4H9OA

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIMALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 29
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oA00
1HQ3C 5GT0B 1KX4D 5AY8A 3NQJB 5BT1D 3AZGD 5GSUB 2BYKA 5B0YA 3TU4B 5B24A 3AZNC 5GT0C 3R45B 2YFVA 5FUGB 5GSUC 3TU4C 3AZLA 4JJNA 5CPKD 4KUDA 1WWIA 1JFIB 3AZIA 2RVQC 3B0BA 4H9RA 3NQUA 3AN2C 4WU9C 1EQZD 1P3BA 4J8UD 1ULYA 3KXBB 4Z5TA 1F1EA 3X1VA 3MGSD 3W98D 4YS3B 3O62A 3UTBB 3KXBC 1P34A 3B6GD 4DRAA 4H9OB 3V9RA 5GXQA 3UTBC 1S32A 4UUZA 3WTPC 4J8WA 2FJ7B 2NQBD 3B6FB 1N1JA 4WZSB 3AZJB 5JRGD 4ZUXD 5B40D 2FJ7C 3C1CB 1P3LB 3C1BD 4QLCD 3B6FC 3REIA 3AZJC 1AOID 1P3FD 1M19B 1P3LC 1P3KB 1ID3B 3AYWB 5BS7A 5DNMD 3UT9D 1U35B 5B2IB 4YM6D 1P3MA 1M18A 1KX4A 3REKD 1M19C 1P3KC 3AZGA 1ID3C 3AYWC 1U35C 5B2IC 4WU8A 3KUYA 5B1LD 3VH6W 3MGPD 1P3OB 5AVCD 2AROB 3A6NB 3A6NA 5DNNC 1P3OC 1H3OA 5CPIB 2AROC 4R8PB 3KSYA 4R8PA 4KGCB 5CPIC 4XUJD 4G92B 1TZYD 3MVDA 2CV5D 4KGCC 3MGSA 2NZDD 3W98A 5CP6B 2CWEA 3MGQB 4LD9B 4G92C 3AZED 1B6WA 2HIOD 4Z66D 3LZ1B 5CP6C 4LD9C 3MGQC 5AV6D 3W99C 2NQBA 2BYMA 5B32B 1P3ID 1HQ3D 3LZ1C 3AZFD 4ZUXA 5AV5B 5JRGA 3WAAA 5GT3D 3WAAB 3AZHA 1P3PB 3AZND 3W97D 5B32C 3C1BA 5GT0D 1ZLAC 5AV5C 1P3FA 4X23B 1P3PC 3TU4D 3LELB 4M6BA 5AV8B 5DNMA 5B31C 3LZ0B 4YM6A 3AV2D 3WKJB 3LJAA 4E44A 4X23C 3REKA 2RVQD 3LELC 4XZQA 4J8VB 3AV1B 5AV8C 1BH8B 3LZ0C 4WU9D 3AN2D 2PYOA 5B1LA 4NE5A 3REHB 3REHA 1F66D 3MGPA 5AVBA 5AVCA 1M1AA 3KWQB 3MGRD 4H9QA 5KDMA 1WWSA 3KWQC 3UTAB 3WTPD 4E45A 4H9PA 5B2JD 5AY8B 4H9SC 5B1MA 4NE6A 2BYKB 5B0YB 4WV4B 5B24B 2NZDA 5AY8C 5B33A 5B33B 3B6FD 2YFVB 3AZJD 5B0YC 3AZLB 5B24C 2HIOA 4JJNB 1P3LD 4KUDB 4Z2MH 5AV6A 3AZIB 1P3IA 3AZLC 4JJNC 3AZFA 4H9RB 4KUDC 3NQUB 5GT3A 1P3KD 1ID3D 3AZIC 3W97A 5BNVA 5CPJA 3AZMD 1P3BB 2F8NG 4WNNA 4CSRA 1KX5D 4Z5TB 1P3GA 5B0ZD 3X1VB 5E5AA 3MNNA 1P3BC 3RELD 3O62B 3AV2A 4CAYA 3X1UA 3WA9A 1P34B 2F8NA 5DNND 3X1VC 5BO0B 5BO0A 3V9RB 5GXQB 4YS3C 3O62C 3AN2A 1S32B 2HUEB 4UUZB 4J8WB 3X1TA 1P34C 1N1JB 5GXQC 1S32C 1F66A 3REJD 2HUEC 1KX3D 3MGRA 3VH5T 3REIB 3C1CC 5G49A 5CP6D 4LD9D 1M18B 3REIC 4KHAA 1P3MB 3W99D 1KX4B 5B2JA 3AZGB 5BS7C 1M18C 1P3MC 4WU8B 3KUYB 5B32D 1ZLAD 5BT1C 3AZGC 3W96D 5AV5D 4WU8C 3X1SD 3KUYC 5CPKA 5CPKB 1P3PD 3VH5W 5B31D 4J8XD 4X23D 1H3OB 3VH6A 5AV8D 5F99D 1EQZA 3A6NC 5BNXB 5BNXA 3AZMA 4J8UA 3AFAD 3MVDB 1KX5A 4R8PC 4HGAB 5B0ZA 1BH9A 4ZBJB 3MGSB 4Z2MG 5AV9D 1P3AD 3RELA 3W98B 4AWLB 3MVDC 2F8NH 3B6GA 4ZBJC 3MGSC 3W98C 3B0CT 3AZKD 2NQBB 2BYMB 5JRGB 4ZUXB 3REJA 1KX3A 5B40A 3AZHB 2NQBC 1TAFA 3C1BB 4QLCA 1AOIA 5JRGC 4ZUXC 1P3FB 3WAAC 5GSUD 3AZHC 3C1BC 1Q9CA 5DNMB 3UT9A 4YM6B 1P3FC 3LJAB 3W99A 3REKB 4XZQB 3B0CW 4KUDD 5DNMC 4YM6C 3WKJC 3LJAC 3AZID 3REKC 2PYOB 4G91B 5B1LB 4XZQC 3W96A 4J8VC 1HTAA 3AV1C 3MGPB 3X1SA 5AVBB 5AVCB 2F8NK 4G91C 2PYOC 5B1LC 1M1AB 4J8XA 3REHC 3KXBD 3MGPC 5AVBC 4EO5B 3X1VD 1R4VA 4H9QB 5KDMB 5F99A 1M1AC 4YS3D 3UTBD 4H9PB 4H9NA 3AFAA 1P34D 4EO5C 4XUJA 1TZYA 5B1MB 5C3IB 2CV5A 5GXQD 3UTAC 1S32D 5AV9A 1P3AA 2FJ7D 2NZDB 5B1MC 5C3IC 3AZEA 2HIOB 4Z66A 2NZDC 3C1CD 5B33C 5AV6B 3AZKA 3REID 2YFWA 1P3IB 1HQ3B 1HQ3A 3AZFB 4H9SA 1M19D 5CHLB 5GT3B 5AV6C 3AYWD 1M18D 1U35D 3AZNB 3AZNA 1P3MD 5B2ID 3W97B 1P3IC 5BNVB 5CPJB 5GT0A 3AZFC 4WNNB 3NQJA 4CSRB 5GT3C 5GSUA 1P3GB 3TU4A 3W97C 4WU8D 3KUYD 5E5AB 3MNNB 5CPJC 3AV2B 3R45A 4CAYB 4Z5TC 5FUGA 3X1UB 1P3GC 3WA9B 3B0DB 2F8NB 1P3OD 5E5AC 3MNNC 2AROD 3AN2B 3AV2C 4WU9B 4WU9A 1JFIA 3A6ND 3X1UC 3X1TB 3WA9C 3B0DC 5CPID 1F66B 4R8PD 4J8WC 3X1TC 4KGCD 3MGRB 3MVDD 3KXBA 1F66C 5G49B 3MGRC 4YS3A 3UTBA 3MGQD 4KHAB 4NFTA 3WTPB 3WTPA 5B2JB 4H9OA 4NE3A 3LZ1D 2FJ7A 1KX4C 5B2JC 3WTPE 3B6FA 3AZJA 3VH6T 3WAAD 3AZHD 3C1CA 1P3LA 1KU5A 5CPKC 1M19A 3LELD 1P3KA 1ID3A 3AYWA 1EQZB 1U35A 3LZ0D 1B67A 5B2IA 3WKJD 3LJAD 3AZMB 4J8UB 3VH5A 4XZQD 1KX5B 4J8VD 1BFMA 3AV1D 1EQZC 5B0ZB 1BH9B 3AZMC 4J8UC 3RELB 2PYOD 1A7WA 1KX5C 5JA4B 5JA4A 4HGAC 5B0ZC 5DNNB 5DNNA 3REHD 5AVBD 1P3OA 3B6GB 3RELC 2AROA 4AWLC 1M1AD 3KWQD 3B6GC 5CPIA 3REJB 1KX3B 5B40B 3UTAD 2JSSA 4KGCA 1TAFB 4QLCB 1AOIB 5AY8D 5B1MD 3REJC 1KX3C 5B40C 5B0YD 5B24D 4QLCC 5B32G 5CP6A 4LD9A 3MGQA 3UT9B 5B33D 1AOIC 3W99B 3AZLD 3LZ1A 4JJND 3UT9C 5B31G 5B32A 1ZLAB 1ZLAA 3W96B 5AV5A 3X1SB 1P3PA 4DRBA 5CPJD 1P3BD 2L5AA 3W96C 5B31B 5B31A 4J8XB 4X23A 4Z5TD 3X1SC 1P3GD 5AVCC 3LELA 5E5AD 3MNND 5AV8A 5F99B 3LZ0A 3O62D 4J8XC 3WKJA 3X1UD 3AFAB 4H9NB 3WA9D 2F8ND 4XUJB 1TZYB 4J8VA 3AV1A 5F99C 1BH8A 2CV5B 5AV9B 4J8WD 1P3AB 3X1TD 3AFAC 2LY8A 4XUJC 1TZYC 3AZEB 2CV5C 5AV9C 1P3AC 4Z66B 2IO5B 3KWQA 3AZKB 3AZEC 2YFWB 2HIOC 4Z66C 2IO5C 3UTAA 3AZKC
chains in the Genus database with same CATH superfamily
1HQ3C 5GT0B 1KX4D 5AY8A 3NQJB 5BT1D 3AZGD 5GSUB 2F2AC 2BYKA 5B0YA 3TU4B 5B24A 3AZNC 5GT0C 3H0RC 3R45B 2YFVA 5FUGB 5GSUC 3TU4C 3AZLA 4JJNA 5CPKD 4KUDA 1WWIA 1JFIB 1Z2CB 3AZIA 2RVQC 3B0BA 4H9RA 3NQUA 3AN2C 4WU9C 1EQZD 2Y2OA 1P3BA 4J8UD 1ULYA 3KXBB 4Z5TA 1F1EA 3X1VA 3MGSD 3W98D 4YS3B 3O62A 3UTBB 4UPKA 3KXBC 1P34A 3B6GD 4DRAA 4H9OB 3V9RA 5GXQA 3UTBC 1S32A 4UUZA 3WTPC 4J8WA 2FJ7B 2NQBD 2XD1A 3B6FB 1N1JA 4WZSB 2G5IC 3AZJB 5JRGD 4ZUXD 5B40D 2FJ7C 3C1CB 1P3LB 3C1BD 4QLCD 3F6TA 3B6FC 3A1KA 3REIA 3AZJC 1AOID 1P3FD 1M19B 1P3LC 1P3KB 1ID3B 3AYWB 5BS7A 5DNMD 3UT9D 3P5JB 5B2IB 4YM6D 1U35B 1P3MA 1M18A 1KX4A 3REKD 1M19C 1P3KC 3AZGA 1ID3C 3AYWC 1U35C 5B2IC 4WU8A 3KUYA 2Y2NA 5B1LD 3VH6W 2JCHA 3MGPD 1P3OB 5AVCD 2AROB 3A6NB 3A6NA 2W8SA 5DNNC 1P3OC 1H3OA 5CPIB 2AROC 4R8PB 3KSYA 4R8PA 4KGCB 5CPIC 4XUJD 4G92B 1TZYD 3MVDA 2CV5D 4KGCC 3MGSA 2NZDD 3W98A 5CP6B 2CWEA 3MGQB 4LD9B 4G92C 3AZED 2G5HC 1B6WA 2HIOD 2ZY5A 4Z66D 3LZ1B 5CP6C 4LD9C 3MGQC 5AV6D 3W99C 2NQBA 2BYMA 5B32B 1P3ID 1HQ3D 3LZ1C 3AZFD 4ZUXA 5AV5B 5JRGA 3WAAA 5GT3D 3WAAB 2VQRA 3AZHA 1P3PB 3AZND 3W97D 5B32C 3C1BA 5GT0D 1ZLAC 5AV5C 2Y2IA 1P3FA 4X23B 1P3PC 3TU4D 3LELB 4M6BA 5AV8B 5DNMA 5B31C 3LZ0B 4YM6A 3AV2D 3WKJB 3LJAA 4E44A 4X23C 3REKA 2RVQD 3LELC 4XZQA 4J8VB 3AV1B 5AV8C 1BH8B 3LZ0C 4WU9D 3AN2D 2PYOA 5B1LA 4NE5A 3REHB 3REHA 1F66D 3MGPA 5AVBA 5AVCA 1M1AA 3KWQB 3MGRD 4H9QA 5KDMA 1WWSA 3KWQC 3UTAB 3WTPD 4E45A 4H9PA 5B2JD 5AY8B 4H9SC 5B1MA 4NE6A 2BYKB 5B0YB 4WV4B 5B24B 2NZDA 5AY8C 5B33A 5B33B 3B6FD 2YFVB 3AZJD 5B0YC 3AZLB 5B24C 2HIOA 4JJNB 1P3LD 4KUDB 2Y2HA 4Z2MH 5AV6A 3AZIB 1P3IA 3AZLC 4JJNC 3AZFA 4H9RB 4KUDC 3NQUB 5GT3A 1P3KD 1ID3D 3AZIC 3W97A 5BNVA 5CPJA 3AZMD 1P3BB 2F8NG 4WNNA 4CSRA 1KX5D 4Z5TB 1P3GA 5B0ZD 3X1VB 5E5AA 3MNNA 1P3BC 3RELD 3O62B 3AV2A 4CAYA 3X1UA 3WA9A 1P34B 2F8NA 5DNND 3X1VC 5BO0B 5BO0A 3V9RB 5GXQB 4YS3C 3O62C 3AN2A 1S32B 2HUEB 4UUZB 4J8WB 3X1TA 1P34C 1N1JB 2RIQA 2ZY2A 3EG5B 5GXQC 1S32C 1F66A 3REJD 2HUEC 1KX3D 3MGRA 3VH5T 3REIB 3C1CC 5G49A 3EPHA 5CP6D 4LD9D 1M18B 3REIC 3FDDA 4KHAA 1P3MB 3W99D 1KX4B 5B2JA 3AZGB 5BS7C 1M18C 1P3MC 4WU8B 3KUYB 5B32D 1ZLAD 5BT1C 3AL0C 1T3UA 3AZGC 3W96D 2Y2LA 5AV5D 4WU8C 3X1SD 3KUYC 5CPKA 5CPKB 1P3PD 3VH5W 5B31D 4J8XD 3H0LC 4X23D 1H3OB 2DQNC 3VH6A 5AV8D 5F99D 1EQZA 3A6NC 5BNXB 5BNXA 3AZMA 4J8UA 3AFAD 3MVDB 1KX5A 4R8PC 4HGAB 5B0ZA 1BH9A 4ZBJB 3MGSB 4Z2MG 5AV9D 1P3AD 2XD5A 3RELA 3W98B 4AWLB 3MVDC 2F8NH 3B6GA 4ZBJC 3MGSC 3W98C 3B0CT 3AZKD 2NQBB 2BYMB 1PZRA 5JRGB 4ZUXB 3REJA 1KX3A 5B40A 3AZHB 2NQBC 1TAFA 3C1BB 4QLCA 1AOIA 5JRGC 4ZUXC 1P3FB 3WAAC 5GSUD 3AZHC 3C1BC 1Q9CA 5DNMB 3UT9A 4YM6B 2Y2JA 1P3FC 3LJAB 3W99A 3REKB 2ZY4A 4XZQB 3B0CW 4KUDD 5DNMC 4YM6C 3WKJC 3LJAC 3AZID 3REKC 2PYOB 4G91B 5B1LB 4XZQC 3W96A 4J8VC 1HTAA 3AV1C 3MGPB 3X1SA 5AVBB 5AVCB 2F8NK 4G91C 2PYOC 5B1LC 1M1AB 4J8XA 3REHC 3KXBD 3MGPC 5AVBC 4EO5B 3X1VD 1R4VA 4H9QB 5KDMB 5F99A 1M1AC 4YS3D 3UTBD 4H9PB 4H9NA 3AFAA 1P34D 4EO5C 4XUJA 1TZYA 5B1MB 5C3IB 2CV5A 5GXQD 3UTAC 1S32D 5AV9A 1P3AA 2FJ7D 2NZDB 5B1MC 5C3IC 3H0MC 3AZEA 2DF4C 2Y2MA 2HIOB 4Z66A 2NZDC 3C1CD 5B33C 5AV6B 3AZKA 3REID 2YFWA 1P3IB 1HQ3B 1HQ3A 3A1IA 3AZFB 2JE5A 4H9SA 1M19D 2FFFB 5CHLB 5GT3B 5AV6C 3AYWD 1M18D 1U35D 3AZNB 3AZNA 1P3MD 5B2ID 3W97B 1P3IC 5BNVB 5CPJB 5GT0A 3AZFC 4WNNB 3NQJA 4CSRB 5GT3C 5GSUA 1P3GB 3TU4A 3W97C 4WU8D 3KUYD 5E5AB 3MNNB 5CPJC 3AV2B 3R45A 4CAYB 4Z5TC 5FUGA 3X1UB 1P3GC 3WA9B 3B0DB 2F8NB 1P3OD 5E5AC 3MNNC 2AROD 3AN2B 3AV2C 2BG1A 4WU9B 4WU9A 1JFIA 3A6ND 3X1UC 3X1TB 3WA9C 3B0DC 5CPID 1F66B 4R8PD 4J8WC 3X1TC 4KGCD 3MGRB 3MVDD 3KXBA 1F66C 2ZY3A 5G49B 3MGRC 4YS3A 3UTBA 3MGQD 4KHAB 4NFTA 3WTPB 3WTPA 2Y2QA 5B2JB 4H9OA 3EPJA 4NE3A 3LZ1D 2J8PA 2FJ7A 1KX4C 5B2JC 3WTPE 3B6FA 3AZJA 3VH6T 3WAAD 3AZHD 2Y2KA 3C1CA 1P3LA 1KU5A 5CPKC 1M19A 3LELD 1P3KA 1ID3A 3AYWA 1EQZB 1U35A 3LZ0D 1B67A 3IP4C 5B2IA 3LJAD 3WKJD 3AZMB 4J8UB 1W2EA 3VH5A 4XZQD 2UWXA 4J8VD 1KX5B 3AV1D 1BFMA 1EQZC 5B0ZB 1BH9B 3AZMC 4J8UC 3RELB 2PYOD 2Y2GA 1A7WA 1KX5C 5JA4B 5JA4A 4HGAC 5B0ZC 5DNNB 5DNNA 3REHD 5AVBD 1P3OA 3B6GB 3RELC 2AROA 4AWLC 1M1AD 3KWQD 3EPKA 3B6GC 5CPIA 3REJB 1KX3B 5B40B 3UTAD 2JSSA 4KGCA 1TAFB 4QLCB 1AOIB 5AY8D 5B1MD 3REJC 1KX3C 5B40C 5B0YD 5B24D 4QLCC 5B32G 5CP6A 4LD9A 3MGQA 3UT9B 5B33D 1AOIC 3W99B 3AZLD 3LZ1A 4JJND 4DQYB 3UT9C 5B31G 5B32A 1ZLAB 1ZLAA 3W96B 5AV5A 3X1SB 1P3PA 4DRBA 5CPJD 1P3BD 2L5AA 3W96C 5B31B 5B31A 4J8XB 2Y2PA 4X23A 4Z5TD 3X1SC 1P3GD 3KFUG 5AVCC 3LELA 5E5AD 3MNND 5AV8A 5F99B 3LZ0A 3O62D 4J8XC 3WKJA 3X1UD 3AFAB 4H9NB 3WA9D 2F8ND 4XUJB 1TZYB 4J8VA 4WJ3C 3AV1A 5F99C 1BH8A 2CV5B 5AV9B 4J8WD 1P3AB 3X1TD 3AFAC 2LY8A 4XUJC 1TZYC 3AZEB 2CV5C 5AV9C 1P3AC 4Z66B 2IO5B 3KWQA 3AZKB 3AZEC 2YFWB 2HIOC 4Z66C 3EPLA 2IO5C 3UTAA 3AZKC 2ZM5A
chains in the Genus database with same CATH topology
1HQ3C 5GT0B 1KX4D 5AY8A 3NQJB 5BT1D 3AZGD 5GSUB 2F2AC 2BYKA 5B0YA 3TU4B 5B24A 3AZNC 5GT0C 3H0RC 3R45B 2YFVA 5FUGB 5GSUC 3TU4C 3AZLA 4JJNA 5CPKD 4KUDA 1WWIA 1JFIB 1Z2CB 3AZIA 2RVQC 3B0BA 4H9RA 3NQUA 3AN2C 4WU9C 1EQZD 2Y2OA 1P3BA 4J8UD 1ULYA 3KXBB 4Z5TA 1F1EA 3X1VA 3MGSD 3W98D 4YS3B 3O62A 3UTBB 4UPKA 3KXBC 1P34A 3B6GD 4DRAA 4H9OB 3V9RA 5GXQA 3UTBC 1S32A 4UUZA 3WTPC 4J8WA 2FJ7B 2NQBD 2XD1A 3B6FB 1N1JA 4WZSB 2G5IC 3AZJB 5JRGD 4ZUXD 5B40D 2FJ7C 3C1CB 1P3LB 3C1BD 4QLCD 3F6TA 3B6FC 3A1KA 3REIA 3AZJC 1AOID 1P3FD 1M19B 1P3LC 1P3KB 1ID3B 3AYWB 5BS7A 5DNMD 3UT9D 3P5JB 5B2IB 4YM6D 1U35B 1P3MA 1M18A 1KX4A 3REKD 1M19C 1P3KC 3AZGA 1ID3C 3AYWC 1U35C 5B2IC 4WU8A 3KUYA 2Y2NA 5B1LD 3VH6W 2JCHA 3MGPD 1P3OB 5AVCD 2AROB 3A6NB 3A6NA 2W8SA 5DNNC 1P3OC 1H3OA 5CPIB 2AROC 4R8PB 3KSYA 4R8PA 4KGCB 5CPIC 4XUJD 4G92B 1TZYD 3MVDA 2CV5D 4KGCC 3MGSA 2NZDD 3W98A 5CP6B 2CWEA 3MGQB 4LD9B 4G92C 3AZED 2G5HC 1B6WA 2HIOD 2ZY5A 4Z66D 3LZ1B 5CP6C 4LD9C 3MGQC 5AV6D 3W99C 2NQBA 2BYMA 5B32B 1P3ID 1HQ3D 3LZ1C 3AZFD 4ZUXA 5AV5B 5JRGA 3WAAA 5GT3D 3WAAB 2VQRA 3AZHA 1P3PB 3AZND 3W97D 5B32C 3C1BA 5GT0D 1ZLAC 5AV5C 2Y2IA 1P3FA 4X23B 1P3PC 3TU4D 3LELB 4M6BA 5AV8B 5DNMA 5B31C 3LZ0B 4YM6A 3AV2D 3WKJB 3LJAA 4E44A 4X23C 3REKA 2RVQD 3LELC 4XZQA 4J8VB 3AV1B 5AV8C 1BH8B 3LZ0C 4WU9D 3AN2D 2PYOA 5B1LA 4NE5A 3REHB 3REHA 1F66D 3MGPA 5AVBA 5AVCA 1M1AA 3KWQB 3MGRD 4H9QA 5KDMA 1WWSA 3KWQC 3UTAB 3WTPD 4E45A 4H9PA 5B2JD 5AY8B 4H9SC 5B1MA 4NE6A 2BYKB 5B0YB 4WV4B 5B24B 2NZDA 5AY8C 5B33A 5B33B 3B6FD 2YFVB 3AZJD 5B0YC 3AZLB 5B24C 2HIOA 4JJNB 1P3LD 4KUDB 2Y2HA 4Z2MH 5AV6A 3AZIB 1P3IA 3AZLC 4JJNC 3AZFA 4H9RB 4KUDC 3NQUB 5GT3A 1P3KD 1ID3D 3AZIC 3W97A 5BNVA 5CPJA 3AZMD 1P3BB 2F8NG 4WNNA 4CSRA 1KX5D 4Z5TB 1P3GA 5B0ZD 3X1VB 5E5AA 3MNNA 1P3BC 3RELD 3O62B 3AV2A 4CAYA 3X1UA 3WA9A 1P34B 2F8NA 5DNND 3X1VC 5BO0B 5BO0A 3V9RB 5GXQB 4YS3C 3O62C 3AN2A 1S32B 2HUEB 4UUZB 4J8WB 3X1TA 1P34C 1N1JB 2RIQA 2ZY2A 3EG5B 5GXQC 1S32C 1F66A 3REJD 2HUEC 1KX3D 3MGRA 3VH5T 3REIB 3C1CC 5G49A 3EPHA 5CP6D 4LD9D 1M18B 3REIC 3FDDA 4KHAA 1P3MB 3W99D 1KX4B 5B2JA 3AZGB 5BS7C 1M18C 1P3MC 4WU8B 3KUYB 5B32D 1ZLAD 5BT1C 3AL0C 1T3UA 3AZGC 3W96D 2Y2LA 5AV5D 4WU8C 3X1SD 3KUYC 5CPKA 5CPKB 1P3PD 3VH5W 5B31D 4J8XD 3H0LC 4X23D 1H3OB 2DQNC 3VH6A 5AV8D 5F99D 1EQZA 3A6NC 5BNXB 5BNXA 3AZMA 4J8UA 3AFAD 3MVDB 1KX5A 4R8PC 4HGAB 5B0ZA 1BH9A 4ZBJB 3MGSB 4Z2MG 5AV9D 1P3AD 2XD5A 3RELA 3W98B 4AWLB 3MVDC 2F8NH 3B6GA 4ZBJC 3MGSC 3W98C 3B0CT 3AZKD 2NQBB 2BYMB 1PZRA 5JRGB 4ZUXB 3REJA 1KX3A 5B40A 3AZHB 2NQBC 1TAFA 3C1BB 4QLCA 1AOIA 5JRGC 4ZUXC 1P3FB 3WAAC 5GSUD 3AZHC 3C1BC 1Q9CA 5DNMB 3UT9A 4YM6B 2Y2JA 1P3FC 3LJAB 3W99A 3REKB 2ZY4A 4XZQB 3B0CW 4KUDD 5DNMC 4YM6C 3WKJC 3LJAC 3AZID 3REKC 2PYOB 4G91B 5B1LB 4XZQC 3W96A 4J8VC 1HTAA 3AV1C 3MGPB 3X1SA 5AVBB 5AVCB 2F8NK 4G91C 2PYOC 5B1LC 1M1AB 4J8XA 3REHC 3KXBD 3MGPC 5AVBC 4EO5B 3X1VD 1R4VA 4H9QB 5KDMB 5F99A 1M1AC 4YS3D 3UTBD 4H9PB 4H9NA 3AFAA 1P34D 4EO5C 4XUJA 1TZYA 5B1MB 5C3IB 2CV5A 5GXQD 3UTAC 1S32D 5AV9A 1P3AA 2FJ7D 2NZDB 5B1MC 5C3IC 3H0MC 3AZEA 2DF4C 2Y2MA 2HIOB 4Z66A 2NZDC 3C1CD 5B33C 5AV6B 3AZKA 3REID 2YFWA 1P3IB 1HQ3B 1HQ3A 3A1IA 3AZFB 2JE5A 4H9SA 1M19D 2FFFB 5CHLB 5GT3B 5AV6C 3AYWD 1M18D 1U35D 3AZNB 3AZNA 1P3MD 5B2ID 3W97B 1P3IC 5BNVB 5CPJB 5GT0A 3AZFC 4WNNB 3NQJA 4CSRB 5GT3C 5GSUA 1P3GB 3TU4A 3W97C 4WU8D 3KUYD 5E5AB 3MNNB 5CPJC 3AV2B 3R45A 4CAYB 4Z5TC 5FUGA 3X1UB 1P3GC 3WA9B 3B0DB 2F8NB 1P3OD 5E5AC 3MNNC 2AROD 3AN2B 3AV2C 2BG1A 4WU9B 4WU9A 1JFIA 3A6ND 3X1UC 3X1TB 3WA9C 3B0DC 5CPID 1F66B 4R8PD 4J8WC 3X1TC 4KGCD 3MGRB 3MVDD 3KXBA 1F66C 2ZY3A 5G49B 3MGRC 4YS3A 3UTBA 3MGQD 4KHAB 4NFTA 3WTPB 3WTPA 2Y2QA 5B2JB 4H9OA 3EPJA 4NE3A 3LZ1D 2J8PA 2FJ7A 1KX4C 5B2JC 3WTPE 3B6FA 3AZJA 3VH6T 3WAAD 3AZHD 2Y2KA 3C1CA 1P3LA 1KU5A 5CPKC 1M19A 3LELD 1P3KA 1ID3A 3AYWA 1EQZB 1U35A 3LZ0D 1B67A 3IP4C 5B2IA 3LJAD 3WKJD 3AZMB 4J8UB 1W2EA 3VH5A 4XZQD 2UWXA 4J8VD 1KX5B 3AV1D 1BFMA 1EQZC 5B0ZB 1BH9B 3AZMC 4J8UC 3RELB 2PYOD 2Y2GA 1A7WA 1KX5C 5JA4B 5JA4A 4HGAC 5B0ZC 5DNNB 5DNNA 3REHD 5AVBD 1P3OA 3B6GB 3RELC 2AROA 4AWLC 1M1AD 3KWQD 3EPKA 3B6GC 5CPIA 3REJB 1KX3B 5B40B 3UTAD 2JSSA 4KGCA 1TAFB 4QLCB 1AOIB 5AY8D 5B1MD 3REJC 1KX3C 5B40C 5B0YD 5B24D 4QLCC 5B32G 5CP6A 4LD9A 3MGQA 3UT9B 5B33D 1AOIC 3W99B 3AZLD 3LZ1A 4JJND 4DQYB 3UT9C 5B31G 5B32A 1ZLAB 1ZLAA 3W96B 5AV5A 3X1SB 1P3PA 4DRBA 5CPJD 1P3BD 2L5AA 3W96C 5B31B 5B31A 4J8XB 2Y2PA 4X23A 4Z5TD 3X1SC 1P3GD 3KFUG 5AVCC 3LELA 5E5AD 3MNND 5AV8A 5F99B 3LZ0A 3O62D 4J8XC 3WKJA 3X1UD 3AFAB 4H9NB 3WA9D 2F8ND 4XUJB 1TZYB 4J8VA 4WJ3C 3AV1A 5F99C 1BH8A 2CV5B 5AV9B 4J8WD 1P3AB 3X1TD 3AFAC 2LY8A 4XUJC 1TZYC 3AZEB 2CV5C 5AV9C 1P3AC 4Z66B 2IO5B 3KWQA 3AZKB 3AZEC 2YFWB 2HIOC 4Z66C 3EPLA 2IO5C 3UTAA 3AZKC 2ZM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 C;  5GT0 B;  1KX4 D;  5AY8 A;  3NQJ B;  5BT1 D;  3AZG D;  5GSU B;  2BYK A;  5B0Y A;  3TU4 B;  5B24 A;  3AZN C;  5GT0 C;  3R45 B;  2YFV A;  5FUG B;  5GSU C;  3TU4 C;  3AZL A;  4JJN A;  5CPK D;  4KUD A;  1WWI A;  1JFI B;  3AZI A;  2RVQ C;  3B0B A;  4H9R A;  3NQU A;  3AN2 C;  4WU9 C;  1EQZ D;  1P3B A;  4J8U D;  1ULY A;  3KXB B;  4Z5T A;  1F1E A;  3X1V A;  3MGS D;  3W98 D;  4YS3 B;  3O62 A;  3UTB B;  3KXB C;  1P34 A;  3B6G D;  4DRA A;  4H9O B;  3V9R A;  5GXQ A;  3UTB C;  1S32 A;  4UUZ A;  3WTP C;  4J8W A;  2FJ7 B;  2NQB D;  3B6F B;  1N1J A;  4WZS B;  3AZJ B;  5JRG D;  4ZUX D;  5B40 D;  2FJ7 C;  3C1C B;  1P3L B;  3C1B D;  4QLC D;  3B6F C;  3REI A;  3AZJ C;  1AOI D;  1P3F D;  1M19 B;  1P3L C;  1P3K B;  1ID3 B;  3AYW B;  5BS7 A;  5DNM D;  3UT9 D;  1U35 B;  5B2I B;  4YM6 D;  1P3M A;  1M18 A;  1KX4 A;  3REK D;  1M19 C;  1P3K C;  3AZG A;  1ID3 C;  3AYW C;  1U35 C;  5B2I C;  4WU8 A;  3KUY A;  5B1L D;  3VH6 W;  3MGP D;  1P3O B;  5AVC D;  2ARO B;  3A6N B;  3A6N A;  5DNN C;  1P3O C;  1H3O A;  5CPI B;  2ARO C;  4R8P B;  3KSY A;  4R8P A;  4KGC B;  5CPI C;  4XUJ D;  4G92 B;  1TZY D;  3MVD A;  2CV5 D;  4KGC C;  3MGS A;  2NZD D;  3W98 A;  5CP6 B;  2CWE A;  3MGQ B;  4LD9 B;  4G92 C;  3AZE D;  1B6W A;  2HIO D;  4Z66 D;  3LZ1 B;  5CP6 C;  4LD9 C;  3MGQ C;  5AV6 D;  3W99 C;  2NQB A;  2BYM A;  5B32 B;  1P3I D;  1HQ3 D;  3LZ1 C;  3AZF D;  4ZUX A;  5AV5 B;  5JRG A;  3WAA A;  5GT3 D;  3WAA B;  3AZH A;  1P3P B;  3AZN D;  3W97 D;  5B32 C;  3C1B A;  5GT0 D;  1ZLA C;  5AV5 C;  1P3F A;  4X23 B;  1P3P C;  3TU4 D;  3LEL B;  4M6B A;  5AV8 B;  5DNM A;  5B31 C;  3LZ0 B;  4YM6 A;  3AV2 D;  3WKJ B;  3LJA A;  4E44 A;  4X23 C;  3REK A;  2RVQ D;  3LEL C;  4XZQ A;  4J8V B;  3AV1 B;  5AV8 C;  1BH8 B;  3LZ0 C;  4WU9 D;  3AN2 D;  2PYO A;  5B1L A;  4NE5 A;  3REH B;  3REH A;  1F66 D;  3MGP A;  5AVB A;  5AVC A;  1M1A A;  3KWQ B;  3MGR D;  4H9Q A;  5KDM A;  1WWS A;  3KWQ C;  3UTA B;  3WTP D;  4E45 A;  4H9P A;  5B2J D;  5AY8 B;  4H9S C;  5B1M A;  4NE6 A;  2BYK B;  5B0Y B;  4WV4 B;  5B24 B;  2NZD A;  5AY8 C;  5B33 A;  5B33 B;  3B6F D;  2YFV B;  3AZJ D;  5B0Y C;  3AZL B;  5B24 C;  2HIO A;  4JJN B;  1P3L D;  4KUD B;  4Z2M H;  5AV6 A;  3AZI B;  1P3I A;  3AZL C;  4JJN C;  3AZF A;  4H9R B;  4KUD C;  3NQU B;  5GT3 A;  1P3K D;  1ID3 D;  3AZI C;  3W97 A;  5BNV A;  5CPJ A;  3AZM D;  1P3B B;  2F8N G;  4WNN A;  4CSR A;  1KX5 D;  4Z5T B;  1P3G A;  5B0Z D;  3X1V B;  5E5A A;  3MNN A;  1P3B C;  3REL D;  3O62 B;  3AV2 A;  4CAY A;  3X1U A;  3WA9 A;  1P34 B;  2F8N A;  5DNN D;  3X1V C;  5BO0 B;  5BO0 A;  3V9R B;  5GXQ B;  4YS3 C;  3O62 C;  3AN2 A;  1S32 B;  2HUE B;  4UUZ B;  4J8W B;  3X1T A;  1P34 C;  1N1J B;  5GXQ C;  1S32 C;  1F66 A;  3REJ D;  2HUE C;  1KX3 D;  3MGR A;  3VH5 T;  3REI B;  3C1C C;  5G49 A;  5CP6 D;  4LD9 D;  1M18 B;  3REI C;  4KHA A;  1P3M B;  3W99 D;  1KX4 B;  5B2J A;  3AZG B;  5BS7 C;  1M18 C;  1P3M C;  4WU8 B;  3KUY B;  5B32 D;  1ZLA D;  5BT1 C;  3AZG C;  3W96 D;  5AV5 D;  4WU8 C;  3X1S D;  3KUY C;  5CPK A;  5CPK B;  1P3P D;  3VH5 W;  5B31 D;  4J8X D;  4X23 D;  1H3O B;  3VH6 A;  5AV8 D;  5F99 D;  1EQZ A;  3A6N C;  5BNX B;  5BNX A;  3AZM A;  4J8U A;  3AFA D;  3MVD B;  1KX5 A;  4R8P C;  4HGA B;  5B0Z A;  1BH9 A;  4ZBJ B;  3MGS B;  4Z2M G;  5AV9 D;  1P3A D;  3REL A;  3W98 B;  4AWL B;  3MVD C;  2F8N H;  3B6G A;  4ZBJ C;  3MGS C;  3W98 C;  3B0C T;  3AZK D;  2NQB B;  2BYM B;  5JRG B;  4ZUX B;  3REJ A;  1KX3 A;  5B40 A;  3AZH B;  2NQB C;  1TAF A;  3C1B B;  4QLC A;  1AOI A;  5JRG C;  4ZUX C;  1P3F B;  3WAA C;  5GSU D;  3AZH C;  3C1B C;  1Q9C A;  5DNM B;  3UT9 A;  4YM6 B;  1P3F C;  3LJA B;  3W99 A;  3REK B;  4XZQ B;  3B0C W;  4KUD D;  5DNM C;  4YM6 C;  3WKJ C;  3LJA C;  3AZI D;  3REK C;  2PYO B;  4G91 B;  5B1L B;  4XZQ C;  3W96 A;  4J8V C;  1HTA A;  3AV1 C;  3MGP B;  3X1S A;  5AVB B;  5AVC B;  2F8N K;  4G91 C;  2PYO C;  5B1L C;  1M1A B;  4J8X A;  3REH C;  3KXB D;  3MGP C;  5AVB C;  4EO5 B;  3X1V D;  1R4V A;  4H9Q B;  5KDM B;  5F99 A;  1M1A C;  4YS3 D;  3UTB D;  4H9P B;  4H9N A;  3AFA A;  1P34 D;  4EO5 C;  4XUJ A;  1TZY A;  5B1M B;  5C3I B;  2CV5 A;  5GXQ D;  3UTA C;  1S32 D;  5AV9 A;  1P3A A;  2FJ7 D;  2NZD B;  5B1M C;  5C3I C;  3AZE A;  2HIO B;  4Z66 A;  2NZD C;  3C1C D;  5B33 C;  5AV6 B;  3AZK A;  3REI D;  2YFW A;  1P3I B;  1HQ3 B;  1HQ3 A;  3AZF B;  4H9S A;  1M19 D;  5CHL B;  5GT3 B;  5AV6 C;  3AYW D;  1M18 D;  1U35 D;  3AZN B;  3AZN A;  1P3M D;  5B2I D;  3W97 B;  1P3I C;  5BNV B;  5CPJ B;  5GT0 A;  3AZF C;  4WNN B;  3NQJ A;  4CSR B;  5GT3 C;  5GSU A;  1P3G B;  3TU4 A;  3W97 C;  4WU8 D;  3KUY D;  5E5A B;  3MNN B;  5CPJ C;  3AV2 B;  3R45 A;  4CAY B;  4Z5T C;  5FUG A;  3X1U B;  1P3G C;  3WA9 B;  3B0D B;  2F8N B;  1P3O D;  5E5A C;  3MNN C;  2ARO D;  3AN2 B;  3AV2 C;  4WU9 B;  4WU9 A;  1JFI A;  3A6N D;  3X1U C;  3X1T B;  3WA9 C;  3B0D C;  5CPI D;  1F66 B;  4R8P D;  4J8W C;  3X1T C;  4KGC D;  3MGR B;  3MVD D;  3KXB A;  1F66 C;  5G49 B;  3MGR C;  4YS3 A;  3UTB A;  3MGQ D;  4KHA B;  4NFT A;  3WTP B;  3WTP A;  5B2J B;  4H9O A;  4NE3 A;  3LZ1 D;  2FJ7 A;  1KX4 C;  5B2J C;  3WTP E;  3B6F A;  3AZJ A;  3VH6 T;  3WAA D;  3AZH D;  3C1C A;  1P3L A;  1KU5 A;  5CPK C;  1M19 A;  3LEL D;  1P3K A;  1ID3 A;  3AYW A;  1EQZ B;  1U35 A;  3LZ0 D;  1B67 A;  5B2I A;  3WKJ D;  3LJA D;  3AZM B;  4J8U B;  3VH5 A;  4XZQ D;  1KX5 B;  4J8V D;  1BFM A;  3AV1 D;  1EQZ C;  5B0Z B;  1BH9 B;  3AZM C;  4J8U C;  3REL B;  2PYO D;  1A7W A;  1KX5 C;  5JA4 B;  5JA4 A;  4HGA C;  5B0Z C;  5DNN B;  5DNN A;  3REH D;  5AVB D;  1P3O A;  3B6G B;  3REL C;  2ARO A;  4AWL C;  1M1A D;  3KWQ D;  3B6G C;  5CPI A;  3REJ B;  1KX3 B;  5B40 B;  3UTA D;  2JSS A;  4KGC A;  1TAF B;  4QLC B;  1AOI B;  5AY8 D;  5B1M D;  3REJ C;  1KX3 C;  5B40 C;  5B0Y D;  5B24 D;  4QLC C;  5B32 G;  5CP6 A;  4LD9 A;  3MGQ A;  3UT9 B;  5B33 D;  1AOI C;  3W99 B;  3AZL D;  3LZ1 A;  4JJN D;  3UT9 C;  5B31 G;  5B32 A;  1ZLA B;  1ZLA A;  3W96 B;  5AV5 A;  3X1S B;  1P3P A;  4DRB A;  5CPJ D;  1P3B D;  2L5A A;  3W96 C;  5B31 B;  5B31 A;  4J8X B;  4X23 A;  4Z5T D;  3X1S C;  1P3G D;  5AVC C;  3LEL A;  5E5A D;  3MNN D;  5AV8 A;  5F99 B;  3LZ0 A;  3O62 D;  4J8X C;  3WKJ A;  3X1U D;  3AFA B;  4H9N B;  3WA9 D;  2F8N D;  4XUJ B;  1TZY B;  4J8V A;  3AV1 A;  5F99 C;  1BH8 A;  2CV5 B;  5AV9 B;  4J8W D;  1P3A B;  3X1T D;  3AFA C;  2LY8 A;  4XUJ C;  1TZY C;  3AZE B;  2CV5 C;  5AV9 C;  1P3A C;  4Z66 B;  2IO5 B;  3KWQ A;  3AZK B;  3AZE C;  2YFW B;  2HIO C;  4Z66 C;  2IO5 C;  3UTA A;  3AZK C; 
#chains in the Genus database with same CATH topology
 1HQ3 C;  5GT0 B;  1KX4 D;  5AY8 A;  3NQJ B;  5BT1 D;  3AZG D;  5GSU B;  2F2A C;  2BYK A;  5B0Y A;  3TU4 B;  5B24 A;  3AZN C;  5GT0 C;  3H0R C;  3R45 B;  2YFV A;  5FUG B;  5GSU C;  3TU4 C;  3AZL A;  4JJN A;  5CPK D;  4KUD A;  1WWI A;  1JFI B;  1Z2C B;  3AZI A;  2RVQ C;  3B0B A;  4H9R A;  3NQU A;  3AN2 C;  4WU9 C;  1EQZ D;  2Y2O A;  1P3B A;  4J8U D;  1ULY A;  3KXB B;  4Z5T A;  1F1E A;  3X1V A;  3MGS D;  3W98 D;  4YS3 B;  3O62 A;  3UTB B;  4UPK A;  3KXB C;  1P34 A;  3B6G D;  4DRA A;  4H9O B;  3V9R A;  5GXQ A;  3UTB C;  1S32 A;  4UUZ A;  3WTP C;  4J8W A;  2FJ7 B;  2NQB D;  2XD1 A;  3B6F B;  1N1J A;  4WZS B;  2G5I C;  3AZJ B;  5JRG D;  4ZUX D;  5B40 D;  2FJ7 C;  3C1C B;  1P3L B;  3C1B D;  4QLC D;  3F6T A;  3B6F C;  3A1K A;  3REI A;  3AZJ C;  1AOI D;  1P3F D;  1M19 B;  1P3L C;  1P3K B;  1ID3 B;  3AYW B;  5BS7 A;  5DNM D;  3UT9 D;  3P5J B;  5B2I B;  4YM6 D;  1U35 B;  1P3M A;  1M18 A;  1KX4 A;  3REK D;  1M19 C;  1P3K C;  3AZG A;  1ID3 C;  3AYW C;  1U35 C;  5B2I C;  4WU8 A;  3KUY A;  2Y2N A;  5B1L D;  3VH6 W;  2JCH A;  3MGP D;  1P3O B;  5AVC D;  2ARO B;  3A6N B;  3A6N A;  2W8S A;  5DNN C;  1P3O C;  1H3O A;  5CPI B;  2ARO C;  4R8P B;  3KSY A;  4R8P A;  4KGC B;  5CPI C;  4XUJ D;  4G92 B;  1TZY D;  3MVD A;  2CV5 D;  4KGC C;  3MGS A;  2NZD D;  3W98 A;  5CP6 B;  2CWE A;  3MGQ B;  4LD9 B;  4G92 C;  3AZE D;  2G5H C;  1B6W A;  2HIO D;  2ZY5 A;  4Z66 D;  3LZ1 B;  5CP6 C;  4LD9 C;  3MGQ C;  5AV6 D;  3W99 C;  2NQB A;  2BYM A;  5B32 B;  1P3I D;  1HQ3 D;  3LZ1 C;  3AZF D;  4ZUX A;  5AV5 B;  5JRG A;  3WAA A;  5GT3 D;  3WAA B;  2VQR A;  3AZH A;  1P3P B;  3AZN D;  3W97 D;  5B32 C;  3C1B A;  5GT0 D;  1ZLA C;  5AV5 C;  2Y2I A;  1P3F A;  4X23 B;  1P3P C;  3TU4 D;  3LEL B;  4M6B A;  5AV8 B;  5DNM A;  5B31 C;  3LZ0 B;  4YM6 A;  3AV2 D;  3WKJ B;  3LJA A;  4E44 A;  4X23 C;  3REK A;  2RVQ D;  3LEL C;  4XZQ A;  4J8V B;  3AV1 B;  5AV8 C;  1BH8 B;  3LZ0 C;  4WU9 D;  3AN2 D;  2PYO A;  5B1L A;  4NE5 A;  3REH B;  3REH A;  1F66 D;  3MGP A;  5AVB A;  5AVC A;  1M1A A;  3KWQ B;  3MGR D;  4H9Q A;  5KDM A;  1WWS A;  3KWQ C;  3UTA B;  3WTP D;  4E45 A;  4H9P A;  5B2J D;  5AY8 B;  4H9S C;  5B1M A;  4NE6 A;  2BYK B;  5B0Y B;  4WV4 B;  5B24 B;  2NZD A;  5AY8 C;  5B33 A;  5B33 B;  3B6F D;  2YFV B;  3AZJ D;  5B0Y C;  3AZL B;  5B24 C;  2HIO A;  4JJN B;  1P3L D;  4KUD B;  2Y2H A;  4Z2M H;  5AV6 A;  3AZI B;  1P3I A;  3AZL C;  4JJN C;  3AZF A;  4H9R B;  4KUD C;  3NQU B;  5GT3 A;  1P3K D;  1ID3 D;  3AZI C;  3W97 A;  5BNV A;  5CPJ A;  3AZM D;  1P3B B;  2F8N G;  4WNN A;  4CSR A;  1KX5 D;  4Z5T B;  1P3G A;  5B0Z D;  3X1V B;  5E5A A;  3MNN A;  1P3B C;  3REL D;  3O62 B;  3AV2 A;  4CAY A;  3X1U A;  3WA9 A;  1P34 B;  2F8N A;  5DNN D;  3X1V C;  5BO0 B;  5BO0 A;  3V9R B;  5GXQ B;  4YS3 C;  3O62 C;  3AN2 A;  1S32 B;  2HUE B;  4UUZ B;  4J8W B;  3X1T A;  1P34 C;  1N1J B;  2RIQ A;  2ZY2 A;  3EG5 B;  5GXQ C;  1S32 C;  1F66 A;  3REJ D;  2HUE C;  1KX3 D;  3MGR A;  3VH5 T;  3REI B;  3C1C C;  5G49 A;  3EPH A;  5CP6 D;  4LD9 D;  1M18 B;  3REI C;  3FDD A;  4KHA A;  1P3M B;  3W99 D;  1KX4 B;  5B2J A;  3AZG B;  5BS7 C;  1M18 C;  1P3M C;  4WU8 B;  3KUY B;  5B32 D;  1ZLA D;  5BT1 C;  3AL0 C;  1T3U A;  3AZG C;  3W96 D;  2Y2L A;  5AV5 D;  4WU8 C;  3X1S D;  3KUY C;  5CPK A;  5CPK B;  1P3P D;  3VH5 W;  5B31 D;  4J8X D;  3H0L C;  4X23 D;  1H3O B;  2DQN C;  3VH6 A;  5AV8 D;  5F99 D;  1EQZ A;  3A6N C;  5BNX B;  5BNX A;  3AZM A;  4J8U A;  3AFA D;  3MVD B;  1KX5 A;  4R8P C;  4HGA B;  5B0Z A;  1BH9 A;  4ZBJ B;  3MGS B;  4Z2M G;  5AV9 D;  1P3A D;  2XD5 A;  3REL A;  3W98 B;  4AWL B;  3MVD C;  2F8N H;  3B6G A;  4ZBJ C;  3MGS C;  3W98 C;  3B0C T;  3AZK D;  2NQB B;  2BYM B;  1PZR A;  5JRG B;  4ZUX B;  3REJ A;  1KX3 A;  5B40 A;  3AZH B;  2NQB C;  1TAF A;  3C1B B;  4QLC A;  1AOI A;  5JRG C;  4ZUX C;  1P3F B;  3WAA C;  5GSU D;  3AZH C;  3C1B C;  1Q9C A;  5DNM B;  3UT9 A;  4YM6 B;  2Y2J A;  1P3F C;  3LJA B;  3W99 A;  3REK B;  2ZY4 A;  4XZQ B;  3B0C W;  4KUD D;  5DNM C;  4YM6 C;  3WKJ C;  3LJA C;  3AZI D;  3REK C;  2PYO B;  4G91 B;  5B1L B;  4XZQ C;  3W96 A;  4J8V C;  1HTA A;  3AV1 C;  3MGP B;  3X1S A;  5AVB B;  5AVC B;  2F8N K;  4G91 C;  2PYO C;  5B1L C;  1M1A B;  4J8X A;  3REH C;  3KXB D;  3MGP C;  5AVB C;  4EO5 B;  3X1V D;  1R4V A;  4H9Q B;  5KDM B;  5F99 A;  1M1A C;  4YS3 D;  3UTB D;  4H9P B;  4H9N A;  3AFA A;  1P34 D;  4EO5 C;  4XUJ A;  1TZY A;  5B1M B;  5C3I B;  2CV5 A;  5GXQ D;  3UTA C;  1S32 D;  5AV9 A;  1P3A A;  2FJ7 D;  2NZD B;  5B1M C;  5C3I C;  3H0M C;  3AZE A;  2DF4 C;  2Y2M A;  2HIO B;  4Z66 A;  2NZD C;  3C1C D;  5B33 C;  5AV6 B;  3AZK A;  3REI D;  2YFW A;  1P3I B;  1HQ3 B;  1HQ3 A;  3A1I A;  3AZF B;  2JE5 A;  4H9S A;  1M19 D;  2FFF B;  5CHL B;  5GT3 B;  5AV6 C;  3AYW D;  1M18 D;  1U35 D;  3AZN B;  3AZN A;  1P3M D;  5B2I D;  3W97 B;  1P3I C;  5BNV B;  5CPJ B;  5GT0 A;  3AZF C;  4WNN B;  3NQJ A;  4CSR B;  5GT3 C;  5GSU A;  1P3G B;  3TU4 A;  3W97 C;  4WU8 D;  3KUY D;  5E5A B;  3MNN B;  5CPJ C;  3AV2 B;  3R45 A;  4CAY B;  4Z5T C;  5FUG A;  3X1U B;  1P3G C;  3WA9 B;  3B0D B;  2F8N B;  1P3O D;  5E5A C;  3MNN C;  2ARO D;  3AN2 B;  3AV2 C;  2BG1 A;  4WU9 B;  4WU9 A;  1JFI A;  3A6N D;  3X1U C;  3X1T B;  3WA9 C;  3B0D C;  5CPI D;  1F66 B;  4R8P D;  4J8W C;  3X1T C;  4KGC D;  3MGR B;  3MVD D;  3KXB A;  1F66 C;  2ZY3 A;  5G49 B;  3MGR C;  4YS3 A;  3UTB A;  3MGQ D;  4KHA B;  4NFT A;  3WTP B;  3WTP A;  2Y2Q A;  5B2J B;  4H9O A;  3EPJ A;  4NE3 A;  3LZ1 D;  2J8P A;  2FJ7 A;  1KX4 C;  5B2J C;  3WTP E;  3B6F A;  3AZJ A;  3VH6 T;  3WAA D;  3AZH D;  2Y2K A;  3C1C A;  1P3L A;  1KU5 A;  5CPK C;  1M19 A;  3LEL D;  1P3K A;  1ID3 A;  3AYW A;  1EQZ B;  1U35 A;  3LZ0 D;  1B67 A;  3IP4 C;  5B2I A;  3LJA D;  3WKJ D;  3AZM B;  4J8U B;  1W2E A;  3VH5 A;  4XZQ D;  2UWX A;  4J8V D;  1KX5 B;  3AV1 D;  1BFM A;  1EQZ C;  5B0Z B;  1BH9 B;  3AZM C;  4J8U C;  3REL B;  2PYO D;  2Y2G A;  1A7W A;  1KX5 C;  5JA4 B;  5JA4 A;  4HGA C;  5B0Z C;  5DNN B;  5DNN A;  3REH D;  5AVB D;  1P3O A;  3B6G B;  3REL C;  2ARO A;  4AWL C;  1M1A D;  3KWQ D;  3EPK A;  3B6G C;  5CPI A;  3REJ B;  1KX3 B;  5B40 B;  3UTA D;  2JSS A;  4KGC A;  1TAF B;  4QLC B;  1AOI B;  5AY8 D;  5B1M D;  3REJ C;  1KX3 C;  5B40 C;  5B0Y D;  5B24 D;  4QLC C;  5B32 G;  5CP6 A;  4LD9 A;  3MGQ A;  3UT9 B;  5B33 D;  1AOI C;  3W99 B;  3AZL D;  3LZ1 A;  4JJN D;  4DQY B;  3UT9 C;  5B31 G;  5B32 A;  1ZLA B;  1ZLA A;  3W96 B;  5AV5 A;  3X1S B;  1P3P A;  4DRB A;  5CPJ D;  1P3B D;  2L5A A;  3W96 C;  5B31 B;  5B31 A;  4J8X B;  2Y2P A;  4X23 A;  4Z5T D;  3X1S C;  1P3G D;  3KFU G;  5AVC C;  3LEL A;  5E5A D;  3MNN D;  5AV8 A;  5F99 B;  3LZ0 A;  3O62 D;  4J8X C;  3WKJ A;  3X1U D;  3AFA B;  4H9N B;  3WA9 D;  2F8N D;  4XUJ B;  1TZY B;  4J8V A;  4WJ3 C;  3AV1 A;  5F99 C;  1BH8 A;  2CV5 B;  5AV9 B;  4J8W D;  1P3A B;  3X1T D;  3AFA C;  2LY8 A;  4XUJ C;  1TZY C;  3AZE B;  2CV5 C;  5AV9 C;  1P3A C;  4Z66 B;  2IO5 B;  3KWQ A;  3AZK B;  3AZE C;  2YFW B;  2HIO C;  4Z66 C;  3EPL A;  2IO5 C;  3UTA A;  3AZK C;  2ZM5 A; 
#chains in the Genus database with same CATH homology
 1HQ3 C;  5GT0 B;  1KX4 D;  5AY8 A;  3NQJ B;  5BT1 D;  3AZG D;  5GSU B;  2F2A C;  2BYK A;  5B0Y A;  3TU4 B;  5B24 A;  3AZN C;  5GT0 C;  3H0R C;  3R45 B;  2YFV A;  5FUG B;  5GSU C;  3TU4 C;  3AZL A;  4JJN A;  5CPK D;  4KUD A;  1WWI A;  1JFI B;  1Z2C B;  3AZI A;  2RVQ C;  3B0B A;  4H9R A;  3NQU A;  3AN2 C;  4WU9 C;  1EQZ D;  2Y2O A;  1P3B A;  4J8U D;  1ULY A;  3KXB B;  4Z5T A;  1F1E A;  3X1V A;  3MGS D;  3W98 D;  4YS3 B;  3O62 A;  3UTB B;  4UPK A;  3KXB C;  1P34 A;  3B6G D;  4DRA A;  4H9O B;  3V9R A;  5GXQ A;  3UTB C;  1S32 A;  4UUZ A;  3WTP C;  4J8W A;  2FJ7 B;  2NQB D;  2XD1 A;  3B6F B;  1N1J A;  4WZS B;  2G5I C;  3AZJ B;  5JRG D;  4ZUX D;  5B40 D;  2FJ7 C;  3C1C B;  1P3L B;  3C1B D;  4QLC D;  3F6T A;  3B6F C;  3A1K A;  3REI A;  3AZJ C;  1AOI D;  1P3F D;  1M19 B;  1P3L C;  1P3K B;  1ID3 B;  3AYW B;  5BS7 A;  5DNM D;  3UT9 D;  3P5J B;  5B2I B;  4YM6 D;  1U35 B;  1P3M A;  1M18 A;  1KX4 A;  3REK D;  1M19 C;  1P3K C;  3AZG A;  1ID3 C;  3AYW C;  1U35 C;  5B2I C;  4WU8 A;  3KUY A;  2Y2N A;  5B1L D;  3VH6 W;  2JCH A;  3MGP D;  1P3O B;  5AVC D;  2ARO B;  3A6N B;  3A6N A;  2W8S A;  5DNN C;  1P3O C;  1H3O A;  5CPI B;  2ARO C;  4R8P B;  3KSY A;  4R8P A;  4KGC B;  5CPI C;  4XUJ D;  4G92 B;  1TZY D;  3MVD A;  2CV5 D;  4KGC C;  3MGS A;  2NZD D;  3W98 A;  5CP6 B;  2CWE A;  3MGQ B;  4LD9 B;  4G92 C;  3AZE D;  2G5H C;  1B6W A;  2HIO D;  2ZY5 A;  4Z66 D;  3LZ1 B;  5CP6 C;  4LD9 C;  3MGQ C;  5AV6 D;  3W99 C;  2NQB A;  2BYM A;  5B32 B;  1P3I D;  1HQ3 D;  3LZ1 C;  3AZF D;  4ZUX A;  5AV5 B;  5JRG A;  3WAA A;  5GT3 D;  3WAA B;  2VQR A;  3AZH A;  1P3P B;  3AZN D;  3W97 D;  5B32 C;  3C1B A;  5GT0 D;  1ZLA C;  5AV5 C;  2Y2I A;  1P3F A;  4X23 B;  1P3P C;  3TU4 D;  3LEL B;  4M6B A;  5AV8 B;  5DNM A;  5B31 C;  3LZ0 B;  4YM6 A;  3AV2 D;  3WKJ B;  3LJA A;  4E44 A;  4X23 C;  3REK A;  2RVQ D;  3LEL C;  4XZQ A;  4J8V B;  3AV1 B;  5AV8 C;  1BH8 B;  3LZ0 C;  4WU9 D;  3AN2 D;  2PYO A;  5B1L A;  4NE5 A;  3REH B;  3REH A;  1F66 D;  3MGP A;  5AVB A;  5AVC A;  1M1A A;  3KWQ B;  3MGR D;  4H9Q A;  5KDM A;  1WWS A;  3KWQ C;  3UTA B;  3WTP D;  4E45 A;  4H9P A;  5B2J D;  5AY8 B;  4H9S C;  5B1M A;  4NE6 A;  2BYK B;  5B0Y B;  4WV4 B;  5B24 B;  2NZD A;  5AY8 C;  5B33 A;  5B33 B;  3B6F D;  2YFV B;  3AZJ D;  5B0Y C;  3AZL B;  5B24 C;  2HIO A;  4JJN B;  1P3L D;  4KUD B;  2Y2H A;  4Z2M H;  5AV6 A;  3AZI B;  1P3I A;  3AZL C;  4JJN C;  3AZF A;  4H9R B;  4KUD C;  3NQU B;  5GT3 A;  1P3K D;  1ID3 D;  3AZI C;  3W97 A;  5BNV A;  5CPJ A;  3AZM D;  1P3B B;  2F8N G;  4WNN A;  4CSR A;  1KX5 D;  4Z5T B;  1P3G A;  5B0Z D;  3X1V B;  5E5A A;  3MNN A;  1P3B C;  3REL D;  3O62 B;  3AV2 A;  4CAY A;  3X1U A;  3WA9 A;  1P34 B;  2F8N A;  5DNN D;  3X1V C;  5BO0 B;  5BO0 A;  3V9R B;  5GXQ B;  4YS3 C;  3O62 C;  3AN2 A;  1S32 B;  2HUE B;  4UUZ B;  4J8W B;  3X1T A;  1P34 C;  1N1J B;  2RIQ A;  2ZY2 A;  3EG5 B;  5GXQ C;  1S32 C;  1F66 A;  3REJ D;  2HUE C;  1KX3 D;  3MGR A;  3VH5 T;  3REI B;  3C1C C;  5G49 A;  3EPH A;  5CP6 D;  4LD9 D;  1M18 B;  3REI C;  3FDD A;  4KHA A;  1P3M B;  3W99 D;  1KX4 B;  5B2J A;  3AZG B;  5BS7 C;  1M18 C;  1P3M C;  4WU8 B;  3KUY B;  5B32 D;  1ZLA D;  5BT1 C;  3AL0 C;  1T3U A;  3AZG C;  3W96 D;  2Y2L A;  5AV5 D;  4WU8 C;  3X1S D;  3KUY C;  5CPK A;  5CPK B;  1P3P D;  3VH5 W;  5B31 D;  4J8X D;  3H0L C;  4X23 D;  1H3O B;  2DQN C;  3VH6 A;  5AV8 D;  5F99 D;  1EQZ A;  3A6N C;  5BNX B;  5BNX A;  3AZM A;  4J8U A;  3AFA D;  3MVD B;  1KX5 A;  4R8P C;  4HGA B;  5B0Z A;  1BH9 A;  4ZBJ B;  3MGS B;  4Z2M G;  5AV9 D;  1P3A D;  2XD5 A;  3REL A;  3W98 B;  4AWL B;  3MVD C;  2F8N H;  3B6G A;  4ZBJ C;  3MGS C;  3W98 C;  3B0C T;  3AZK D;  2NQB B;  2BYM B;  1PZR A;  5JRG B;  4ZUX B;  3REJ A;  1KX3 A;  5B40 A;  3AZH B;  2NQB C;  1TAF A;  3C1B B;  4QLC A;  1AOI A;  5JRG C;  4ZUX C;  1P3F B;  3WAA C;  5GSU D;  3AZH C;  3C1B C;  1Q9C A;  5DNM B;  3UT9 A;  4YM6 B;  2Y2J A;  1P3F C;  3LJA B;  3W99 A;  3REK B;  2ZY4 A;  4XZQ B;  3B0C W;  4KUD D;  5DNM C;  4YM6 C;  3WKJ C;  3LJA C;  3AZI D;  3REK C;  2PYO B;  4G91 B;  5B1L B;  4XZQ C;  3W96 A;  4J8V C;  1HTA A;  3AV1 C;  3MGP B;  3X1S A;  5AVB B;  5AVC B;  2F8N K;  4G91 C;  2PYO C;  5B1L C;  1M1A B;  4J8X A;  3REH C;  3KXB D;  3MGP C;  5AVB C;  4EO5 B;  3X1V D;  1R4V A;  4H9Q B;  5KDM B;  5F99 A;  1M1A C;  4YS3 D;  3UTB D;  4H9P B;  4H9N A;  3AFA A;  1P34 D;  4EO5 C;  4XUJ A;  1TZY A;  5B1M B;  5C3I B;  2CV5 A;  5GXQ D;  3UTA C;  1S32 D;  5AV9 A;  1P3A A;  2FJ7 D;  2NZD B;  5B1M C;  5C3I C;  3H0M C;  3AZE A;  2DF4 C;  2Y2M A;  2HIO B;  4Z66 A;  2NZD C;  3C1C D;  5B33 C;  5AV6 B;  3AZK A;  3REI D;  2YFW A;  1P3I B;  1HQ3 B;  1HQ3 A;  3A1I A;  3AZF B;  2JE5 A;  4H9S A;  1M19 D;  2FFF B;  5CHL B;  5GT3 B;  5AV6 C;  3AYW D;  1M18 D;  1U35 D;  3AZN B;  3AZN A;  1P3M D;  5B2I D;  3W97 B;  1P3I C;  5BNV B;  5CPJ B;  5GT0 A;  3AZF C;  4WNN B;  3NQJ A;  4CSR B;  5GT3 C;  5GSU A;  1P3G B;  3TU4 A;  3W97 C;  4WU8 D;  3KUY D;  5E5A B;  3MNN B;  5CPJ C;  3AV2 B;  3R45 A;  4CAY B;  4Z5T C;  5FUG A;  3X1U B;  1P3G C;  3WA9 B;  3B0D B;  2F8N B;  1P3O D;  5E5A C;  3MNN C;  2ARO D;  3AN2 B;  3AV2 C;  2BG1 A;  4WU9 B;  4WU9 A;  1JFI A;  3A6N D;  3X1U C;  3X1T B;  3WA9 C;  3B0D C;  5CPI D;  1F66 B;  4R8P D;  4J8W C;  3X1T C;  4KGC D;  3MGR B;  3MVD D;  3KXB A;  1F66 C;  2ZY3 A;  5G49 B;  3MGR C;  4YS3 A;  3UTB A;  3MGQ D;  4KHA B;  4NFT A;  3WTP B;  3WTP A;  2Y2Q A;  5B2J B;  4H9O A;  3EPJ A;  4NE3 A;  3LZ1 D;  2J8P A;  2FJ7 A;  1KX4 C;  5B2J C;  3WTP E;  3B6F A;  3AZJ A;  3VH6 T;  3WAA D;  3AZH D;  2Y2K A;  3C1C A;  1P3L A;  1KU5 A;  5CPK C;  1M19 A;  3LEL D;  1P3K A;  1ID3 A;  3AYW A;  1EQZ B;  1U35 A;  3LZ0 D;  1B67 A;  3IP4 C;  5B2I A;  3LJA D;  3WKJ D;  3AZM B;  4J8U B;  1W2E A;  3VH5 A;  4XZQ D;  2UWX A;  4J8V D;  1KX5 B;  3AV1 D;  1BFM A;  1EQZ C;  5B0Z B;  1BH9 B;  3AZM C;  4J8U C;  3REL B;  2PYO D;  2Y2G A;  1A7W A;  1KX5 C;  5JA4 B;  5JA4 A;  4HGA C;  5B0Z C;  5DNN B;  5DNN A;  3REH D;  5AVB D;  1P3O A;  3B6G B;  3REL C;  2ARO A;  4AWL C;  1M1A D;  3KWQ D;  3EPK A;  3B6G C;  5CPI A;  3REJ B;  1KX3 B;  5B40 B;  3UTA D;  2JSS A;  4KGC A;  1TAF B;  4QLC B;  1AOI B;  5AY8 D;  5B1M D;  3REJ C;  1KX3 C;  5B40 C;  5B0Y D;  5B24 D;  4QLC C;  5B32 G;  5CP6 A;  4LD9 A;  3MGQ A;  3UT9 B;  5B33 D;  1AOI C;  3W99 B;  3AZL D;  3LZ1 A;  4JJN D;  4DQY B;  3UT9 C;  5B31 G;  5B32 A;  1ZLA B;  1ZLA A;  3W96 B;  5AV5 A;  3X1S B;  1P3P A;  4DRB A;  5CPJ D;  1P3B D;  2L5A A;  3W96 C;  5B31 B;  5B31 A;  4J8X B;  2Y2P A;  4X23 A;  4Z5T D;  3X1S C;  1P3G D;  3KFU G;  5AVC C;  3LEL A;  5E5A D;  3MNN D;  5AV8 A;  5F99 B;  3LZ0 A;  3O62 D;  4J8X C;  3WKJ A;  3X1U D;  3AFA B;  4H9N B;  3WA9 D;  2F8N D;  4XUJ B;  1TZY B;  4J8V A;  4WJ3 C;  3AV1 A;  5F99 C;  1BH8 A;  2CV5 B;  5AV9 B;  4J8W D;  1P3A B;  3X1T D;  3AFA C;  2LY8 A;  4XUJ C;  1TZY C;  3AZE B;  2CV5 C;  5AV9 C;  1P3A C;  4Z66 B;  2IO5 B;  3KWQ A;  3AZK B;  3AZE C;  2YFW B;  2HIO C;  4Z66 C;  3EPL A;  2IO5 C;  3UTA A;  3AZK C;  2ZM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...