4H9OA

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIMALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 29
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oA00
5B32B 1TAFA 3AYWB 5G49A 3W98B 4XUJD 4ZUXA 3MGQC 4WU9A 3X1UA 3WA9C 3W99D 5AV6B 3B6FD 3REHC 1KX4B 1N1JA 2HIOB 3AZJD 3A6NA 5B0YC 2NQBB 1P3IB 3KXBA 3AZIA 1P3BA 5CP6B 3X1SA 3AFAD 1P3MB 3W96D 5BS7A 4LD9A 4H9RA 1KX5D 2F8NH 3AN2B 3KUYA 1U35D 3O62D 3AZFA 3RELD 1M1AC 5B1LB 4EO5C 3AZMB 5CPKC 3X1TC 5CPKB 5BNVB 3WKJB 5CPID 3AZGA 3MGSB 5B2JC 1TZYA 1P3LB 3KWQD 4J8WD 2FJ7B 4CSRA 4WZSB 4XUJC 4WU8A 2RVQD 3B6GD 5DNMD 1S32D 3W99C 3B6FC 3B0DB 4YM6B 5CHLB 3AZJC 1BH9B 3NQUB 5JRGD 5AVBD 2L5AA 3AZND 1KX3A 2PYOB 3AFAC 1M19A 3AZEB 2F8NK 3AZHD 3KSYA 3LZ0D 1P3KA 1P3PB 4ZBJC 4ZBJB 3W96C 4R8PA 5JA4A 3WTPE 5BO0A 1KX5C 4J8VA 1U35C 1U35B 4Z66B 3O62C 1P3OD 5B24A 5BNXA 1P3FB 3RELC 4NE3A 1A7WA 3UT9D 2AROB 1M18D 4KGCD 3MGQA 3X1VB 5CPIC 3WA9A 1WWIA 3UTAD 3MGRD 2CV5A 1F66D 3REJD 5AV8A 3KWQC 4YS3A 5B0YA 5F99B 1JFIB 3B6GC 5DNMC 1S32C 3TU4D 2IO5C 5GSUB 3MVDD 1ID3D 4UUZB 4DRAA 5GT3D 4H9OA 5JRGC 5AV9B 5AY8A 5B2IB 3X1UB 4KHAA 5AVBC 4QLCD 4DRBA 5B32D 3AZNC 1N1JB 3AYWD 2NZDD 3W98D 3MGPB 3LZ0C 4NE5A 5E5AA 5AV6D 3REKB 3AZIB 1KX4D 2HIOD 4M6BA 3X1TA 2YFVA 2NQBD 5B40B 1P3ID 5B0ZB 1P3OC 4X23B 3UTBB 2BYKB 5B2JA 5CP6D 3MNNC 3LZ1C 2F8NG 3MNNB 3LZ1B 5CPJB 4H9RB 3UT9C 1M18C 4XUJA 1P3MD 4KGCC 3W99A 3UTAC 3MGRC 3AZJA 2JSSA 3C1BA 3REJC 3AN2D 4AWLC 2F8NB 4KUDC 4KUDB 3AZLA 5C3IC 5AVCB 5B32G 5B1LD 5GT0B 3AFAA 3MVDC 1P34B 3AZMD 5GXQB 1ID3C 1R4VA 5CPKD 3WKJD 1H3OB 1HQ3A 2YFWA 3MGSD 4QLCC 1KX5A 3VH6A 1P3LD 5B33B 5B32C 2NZDC 3AYWC 2FJ7D 3WTPB 4G92B 3W98C 3O62A 3W97B 3REIA 4WNNA 5AV6C 3RELA 5AV5A 1KX4C 2HIOC 4YM6D 4Z5TB 5CPIA 2NQBC 1P3IC 4H9NA 5B31G 4E45A 5CP6C 2PYOD 3KWQA 4XZQB 4J8WA 3AZED 1P3MC 4J8VB 1P3PD 3B6GA 5DNMA 1S32A 1ZLAB 5B31B 3LJAB 2BYMB 3AN2C 5JRGA 5B1MD 4J8XA 4Z66D 1EQZB 5AVBA 2LY8A 1P3FD 3AZNA 5B1LC 2CV5B 4CAYA 3AZMC 2AROD 3AZHA 3LZ0A 4YS3B 3X1VD 1P3AD 3WKJC 3C1CB 5BT1D 4JJNB 3MGSC 1P3LC 3WAAB 2FJ7C 5F99D 1P3OA 3AV1B 3AZKB 5GSUD 1AOIA 3B0DC 3UT9A 4YM6C 1M18A 4KGCA 5AV9D 3UTAA 5B2ID 3X1UD 5FUGA 4H9PA 3VH6T 4NE6A 3MGRA 1F66A 3REJA 2PYOC 3AZEC 3MGPD 1P3GA 3B0CT 3NQJB 1P3PC 3TU4A 3REKD 3R45A 3AZID 3AV2B 1ID3A 5GT3A 3V9RB 5B1MC 4Z66C 5B1MB 5B40D 5B0ZD 4X23D 3UTBD 4QLCA 1P3FC 3MNND 3LZ1D 5DNNB 5CPJD 2NZDA 3VH5A 2AROC 3W98A 3C1BB 1BH8B 3X1VC 1P3AC 3LELB 1P3AB 5AV6A 5BT1C 3REHA 2HIOA 4H9SC 2F8ND 4KUDD 5F99C 1P3IA 4J8UB 1HQ3B 5GSUC 5CP6A 5AVCD 1BFMA 1P34D 5GT0D 5GXQD 4Z2MH 1P3MA 1TAFB 5AV9C 5G49B 5B2IC 4ZUXB 3X1UC 4WU9B 3REIB 3AN2A 5AV5B 5B33D 3WTPD 4G91B 3MGPC 4WV4B 3W97D 3A6NB 3REKC 3AZIC 1M1AA 3KXBB 3AZMA 4Z5TD 5CPKA 1P3BB 3X1SB 5BNVA 3WKJA 1KU5A 1P3KD 5B40C 5B0ZC 5BS7C 3MGSA 4X23C 3UTBC 1P3LA 5CPJC 4LD9B 4XZQD 2FJ7A 4J8VD 3KUYB 1ZLAD 4J8XB 3AZFC 3AZFB 3B6FA 5B31D 4YM6A 3LJAD 1BH9A 3NQUA 1EQZD 5AVCC 3AZGB 3VH5T 2CV5D 5GT0C 1P34C 2PYOA 3AZEA 5GXQC 1TZYC 1P3PA 5AV8D 1TZYB 4YS3D 3W96A 4CSRB 3C1CD 4WU8B 4JJND 1AOIB 5B33C 3WAAD 3WTPC 4G92C 1U35A 4Z66A 3W97C 3AV1D 3AZKD 1P3FA 2AROA 2HUEB 4Z5TC 1KX3C 3X1VA 1KX3B 1M19B 1P3GB 1P3KC 1P3KB 4R8PB 5KDMA 5JA4B 4XZQC 5BO0B 4J8VC 1JFIA 1ZLAC 4NFTA 5GSUA 3AV2D 5B31C 4UUZA 5B24B 3LJAC 5BNXB 4HGAB 5AV9A 4H9QA 5B2IA 3MGQB 1EQZC 3WA9B 3VH6W 2CV5C 5DNND 3REHB 3MGPA 3C1BD 5AV8C 4YS3C 3B0CW 5AV8B 3LELD 3AZLD 3C1CC 5B0YB 3REKA 4JJNC 4Z2MG 3WAAC 5B40A 5B0ZA 4J8UD 4H9OB 1HQ3D 3AV1C 4X23A 3UTBA 2BYKA 5AY8C 3AZKC 5AY8B 3MNNA 3LZ1A 5CPJA 4KHAB 4ZUXD 4WU9D 3REID 5E5AC 5E5AB 5AV5D 1M1AB 4EO5B 2F8NA 4KUDA 3X1TB 2YFVB 1HTAA 3A6ND 5AVCA 3AV2C 5GT0A 3KXBD 1P34A 3MVDA 5GXQA 1Q9CA 5B2JB 1P3BD 3X1SD 1H3OA 1B6WA 4XUJB 3W99B 3B6FB 5B33A 5DNNC 4LD9D 5B32A 3WTPA 3AYWA 3C1BC 3AZJB 3KUYD 3W97A 3LELC 4J8XD 3AZLC 3AZLB 3AZFD 1KX4A 4Z5TA 3AFAB 2NQBA 4J8UC 1HQ3C 3W96B 3AZGD 2YFWB 4XZQA 3B0BA 1KX5B 1WWSA 1TZYD 1ZLAA 4WU8D 3O62B 4ZUXC 4WU9C 5B31A 3LJAA 2CWEA 2BYMA 3REIC 1AOID 4WNNB 5AV5C 3RELB 4G91C 1EQZA 5CPIB 3A6NC 4H9NB 3KXBC 5B1LA 3VH5W 5KDMB 1P3BC 3X1SC 4J8WC 3KWQB 1KX3D 1M19D 4J8WB 1P3GD 3C1CA 2RVQC 1ULYA 4JJNA 3B6GB 4R8PD 5DNMB 1S32B 2IO5B 4E44A 3WAAA 4LD9C 1B67A 3KUYC 5JRGB 3AV1A 3AZKA 4J8XC 4H9QB 5AVBB 5B24D 3AZNB 3AZHC 4CAYB 3AZHB 3LZ0B 3MGQD 3WA9D 3AZGC 3REHD 3NQJA 5B0YD 4WU8C 3AV2A 1P3OB 3V9RA 1AOIC 3UT9B 5B1MA 1M18B 4KGCB 1F1EA 5AY8D 3UTAB 1F66C 5DNNA 3MGRB 5FUGB 1F66B 4H9PB 2HUEC 3REJB 1BH8A 4AWLB 3LELA 1M19C 1P3GC 1P3AA 3TU4C 5C3IB 4R8PC 3TU4B 5E5AD 3R45B 1M1AD 3MVDB 4H9SA 5GT3C 1ID3B 5GT3B 3X1TD 5F99A 4J8UA 5B24C 4QLCB 5B2JD 4HGAC 2NZDB
chains in the Genus database with same CATH superfamily
5B32B 1TAFA 3AYWB 5G49A 3W98B 4XUJD 4ZUXA 3MGQC 4WU9A 3X1UA 3EPLA 3WA9C 3W99D 5AV6B 3B6FD 3REHC 1KX4B 1N1JA 2HIOB 3AZJD 2FFFB 3A6NA 5B0YC 2NQBB 1P3IB 3KXBA 3AZIA 1P3BA 5CP6B 3X1SA 3AFAD 2ZY4A 1T3UA 1P3MB 3W96D 5BS7A 4LD9A 2ZY5A 4H9RA 1KX5D 2F8NH 3AN2B 3KUYA 1U35D 3O62D 3AZFA 3RELD 1M1AC 5B1LB 4EO5C 3AZMB 5CPKC 3X1TC 5CPKB 5BNVB 3WKJB 5CPID 3AZGA 3MGSB 5B2JC 1TZYA 1P3LB 3KWQD 4J8WD 2FJ7B 4CSRA 4WZSB 4XUJC 4WU8A 2RVQD 3B6GD 5DNMD 1S32D 3W99C 2Y2GA 3B0DB 3B6FC 4YM6B 5CHLB 3AZJC 1BH9B 3NQUB 5JRGD 5AVBD 3F6TA 2L5AA 3AZND 1KX3A 2PYOB 3AFAC 1M19A 3AZEB 2F8NK 2VQRA 3AZHD 3KSYA 3LZ0D 1P3KA 1P3PB 4ZBJC 4ZBJB 3W96C 4R8PA 5JA4A 3WTPE 5BO0A 1KX5C 4J8VA 1U35C 1U35B 4Z66B 3O62C 1P3OD 5B24A 5BNXA 1P3FB 3RELC 4NE3A 1A7WA 3UT9D 2AROB 1M18D 4KGCD 2ZM5A 2DQNC 3MGQA 3X1VB 5CPIC 3WA9A 1WWIA 3UTAD 2G5IC 3MGRD 2CV5A 1F66D 3REJD 5AV8A 3KWQC 4YS3A 5B0YA 5F99B 3EPJA 1JFIB 3B6GC 5DNMC 1S32C 3TU4D 2IO5C 5GSUB 3MVDD 1ID3D 4UUZB 4DRAA 5GT3D 4H9OA 5JRGC 2Y2KA 2F2AC 5AV9B 5AY8A 5B2IB 3X1UB 4KHAA 5AVBC 4QLCD 4DRBA 5B32D 3AZNC 1N1JB 3AYWD 2NZDD 3W98D 3MGPB 3LZ0C 4NE5A 5E5AA 5AV6D 3REKB 3AZIB 1KX4D 2HIOD 4M6BA 3X1TA 2YFVA 3A1IA 2NQBD 5B40B 1P3ID 5B0ZB 1P3OC 4X23B 3UTBB 2BYKB 5B2JA 5CP6D 3MNNC 3LZ1C 2F8NG 3MNNB 3LZ1B 5CPJB 2BG1A 4H9RB 3UT9C 1M18C 4XUJA 1P3MD 4KGCC 3H0LC 3W99A 3UTAC 3MGRC 2JCHA 3AZJA 2JSSA 3C1BA 3REJC 3AN2D 4AWLC 4WJ3C 2F8NB 4KUDC 4KUDB 3AZLA 3A1KA 5C3IC 5AVCB 5B32G 4UPKA 5B1LD 5GT0B 3AFAA 3MVDC 1P34B 3AZMD 5GXQB 1ID3C 1R4VA 5CPKD 3WKJD 1H3OB 1HQ3A 2YFWA 3MGSD 4QLCC 1KX5A 3VH6A 1P3LD 5B33B 5B32C 2NZDC 3AYWC 2FJ7D 3WTPB 4G92B 3W98C 2DF4C 3O62A 3W97B 3REIA 4WNNA 5AV6C 3RELA 5AV5A 1KX4C 2HIOC 4YM6D 4Z5TB 5CPIA 2NQBC 1P3IC 2Y2LA 4H9NA 5B31G 4E45A 5CP6C 2PYOD 3KWQA 4XZQB 4J8WA 3AZED 1P3MC 4J8VB 1P3PD 3B6GA 5DNMA 1S32A 1ZLAB 5B31B 3LJAB 2BYMB 3AN2C 5JRGA 5B1MD 4J8XA 4Z66D 3EPHA 1EQZB 5AVBA 2LY8A 1P3FD 3AZNA 5B1LC 2CV5B 4CAYA 3AZMC 2AROD 3AZHA 3LZ0A 4YS3B 3X1VD 1P3AD 3WKJC 3C1CB 5BT1D 4JJNB 3MGSC 1P3LC 3WAAB 2FJ7C 5F99D 1P3OA 3AV1B 3AZKB 2JE5A 5GSUD 1AOIA 3B0DC 2Y2PA 3UT9A 4YM6C 1M18A 4KGCA 5AV9D 3UTAA 1Z2CB 5B2ID 5FUGA 3X1UD 4H9PA 3VH6T 4NE6A 3MGRA 1F66A 3REJA 2PYOC 3AZEC 3MGPD 1P3GA 3B0CT 3NQJB 1P3PC 3TU4A 3REKD 3R45A 2XD1A 3AZID 3AV2B 1ID3A 5GT3A 3V9RB 5B1MC 4Z66C 5B1MB 3FDDA 5B40D 5B0ZD 4X23D 2ZY3A 3EG5B 4QLCA 3UTBD 1P3FC 3MNND 3LZ1D 5DNNB 5CPJD 2NZDA 3VH5A 2AROC 3W98A 3C1BB 2RIQA 1BH8B 3X1VC 1P3AC 3LELB 2Y2HA 1P3AB 5AV6A 5BT1C 3REHA 2HIOA 4H9SC 2F8ND 4KUDD 5F99C 1P3IA 4J8UB 1HQ3B 5GSUC 5CP6A 5AVCD 2Y2JA 1BFMA 1P34D 5GT0D 5GXQD 4Z2MH 1P3MA 2ZY2A 1TAFB 5AV9C 5G49B 2Y2OA 5B2IC 4ZUXB 3X1UC 4WU9B 3P5JB 3REIB 3AN2A 5AV5B 5B33D 3WTPD 4G91B 3MGPC 4WV4B 3W97D 3A6NB 3REKC 2Y2QA 3AZIC 1M1AA 3KXBB 3AZMA 4Z5TD 5CPKA 1P3BB 3X1SB 5BNVA 3WKJA 1KU5A 1P3KD 5B40C 5B0ZC 5BS7C 3MGSA 4X23C 3UTBC 1P3LA 5CPJC 4LD9B 4XZQD 2FJ7A 4J8VD 3KUYB 1ZLAD 4J8XB 3AZFC 3AZFB 3B6FA 3H0RC 5B31D 4YM6A 3LJAD 1BH9A 3NQUA 1EQZD 5AVCC 3AZGB 3VH5T 2CV5D 5GT0C 1P34C 2PYOA 3AZEA 5GXQC 1TZYC 1P3PA 5AV8D 1TZYB 4YS3D 3W96A 4CSRB 3C1CD 4WU8B 2XD5A 4JJND 1AOIB 3AL0C 5B33C 3WAAD 3WTPC 4G92C 1U35A 4Z66A 3W97C 3AV1D 3AZKD 1P3FA 4DQYB 2AROA 2HUEB 4Z5TC 1KX3C 3X1VA 1KX3B 1M19B 1P3GB 1P3KC 1P3KB 4R8PB 5KDMA 5JA4B 4XZQC 5BO0B 4J8VC 1JFIA 1ZLAC 4NFTA 5GSUA 3AV2D 5B31C 4UUZA 5B24B 3LJAC 5BNXB 4HGAB 5AV9A 4H9QA 5B2IA 2Y2NA 3MGQB 1PZRA 1EQZC 3WA9B 3VH6W 2CV5C 5DNND 3REHB 2W8SA 3MGPA 3C1BD 5AV8C 4YS3C 3B0CW 5AV8B 3LELD 3AZLD 3C1CC 5B0YB 3REKA 4JJNC 4Z2MG 3WAAC 5B40A 5B0ZA 4J8UD 4H9OB 1HQ3D 3AV1C 4X23A 3UTBA 2BYKA 5AY8C 3AZKC 5AY8B 3MNNA 3LZ1A 5CPJA 4KHAB 4ZUXD 4WU9D 3REID 5E5AC 5E5AB 5AV5D 1M1AB 4EO5B 2F8NA 1W2EA 4KUDA 3X1TB 2YFVB 1HTAA 3A6ND 5AVCA 3AV2C 5GT0A 3KXBD 1P34A 3MVDA 5GXQA 3IP4C 1Q9CA 5B2JB 1P3BD 3X1SD 1H3OA 1B6WA 4XUJB 3KFUG 3W99B 3B6FB 5B33A 5DNNC 4LD9D 5B32A 3WTPA 3AYWA 3C1BC 3AZJB 3KUYD 3W97A 3LELC 4J8XD 3AZLC 3AZLB 3AZFD 1KX4A 4Z5TA 3AFAB 2NQBA 4J8UC 1HQ3C 3W96B 2J8PA 3AZGD 2YFWB 4XZQA 3B0BA 1KX5B 1WWSA 1TZYD 1ZLAA 4WU8D 3O62B 4ZUXC 4WU9C 5B31A 3LJAA 2CWEA 2BYMA 3REIC 1AOID 4WNNB 5AV5C 3RELB 4G91C 1EQZA 5CPIB 3A6NC 4H9NB 3KXBC 5B1LA 3VH5W 5KDMB 1P3BC 3X1SC 4J8WC 3KWQB 1KX3D 1M19D 4J8WB 1P3GD 3C1CA 2RVQC 1ULYA 4JJNA 3B6GB 4R8PD 5DNMB 1S32B 2IO5B 4E44A 3WAAA 4LD9C 1B67A 3KUYC 5JRGB 3AV1A 3AZKA 4J8XC 4H9QB 5AVBB 5B24D 3AZNB 3AZHC 4CAYB 3AZHB 2Y2IA 3LZ0B 3MGQD 3WA9D 3AZGC 3REHD 3NQJA 3EPKA 5B0YD 4WU8C 3AV2A 1P3OB 3V9RA 1AOIC 3UT9B 5B1MA 1M18B 4KGCB 1F1EA 3H0MC 5AY8D 3UTAB 1F66C 5DNNA 3MGRB 5FUGB 1F66B 4H9PB 2HUEC 2Y2MA 3REJB 1BH8A 4AWLB 3LELA 1M19C 1P3GC 1P3AA 2G5HC 3TU4C 5C3IB 4R8PC 3TU4B 5E5AD 3R45B 1M1AD 3MVDB 4H9SA 5GT3C 1ID3B 5GT3B 3X1TD 5F99A 4J8UA 2UWXA 5B24C 4QLCB 5B2JD 4HGAC 2NZDB
chains in the Genus database with same CATH topology
5B32B 1TAFA 3AYWB 5G49A 3W98B 4XUJD 4ZUXA 3MGQC 4WU9A 3X1UA 3EPLA 3WA9C 3W99D 5AV6B 3B6FD 3REHC 1KX4B 1N1JA 2HIOB 3AZJD 2FFFB 3A6NA 5B0YC 2NQBB 1P3IB 3KXBA 3AZIA 1P3BA 5CP6B 3X1SA 3AFAD 2ZY4A 1T3UA 1P3MB 3W96D 5BS7A 4LD9A 2ZY5A 4H9RA 1KX5D 2F8NH 3AN2B 3KUYA 1U35D 3O62D 3AZFA 3RELD 1M1AC 5B1LB 4EO5C 3AZMB 5CPKC 3X1TC 5CPKB 5BNVB 3WKJB 5CPID 3AZGA 3MGSB 5B2JC 1TZYA 1P3LB 3KWQD 4J8WD 2FJ7B 4CSRA 4WZSB 4XUJC 4WU8A 2RVQD 3B6GD 5DNMD 1S32D 3W99C 2Y2GA 3B0DB 3B6FC 4YM6B 5CHLB 3AZJC 1BH9B 3NQUB 5JRGD 5AVBD 3F6TA 2L5AA 3AZND 1KX3A 2PYOB 3AFAC 1M19A 3AZEB 2F8NK 2VQRA 3AZHD 3KSYA 3LZ0D 1P3KA 1P3PB 4ZBJC 4ZBJB 3W96C 4R8PA 5JA4A 3WTPE 5BO0A 1KX5C 4J8VA 1U35C 1U35B 4Z66B 3O62C 1P3OD 5B24A 5BNXA 1P3FB 3RELC 4NE3A 1A7WA 3UT9D 2AROB 1M18D 4KGCD 2ZM5A 2DQNC 3MGQA 3X1VB 5CPIC 3WA9A 1WWIA 3UTAD 2G5IC 3MGRD 2CV5A 1F66D 3REJD 5AV8A 3KWQC 4YS3A 5B0YA 5F99B 3EPJA 1JFIB 3B6GC 5DNMC 1S32C 3TU4D 2IO5C 5GSUB 3MVDD 1ID3D 4UUZB 4DRAA 5GT3D 4H9OA 5JRGC 2Y2KA 2F2AC 5AV9B 5AY8A 5B2IB 3X1UB 4KHAA 5AVBC 4QLCD 4DRBA 5B32D 3AZNC 1N1JB 3AYWD 2NZDD 3W98D 3MGPB 3LZ0C 4NE5A 5E5AA 5AV6D 3REKB 3AZIB 1KX4D 2HIOD 4M6BA 3X1TA 2YFVA 3A1IA 2NQBD 5B40B 1P3ID 5B0ZB 1P3OC 4X23B 3UTBB 2BYKB 5B2JA 5CP6D 3MNNC 3LZ1C 2F8NG 3MNNB 3LZ1B 5CPJB 2BG1A 4H9RB 3UT9C 1M18C 4XUJA 1P3MD 4KGCC 3H0LC 3W99A 3UTAC 3MGRC 2JCHA 3AZJA 2JSSA 3C1BA 3REJC 3AN2D 4AWLC 4WJ3C 2F8NB 4KUDC 4KUDB 3AZLA 3A1KA 5C3IC 5AVCB 5B32G 4UPKA 5B1LD 5GT0B 3AFAA 3MVDC 1P34B 3AZMD 5GXQB 1ID3C 1R4VA 5CPKD 3WKJD 1H3OB 1HQ3A 2YFWA 3MGSD 4QLCC 1KX5A 3VH6A 1P3LD 5B33B 5B32C 2NZDC 3AYWC 2FJ7D 3WTPB 4G92B 3W98C 2DF4C 3O62A 3W97B 3REIA 4WNNA 5AV6C 3RELA 5AV5A 1KX4C 2HIOC 4YM6D 4Z5TB 5CPIA 2NQBC 1P3IC 2Y2LA 4H9NA 5B31G 4E45A 5CP6C 2PYOD 3KWQA 4XZQB 4J8WA 3AZED 1P3MC 4J8VB 1P3PD 3B6GA 5DNMA 1S32A 1ZLAB 5B31B 3LJAB 2BYMB 3AN2C 5JRGA 5B1MD 4J8XA 4Z66D 3EPHA 1EQZB 5AVBA 2LY8A 1P3FD 3AZNA 5B1LC 2CV5B 4CAYA 3AZMC 2AROD 3AZHA 3LZ0A 4YS3B 3X1VD 1P3AD 3WKJC 3C1CB 5BT1D 4JJNB 3MGSC 1P3LC 3WAAB 2FJ7C 5F99D 1P3OA 3AV1B 3AZKB 2JE5A 5GSUD 1AOIA 3B0DC 2Y2PA 3UT9A 4YM6C 1M18A 4KGCA 5AV9D 3UTAA 1Z2CB 5B2ID 5FUGA 3X1UD 4H9PA 3VH6T 4NE6A 3MGRA 1F66A 3REJA 2PYOC 3AZEC 3MGPD 1P3GA 3B0CT 3NQJB 1P3PC 3TU4A 3REKD 3R45A 2XD1A 3AZID 3AV2B 1ID3A 5GT3A 3V9RB 5B1MC 4Z66C 5B1MB 3FDDA 5B40D 5B0ZD 4X23D 2ZY3A 3EG5B 4QLCA 3UTBD 1P3FC 3MNND 3LZ1D 5DNNB 5CPJD 2NZDA 3VH5A 2AROC 3W98A 3C1BB 2RIQA 1BH8B 3X1VC 1P3AC 3LELB 2Y2HA 1P3AB 5AV6A 5BT1C 3REHA 2HIOA 4H9SC 2F8ND 4KUDD 5F99C 1P3IA 4J8UB 1HQ3B 5GSUC 5CP6A 5AVCD 2Y2JA 1BFMA 1P34D 5GT0D 5GXQD 4Z2MH 1P3MA 2ZY2A 1TAFB 5AV9C 5G49B 2Y2OA 5B2IC 4ZUXB 3X1UC 4WU9B 3P5JB 3REIB 3AN2A 5AV5B 5B33D 3WTPD 4G91B 3MGPC 4WV4B 3W97D 3A6NB 3REKC 2Y2QA 3AZIC 1M1AA 3KXBB 3AZMA 4Z5TD 5CPKA 1P3BB 3X1SB 5BNVA 3WKJA 1KU5A 1P3KD 5B40C 5B0ZC 5BS7C 3MGSA 4X23C 3UTBC 1P3LA 5CPJC 4LD9B 4XZQD 2FJ7A 4J8VD 3KUYB 1ZLAD 4J8XB 3AZFC 3AZFB 3B6FA 3H0RC 5B31D 4YM6A 3LJAD 1BH9A 3NQUA 1EQZD 5AVCC 3AZGB 3VH5T 2CV5D 5GT0C 1P34C 2PYOA 3AZEA 5GXQC 1TZYC 1P3PA 5AV8D 1TZYB 4YS3D 3W96A 4CSRB 3C1CD 4WU8B 2XD5A 4JJND 1AOIB 3AL0C 5B33C 3WAAD 3WTPC 4G92C 1U35A 4Z66A 3W97C 3AV1D 3AZKD 1P3FA 4DQYB 2AROA 2HUEB 4Z5TC 1KX3C 3X1VA 1KX3B 1M19B 1P3GB 1P3KC 1P3KB 4R8PB 5KDMA 5JA4B 4XZQC 5BO0B 4J8VC 1JFIA 1ZLAC 4NFTA 5GSUA 3AV2D 5B31C 4UUZA 5B24B 3LJAC 5BNXB 4HGAB 5AV9A 4H9QA 5B2IA 2Y2NA 3MGQB 1PZRA 1EQZC 3WA9B 3VH6W 2CV5C 5DNND 3REHB 2W8SA 3MGPA 3C1BD 5AV8C 4YS3C 3B0CW 5AV8B 3LELD 3AZLD 3C1CC 5B0YB 3REKA 4JJNC 4Z2MG 3WAAC 5B40A 5B0ZA 4J8UD 4H9OB 1HQ3D 3AV1C 4X23A 3UTBA 2BYKA 5AY8C 3AZKC 5AY8B 3MNNA 3LZ1A 5CPJA 4KHAB 4ZUXD 4WU9D 3REID 5E5AC 5E5AB 5AV5D 1M1AB 4EO5B 2F8NA 1W2EA 4KUDA 3X1TB 2YFVB 1HTAA 3A6ND 5AVCA 3AV2C 5GT0A 3KXBD 1P34A 3MVDA 5GXQA 3IP4C 1Q9CA 5B2JB 1P3BD 3X1SD 1H3OA 1B6WA 4XUJB 3KFUG 3W99B 3B6FB 5B33A 5DNNC 4LD9D 5B32A 3WTPA 3AYWA 3C1BC 3AZJB 3KUYD 3W97A 3LELC 4J8XD 3AZLC 3AZLB 3AZFD 1KX4A 4Z5TA 3AFAB 2NQBA 4J8UC 1HQ3C 3W96B 2J8PA 3AZGD 2YFWB 4XZQA 3B0BA 1KX5B 1WWSA 1TZYD 1ZLAA 4WU8D 3O62B 4ZUXC 4WU9C 5B31A 3LJAA 2CWEA 2BYMA 3REIC 1AOID 4WNNB 5AV5C 3RELB 4G91C 1EQZA 5CPIB 3A6NC 4H9NB 3KXBC 5B1LA 3VH5W 5KDMB 1P3BC 3X1SC 4J8WC 3KWQB 1KX3D 1M19D 4J8WB 1P3GD 3C1CA 2RVQC 1ULYA 4JJNA 3B6GB 4R8PD 5DNMB 1S32B 2IO5B 4E44A 3WAAA 4LD9C 1B67A 3KUYC 5JRGB 3AV1A 3AZKA 4J8XC 4H9QB 5AVBB 5B24D 3AZNB 3AZHC 4CAYB 3AZHB 2Y2IA 3LZ0B 3MGQD 3WA9D 3AZGC 3REHD 3NQJA 3EPKA 5B0YD 4WU8C 3AV2A 1P3OB 3V9RA 1AOIC 3UT9B 5B1MA 1M18B 4KGCB 1F1EA 3H0MC 5AY8D 3UTAB 1F66C 5DNNA 3MGRB 5FUGB 1F66B 4H9PB 2HUEC 2Y2MA 3REJB 1BH8A 4AWLB 3LELA 1M19C 1P3GC 1P3AA 2G5HC 3TU4C 5C3IB 4R8PC 3TU4B 5E5AD 3R45B 1M1AD 3MVDB 4H9SA 5GT3C 1ID3B 5GT3B 3X1TD 5F99A 4J8UA 2UWXA 5B24C 4QLCB 5B2JD 4HGAC 2NZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 B;  1TAF A;  3AYW B;  5G49 A;  3W98 B;  4XUJ D;  4ZUX A;  3MGQ C;  4WU9 A;  3X1U A;  3WA9 C;  3W99 D;  5AV6 B;  3B6F D;  3REH C;  1KX4 B;  1N1J A;  2HIO B;  3AZJ D;  3A6N A;  5B0Y C;  2NQB B;  1P3I B;  3KXB A;  3AZI A;  1P3B A;  5CP6 B;  3X1S A;  3AFA D;  1P3M B;  3W96 D;  5BS7 A;  4LD9 A;  4H9R A;  1KX5 D;  2F8N H;  3AN2 B;  3KUY A;  1U35 D;  3O62 D;  3AZF A;  3REL D;  1M1A C;  5B1L B;  4EO5 C;  3AZM B;  5CPK C;  3X1T C;  5CPK B;  5BNV B;  3WKJ B;  5CPI D;  3AZG A;  3MGS B;  5B2J C;  1TZY A;  1P3L B;  3KWQ D;  4J8W D;  2FJ7 B;  4CSR A;  4WZS B;  4XUJ C;  4WU8 A;  2RVQ D;  3B6G D;  5DNM D;  1S32 D;  3W99 C;  3B6F C;  3B0D B;  4YM6 B;  5CHL B;  3AZJ C;  1BH9 B;  3NQU B;  5JRG D;  5AVB D;  2L5A A;  3AZN D;  1KX3 A;  2PYO B;  3AFA C;  1M19 A;  3AZE B;  2F8N K;  3AZH D;  3KSY A;  3LZ0 D;  1P3K A;  1P3P B;  4ZBJ C;  4ZBJ B;  3W96 C;  4R8P A;  5JA4 A;  3WTP E;  5BO0 A;  1KX5 C;  4J8V A;  1U35 C;  1U35 B;  4Z66 B;  3O62 C;  1P3O D;  5B24 A;  5BNX A;  1P3F B;  3REL C;  4NE3 A;  1A7W A;  3UT9 D;  2ARO B;  1M18 D;  4KGC D;  3MGQ A;  3X1V B;  5CPI C;  3WA9 A;  1WWI A;  3UTA D;  3MGR D;  2CV5 A;  1F66 D;  3REJ D;  5AV8 A;  3KWQ C;  4YS3 A;  5B0Y A;  5F99 B;  1JFI B;  3B6G C;  5DNM C;  1S32 C;  3TU4 D;  2IO5 C;  5GSU B;  3MVD D;  1ID3 D;  4UUZ B;  4DRA A;  5GT3 D;  4H9O A;  5JRG C;  5AV9 B;  5AY8 A;  5B2I B;  3X1U B;  4KHA A;  5AVB C;  4QLC D;  4DRB A;  5B32 D;  3AZN C;  1N1J B;  3AYW D;  2NZD D;  3W98 D;  3MGP B;  3LZ0 C;  4NE5 A;  5E5A A;  5AV6 D;  3REK B;  3AZI B;  1KX4 D;  2HIO D;  4M6B A;  3X1T A;  2YFV A;  2NQB D;  5B40 B;  1P3I D;  5B0Z B;  1P3O C;  4X23 B;  3UTB B;  2BYK B;  5B2J A;  5CP6 D;  3MNN C;  3LZ1 C;  2F8N G;  3MNN B;  3LZ1 B;  5CPJ B;  4H9R B;  3UT9 C;  1M18 C;  4XUJ A;  1P3M D;  4KGC C;  3W99 A;  3UTA C;  3MGR C;  3AZJ A;  2JSS A;  3C1B A;  3REJ C;  3AN2 D;  4AWL C;  2F8N B;  4KUD C;  4KUD B;  3AZL A;  5C3I C;  5AVC B;  5B32 G;  5B1L D;  5GT0 B;  3AFA A;  3MVD C;  1P34 B;  3AZM D;  5GXQ B;  1ID3 C;  1R4V A;  5CPK D;  3WKJ D;  1H3O B;  1HQ3 A;  2YFW A;  3MGS D;  4QLC C;  1KX5 A;  3VH6 A;  1P3L D;  5B33 B;  5B32 C;  2NZD C;  3AYW C;  2FJ7 D;  3WTP B;  4G92 B;  3W98 C;  3O62 A;  3W97 B;  3REI A;  4WNN A;  5AV6 C;  3REL A;  5AV5 A;  1KX4 C;  2HIO C;  4YM6 D;  4Z5T B;  5CPI A;  2NQB C;  1P3I C;  4H9N A;  5B31 G;  4E45 A;  5CP6 C;  2PYO D;  3KWQ A;  4XZQ B;  4J8W A;  3AZE D;  1P3M C;  4J8V B;  1P3P D;  3B6G A;  5DNM A;  1S32 A;  1ZLA B;  5B31 B;  3LJA B;  2BYM B;  3AN2 C;  5JRG A;  5B1M D;  4J8X A;  4Z66 D;  1EQZ B;  5AVB A;  2LY8 A;  1P3F D;  3AZN A;  5B1L C;  2CV5 B;  4CAY A;  3AZM C;  2ARO D;  3AZH A;  3LZ0 A;  4YS3 B;  3X1V D;  1P3A D;  3WKJ C;  3C1C B;  5BT1 D;  4JJN B;  3MGS C;  1P3L C;  3WAA B;  2FJ7 C;  5F99 D;  1P3O A;  3AV1 B;  3AZK B;  5GSU D;  1AOI A;  3B0D C;  3UT9 A;  4YM6 C;  1M18 A;  4KGC A;  5AV9 D;  3UTA A;  5B2I D;  3X1U D;  5FUG A;  4H9P A;  3VH6 T;  4NE6 A;  3MGR A;  1F66 A;  3REJ A;  2PYO C;  3AZE C;  3MGP D;  1P3G A;  3B0C T;  3NQJ B;  1P3P C;  3TU4 A;  3REK D;  3R45 A;  3AZI D;  3AV2 B;  1ID3 A;  5GT3 A;  3V9R B;  5B1M C;  4Z66 C;  5B1M B;  5B40 D;  5B0Z D;  4X23 D;  3UTB D;  4QLC A;  1P3F C;  3MNN D;  3LZ1 D;  5DNN B;  5CPJ D;  2NZD A;  3VH5 A;  2ARO C;  3W98 A;  3C1B B;  1BH8 B;  3X1V C;  1P3A C;  3LEL B;  1P3A B;  5AV6 A;  5BT1 C;  3REH A;  2HIO A;  4H9S C;  2F8N D;  4KUD D;  5F99 C;  1P3I A;  4J8U B;  1HQ3 B;  5GSU C;  5CP6 A;  5AVC D;  1BFM A;  1P34 D;  5GT0 D;  5GXQ D;  4Z2M H;  1P3M A;  1TAF B;  5AV9 C;  5G49 B;  5B2I C;  4ZUX B;  3X1U C;  4WU9 B;  3REI B;  3AN2 A;  5AV5 B;  5B33 D;  3WTP D;  4G91 B;  3MGP C;  4WV4 B;  3W97 D;  3A6N B;  3REK C;  3AZI C;  1M1A A;  3KXB B;  3AZM A;  4Z5T D;  5CPK A;  1P3B B;  3X1S B;  5BNV A;  3WKJ A;  1KU5 A;  1P3K D;  5B40 C;  5B0Z C;  5BS7 C;  3MGS A;  4X23 C;  3UTB C;  1P3L A;  5CPJ C;  4LD9 B;  4XZQ D;  2FJ7 A;  4J8V D;  3KUY B;  1ZLA D;  4J8X B;  3AZF C;  3AZF B;  3B6F A;  5B31 D;  4YM6 A;  3LJA D;  1BH9 A;  3NQU A;  1EQZ D;  5AVC C;  3AZG B;  3VH5 T;  2CV5 D;  5GT0 C;  1P34 C;  2PYO A;  3AZE A;  5GXQ C;  1TZY C;  1P3P A;  5AV8 D;  1TZY B;  4YS3 D;  3W96 A;  4CSR B;  3C1C D;  4WU8 B;  4JJN D;  1AOI B;  5B33 C;  3WAA D;  3WTP C;  4G92 C;  1U35 A;  4Z66 A;  3W97 C;  3AV1 D;  3AZK D;  1P3F A;  2ARO A;  2HUE B;  4Z5T C;  1KX3 C;  3X1V A;  1KX3 B;  1M19 B;  1P3G B;  1P3K C;  1P3K B;  4R8P B;  5KDM A;  5JA4 B;  4XZQ C;  5BO0 B;  4J8V C;  1JFI A;  1ZLA C;  4NFT A;  5GSU A;  3AV2 D;  5B31 C;  4UUZ A;  5B24 B;  3LJA C;  5BNX B;  4HGA B;  5AV9 A;  4H9Q A;  5B2I A;  3MGQ B;  1EQZ C;  3WA9 B;  3VH6 W;  2CV5 C;  5DNN D;  3REH B;  3MGP A;  3C1B D;  5AV8 C;  4YS3 C;  3B0C W;  5AV8 B;  3LEL D;  3AZL D;  3C1C C;  5B0Y B;  3REK A;  4JJN C;  4Z2M G;  3WAA C;  5B40 A;  5B0Z A;  4J8U D;  4H9O B;  1HQ3 D;  3AV1 C;  4X23 A;  3UTB A;  2BYK A;  5AY8 C;  3AZK C;  5AY8 B;  3MNN A;  3LZ1 A;  5CPJ A;  4KHA B;  4ZUX D;  4WU9 D;  3REI D;  5E5A C;  5E5A B;  5AV5 D;  1M1A B;  4EO5 B;  2F8N A;  4KUD A;  3X1T B;  2YFV B;  1HTA A;  3A6N D;  5AVC A;  3AV2 C;  5GT0 A;  3KXB D;  1P34 A;  3MVD A;  5GXQ A;  1Q9C A;  5B2J B;  1P3B D;  3X1S D;  1H3O A;  1B6W A;  4XUJ B;  3W99 B;  3B6F B;  5B33 A;  5DNN C;  4LD9 D;  5B32 A;  3WTP A;  3AYW A;  3C1B C;  3AZJ B;  3KUY D;  3W97 A;  3LEL C;  4J8X D;  3AZL C;  3AZL B;  3AZF D;  1KX4 A;  4Z5T A;  3AFA B;  2NQB A;  4J8U C;  1HQ3 C;  3W96 B;  3AZG D;  2YFW B;  4XZQ A;  3B0B A;  1KX5 B;  1WWS A;  1TZY D;  1ZLA A;  4WU8 D;  3O62 B;  4ZUX C;  4WU9 C;  5B31 A;  3LJA A;  2CWE A;  2BYM A;  3REI C;  1AOI D;  4WNN B;  5AV5 C;  3REL B;  4G91 C;  1EQZ A;  5CPI B;  3A6N C;  4H9N B;  3KXB C;  5B1L A;  3VH5 W;  5KDM B;  1P3B C;  3X1S C;  4J8W C;  3KWQ B;  1KX3 D;  1M19 D;  4J8W B;  1P3G D;  3C1C A;  2RVQ C;  1ULY A;  4JJN A;  3B6G B;  4R8P D;  5DNM B;  1S32 B;  2IO5 B;  4E44 A;  3WAA A;  4LD9 C;  1B67 A;  3KUY C;  5JRG B;  3AV1 A;  3AZK A;  4J8X C;  4H9Q B;  5AVB B;  5B24 D;  3AZN B;  3AZH C;  4CAY B;  3AZH B;  3LZ0 B;  3MGQ D;  3WA9 D;  3AZG C;  3REH D;  3NQJ A;  5B0Y D;  4WU8 C;  3AV2 A;  1P3O B;  3V9R A;  1AOI C;  3UT9 B;  5B1M A;  1M18 B;  4KGC B;  1F1E A;  5AY8 D;  3UTA B;  1F66 C;  5DNN A;  3MGR B;  5FUG B;  1F66 B;  4H9P B;  2HUE C;  3REJ B;  1BH8 A;  4AWL B;  3LEL A;  1M19 C;  1P3G C;  1P3A A;  3TU4 C;  5C3I B;  4R8P C;  3TU4 B;  5E5A D;  3R45 B;  1M1A D;  3MVD B;  4H9S A;  5GT3 C;  1ID3 B;  5GT3 B;  3X1T D;  5F99 A;  4J8U A;  5B24 C;  4QLC B;  5B2J D;  4HGA C;  2NZD B; 
#chains in the Genus database with same CATH topology
 5B32 B;  1TAF A;  3AYW B;  5G49 A;  3W98 B;  4XUJ D;  4ZUX A;  3MGQ C;  4WU9 A;  3X1U A;  3EPL A;  3WA9 C;  3W99 D;  5AV6 B;  3B6F D;  3REH C;  1KX4 B;  1N1J A;  2HIO B;  3AZJ D;  2FFF B;  3A6N A;  5B0Y C;  2NQB B;  1P3I B;  3KXB A;  3AZI A;  1P3B A;  5CP6 B;  3X1S A;  3AFA D;  2ZY4 A;  1T3U A;  1P3M B;  3W96 D;  5BS7 A;  4LD9 A;  2ZY5 A;  4H9R A;  1KX5 D;  2F8N H;  3AN2 B;  3KUY A;  1U35 D;  3O62 D;  3AZF A;  3REL D;  1M1A C;  5B1L B;  4EO5 C;  3AZM B;  5CPK C;  3X1T C;  5CPK B;  5BNV B;  3WKJ B;  5CPI D;  3AZG A;  3MGS B;  5B2J C;  1TZY A;  1P3L B;  3KWQ D;  4J8W D;  2FJ7 B;  4CSR A;  4WZS B;  4XUJ C;  4WU8 A;  2RVQ D;  3B6G D;  5DNM D;  1S32 D;  3W99 C;  2Y2G A;  3B0D B;  3B6F C;  4YM6 B;  5CHL B;  3AZJ C;  1BH9 B;  3NQU B;  5JRG D;  5AVB D;  3F6T A;  2L5A A;  3AZN D;  1KX3 A;  2PYO B;  3AFA C;  1M19 A;  3AZE B;  2F8N K;  2VQR A;  3AZH D;  3KSY A;  3LZ0 D;  1P3K A;  1P3P B;  4ZBJ C;  4ZBJ B;  3W96 C;  4R8P A;  5JA4 A;  3WTP E;  5BO0 A;  1KX5 C;  4J8V A;  1U35 C;  1U35 B;  4Z66 B;  3O62 C;  1P3O D;  5B24 A;  5BNX A;  1P3F B;  3REL C;  4NE3 A;  1A7W A;  3UT9 D;  2ARO B;  1M18 D;  4KGC D;  2ZM5 A;  2DQN C;  3MGQ A;  3X1V B;  5CPI C;  3WA9 A;  1WWI A;  3UTA D;  2G5I C;  3MGR D;  2CV5 A;  1F66 D;  3REJ D;  5AV8 A;  3KWQ C;  4YS3 A;  5B0Y A;  5F99 B;  3EPJ A;  1JFI B;  3B6G C;  5DNM C;  1S32 C;  3TU4 D;  2IO5 C;  5GSU B;  3MVD D;  1ID3 D;  4UUZ B;  4DRA A;  5GT3 D;  4H9O A;  5JRG C;  2Y2K A;  2F2A C;  5AV9 B;  5AY8 A;  5B2I B;  3X1U B;  4KHA A;  5AVB C;  4QLC D;  4DRB A;  5B32 D;  3AZN C;  1N1J B;  3AYW D;  2NZD D;  3W98 D;  3MGP B;  3LZ0 C;  4NE5 A;  5E5A A;  5AV6 D;  3REK B;  3AZI B;  1KX4 D;  2HIO D;  4M6B A;  3X1T A;  2YFV A;  3A1I A;  2NQB D;  5B40 B;  1P3I D;  5B0Z B;  1P3O C;  4X23 B;  3UTB B;  2BYK B;  5B2J A;  5CP6 D;  3MNN C;  3LZ1 C;  2F8N G;  3MNN B;  3LZ1 B;  5CPJ B;  2BG1 A;  4H9R B;  3UT9 C;  1M18 C;  4XUJ A;  1P3M D;  4KGC C;  3H0L C;  3W99 A;  3UTA C;  3MGR C;  2JCH A;  3AZJ A;  2JSS A;  3C1B A;  3REJ C;  3AN2 D;  4AWL C;  4WJ3 C;  2F8N B;  4KUD C;  4KUD B;  3AZL A;  3A1K A;  5C3I C;  5AVC B;  5B32 G;  4UPK A;  5B1L D;  5GT0 B;  3AFA A;  3MVD C;  1P34 B;  3AZM D;  5GXQ B;  1ID3 C;  1R4V A;  5CPK D;  3WKJ D;  1H3O B;  1HQ3 A;  2YFW A;  3MGS D;  4QLC C;  1KX5 A;  3VH6 A;  1P3L D;  5B33 B;  5B32 C;  2NZD C;  3AYW C;  2FJ7 D;  3WTP B;  4G92 B;  3W98 C;  2DF4 C;  3O62 A;  3W97 B;  3REI A;  4WNN A;  5AV6 C;  3REL A;  5AV5 A;  1KX4 C;  2HIO C;  4YM6 D;  4Z5T B;  5CPI A;  2NQB C;  1P3I C;  2Y2L A;  4H9N A;  5B31 G;  4E45 A;  5CP6 C;  2PYO D;  3KWQ A;  4XZQ B;  4J8W A;  3AZE D;  1P3M C;  4J8V B;  1P3P D;  3B6G A;  5DNM A;  1S32 A;  1ZLA B;  5B31 B;  3LJA B;  2BYM B;  3AN2 C;  5JRG A;  5B1M D;  4J8X A;  4Z66 D;  3EPH A;  1EQZ B;  5AVB A;  2LY8 A;  1P3F D;  3AZN A;  5B1L C;  2CV5 B;  4CAY A;  3AZM C;  2ARO D;  3AZH A;  3LZ0 A;  4YS3 B;  3X1V D;  1P3A D;  3WKJ C;  3C1C B;  5BT1 D;  4JJN B;  3MGS C;  1P3L C;  3WAA B;  2FJ7 C;  5F99 D;  1P3O A;  3AV1 B;  3AZK B;  2JE5 A;  5GSU D;  1AOI A;  3B0D C;  2Y2P A;  3UT9 A;  4YM6 C;  1M18 A;  4KGC A;  5AV9 D;  3UTA A;  1Z2C B;  5B2I D;  5FUG A;  3X1U D;  4H9P A;  3VH6 T;  4NE6 A;  3MGR A;  1F66 A;  3REJ A;  2PYO C;  3AZE C;  3MGP D;  1P3G A;  3B0C T;  3NQJ B;  1P3P C;  3TU4 A;  3REK D;  3R45 A;  2XD1 A;  3AZI D;  3AV2 B;  1ID3 A;  5GT3 A;  3V9R B;  5B1M C;  4Z66 C;  5B1M B;  3FDD A;  5B40 D;  5B0Z D;  4X23 D;  2ZY3 A;  3EG5 B;  4QLC A;  3UTB D;  1P3F C;  3MNN D;  3LZ1 D;  5DNN B;  5CPJ D;  2NZD A;  3VH5 A;  2ARO C;  3W98 A;  3C1B B;  2RIQ A;  1BH8 B;  3X1V C;  1P3A C;  3LEL B;  2Y2H A;  1P3A B;  5AV6 A;  5BT1 C;  3REH A;  2HIO A;  4H9S C;  2F8N D;  4KUD D;  5F99 C;  1P3I A;  4J8U B;  1HQ3 B;  5GSU C;  5CP6 A;  5AVC D;  2Y2J A;  1BFM A;  1P34 D;  5GT0 D;  5GXQ D;  4Z2M H;  1P3M A;  2ZY2 A;  1TAF B;  5AV9 C;  5G49 B;  2Y2O A;  5B2I C;  4ZUX B;  3X1U C;  4WU9 B;  3P5J B;  3REI B;  3AN2 A;  5AV5 B;  5B33 D;  3WTP D;  4G91 B;  3MGP C;  4WV4 B;  3W97 D;  3A6N B;  3REK C;  2Y2Q A;  3AZI C;  1M1A A;  3KXB B;  3AZM A;  4Z5T D;  5CPK A;  1P3B B;  3X1S B;  5BNV A;  3WKJ A;  1KU5 A;  1P3K D;  5B40 C;  5B0Z C;  5BS7 C;  3MGS A;  4X23 C;  3UTB C;  1P3L A;  5CPJ C;  4LD9 B;  4XZQ D;  2FJ7 A;  4J8V D;  3KUY B;  1ZLA D;  4J8X B;  3AZF C;  3AZF B;  3B6F A;  3H0R C;  5B31 D;  4YM6 A;  3LJA D;  1BH9 A;  3NQU A;  1EQZ D;  5AVC C;  3AZG B;  3VH5 T;  2CV5 D;  5GT0 C;  1P34 C;  2PYO A;  3AZE A;  5GXQ C;  1TZY C;  1P3P A;  5AV8 D;  1TZY B;  4YS3 D;  3W96 A;  4CSR B;  3C1C D;  4WU8 B;  2XD5 A;  4JJN D;  1AOI B;  3AL0 C;  5B33 C;  3WAA D;  3WTP C;  4G92 C;  1U35 A;  4Z66 A;  3W97 C;  3AV1 D;  3AZK D;  1P3F A;  4DQY B;  2ARO A;  2HUE B;  4Z5T C;  1KX3 C;  3X1V A;  1KX3 B;  1M19 B;  1P3G B;  1P3K C;  1P3K B;  4R8P B;  5KDM A;  5JA4 B;  4XZQ C;  5BO0 B;  4J8V C;  1JFI A;  1ZLA C;  4NFT A;  5GSU A;  3AV2 D;  5B31 C;  4UUZ A;  5B24 B;  3LJA C;  5BNX B;  4HGA B;  5AV9 A;  4H9Q A;  5B2I A;  2Y2N A;  3MGQ B;  1PZR A;  1EQZ C;  3WA9 B;  3VH6 W;  2CV5 C;  5DNN D;  3REH B;  2W8S A;  3MGP A;  3C1B D;  5AV8 C;  4YS3 C;  3B0C W;  5AV8 B;  3LEL D;  3AZL D;  3C1C C;  5B0Y B;  3REK A;  4JJN C;  4Z2M G;  3WAA C;  5B40 A;  5B0Z A;  4J8U D;  4H9O B;  1HQ3 D;  3AV1 C;  4X23 A;  3UTB A;  2BYK A;  5AY8 C;  3AZK C;  5AY8 B;  3MNN A;  3LZ1 A;  5CPJ A;  4KHA B;  4ZUX D;  4WU9 D;  3REI D;  5E5A C;  5E5A B;  5AV5 D;  1M1A B;  4EO5 B;  2F8N A;  1W2E A;  4KUD A;  3X1T B;  2YFV B;  1HTA A;  3A6N D;  5AVC A;  3AV2 C;  5GT0 A;  3KXB D;  1P34 A;  3MVD A;  5GXQ A;  3IP4 C;  1Q9C A;  5B2J B;  1P3B D;  3X1S D;  1H3O A;  1B6W A;  4XUJ B;  3KFU G;  3W99 B;  3B6F B;  5B33 A;  5DNN C;  4LD9 D;  5B32 A;  3WTP A;  3AYW A;  3C1B C;  3AZJ B;  3KUY D;  3W97 A;  3LEL C;  4J8X D;  3AZL C;  3AZL B;  3AZF D;  1KX4 A;  4Z5T A;  3AFA B;  2NQB A;  4J8U C;  1HQ3 C;  3W96 B;  2J8P A;  3AZG D;  2YFW B;  4XZQ A;  3B0B A;  1KX5 B;  1WWS A;  1TZY D;  1ZLA A;  4WU8 D;  3O62 B;  4ZUX C;  4WU9 C;  5B31 A;  3LJA A;  2CWE A;  2BYM A;  3REI C;  1AOI D;  4WNN B;  5AV5 C;  3REL B;  4G91 C;  1EQZ A;  5CPI B;  3A6N C;  4H9N B;  3KXB C;  5B1L A;  3VH5 W;  5KDM B;  1P3B C;  3X1S C;  4J8W C;  3KWQ B;  1KX3 D;  1M19 D;  4J8W B;  1P3G D;  3C1C A;  2RVQ C;  1ULY A;  4JJN A;  3B6G B;  4R8P D;  5DNM B;  1S32 B;  2IO5 B;  4E44 A;  3WAA A;  4LD9 C;  1B67 A;  3KUY C;  5JRG B;  3AV1 A;  3AZK A;  4J8X C;  4H9Q B;  5AVB B;  5B24 D;  3AZN B;  3AZH C;  4CAY B;  3AZH B;  2Y2I A;  3LZ0 B;  3MGQ D;  3WA9 D;  3AZG C;  3REH D;  3NQJ A;  3EPK A;  5B0Y D;  4WU8 C;  3AV2 A;  1P3O B;  3V9R A;  1AOI C;  3UT9 B;  5B1M A;  1M18 B;  4KGC B;  1F1E A;  3H0M C;  5AY8 D;  3UTA B;  1F66 C;  5DNN A;  3MGR B;  5FUG B;  1F66 B;  4H9P B;  2HUE C;  2Y2M A;  3REJ B;  1BH8 A;  4AWL B;  3LEL A;  1M19 C;  1P3G C;  1P3A A;  2G5H C;  3TU4 C;  5C3I B;  4R8P C;  3TU4 B;  5E5A D;  3R45 B;  1M1A D;  3MVD B;  4H9S A;  5GT3 C;  1ID3 B;  5GT3 B;  3X1T D;  5F99 A;  4J8U A;  2UWX A;  5B24 C;  4QLC B;  5B2J D;  4HGA C;  2NZD B; 
#chains in the Genus database with same CATH homology
 5B32 B;  1TAF A;  3AYW B;  5G49 A;  3W98 B;  4XUJ D;  4ZUX A;  3MGQ C;  4WU9 A;  3X1U A;  3EPL A;  3WA9 C;  3W99 D;  5AV6 B;  3B6F D;  3REH C;  1KX4 B;  1N1J A;  2HIO B;  3AZJ D;  2FFF B;  3A6N A;  5B0Y C;  2NQB B;  1P3I B;  3KXB A;  3AZI A;  1P3B A;  5CP6 B;  3X1S A;  3AFA D;  2ZY4 A;  1T3U A;  1P3M B;  3W96 D;  5BS7 A;  4LD9 A;  2ZY5 A;  4H9R A;  1KX5 D;  2F8N H;  3AN2 B;  3KUY A;  1U35 D;  3O62 D;  3AZF A;  3REL D;  1M1A C;  5B1L B;  4EO5 C;  3AZM B;  5CPK C;  3X1T C;  5CPK B;  5BNV B;  3WKJ B;  5CPI D;  3AZG A;  3MGS B;  5B2J C;  1TZY A;  1P3L B;  3KWQ D;  4J8W D;  2FJ7 B;  4CSR A;  4WZS B;  4XUJ C;  4WU8 A;  2RVQ D;  3B6G D;  5DNM D;  1S32 D;  3W99 C;  2Y2G A;  3B0D B;  3B6F C;  4YM6 B;  5CHL B;  3AZJ C;  1BH9 B;  3NQU B;  5JRG D;  5AVB D;  3F6T A;  2L5A A;  3AZN D;  1KX3 A;  2PYO B;  3AFA C;  1M19 A;  3AZE B;  2F8N K;  2VQR A;  3AZH D;  3KSY A;  3LZ0 D;  1P3K A;  1P3P B;  4ZBJ C;  4ZBJ B;  3W96 C;  4R8P A;  5JA4 A;  3WTP E;  5BO0 A;  1KX5 C;  4J8V A;  1U35 C;  1U35 B;  4Z66 B;  3O62 C;  1P3O D;  5B24 A;  5BNX A;  1P3F B;  3REL C;  4NE3 A;  1A7W A;  3UT9 D;  2ARO B;  1M18 D;  4KGC D;  2ZM5 A;  2DQN C;  3MGQ A;  3X1V B;  5CPI C;  3WA9 A;  1WWI A;  3UTA D;  2G5I C;  3MGR D;  2CV5 A;  1F66 D;  3REJ D;  5AV8 A;  3KWQ C;  4YS3 A;  5B0Y A;  5F99 B;  3EPJ A;  1JFI B;  3B6G C;  5DNM C;  1S32 C;  3TU4 D;  2IO5 C;  5GSU B;  3MVD D;  1ID3 D;  4UUZ B;  4DRA A;  5GT3 D;  4H9O A;  5JRG C;  2Y2K A;  2F2A C;  5AV9 B;  5AY8 A;  5B2I B;  3X1U B;  4KHA A;  5AVB C;  4QLC D;  4DRB A;  5B32 D;  3AZN C;  1N1J B;  3AYW D;  2NZD D;  3W98 D;  3MGP B;  3LZ0 C;  4NE5 A;  5E5A A;  5AV6 D;  3REK B;  3AZI B;  1KX4 D;  2HIO D;  4M6B A;  3X1T A;  2YFV A;  3A1I A;  2NQB D;  5B40 B;  1P3I D;  5B0Z B;  1P3O C;  4X23 B;  3UTB B;  2BYK B;  5B2J A;  5CP6 D;  3MNN C;  3LZ1 C;  2F8N G;  3MNN B;  3LZ1 B;  5CPJ B;  2BG1 A;  4H9R B;  3UT9 C;  1M18 C;  4XUJ A;  1P3M D;  4KGC C;  3H0L C;  3W99 A;  3UTA C;  3MGR C;  2JCH A;  3AZJ A;  2JSS A;  3C1B A;  3REJ C;  3AN2 D;  4AWL C;  4WJ3 C;  2F8N B;  4KUD C;  4KUD B;  3AZL A;  3A1K A;  5C3I C;  5AVC B;  5B32 G;  4UPK A;  5B1L D;  5GT0 B;  3AFA A;  3MVD C;  1P34 B;  3AZM D;  5GXQ B;  1ID3 C;  1R4V A;  5CPK D;  3WKJ D;  1H3O B;  1HQ3 A;  2YFW A;  3MGS D;  4QLC C;  1KX5 A;  3VH6 A;  1P3L D;  5B33 B;  5B32 C;  2NZD C;  3AYW C;  2FJ7 D;  3WTP B;  4G92 B;  3W98 C;  2DF4 C;  3O62 A;  3W97 B;  3REI A;  4WNN A;  5AV6 C;  3REL A;  5AV5 A;  1KX4 C;  2HIO C;  4YM6 D;  4Z5T B;  5CPI A;  2NQB C;  1P3I C;  2Y2L A;  4H9N A;  5B31 G;  4E45 A;  5CP6 C;  2PYO D;  3KWQ A;  4XZQ B;  4J8W A;  3AZE D;  1P3M C;  4J8V B;  1P3P D;  3B6G A;  5DNM A;  1S32 A;  1ZLA B;  5B31 B;  3LJA B;  2BYM B;  3AN2 C;  5JRG A;  5B1M D;  4J8X A;  4Z66 D;  3EPH A;  1EQZ B;  5AVB A;  2LY8 A;  1P3F D;  3AZN A;  5B1L C;  2CV5 B;  4CAY A;  3AZM C;  2ARO D;  3AZH A;  3LZ0 A;  4YS3 B;  3X1V D;  1P3A D;  3WKJ C;  3C1C B;  5BT1 D;  4JJN B;  3MGS C;  1P3L C;  3WAA B;  2FJ7 C;  5F99 D;  1P3O A;  3AV1 B;  3AZK B;  2JE5 A;  5GSU D;  1AOI A;  3B0D C;  2Y2P A;  3UT9 A;  4YM6 C;  1M18 A;  4KGC A;  5AV9 D;  3UTA A;  1Z2C B;  5B2I D;  5FUG A;  3X1U D;  4H9P A;  3VH6 T;  4NE6 A;  3MGR A;  1F66 A;  3REJ A;  2PYO C;  3AZE C;  3MGP D;  1P3G A;  3B0C T;  3NQJ B;  1P3P C;  3TU4 A;  3REK D;  3R45 A;  2XD1 A;  3AZI D;  3AV2 B;  1ID3 A;  5GT3 A;  3V9R B;  5B1M C;  4Z66 C;  5B1M B;  3FDD A;  5B40 D;  5B0Z D;  4X23 D;  2ZY3 A;  3EG5 B;  4QLC A;  3UTB D;  1P3F C;  3MNN D;  3LZ1 D;  5DNN B;  5CPJ D;  2NZD A;  3VH5 A;  2ARO C;  3W98 A;  3C1B B;  2RIQ A;  1BH8 B;  3X1V C;  1P3A C;  3LEL B;  2Y2H A;  1P3A B;  5AV6 A;  5BT1 C;  3REH A;  2HIO A;  4H9S C;  2F8N D;  4KUD D;  5F99 C;  1P3I A;  4J8U B;  1HQ3 B;  5GSU C;  5CP6 A;  5AVC D;  2Y2J A;  1BFM A;  1P34 D;  5GT0 D;  5GXQ D;  4Z2M H;  1P3M A;  2ZY2 A;  1TAF B;  5AV9 C;  5G49 B;  2Y2O A;  5B2I C;  4ZUX B;  3X1U C;  4WU9 B;  3P5J B;  3REI B;  3AN2 A;  5AV5 B;  5B33 D;  3WTP D;  4G91 B;  3MGP C;  4WV4 B;  3W97 D;  3A6N B;  3REK C;  2Y2Q A;  3AZI C;  1M1A A;  3KXB B;  3AZM A;  4Z5T D;  5CPK A;  1P3B B;  3X1S B;  5BNV A;  3WKJ A;  1KU5 A;  1P3K D;  5B40 C;  5B0Z C;  5BS7 C;  3MGS A;  4X23 C;  3UTB C;  1P3L A;  5CPJ C;  4LD9 B;  4XZQ D;  2FJ7 A;  4J8V D;  3KUY B;  1ZLA D;  4J8X B;  3AZF C;  3AZF B;  3B6F A;  3H0R C;  5B31 D;  4YM6 A;  3LJA D;  1BH9 A;  3NQU A;  1EQZ D;  5AVC C;  3AZG B;  3VH5 T;  2CV5 D;  5GT0 C;  1P34 C;  2PYO A;  3AZE A;  5GXQ C;  1TZY C;  1P3P A;  5AV8 D;  1TZY B;  4YS3 D;  3W96 A;  4CSR B;  3C1C D;  4WU8 B;  2XD5 A;  4JJN D;  1AOI B;  3AL0 C;  5B33 C;  3WAA D;  3WTP C;  4G92 C;  1U35 A;  4Z66 A;  3W97 C;  3AV1 D;  3AZK D;  1P3F A;  4DQY B;  2ARO A;  2HUE B;  4Z5T C;  1KX3 C;  3X1V A;  1KX3 B;  1M19 B;  1P3G B;  1P3K C;  1P3K B;  4R8P B;  5KDM A;  5JA4 B;  4XZQ C;  5BO0 B;  4J8V C;  1JFI A;  1ZLA C;  4NFT A;  5GSU A;  3AV2 D;  5B31 C;  4UUZ A;  5B24 B;  3LJA C;  5BNX B;  4HGA B;  5AV9 A;  4H9Q A;  5B2I A;  2Y2N A;  3MGQ B;  1PZR A;  1EQZ C;  3WA9 B;  3VH6 W;  2CV5 C;  5DNN D;  3REH B;  2W8S A;  3MGP A;  3C1B D;  5AV8 C;  4YS3 C;  3B0C W;  5AV8 B;  3LEL D;  3AZL D;  3C1C C;  5B0Y B;  3REK A;  4JJN C;  4Z2M G;  3WAA C;  5B40 A;  5B0Z A;  4J8U D;  4H9O B;  1HQ3 D;  3AV1 C;  4X23 A;  3UTB A;  2BYK A;  5AY8 C;  3AZK C;  5AY8 B;  3MNN A;  3LZ1 A;  5CPJ A;  4KHA B;  4ZUX D;  4WU9 D;  3REI D;  5E5A C;  5E5A B;  5AV5 D;  1M1A B;  4EO5 B;  2F8N A;  1W2E A;  4KUD A;  3X1T B;  2YFV B;  1HTA A;  3A6N D;  5AVC A;  3AV2 C;  5GT0 A;  3KXB D;  1P34 A;  3MVD A;  5GXQ A;  3IP4 C;  1Q9C A;  5B2J B;  1P3B D;  3X1S D;  1H3O A;  1B6W A;  4XUJ B;  3KFU G;  3W99 B;  3B6F B;  5B33 A;  5DNN C;  4LD9 D;  5B32 A;  3WTP A;  3AYW A;  3C1B C;  3AZJ B;  3KUY D;  3W97 A;  3LEL C;  4J8X D;  3AZL C;  3AZL B;  3AZF D;  1KX4 A;  4Z5T A;  3AFA B;  2NQB A;  4J8U C;  1HQ3 C;  3W96 B;  2J8P A;  3AZG D;  2YFW B;  4XZQ A;  3B0B A;  1KX5 B;  1WWS A;  1TZY D;  1ZLA A;  4WU8 D;  3O62 B;  4ZUX C;  4WU9 C;  5B31 A;  3LJA A;  2CWE A;  2BYM A;  3REI C;  1AOI D;  4WNN B;  5AV5 C;  3REL B;  4G91 C;  1EQZ A;  5CPI B;  3A6N C;  4H9N B;  3KXB C;  5B1L A;  3VH5 W;  5KDM B;  1P3B C;  3X1S C;  4J8W C;  3KWQ B;  1KX3 D;  1M19 D;  4J8W B;  1P3G D;  3C1C A;  2RVQ C;  1ULY A;  4JJN A;  3B6G B;  4R8P D;  5DNM B;  1S32 B;  2IO5 B;  4E44 A;  3WAA A;  4LD9 C;  1B67 A;  3KUY C;  5JRG B;  3AV1 A;  3AZK A;  4J8X C;  4H9Q B;  5AVB B;  5B24 D;  3AZN B;  3AZH C;  4CAY B;  3AZH B;  2Y2I A;  3LZ0 B;  3MGQ D;  3WA9 D;  3AZG C;  3REH D;  3NQJ A;  3EPK A;  5B0Y D;  4WU8 C;  3AV2 A;  1P3O B;  3V9R A;  1AOI C;  3UT9 B;  5B1M A;  1M18 B;  4KGC B;  1F1E A;  3H0M C;  5AY8 D;  3UTA B;  1F66 C;  5DNN A;  3MGR B;  5FUG B;  1F66 B;  4H9P B;  2HUE C;  2Y2M A;  3REJ B;  1BH8 A;  4AWL B;  3LEL A;  1M19 C;  1P3G C;  1P3A A;  2G5H C;  3TU4 C;  5C3I B;  4R8P C;  3TU4 B;  5E5A D;  3R45 B;  1M1A D;  3MVD B;  4H9S A;  5GT3 C;  1ID3 B;  5GT3 B;  3X1T D;  5F99 A;  4J8U A;  2UWX A;  5B24 C;  4QLC B;  5B2J D;  4HGA C;  2NZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...