 3WKJD 2Y2OA 3WAAC 3B6FD 4Z66A 3MGRA 4KGCB 3TU4A 4YM6B 3WAAD 3AZIB 1AOIA 4H9SA 3AYWB 5B1MC 3REIB 3AZFB 5CPIC 3W96A 3LELB 4R8PA 5B1MD 4H9NA 5GSUA 2Y2PA 5CPID 3MGRC 5AVCA 3TU4C 3MGSA 2J8PA 4LD9B 4Z66D 3MGRD 1AOIC 3FDDA 3TU4D 5B32B 5B40B 5BNXA 2UWXA 1AOID 4XZQC 5CP6B 1S32B 3B6GB 1KU5A 3B0DC 2Y2JA 3X1TA 2HIOC 5GSUC 1JFIA 5B2JA 5AVCC 3MGSC 3W96D 1M19B 2ZY3A 4H9QB 1F66A 4R8PD 5GSUD 3WKJB 5B32G 5AVCD 3MGSD 3B6FB 1B6WA 3KFUG 4UPKA 3LZ1A 2BYMB 4WNNA 3X1TC 3WAAB 5B2JC 3X1TD 5B2JD 5B1MB 1F66D 5CPIB 3WTPD 3LZ1C 2DF4C 3VH5T 3MGRB 4AWLC 4HGAC 3TU4B 4G92B 4NE6A 3LZ1D 4G91C 3VH6W 3MGPA 1AOIB 2F8NK 1BH9B 5GT3A 4KUDA 5B24A 4Z2MG 1M1AC 2ZY2A 5B1LC 3B0DB 4R8PB 2HIOB 4H9NB 3W97A 5GSUB 1R4VA 3AV2A 5AVCB 3MGSB 3AZMA 3MGPC 5DNMC 3AFAA 2JSSA 4KUDC 2BYKA 4H9OA 1KX5A 4WU8A 3MVDA 4CAYA 3MGPD 3VH5A 5GT3D 4KUDD 3X1TB 3AL0C 3B0BA 3W97C 2Y2KA 5B24D 1JFIB 5B2JB 3AZMC 3W97D 3AV2D 3UTBC 5GT0A 3AZMD 2YFVA 3MVDC 4DRAA 3LZ1B 3AFAD 4WNNB 2Y2GA 1WWSA 3B0CT 4AWLB 3MVDD 4HGAB 3AZNA 4WU8D 1KX5D 3W99C 4G91B 2XD5A 1P3GA 1P3IA 5GT0C 1ZLAC 3C1BA 1M1AB 1P3PA 5GT0D 3LJAC 4WZSB 4YM6A 3AZNC 5B31A 2ZY5A 4DRBA 1P3GC 3MGPB 2HUEC 3AZND 3REIA 1P3IC 1KX4A 4JJNA 4KUDB 3AZJA 5B24B 1P3GD 3C1BC 1P3ID 3REJC 1P3PC 3W97B 4LD9A 3X1SA 5B31C 3C1BD 3AZMB 3RELA 1P3PD 4YM6D 1KX4C 5B31D 4JJNC 4H9OB 1KX5B 4WU8B 3MVDB 4CAYB 3AZGA 3AZJC 3REID 1KX4D 4JJND 1N1JA 3AZJD 3KSYA 4WU9A 1P34A 3KUYA 2F2AC 3RELC 2CWEA 3A6NA 4LD9D 3X1SD 5GT0B 1ZLAB 3RELD 2YFVB 1P3BA 3AZGC 3LJAB 5JRGA 5GXQA 3AZNB 3AZGD 4WU9C 3KUYC 3W98A 1P3GB 2HUEB 3A6NC 1P3IB 4WU9D 1P34D 3KUYD 5B0YA 4NFTA 1P3BC 3C1BB 3A6ND 1P3PB 5JRGC 5GXQC 1P3BD 5B31B 3W98C 2Y2IA 5GXQD 1BH9A 5JRGD 3MNNC 1KX4B 4JJNB 4CSRA 4J8XA 3W98D 5B0YC 4XZQA 3AZJB 2HIOA 5B31G 5B0YD 3X1SB 2G5HC 3RELB 5AV6A 1BFMA 4J8XC 3AZEC 3X1UA 3AZGB 3UT9A 4DQYB 1N1JB 4J8XD 4XZQD 4WU9B 1P34B 3KUYB 2HIOD 5AV6C 5KDMA 3A6NB 1W2EA 4WV4B 3X1UC 4NE5A 2YFWA 1P3BB 5BO0A 5AV6D 5C3IC 3UT9C 5JRGB 5GXQB 3LZ0A 3X1UD 3EPHA 3UT9D 4WJ3C 3W98B 3MNNB 5AY8A 3C1CA 5CHLB 1M1AA 5B0YB 1Z2CB 3H0MC 5B1LA 1P3KC 4UUZA 3NQJA 3LZ0C 4E44A 1P3LC 5AY8C 5DNMA 3LZ0D 3C1CC 4CSRB 4J8XB 4M6BA 4XZQB 5AY8D 3C1CD 1ID3A 3P5JB 2PYOC 1M1AD 5B1LD 3UTBA 5AV6B 1ULYA 3AZHA 3X1UB 4NE3A 5DNMD 5C3IB 3UT9B 1ID3C 4QLCA 3R45A 1HQ3A 3W99A 5B2IA 1ID3D 5KDMB 1ZLAA 2IO5C 3AZHC 2YFWB 3UTBD 5BO0B 1P3KB 3LJAA 3V9RA 4ZUXA 3AZHD 4QLCC 4H9RA 3LZ0B 1HQ3C 2CV5A 5B2IC 3AN2A 1P3LB 4QLCD 5AY8B 1HQ3D 1TZYA 1B67A 3W99D 5B2ID 3C1CB 2JE5A 3X1VA 1HTAA 3UTAA 4XUJA 5AV5C 5B1LB 3REJA 1ZLAD 5FUGA 4UUZB 4ZUXC 1U35A 2PYOB 3NQJB 2CV5C 3AN2C 3LJAD 4ZUXD 5DNMB 1TZYC 3X1VC 2CV5D 4X23A 3AN2D 3EPKA 3UTAC 2DQNC 4XUJC 3KWQA 1TAFA 4J8UA 1TZYD 3X1VD 1ID3B 2ZM5A 1U35C 3UTAD 3F6TA 4XUJD 2NQBA 3REJD 1U35D 3UTBB 5JA4A 2IO5B 4X23C 3AZHB 3AZLA 3KWQC 3KXBA 4J8UC 2F8NH 4X23D 4QLCB 3R45B 1HQ3B 3W99B 3KWQD 3WA9C 5B2IB 2NQBC 2FJ7C 4J8UD 1P3MC 2NQBD 5B33C 2XD1A 5B0ZA 3AZLC 3VH5W 3KXBC 3V9RB 4ZUXB 3AZKC 3A1KA 4H9RB 4Z2MH 3AZLD 2CV5B 3KXBD 3AN2B 3MNNA 5BNVA 3VH6T 1TZYB 3X1VB 4YS3A 3UTAB 1EQZA 4XUJB 5AV9A 5B0ZC 4J8WC 3REJB 5FUGB 1U35B 5AVBA 5B0ZD 1F1EA 3EG5B 3AZEA 2F8NA 4X23B 4YS3C 1S32C 3MNND 5E5AA 1EQZC 3B6GC 5AV9C 2AROA 3KWQB 1TAFB 4J8UB 4YS3D 3H0LC 1EQZD 5AV9D 3VH6A 5AVBC 2NQBB 2FJ7B 2NZDA 5AVBD 5JA4B 2RVQC 5B33B 2RIQA 5E5AC 3B0CW 2AROC 2ZY4A 1H3OA 3AZLB 3KXBB 3AZED 2F8ND 2RVQD 3AZKB 5E5AD 2AROD 2Y2QA 5BS7A 2NZDC 1M18A 1P3KA 4J8WB 5B0ZB 2NZDD 4Z66C 4G92C 3MGQA 3IP4C 1P3LA 1WWIA 2Y2NA 2L5AA 5BNVB 4H9SC 5BS7C 1BH8A 4Z5TA 3W96C 4YS3B 1M18C 1EQZB 4R8PC 1T3UA 5DNNA 5AV9B 3A1IA 2PYOA 1M18D 3O62A 3WTPE 1P3KD 3MGQC 5AVBB 3WTPA 5BT1C 4KHAA 5G49A 3MGQD 1KX3A 2LY8A 1P3FA 3AZEB 2F8NB 4Z5TC 5BT1D 3AV1A 1P3LD 5E5AB 5DNNC 3H0RC 2AROB 4ZBJC 4Z5TD 1F66C 3O62C 5DNND 3WTPC 2PYOD 4H9PA 3O62D 2F8NG 2NZDB 1KX3C 1P3FC 4J8VA 3AV1C 5CPKA 1H3OB 1KX3D 4Z66B 1P3FD 3AV1D 1P3AA 5F99A 2Y2LA 3REKA 4J8VC 3W96B 5AV5A 1M18B 5CPKC 1PZRA 3EPLA 4J8VD 5CPKD 1P3AC 3MGQB 5F99C 2Y2MA 2VQRA 5GT3C 3REHA 1BH8B 1P3AD 5BNXB 5B24C 5F99D 3REKC 4Z5TB 5DNNB 3REKD 3AV2C 4ZBJB 5AV5D 3O62B 1F66B 3WTPB 5CPJA 4KHAB 3AFAC 5G49B 3REHC 2FFFB 1KX3B 1KX5C 4WU8C 1P3FB 3AV1B 1Q9CA 3REHD
chains in the Genus database with same CATH topology
3WA9A 2FJ7A 1P3MA 3NQUA 5CPJC 4H9PB 5AV8A 1P3OA 5B33A 2BG1A 4J8VB 5CPJD 5CPKB 4KGCA 3AZKA 4EO5C 3AZIA 1P3AB 5F99B 3AYWA 1A7WA 2JCHA 5GT3B 3AZFA 3WA9D 5AV8C 1P3OC 2FJ7D 3REKB 1P3MD 3LELA 4J8WA 5AV5B 4KGCC 5AV8D 1P3OD 5B33D 4YM6C 3AV2B 3AZIC 4KGCD 2G5IC 3AYWC 3AZKD 3REIC 3AZFC 5B32A 5B40A 3AFAB 3REHB 3AZID 2BYKB 5CP6A 1S32A 3B6GA 3LELC 3AYWD 3AZFD 2W8SA 4LD9C 3X1SC 1M19A 4H9QA 3LELD 4J8WD 3WKJA 5CPJB 2Y2HA 5B32C 5B40C 3B6FA 4E45A 5CP6C 3EPJA 2BYMA 3WAAA 5B32D 5B40D 5CP6D 1S32D 1M19C 1P34C 3B6GD 4EO5B 3WA9B 3WKJC 1P3MB 5B1MA 1M19D 3NQUB 5CPIA 3B6FC 5AV8B 1P3OB 3WKJD 2Y2OA 3WAAC 3B6FD 4Z66A 3MGRA 4KGCB 3TU4A 4YM6B 3WAAD 3AZIB 1AOIA 4H9SA 3AYWB 5B1MC 3REIB 3AZFB 5CPIC 3W96A 3LELB 4R8PA 5B1MD 4H9NA 5GSUA 2Y2PA 5CPID 3MGRC 5AVCA 3TU4C 3MGSA 2J8PA 4LD9B 4Z66D 3MGRD 1AOIC 3FDDA 3TU4D 5B32B 5B40B 5BNXA 2UWXA 1AOID 4XZQC 5CP6B 1S32B 3B6GB 1KU5A 3B0DC 2Y2JA 3X1TA 2HIOC 5GSUC 1JFIA 5B2JA 5AVCC 3MGSC 3W96D 1M19B 2ZY3A 4H9QB 1F66A 4R8PD 5GSUD 3WKJB 5B32G 5AVCD 3MGSD 3B6FB 1B6WA 3KFUG 4UPKA 3LZ1A 2BYMB 4WNNA 3X1TC 3WAAB 5B2JC 3X1TD 5B2JD 5B1MB 1F66D 5CPIB 3WTPD 3LZ1C 2DF4C 3VH5T 3MGRB 4AWLC 4HGAC 3TU4B 4G92B 4NE6A 3LZ1D 4G91C 3VH6W 3MGPA 1AOIB 2F8NK 1BH9B 5GT3A 4KUDA 5B24A 4Z2MG 1M1AC 2ZY2A 5B1LC 3B0DB 4R8PB 2HIOB 4H9NB 3W97A 5GSUB 1R4VA 3AV2A 5AVCB 3MGSB 3AZMA 3MGPC 5DNMC 3AFAA 2JSSA 4KUDC 2BYKA 4H9OA 1KX5A 4WU8A 3MVDA 4CAYA 3MGPD 3VH5A 5GT3D 4KUDD 3X1TB 3AL0C 3B0BA 3W97C 2Y2KA 5B24D 1JFIB 5B2JB 3AZMC 3W97D 3AV2D 3UTBC 5GT0A 3AZMD 2YFVA 3MVDC 4DRAA 3LZ1B 3AFAD 4WNNB 2Y2GA 1WWSA 3B0CT 4AWLB 3MVDD 4HGAB 3AZNA 4WU8D 1KX5D 3W99C 4G91B 2XD5A 1P3GA 1P3IA 5GT0C 1ZLAC 3C1BA 1M1AB 1P3PA 5GT0D 3LJAC 4WZSB 4YM6A 3AZNC 5B31A 2ZY5A 4DRBA 1P3GC 3MGPB 2HUEC 3AZND 3REIA 1P3IC 1KX4A 4JJNA 4KUDB 3AZJA 5B24B 1P3GD 3C1BC 1P3ID 3REJC 1P3PC 3W97B 4LD9A 3X1SA 5B31C 3C1BD 3AZMB 3RELA 1P3PD 4YM6D 1KX4C 5B31D 4JJNC 4H9OB 1KX5B 4WU8B 3MVDB 4CAYB 3AZGA 3AZJC 3REID 1KX4D 4JJND 1N1JA 3AZJD 3KSYA 4WU9A 1P34A 3KUYA 2F2AC 3RELC 2CWEA 3A6NA 4LD9D 3X1SD 5GT0B 1ZLAB 3RELD 2YFVB 1P3BA 3AZGC 3LJAB 5JRGA 5GXQA 3AZNB 3AZGD 4WU9C 3KUYC 3W98A 1P3GB 2HUEB 3A6NC 1P3IB 4WU9D 1P34D 3KUYD 5B0YA 4NFTA 1P3BC 3C1BB 3A6ND 1P3PB 5JRGC 5GXQC 1P3BD 5B31B 3W98C 2Y2IA 5GXQD 1BH9A 5JRGD 3MNNC 1KX4B 4JJNB 4CSRA 4J8XA 3W98D 5B0YC 4XZQA 3AZJB 2HIOA 5B31G 5B0YD 3X1SB 2G5HC 3RELB 5AV6A 1BFMA 4J8XC 3AZEC 3X1UA 3AZGB 3UT9A 4DQYB 1N1JB 4J8XD 4XZQD 4WU9B 1P34B 3KUYB 2HIOD 5AV6C 5KDMA 3A6NB 1W2EA 4WV4B 3X1UC 4NE5A 2YFWA 1P3BB 5BO0A 5AV6D 5C3IC 3UT9C 5JRGB 5GXQB 3LZ0A 3X1UD 3EPHA 3UT9D 4WJ3C 3W98B 3MNNB 5AY8A 3C1CA 5CHLB 1M1AA 5B0YB 1Z2CB 3H0MC 5B1LA 1P3KC 4UUZA 3NQJA 3LZ0C 4E44A 1P3LC 5AY8C 5DNMA 3LZ0D 3C1CC 4CSRB 4J8XB 4M6BA 4XZQB 5AY8D 3C1CD 1ID3A 3P5JB 2PYOC 1M1AD 5B1LD 3UTBA 5AV6B 1ULYA 3AZHA 3X1UB 4NE3A 5DNMD 5C3IB 3UT9B 1ID3C 4QLCA 3R45A 1HQ3A 3W99A 5B2IA 1ID3D 5KDMB 1ZLAA 2IO5C 3AZHC 2YFWB 3UTBD 5BO0B 1P3KB 3LJAA 3V9RA 4ZUXA 3AZHD 4QLCC 4H9RA 3LZ0B 1HQ3C 2CV5A 5B2IC 3AN2A 1P3LB 4QLCD 5AY8B 1HQ3D 1TZYA 1B67A 3W99D 5B2ID 3C1CB 2JE5A 3X1VA 1HTAA 3UTAA 4XUJA 5AV5C 5B1LB 3REJA 1ZLAD 5FUGA 4UUZB 4ZUXC 1U35A 2PYOB 3NQJB 2CV5C 3AN2C 3LJAD 4ZUXD 5DNMB 1TZYC 3X1VC 2CV5D 4X23A 3AN2D 3EPKA 3UTAC 2DQNC 4XUJC 3KWQA 1TAFA 4J8UA 1TZYD 3X1VD 1ID3B 2ZM5A 1U35C 3UTAD 3F6TA 4XUJD 2NQBA 3REJD 1U35D 3UTBB 5JA4A 2IO5B 4X23C 3AZHB 3AZLA 3KWQC 3KXBA 4J8UC 2F8NH 4X23D 4QLCB 3R45B 1HQ3B 3W99B 3KWQD 3WA9C 5B2IB 2NQBC 2FJ7C 4J8UD 1P3MC 2NQBD 5B33C 2XD1A 5B0ZA 3AZLC 3VH5W 3KXBC 3V9RB 4ZUXB 3AZKC 3A1KA 4H9RB 4Z2MH 3AZLD 2CV5B 3KXBD 3AN2B 3MNNA 5BNVA 3VH6T 1TZYB 3X1VB 4YS3A 3UTAB 1EQZA 4XUJB 5AV9A 5B0ZC 4J8WC 3REJB 5FUGB 1U35B 5AVBA 5B0ZD 1F1EA 3EG5B 3AZEA 2F8NA 4X23B 4YS3C 1S32C 3MNND 5E5AA 1EQZC 3B6GC 5AV9C 2AROA 3KWQB 1TAFB 4J8UB 4YS3D 3H0LC 1EQZD 5AV9D 3VH6A 5AVBC 2NQBB 2FJ7B 2NZDA 5AVBD 5JA4B 2RVQC 5B33B 2RIQA 5E5AC 3B0CW 2AROC 2ZY4A 1H3OA 3AZLB 3KXBB 3AZED 2F8ND 2RVQD 3AZKB 5E5AD 2AROD 2Y2QA 5BS7A 2NZDC 1M18A 1P3KA 4J8WB 5B0ZB 2NZDD 4Z66C 4G92C 3MGQA 3IP4C 1P3LA 1WWIA 2Y2NA 2L5AA 5BNVB 4H9SC 5BS7C 1BH8A 4Z5TA 3W96C 4YS3B 1M18C 1EQZB 4R8PC 1T3UA 5DNNA 5AV9B 3A1IA 2PYOA 1M18D 3O62A 3WTPE 1P3KD 3MGQC 5AVBB 3WTPA 5BT1C 4KHAA 5G49A 3MGQD 1KX3A 2LY8A 1P3FA 3AZEB 2F8NB 4Z5TC 5BT1D 3AV1A 1P3LD 5E5AB 5DNNC 3H0RC 2AROB 4ZBJC 4Z5TD 1F66C 3O62C 5DNND 3WTPC 2PYOD 4H9PA 3O62D 2F8NG 2NZDB 1KX3C 1P3FC 4J8VA 3AV1C 5CPKA 1H3OB 1KX3D 4Z66B 1P3FD 3AV1D 1P3AA 5F99A 2Y2LA 3REKA 4J8VC 3W96B 5AV5A 1M18B 5CPKC 1PZRA 3EPLA 4J8VD 5CPKD 1P3AC 3MGQB 5F99C 2Y2MA 2VQRA 5GT3C 3REHA 1BH8B 1P3AD 5BNXB 5B24C 5F99D 3REKC 4Z5TB 5DNNB 3REKD 3AV2C 4ZBJB 5AV5D 3O62B 1F66B 3WTPB 5CPJA 4KHAB 3AFAC 5G49B 3REHC 2FFFB 1KX3B 1KX5C 4WU8C 1P3FB 3AV1B 1Q9CA 3REHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 A;  2FJ7 A;  1P3M A;  3NQU A;  5CPJ C;  4H9P B;  5AV8 A;  1P3O A;  5B33 A;  4J8V B;  5CPJ D;  5CPK B;  4KGC A;  3AZK A;  4EO5 C;  3AZI A;  1P3A B;  5F99 B;  3AYW A;  1A7W A;  5GT3 B;  3AZF A;  3WA9 D;  5AV8 C;  1P3O C;  2FJ7 D;  3REK B;  1P3M D;  3LEL A;  4J8W A;  5AV5 B;  4KGC C;  5AV8 D;  1P3O D;  5B33 D;  4YM6 C;  3AV2 B;  3AZI C;  4KGC D;  3AYW C;  3AZK D;  3REI C;  3AZF C;  5B32 A;  5B40 A;  3AFA B;  3REH B;  3AZI D;  2BYK B;  5CP6 A;  1S32 A;  3B6G A;  3LEL C;  3AYW D;  3AZF D;  4LD9 C;  3X1S C;  1M19 A;  4H9Q A;  3LEL D;  4J8W D;  3WKJ A;  5CPJ B;  5B32 C;  3B6F A;  5B40 C;  4E45 A;  5CP6 C;  2BYM A;  3WAA A;  5B32 D;  5B40 D;  5CP6 D;  1S32 D;  1M19 C;  1P34 C;  3B6G D;  4EO5 B;  3WA9 B;  3WKJ C;  1P3M B;  5B1M A;  1M19 D;  3NQU B;  5CPI A;  3B6F C;  5AV8 B;  1P3O B;  3WKJ D;  3WAA C;  3B6F D;  4Z66 A;  3MGR A;  4KGC B;  3TU4 A;  4YM6 B;  3WAA D;  3AZI B;  1AOI A;  4H9S A;  3AYW B;  5B1M C;  3REI B;  3AZF B;  5CPI C;  3W96 A;  3LEL B;  4R8P A;  5B1M D;  4H9N A;  5GSU A;  5CPI D;  3MGR C;  5AVC A;  3TU4 C;  3MGS A;  4LD9 B;  4Z66 D;  3MGR D;  1AOI C;  3TU4 D;  5B32 B;  5B40 B;  5BNX A;  1AOI D;  4XZQ C;  5CP6 B;  1S32 B;  3B6G B;  1KU5 A;  3B0D C;  3X1T A;  2HIO C;  5GSU C;  1JFI A;  5B2J A;  5AVC C;  3MGS C;  3W96 D;  1M19 B;  1F66 A;  4H9Q B;  4R8P D;  5GSU D;  3WKJ B;  5B32 G;  5AVC D;  3MGS D;  3B6F B;  1B6W A;  3LZ1 A;  2BYM B;  4WNN A;  3X1T C;  3WAA B;  5B2J C;  3X1T D;  5B2J D;  5B1M B;  1F66 D;  5CPI B;  3WTP D;  3LZ1 C;  3VH5 T;  3MGR B;  4AWL C;  4HGA C;  3TU4 B;  4G92 B;  4NE6 A;  3LZ1 D;  4G91 C;  3VH6 W;  3MGP A;  1AOI B;  2F8N K;  1BH9 B;  5GT3 A;  4KUD A;  5B24 A;  4Z2M G;  1M1A C;  5B1L C;  3B0D B;  4R8P B;  2HIO B;  4H9N B;  3W97 A;  5GSU B;  1R4V A;  3AV2 A;  5AVC B;  3MGS B;  3AZM A;  3MGP C;  5DNM C;  3AFA A;  2JSS A;  4KUD C;  2BYK A;  4H9O A;  1KX5 A;  4WU8 A;  3MVD A;  4CAY A;  3MGP D;  3VH5 A;  5GT3 D;  4KUD D;  3X1T B;  3B0B A;  3W97 C;  5B24 D;  1JFI B;  5B2J B;  3AZM C;  3W97 D;  3AV2 D;  3UTB C;  5GT0 A;  3AZM D;  2YFV A;  3MVD C;  4DRA A;  3LZ1 B;  3AFA D;  4WNN B;  3B0C T;  1WWS A;  4AWL B;  3AZN A;  3MVD D;  4HGA B;  4WU8 D;  1KX5 D;  3W99 C;  4G91 B;  1P3G A;  1P3I A;  5GT0 C;  1ZLA C;  3C1B A;  1M1A B;  1P3P A;  5GT0 D;  3LJA C;  4WZS B;  4YM6 A;  3AZN C;  5B31 A;  4DRB A;  1P3G C;  3MGP B;  2HUE C;  3AZN D;  3REI A;  1P3I C;  1KX4 A;  4JJN A;  4KUD B;  3AZJ A;  5B24 B;  1P3G D;  3C1B C;  1P3I D;  3REJ C;  1P3P C;  3W97 B;  4LD9 A;  3X1S A;  5B31 C;  3C1B D;  3AZM B;  3REL A;  1P3P D;  4YM6 D;  1KX4 C;  5B31 D;  4JJN C;  4H9O B;  1KX5 B;  4WU8 B;  3MVD B;  4CAY B;  3AZG A;  3AZJ C;  3REI D;  1KX4 D;  4JJN D;  1N1J A;  3AZJ D;  3KSY A;  4WU9 A;  1P34 A;  3KUY A;  3REL C;  2CWE A;  3A6N A;  4LD9 D;  3X1S D;  5GT0 B;  1ZLA B;  3REL D;  2YFV B;  1P3B A;  3AZG C;  3LJA B;  5JRG A;  5GXQ A;  3AZN B;  3AZG D;  4WU9 C;  3KUY C;  3W98 A;  1P3G B;  2HUE B;  3A6N C;  1P3I B;  4WU9 D;  1P34 D;  3KUY D;  5B0Y A;  4NFT A;  1P3B C;  3C1B B;  3A6N D;  1P3P B;  5JRG C;  5GXQ C;  1P3B D;  5B31 B;  3W98 C;  5JRG D;  5GXQ D;  1BH9 A;  3MNN C;  1KX4 B;  4JJN B;  4CSR A;  4J8X A;  3W98 D;  5B0Y C;  4XZQ A;  3AZJ B;  2HIO A;  5B31 G;  5B0Y D;  3X1S B;  3REL B;  5AV6 A;  1BFM A;  4J8X C;  3AZE C;  3X1U A;  3AZG B;  3UT9 A;  1N1J B;  4J8X D;  4XZQ D;  4WU9 B;  1P34 B;  3KUY B;  2HIO D;  5AV6 C;  5KDM A;  3A6N B;  4WV4 B;  3X1U C;  4NE5 A;  2YFW A;  1P3B B;  5BO0 A;  5AV6 D;  5C3I C;  3UT9 C;  5JRG B;  5GXQ B;  3LZ0 A;  3X1U D;  3UT9 D;  3W98 B;  3MNN B;  5AY8 A;  3C1C A;  5CHL B;  1M1A A;  5B0Y B;  5B1L A;  1P3K C;  4UUZ A;  3NQJ A;  3LZ0 C;  4E44 A;  1P3L C;  5AY8 C;  5DNM A;  3LZ0 D;  3C1C C;  4CSR B;  4J8X B;  4M6B A;  4XZQ B;  5AY8 D;  3C1C D;  1ID3 A;  2PYO C;  1M1A D;  5B1L D;  3UTB A;  5AV6 B;  1ULY A;  3AZH A;  3X1U B;  4NE3 A;  5DNM D;  5C3I B;  3UT9 B;  1ID3 C;  4QLC A;  3R45 A;  1HQ3 A;  3W99 A;  5B2I A;  1ID3 D;  5KDM B;  1ZLA A;  2IO5 C;  3AZH C;  2YFW B;  3UTB D;  5BO0 B;  1P3K B;  3LJA A;  3V9R A;  4ZUX A;  3AZH D;  4QLC C;  4H9R A;  3LZ0 B;  1HQ3 C;  2CV5 A;  5B2I C;  3AN2 A;  1P3L B;  4QLC D;  5AY8 B;  1HQ3 D;  1TZY A;  1B67 A;  3W99 D;  5B2I D;  3C1C B;  3X1V A;  1HTA A;  3UTA A;  4XUJ A;  5AV5 C;  5B1L B;  3REJ A;  1ZLA D;  5FUG A;  4UUZ B;  4ZUX C;  1U35 A;  2PYO B;  3NQJ B;  2CV5 C;  3AN2 C;  3LJA D;  4ZUX D;  5DNM B;  1TZY C;  3X1V C;  2CV5 D;  4X23 A;  3AN2 D;  3UTA C;  4XUJ C;  3KWQ A;  1TAF A;  4J8U A;  1TZY D;  3X1V D;  1ID3 B;  1U35 C;  3UTA D;  4XUJ D;  2NQB A;  3REJ D;  1U35 D;  3UTB B;  5JA4 A;  2IO5 B;  4X23 C;  3AZH B;  3AZL A;  3KWQ C;  3KXB A;  4J8U C;  2F8N H;  4X23 D;  4QLC B;  3R45 B;  1HQ3 B;  3W99 B;  3KWQ D;  3WA9 C;  5B2I B;  2NQB C;  2FJ7 C;  4J8U D;  1P3M C;  2NQB D;  5B33 C;  5B0Z A;  3AZL C;  3VH5 W;  3KXB C;  3V9R B;  4ZUX B;  3AZK C;  4H9R B;  4Z2M H;  3AZL D;  2CV5 B;  3KXB D;  3AN2 B;  3MNN A;  5BNV A;  3VH6 T;  1TZY B;  3X1V B;  4YS3 A;  3UTA B;  1EQZ A;  4XUJ B;  5AV9 A;  5B0Z C;  4J8W C;  3REJ B;  5FUG B;  1U35 B;  5AVB A;  5B0Z D;  1F1E A;  3AZE A;  2F8N A;  4X23 B;  4YS3 C;  1S32 C;  3MNN D;  5E5A A;  1EQZ C;  3B6G C;  5AV9 C;  2ARO A;  3KWQ B;  1TAF B;  4J8U B;  4YS3 D;  1EQZ D;  5AV9 D;  3VH6 A;  5AVB C;  2NQB B;  2FJ7 B;  2NZD A;  5AVB D;  5JA4 B;  2RVQ C;  5B33 B;  5E5A C;  3B0C W;  2ARO C;  3AZL B;  1H3O A;  3KXB B;  3AZE D;  2F8N D;  2RVQ D;  3AZK B;  5E5A D;  2ARO D;  5BS7 A;  2NZD C;  1M18 A;  1P3K A;  4J8W B;  5B0Z B;  2NZD D;  4Z66 C;  4G92 C;  3MGQ A;  1P3L A;  1WWI A;  2L5A A;  5BNV B;  4H9S C;  5BS7 C;  1BH8 A;  4Z5T A;  3W96 C;  4YS3 B;  1M18 C;  1EQZ B;  4R8P C;  5DNN A;  5AV9 B;  2PYO A;  1M18 D;  3O62 A;  3WTP E;  1P3K D;  3MGQ C;  5AVB B;  3WTP A;  5BT1 C;  4KHA A;  5G49 A;  3MGQ D;  1KX3 A;  2LY8 A;  1P3F A;  3AZE B;  2F8N B;  4Z5T C;  5BT1 D;  3AV1 A;  1P3L D;  5E5A B;  5DNN C;  2ARO B;  4ZBJ C;  4Z5T D;  1F66 C;  3O62 C;  5DNN D;  3WTP C;  2PYO D;  4H9P A;  3O62 D;  2F8N G;  2NZD B;  1KX3 C;  1P3F C;  4J8V A;  3AV1 C;  5CPK A;  1H3O B;  1KX3 D;  4Z66 B;  1P3F D;  3AV1 D;  1P3A A;  5F99 A;  3REK A;  4J8V C;  3W96 B;  5AV5 A;  1M18 B;  5CPK C;  4J8V D;  5CPK D;  1P3A C;  3MGQ B;  5F99 C;  5GT3 C;  3REH A;  1BH8 B;  1P3A D;  5BNX B;  5B24 C;  5F99 D;  3REK C;  4Z5T B;  5DNN B;  3REK D;  3AV2 C;  4ZBJ B;  5AV5 D;  3O62 B;  1F66 B;  3WTP B;  5CPJ A;  4KHA B;  3AFA C;  5G49 B;  3REH C;  1KX3 B;  1KX5 C;  4WU8 C;  1P3F B;  3AV1 B;  1Q9C A;  3REH D; 
#chains in the Genus database with same CATH topology
 3WA9 A;  2FJ7 A;  1P3M A;  3NQU A;  5CPJ C;  4H9P B;  5AV8 A;  1P3O A;  5B33 A;  2BG1 A;  4J8V B;  5CPJ D;  5CPK B;  4KGC A;  3AZK A;  4EO5 C;  3AZI A;  1P3A B;  5F99 B;  3AYW A;  1A7W A;  2JCH A;  5GT3 B;  3AZF A;  3WA9 D;  5AV8 C;  1P3O C;  2FJ7 D;  3REK B;  1P3M D;  3LEL A;  4J8W A;  5AV5 B;  4KGC C;  5AV8 D;  1P3O D;  5B33 D;  4YM6 C;  3AV2 B;  3AZI C;  4KGC D;  2G5I C;  3AYW C;  3AZK D;  3REI C;  3AZF C;  5B32 A;  5B40 A;  3AFA B;  3REH B;  3AZI D;  2BYK B;  5CP6 A;  1S32 A;  3B6G A;  3LEL C;  3AYW D;  3AZF D;  2W8S A;  4LD9 C;  3X1S C;  1M19 A;  4H9Q A;  3LEL D;  4J8W D;  3WKJ A;  5CPJ B;  2Y2H A;  5B32 C;  5B40 C;  3B6F A;  4E45 A;  5CP6 C;  3EPJ A;  2BYM A;  3WAA A;  5B32 D;  5B40 D;  5CP6 D;  1S32 D;  1M19 C;  1P34 C;  3B6G D;  4EO5 B;  3WA9 B;  3WKJ C;  1P3M B;  5B1M A;  1M19 D;  3NQU B;  5CPI A;  3B6F C;  5AV8 B;  1P3O B;  3WKJ D;  2Y2O A;  3WAA C;  3B6F D;  4Z66 A;  3MGR A;  4KGC B;  3TU4 A;  4YM6 B;  3WAA D;  3AZI B;  1AOI A;  4H9S A;  3AYW B;  5B1M C;  3REI B;  3AZF B;  5CPI C;  3W96 A;  3LEL B;  4R8P A;  5B1M D;  4H9N A;  5GSU A;  2Y2P A;  5CPI D;  3MGR C;  5AVC A;  3TU4 C;  3MGS A;  2J8P A;  4LD9 B;  4Z66 D;  3MGR D;  1AOI C;  3FDD A;  3TU4 D;  5B32 B;  5B40 B;  5BNX A;  2UWX A;  1AOI D;  4XZQ C;  5CP6 B;  1S32 B;  3B6G B;  1KU5 A;  3B0D C;  2Y2J A;  3X1T A;  2HIO C;  5GSU C;  1JFI A;  5B2J A;  5AVC C;  3MGS C;  3W96 D;  1M19 B;  2ZY3 A;  4H9Q B;  1F66 A;  4R8P D;  5GSU D;  3WKJ B;  5B32 G;  5AVC D;  3MGS D;  3B6F B;  1B6W A;  3KFU G;  4UPK A;  3LZ1 A;  2BYM B;  4WNN A;  3X1T C;  3WAA B;  5B2J C;  3X1T D;  5B2J D;  5B1M B;  1F66 D;  5CPI B;  3WTP D;  3LZ1 C;  2DF4 C;  3VH5 T;  3MGR B;  4AWL C;  4HGA C;  3TU4 B;  4G92 B;  4NE6 A;  3LZ1 D;  4G91 C;  3VH6 W;  3MGP A;  1AOI B;  2F8N K;  1BH9 B;  5GT3 A;  4KUD A;  5B24 A;  4Z2M G;  1M1A C;  2ZY2 A;  5B1L C;  3B0D B;  4R8P B;  2HIO B;  4H9N B;  3W97 A;  5GSU B;  1R4V A;  3AV2 A;  5AVC B;  3MGS B;  3AZM A;  3MGP C;  5DNM C;  3AFA A;  2JSS A;  4KUD C;  2BYK A;  4H9O A;  1KX5 A;  4WU8 A;  3MVD A;  4CAY A;  3MGP D;  3VH5 A;  5GT3 D;  4KUD D;  3X1T B;  3AL0 C;  3B0B A;  3W97 C;  2Y2K A;  5B24 D;  1JFI B;  5B2J B;  3AZM C;  3W97 D;  3AV2 D;  3UTB C;  5GT0 A;  3AZM D;  2YFV A;  3MVD C;  4DRA A;  3LZ1 B;  3AFA D;  4WNN B;  2Y2G A;  1WWS A;  3B0C T;  4AWL B;  3MVD D;  4HGA B;  3AZN A;  4WU8 D;  1KX5 D;  3W99 C;  4G91 B;  2XD5 A;  1P3G A;  1P3I A;  5GT0 C;  1ZLA C;  3C1B A;  1M1A B;  1P3P A;  5GT0 D;  3LJA C;  4WZS B;  4YM6 A;  3AZN C;  5B31 A;  2ZY5 A;  4DRB A;  1P3G C;  3MGP B;  2HUE C;  3AZN D;  3REI A;  1P3I C;  1KX4 A;  4JJN A;  4KUD B;  3AZJ A;  5B24 B;  1P3G D;  3C1B C;  1P3I D;  3REJ C;  1P3P C;  3W97 B;  4LD9 A;  3X1S A;  5B31 C;  3C1B D;  3AZM B;  3REL A;  1P3P D;  4YM6 D;  1KX4 C;  5B31 D;  4JJN C;  4H9O B;  1KX5 B;  4WU8 B;  3MVD B;  4CAY B;  3AZG A;  3AZJ C;  3REI D;  1KX4 D;  4JJN D;  1N1J A;  3AZJ D;  3KSY A;  4WU9 A;  1P34 A;  3KUY A;  2F2A C;  3REL C;  2CWE A;  3A6N A;  4LD9 D;  3X1S D;  5GT0 B;  1ZLA B;  3REL D;  2YFV B;  1P3B A;  3AZG C;  3LJA B;  5JRG A;  5GXQ A;  3AZN B;  3AZG D;  4WU9 C;  3KUY C;  3W98 A;  1P3G B;  2HUE B;  3A6N C;  1P3I B;  4WU9 D;  1P34 D;  3KUY D;  5B0Y A;  4NFT A;  1P3B C;  3C1B B;  3A6N D;  1P3P B;  5JRG C;  5GXQ C;  1P3B D;  5B31 B;  3W98 C;  2Y2I A;  5GXQ D;  1BH9 A;  5JRG D;  3MNN C;  1KX4 B;  4JJN B;  4CSR A;  4J8X A;  3W98 D;  5B0Y C;  4XZQ A;  3AZJ B;  2HIO A;  5B31 G;  5B0Y D;  3X1S B;  2G5H C;  3REL B;  5AV6 A;  1BFM A;  4J8X C;  3AZE C;  3X1U A;  3AZG B;  3UT9 A;  4DQY B;  1N1J B;  4J8X D;  4XZQ D;  4WU9 B;  1P34 B;  3KUY B;  2HIO D;  5AV6 C;  5KDM A;  3A6N B;  1W2E A;  4WV4 B;  3X1U C;  4NE5 A;  2YFW A;  1P3B B;  5BO0 A;  5AV6 D;  5C3I C;  3UT9 C;  5JRG B;  5GXQ B;  3LZ0 A;  3X1U D;  3EPH A;  3UT9 D;  4WJ3 C;  3W98 B;  3MNN B;  5AY8 A;  3C1C A;  5CHL B;  1M1A A;  5B0Y B;  1Z2C B;  3H0M C;  5B1L A;  1P3K C;  4UUZ A;  3NQJ A;  3LZ0 C;  4E44 A;  1P3L C;  5AY8 C;  5DNM A;  3LZ0 D;  3C1C C;  4CSR B;  4J8X B;  4M6B A;  4XZQ B;  5AY8 D;  3C1C D;  1ID3 A;  3P5J B;  2PYO C;  1M1A D;  5B1L D;  3UTB A;  5AV6 B;  1ULY A;  3AZH A;  3X1U B;  4NE3 A;  5DNM D;  5C3I B;  3UT9 B;  1ID3 C;  4QLC A;  3R45 A;  1HQ3 A;  3W99 A;  5B2I A;  1ID3 D;  5KDM B;  1ZLA A;  2IO5 C;  3AZH C;  2YFW B;  3UTB D;  5BO0 B;  1P3K B;  3LJA A;  3V9R A;  4ZUX A;  3AZH D;  4QLC C;  4H9R A;  3LZ0 B;  1HQ3 C;  2CV5 A;  5B2I C;  3AN2 A;  1P3L B;  4QLC D;  5AY8 B;  1HQ3 D;  1TZY A;  1B67 A;  3W99 D;  5B2I D;  3C1C B;  2JE5 A;  3X1V A;  1HTA A;  3UTA A;  4XUJ A;  5AV5 C;  5B1L B;  3REJ A;  1ZLA D;  5FUG A;  4UUZ B;  4ZUX C;  1U35 A;  2PYO B;  3NQJ B;  2CV5 C;  3AN2 C;  3LJA D;  4ZUX D;  5DNM B;  1TZY C;  3X1V C;  2CV5 D;  4X23 A;  3AN2 D;  3EPK A;  3UTA C;  2DQN C;  4XUJ C;  3KWQ A;  1TAF A;  4J8U A;  1TZY D;  3X1V D;  1ID3 B;  2ZM5 A;  1U35 C;  3UTA D;  3F6T A;  4XUJ D;  2NQB A;  3REJ D;  1U35 D;  3UTB B;  5JA4 A;  2IO5 B;  4X23 C;  3AZH B;  3AZL A;  3KWQ C;  3KXB A;  4J8U C;  2F8N H;  4X23 D;  4QLC B;  3R45 B;  1HQ3 B;  3W99 B;  3KWQ D;  3WA9 C;  5B2I B;  2NQB C;  2FJ7 C;  4J8U D;  1P3M C;  2NQB D;  5B33 C;  2XD1 A;  5B0Z A;  3AZL C;  3VH5 W;  3KXB C;  3V9R B;  4ZUX B;  3AZK C;  3A1K A;  4H9R B;  4Z2M H;  3AZL D;  2CV5 B;  3KXB D;  3AN2 B;  3MNN A;  5BNV A;  3VH6 T;  1TZY B;  3X1V B;  4YS3 A;  3UTA B;  1EQZ A;  4XUJ B;  5AV9 A;  5B0Z C;  4J8W C;  3REJ B;  5FUG B;  1U35 B;  5AVB A;  5B0Z D;  1F1E A;  3EG5 B;  3AZE A;  2F8N A;  4X23 B;  4YS3 C;  1S32 C;  3MNN D;  5E5A A;  1EQZ C;  3B6G C;  5AV9 C;  2ARO A;  3KWQ B;  1TAF B;  4J8U B;  4YS3 D;  3H0L C;  1EQZ D;  5AV9 D;  3VH6 A;  5AVB C;  2NQB B;  2FJ7 B;  2NZD A;  5AVB D;  5JA4 B;  2RVQ C;  5B33 B;  2RIQ A;  5E5A C;  3B0C W;  2ARO C;  2ZY4 A;  1H3O A;  3AZL B;  3KXB B;  3AZE D;  2F8N D;  2RVQ D;  3AZK B;  5E5A D;  2ARO D;  2Y2Q A;  5BS7 A;  2NZD C;  1M18 A;  1P3K A;  4J8W B;  5B0Z B;  2NZD D;  4Z66 C;  4G92 C;  3MGQ A;  3IP4 C;  1P3L A;  1WWI A;  2Y2N A;  2L5A A;  5BNV B;  4H9S C;  5BS7 C;  1BH8 A;  4Z5T A;  3W96 C;  4YS3 B;  1M18 C;  1EQZ B;  4R8P C;  1T3U A;  5DNN A;  5AV9 B;  3A1I A;  2PYO A;  1M18 D;  3O62 A;  3WTP E;  1P3K D;  3MGQ C;  5AVB B;  3WTP A;  5BT1 C;  4KHA A;  5G49 A;  3MGQ D;  1KX3 A;  2LY8 A;  1P3F A;  3AZE B;  2F8N B;  4Z5T C;  5BT1 D;  3AV1 A;  1P3L D;  5E5A B;  5DNN C;  3H0R C;  2ARO B;  4ZBJ C;  4Z5T D;  1F66 C;  3O62 C;  5DNN D;  3WTP C;  2PYO D;  4H9P A;  3O62 D;  2F8N G;  2NZD B;  1KX3 C;  1P3F C;  4J8V A;  3AV1 C;  5CPK A;  1H3O B;  1KX3 D;  4Z66 B;  1P3F D;  3AV1 D;  1P3A A;  5F99 A;  2Y2L A;  3REK A;  4J8V C;  3W96 B;  5AV5 A;  1M18 B;  5CPK C;  1PZR A;  3EPL A;  4J8V D;  5CPK D;  1P3A C;  3MGQ B;  5F99 C;  2Y2M A;  2VQR A;  5GT3 C;  3REH A;  1BH8 B;  1P3A D;  5BNX B;  5B24 C;  5F99 D;  3REK C;  4Z5T B;  5DNN B;  3REK D;  3AV2 C;  4ZBJ B;  5AV5 D;  3O62 B;  1F66 B;  3WTP B;  5CPJ A;  4KHA B;  3AFA C;  5G49 B;  3REH C;  2FFF B;  1KX3 B;  1KX5 C;  4WU8 C;  1P3F B;  3AV1 B;  1Q9C A;  3REH D; 
#chains in the Genus database with same CATH homology
 3WA9 A;  2FJ7 A;  1P3M A;  3NQU A;  5CPJ C;  4H9P B;  5AV8 A;  1P3O A;  5B33 A;  2BG1 A;  4J8V B;  5CPJ D;  5CPK B;  4KGC A;  3AZK A;  4EO5 C;  3AZI A;  1P3A B;  5F99 B;  3AYW A;  1A7W A;  2JCH A;  5GT3 B;  3AZF A;  3WA9 D;  5AV8 C;  1P3O C;  2FJ7 D;  3REK B;  1P3M D;  3LEL A;  4J8W A;  5AV5 B;  4KGC C;  5AV8 D;  1P3O D;  5B33 D;  4YM6 C;  3AV2 B;  3AZI C;  4KGC D;  2G5I C;  3AYW C;  3AZK D;  3REI C;  3AZF C;  5B32 A;  5B40 A;  3AFA B;  3REH B;  3AZI D;  2BYK B;  5CP6 A;  1S32 A;  3B6G A;  3LEL C;  3AYW D;  3AZF D;  2W8S A;  4LD9 C;  3X1S C;  1M19 A;  4H9Q A;  3LEL D;  4J8W D;  3WKJ A;  5CPJ B;  2Y2H A;  5B32 C;  5B40 C;  3B6F A;  4E45 A;  5CP6 C;  3EPJ A;  2BYM A;  3WAA A;  5B32 D;  5B40 D;  5CP6 D;  1S32 D;  1M19 C;  1P34 C;  3B6G D;  4EO5 B;  3WA9 B;  3WKJ C;  1P3M B;  5B1M A;  1M19 D;  3NQU B;  5CPI A;  3B6F C;  5AV8 B;  1P3O B;  3WKJ D;  2Y2O A;  3WAA C;  3B6F D;  4Z66 A;  3MGR A;  4KGC B;  3TU4 A;  4YM6 B;  3WAA D;  3AZI B;  1AOI A;  4H9S A;  3AYW B;  5B1M C;  3REI B;  3AZF B;  5CPI C;  3W96 A;  3LEL B;  4R8P A;  5B1M D;  4H9N A;  5GSU A;  2Y2P A;  5CPI D;  3MGR C;  5AVC A;  3TU4 C;  3MGS A;  2J8P A;  4LD9 B;  4Z66 D;  3MGR D;  1AOI C;  3FDD A;  3TU4 D;  5B32 B;  5B40 B;  5BNX A;  2UWX A;  1AOI D;  4XZQ C;  5CP6 B;  1S32 B;  3B6G B;  1KU5 A;  3B0D C;  2Y2J A;  3X1T A;  2HIO C;  5GSU C;  1JFI A;  5B2J A;  5AVC C;  3MGS C;  3W96 D;  1M19 B;  2ZY3 A;  4H9Q B;  1F66 A;  4R8P D;  5GSU D;  3WKJ B;  5B32 G;  5AVC D;  3MGS D;  3B6F B;  1B6W A;  3KFU G;  4UPK A;  3LZ1 A;  2BYM B;  4WNN A;  3X1T C;  3WAA B;  5B2J C;  3X1T D;  5B2J D;  5B1M B;  1F66 D;  5CPI B;  3WTP D;  3LZ1 C;  2DF4 C;  3VH5 T;  3MGR B;  4AWL C;  4HGA C;  3TU4 B;  4G92 B;  4NE6 A;  3LZ1 D;  4G91 C;  3VH6 W;  3MGP A;  1AOI B;  2F8N K;  1BH9 B;  5GT3 A;  4KUD A;  5B24 A;  4Z2M G;  1M1A C;  2ZY2 A;  5B1L C;  3B0D B;  4R8P B;  2HIO B;  4H9N B;  3W97 A;  5GSU B;  1R4V A;  3AV2 A;  5AVC B;  3MGS B;  3AZM A;  3MGP C;  5DNM C;  3AFA A;  2JSS A;  4KUD C;  2BYK A;  4H9O A;  1KX5 A;  4WU8 A;  3MVD A;  4CAY A;  3MGP D;  3VH5 A;  5GT3 D;  4KUD D;  3X1T B;  3AL0 C;  3B0B A;  3W97 C;  2Y2K A;  5B24 D;  1JFI B;  5B2J B;  3AZM C;  3W97 D;  3AV2 D;  3UTB C;  5GT0 A;  3AZM D;  2YFV A;  3MVD C;  4DRA A;  3LZ1 B;  3AFA D;  4WNN B;  2Y2G A;  1WWS A;  3B0C T;  4AWL B;  3MVD D;  4HGA B;  3AZN A;  4WU8 D;  1KX5 D;  3W99 C;  4G91 B;  2XD5 A;  1P3G A;  1P3I A;  5GT0 C;  1ZLA C;  3C1B A;  1M1A B;  1P3P A;  5GT0 D;  3LJA C;  4WZS B;  4YM6 A;  3AZN C;  5B31 A;  2ZY5 A;  4DRB A;  1P3G C;  3MGP B;  2HUE C;  3AZN D;  3REI A;  1P3I C;  1KX4 A;  4JJN A;  4KUD B;  3AZJ A;  5B24 B;  1P3G D;  3C1B C;  1P3I D;  3REJ C;  1P3P C;  3W97 B;  4LD9 A;  3X1S A;  5B31 C;  3C1B D;  3AZM B;  3REL A;  1P3P D;  4YM6 D;  1KX4 C;  5B31 D;  4JJN C;  4H9O B;  1KX5 B;  4WU8 B;  3MVD B;  4CAY B;  3AZG A;  3AZJ C;  3REI D;  1KX4 D;  4JJN D;  1N1J A;  3AZJ D;  3KSY A;  4WU9 A;  1P34 A;  3KUY A;  2F2A C;  3REL C;  2CWE A;  3A6N A;  4LD9 D;  3X1S D;  5GT0 B;  1ZLA B;  3REL D;  2YFV B;  1P3B A;  3AZG C;  3LJA B;  5JRG A;  5GXQ A;  3AZN B;  3AZG D;  4WU9 C;  3KUY C;  3W98 A;  1P3G B;  2HUE B;  3A6N C;  1P3I B;  4WU9 D;  1P34 D;  3KUY D;  5B0Y A;  4NFT A;  1P3B C;  3C1B B;  3A6N D;  1P3P B;  5JRG C;  5GXQ C;  1P3B D;  5B31 B;  3W98 C;  2Y2I A;  5GXQ D;  1BH9 A;  5JRG D;  3MNN C;  1KX4 B;  4JJN B;  4CSR A;  4J8X A;  3W98 D;  5B0Y C;  4XZQ A;  3AZJ B;  2HIO A;  5B31 G;  5B0Y D;  3X1S B;  2G5H C;  3REL B;  5AV6 A;  1BFM A;  4J8X C;  3AZE C;  3X1U A;  3AZG B;  3UT9 A;  4DQY B;  1N1J B;  4J8X D;  4XZQ D;  4WU9 B;  1P34 B;  3KUY B;  2HIO D;  5AV6 C;  5KDM A;  3A6N B;  1W2E A;  4WV4 B;  3X1U C;  4NE5 A;  2YFW A;  1P3B B;  5BO0 A;  5AV6 D;  5C3I C;  3UT9 C;  5JRG B;  5GXQ B;  3LZ0 A;  3X1U D;  3EPH A;  3UT9 D;  4WJ3 C;  3W98 B;  3MNN B;  5AY8 A;  3C1C A;  5CHL B;  1M1A A;  5B0Y B;  1Z2C B;  3H0M C;  5B1L A;  1P3K C;  4UUZ A;  3NQJ A;  3LZ0 C;  4E44 A;  1P3L C;  5AY8 C;  5DNM A;  3LZ0 D;  3C1C C;  4CSR B;  4J8X B;  4M6B A;  4XZQ B;  5AY8 D;  3C1C D;  1ID3 A;  3P5J B;  2PYO C;  1M1A D;  5B1L D;  3UTB A;  5AV6 B;  1ULY A;  3AZH A;  3X1U B;  4NE3 A;  5DNM D;  5C3I B;  3UT9 B;  1ID3 C;  4QLC A;  3R45 A;  1HQ3 A;  3W99 A;  5B2I A;  1ID3 D;  5KDM B;  1ZLA A;  2IO5 C;  3AZH C;  2YFW B;  3UTB D;  5BO0 B;  1P3K B;  3LJA A;  3V9R A;  4ZUX A;  3AZH D;  4QLC C;  4H9R A;  3LZ0 B;  1HQ3 C;  2CV5 A;  5B2I C;  3AN2 A;  1P3L B;  4QLC D;  5AY8 B;  1HQ3 D;  1TZY A;  1B67 A;  3W99 D;  5B2I D;  3C1C B;  2JE5 A;  3X1V A;  1HTA A;  3UTA A;  4XUJ A;  5AV5 C;  5B1L B;  3REJ A;  1ZLA D;  5FUG A;  4UUZ B;  4ZUX C;  1U35 A;  2PYO B;  3NQJ B;  2CV5 C;  3AN2 C;  3LJA D;  4ZUX D;  5DNM B;  1TZY C;  3X1V C;  2CV5 D;  4X23 A;  3AN2 D;  3EPK A;  3UTA C;  2DQN C;  4XUJ C;  3KWQ A;  1TAF A;  4J8U A;  1TZY D;  3X1V D;  1ID3 B;  2ZM5 A;  1U35 C;  3UTA D;  3F6T A;  4XUJ D;  2NQB A;  3REJ D;  1U35 D;  3UTB B;  5JA4 A;  2IO5 B;  4X23 C;  3AZH B;  3AZL A;  3KWQ C;  3KXB A;  4J8U C;  2F8N H;  4X23 D;  4QLC B;  3R45 B;  1HQ3 B;  3W99 B;  3KWQ D;  3WA9 C;  5B2I B;  2NQB C;  2FJ7 C;  4J8U D;  1P3M C;  2NQB D;  5B33 C;  2XD1 A;  5B0Z A;  3AZL C;  3VH5 W;  3KXB C;  3V9R B;  4ZUX B;  3AZK C;  3A1K A;  4H9R B;  4Z2M H;  3AZL D;  2CV5 B;  3KXB D;  3AN2 B;  3MNN A;  5BNV A;  3VH6 T;  1TZY B;  3X1V B;  4YS3 A;  3UTA B;  1EQZ A;  4XUJ B;  5AV9 A;  5B0Z C;  4J8W C;  3REJ B;  5FUG B;  1U35 B;  5AVB A;  5B0Z D;  1F1E A;  3EG5 B;  3AZE A;  2F8N A;  4X23 B;  4YS3 C;  1S32 C;  3MNN D;  5E5A A;  1EQZ C;  3B6G C;  5AV9 C;  2ARO A;  3KWQ B;  1TAF B;  4J8U B;  4YS3 D;  3H0L C;  1EQZ D;  5AV9 D;  3VH6 A;  5AVB C;  2NQB B;  2FJ7 B;  2NZD A;  5AVB D;  5JA4 B;  2RVQ C;  5B33 B;  2RIQ A;  5E5A C;  3B0C W;  2ARO C;  2ZY4 A;  1H3O A;  3AZL B;  3KXB B;  3AZE D;  2F8N D;  2RVQ D;  3AZK B;  5E5A D;  2ARO D;  2Y2Q A;  5BS7 A;  2NZD C;  1M18 A;  1P3K A;  4J8W B;  5B0Z B;  2NZD D;  4Z66 C;  4G92 C;  3MGQ A;  3IP4 C;  1P3L A;  1WWI A;  2Y2N A;  2L5A A;  5BNV B;  4H9S C;  5BS7 C;  1BH8 A;  4Z5T A;  3W96 C;  4YS3 B;  1M18 C;  1EQZ B;  4R8P C;  1T3U A;  5DNN A;  5AV9 B;  3A1I A;  2PYO A;  1M18 D;  3O62 A;  3WTP E;  1P3K D;  3MGQ C;  5AVB B;  3WTP A;  5BT1 C;  4KHA A;  5G49 A;  3MGQ D;  1KX3 A;  2LY8 A;  1P3F A;  3AZE B;  2F8N B;  4Z5T C;  5BT1 D;  3AV1 A;  1P3L D;  5E5A B;  5DNN C;  3H0R C;  2ARO B;  4ZBJ C;  4Z5T D;  1F66 C;  3O62 C;  5DNN D;  3WTP C;  2PYO D;  4H9P A;  3O62 D;  2F8N G;  2NZD B;  1KX3 C;  1P3F C;  4J8V A;  3AV1 C;  5CPK A;  1H3O B;  1KX3 D;  4Z66 B;  1P3F D;  3AV1 D;  1P3A A;  5F99 A;  2Y2L A;  3REK A;  4J8V C;  3W96 B;  5AV5 A;  1M18 B;  5CPK C;  1PZR A;  3EPL A;  4J8V D;  5CPK D;  1P3A C;  3MGQ B;  5F99 C;  2Y2M A;  2VQR A;  5GT3 C;  3REH A;  1BH8 B;  1P3A D;  5BNX B;  5B24 C;  5F99 D;  3REK C;  4Z5T B;  5DNN B;  3REK D;  3AV2 C;  4ZBJ B;  5AV5 D;  3O62 B;  1F66 B;  3WTP B;  5CPJ A;  4KHA B;  3AFA C;  5G49 B;  3REH C;  2FFF B;  1KX3 B;  1KX5 C;  4WU8 C;  1P3F B;  3AV1 B;  1Q9C A;  3REH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...