4H9OA

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIMALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 29
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9oA00
4KHAB 4YS3D 3MVDD 3C1CA 3UTAB 1F66D 5B1LB 3REIA 3WA9A 2YFVB 3AV2B 2F8NA 4M6BA 4XZQA 5DNMC 3WAAC 5GT0C 1M1AD 5B33D 3AZED 1P3OD 4ZUXA 3X1SD 1P3PB 3REKA 3B0DC 5B0YB 2NZDC 3AZNB 5B24B 3KXBD 4R8PA 5C3IC 3AV1C 4Z2MH 5B0ZB 3B6GC 3O62C 4WNNA 3B0BA 4H9SA 1P3AA 4QLCC 3KWQD 4H9PA 3A6NA 1P34D 3REHD 2AROD 2JSSA 3R45B 4YM6C 5CPID 4G91B 3UTAC 3B6FB 3AV2C 4Z66D 3AYWA 3AZJB 1BH8A 5B2ID 4X23A 3KUYD 1P3PC 3W96D 5BNXB 3REJA 3VH5T 5B1MD 5B0ZC 3LELB 3AZLC 3W97D 2CWEA 2YFWA 3AZHD 4Z5TD 3AZMA 1P3BB 5JRGC 1P3LD 1S32B 1TZYD 5E5AA 4G91C 3AZFA 1P3ID 2HIOD 5AY8C 5AV6B 2PYOD 3LZ1D 5GT3B 3AFAD 5GXQC 3MGQA 4LD9D 4XUJB 5AVBA 4KGCA 3REIC 3NQUA 5DNNA 1A7WA 5B40D 3WA9C 5B2JB 2IO5B 1KX4A 4Z2MG 5B32D 1JFIB 2NQBB 5AVCB 4XZQC 4JJNB 5F99D 3W99A 3LJAA 5CPJB 4ZUXC 4YS3B 5BNVB 3V9RB 3MVDB 3REKC 5CPKD 1F66B 1ID3D 4R8PC 1S32C 3MGPD 1KX3A 1M1AB 5B33B 3AZEB 1P3OB 3A6NC 3X1SB 4E45A 3KXBB 3UTBA 3RELA 5GSUD 1M19D 4XUJC 3UT9A 5B2JC 2IO5C 2NQBC 3KWQB 1P34B 5AV9D 3MNND 5BT1D 4X23C 4HGAC 1H3OA 2AROB 4NE6A 3REHB 3MGSA 5GT0A 4WU9C 5CPIB 3WAAA 3VH6T 1F66C 2CV5D 3REJC 1P3KD 2NZDA 4Z66B 3MGRD 3AV1A 5B2IB 5B33C 3KUYB 1P3OC 1KX5D 3AZMC 5CP6A 1AOID 3W96B 2LY8A 3KXBC 3X1TD 3AZFC 1U35D 4KHAA 3W97B 3UTAA 3LZ0D 5B31D 5CHLB 2F8NH 2YFVA 3AV2A 1P34C 4J8WD 3AZHB 2F8NK 4Z5TB 2AROC 1TZYB 4UUZB 4AWLC 5CPIC 1P3MB 4KGCC 1P3IB 4J8XD 2HIOB 1P3PA 5B0YA 2PYOB 3W99C 4H9RB 3LZ1B 4Z66C 3WTPE 5B24A 3AFAB 4LD9B 5B0ZA 3AZLA 1WWIA 3X1VD 3AZGD 3KUYC 5B40B 3AZID 5B32B 5KDMB 3W96C 4H9NB 2BYMB 5F99B 3R45A 1P3GD 5AV8D 3W97C 5G49B 5AY8A 5CPKB 3B6FA 3TU4D 1ID3B 4Z5TC 3UTBC 3WTPD 3AZJA 3MGPB 1P3MC 3W98C 3UT9C 2HIOC 3X1UD 5BNXA 2PYOC 4CAYB 3VH6W 3MGSC 3C1BD 3LELA 1M19B 5GSUB 1P3FC 5B40C 1HQ3D 5B32C 4H9OB 1P3BA 1S32A 5AV9B 5F99C 3MNNB 2F8NG 4WV4B 4DRBA 3AZKC 4ZBJB 5CP6C 5GT3A 2CV5B 1P3KB 3KSYA 1ID3C 3MGRB 3AN2D 3MGPC 4XUJA 5B1LC 5B2JA 3VH5A 1JFIA 2NQBA 5AVCA 4JJNA 1AOIB 4WU9A 5CPJA 1M19C 5GSUC 4YS3A 3MVDA 3V9RA 4J8VD 5B0YC 3LZ0B 1F66A 5B31B 3AZNC 5B24C 1M18D 4J8WB 5AV9C 5BT1C 3MGQD 5B33A 3AZEA 1P3OA 4J8XB 3X1SA 1P3KC 3MGRC 5AV5D 3KXBA 4J8UD 2FJ7D 3B6FC 3X1VB 3LJAD 3AZGB 4H9QB 3KWQA 3AZIB 1P34A 1AOIC 3WKJB 3AZJC 1R4VA 3REHA 2AROA 1P3GB 5AV8B 5CPIA 2L5AA 1KX3D 1BH9B 3LZ0C 1EQZD 3TU4B 4Z66A 5FUGB 3LELC 1N1JB 3WTPB 5B2IA 3KUYA 1ZLAD 3NQJB 1WWSA 1P3BC 3W96A 3X1UB 1F1EA 3C1BB 3W97A 5AV6C 5DNMD 3WAAD 5GT0D 5GT3C 1B6WA 3AZGC 3AZIC 1HQ3B 3AZHA 3WKJC 4Z5TA 2NZDD 1TZYA 4UUZA 1P3MA 3W98A 3AV1D 2HIOA 3B6GD 5AVCC 3O62D 4JJNC 2PYOA 4H9RA 3LZ1A 3AFAA 4QLCD 4LD9A 5CPJC 3WTPC 3AN2B 4YS3C 3MVDC 4YM6D 1P3FA 5B40A 4EO5B 5B32A 5KDMA 4H9NA 2BYMA 5F99A 2YFWB 4KUDD 3C1BC 1M1AC 3AZEC 5G49A 3AZKA 3X1SC 4J8VB 5CPKA 4WU8D 1HQ3C 5JA4B 1ID3A 5B1MB 1M18B 3MGPA 5B1LA 3AZLD 3KWQC 1B67A 4CAYA 1P3LB 3REHC 5AV5B 5JRGD 1M19A 5GSUA 4J8UB 2FJ7B 3AZNA 3LJAB 5AY8D 4H9OA 5AV9A 3MNNA 5B2IC 5GXQD 4J8VC 3C1CD 3REID 2CV5A 1P3KA 1EQZB 2BYKB 3WA9D 1KU5A 5B1MC 3MGRA 2F8ND 4XZQD 2RVQD 1ZLAB 4ZUXD 4CSRB 3AZHC 3REKD 1AOIA 1P3LC 1TZYC 4NE5A 5AV5C 4R8PD 1P3IC 5DNMB 3LZ0A 5B31A 3WAAB 3LZ1C 1P3AD 3AFAC 3A6ND 4J8WA 4LD9C 2NZDB 2HUEB 3AV1B 4J8XA 1TAFB 3B6GB 3O62B 1EQZC 4QLCB 3AYWD 5AV6A 4X23D 5CPKC 4WU9D 4YM6B 3AZGA 1ZLAC 4H9QA 3AZIA 3WKJA 3REJD 1P3GA 5AV8A 4KUDB 1BH9A 1KX5B 4WU8B 4WZSB 3TU4A 5FUGA 3AZMD 1BFMA 1N1JA 3X1TB 3WTPA 1U35B 5BNVA 2HUEC 5E5AD 3AZFD 3NQJA 5BO0B 3AZLB 3X1UA 3MNNC 3C1BA 1M1AA 5JRGB 4ZBJC 5AVBD 4KGCD 2CV5C 5DNND 1KX4D 1HQ3A 5AY8B 3W99D 4KUDC 5GXQB 3B0CT 1KX5C 3C1CB 4WU8C 3REIB 3WA9B 2F8NB 3X1TC 3AN2A 1U35C 4XZQB 1Q9CA 5B31C 4ZUXB 4J8WC 3REKB 4R8PB 3RELD 3UTBD 4J8XC 4J8VA 1P3MD 3W98D 3UT9D 4WNNB 5JA4A 5BS7C 1P3AB 5B1MA 4H9PB 3A6NB 1M18A 3MGSD 3X1VC 3C1CC 1P3FD 1P3LA 3VH6A 1P3GC 5AV8C 5AV5A 1P3IA 3AYWB 2RVQC 4J8UA 1BH8B 4HGAB 4X23B 2FJ7A 4WU9B 3TU4C 3AZKD 5CP6D 3REJB 4G92B 3UTAD 3X1UC 5B1LD 1EQZA 2BYKA 4H9SC 3AV2D 1P3AC 3AZMB 1ULYA 5E5AB 1ZLAA 3AZFB 4CSRA 1P3PD 5B0YD 3AZND 3B0CW 5B32G 5B24D 3MGQB 3AYWC 5B0ZD 4NFTA 4E44A 5DNMA 4DRAA 5AVBB 4AWLB 3NQUB 4NE3A 5DNNB 4KGCB 1KX4B 3VH5W 3AN2C 3W99B 4G92C 4EO5C 1TAFA 3B6GA 3O62A 3B6FD 4QLCA 3AZJD 1KX3B 5E5AC 4YM6A 1M18C 3MGQC 4KUDA 3LELD 3UTBB 3RELB 1KX5A 5AVBC 5DNNC 4WU8A 3W98B 3UT9B 1KX4C 1P3BD 3X1TA 1S32D 1U35A 4J8UC 1H3OB 2FJ7C 3MGSB 5GT0B 3LJAC 5BO0A 5AV6D 3B0DB 5GT3D 1P3FB 3WKJD 5JRGA 5C3IB 1KX3C 1HTAA 4XUJD 5B2JD 5BS7A 2NQBD 5B31G 3AZKB 5AVCD 4JJND 5CP6B 5GXQA 3X1VA 5CPJD 3RELC
chains in the Genus database with same CATH superfamily
4KHAB 4YS3D 3MVDD 3C1CA 3UTAB 1F66D 5B1LB 3REIA 3WA9A 2YFVB 3AV2B 2F8NA 4M6BA 4XZQA 5DNMC 3WAAC 5GT0C 1M1AD 5B33D 3AZED 1P3OD 4ZUXA 3X1SD 2G5HC 1P3PB 3REKA 3B0DC 5B0YB 2NZDC 3AZNB 5B24B 3KXBD 4R8PA 5C3IC 3AV1C 4Z2MH 5B0ZB 3B6GC 3O62C 4WNNA 3B0BA 4H9SA 1P3AA 4QLCC 3KWQD 4H9PA 3A6NA 1P34D 3F6TA 2AROD 2JSSA 3R45B 3REHD 4YM6C 5CPID 4G91B 3UTAC 3B6FB 3AV2C 3EPLA 4Z66D 3AYWA 3AZJB 1BH8A 5B2ID 4X23A 3KUYD 1P3PC 3W96D 5BNXB 3REJA 3VH5T 5B1MD 5B0ZC 3LELB 3AZLC 3W97D 2CWEA 2YFWA 3AZHD 4Z5TD 3AZMA 1P3BB 5JRGC 1P3LD 1S32B 1TZYD 5E5AA 4G91C 3AZFA 1P3ID 2HIOD 5AY8C 5AV6B 2PYOD 3LZ1D 5GT3B 3AFAD 5GXQC 3MGQA 4LD9D 4XUJB 5AVBA 4KGCA 3REIC 3NQUA 5DNNA 1A7WA 5B40D 3WA9C 5B2JB 2IO5B 1KX4A 4Z2MG 5B32D 1JFIB 2NQBB 5AVCB 4XZQC 4JJNB 5F99D 3W99A 3LJAA 5CPJB 4ZUXC 4YS3B 5BNVB 3V9RB 3MVDB 3REKC 5CPKD 1F66B 1ID3D 4R8PC 2G5IC 1S32C 3MGPD 1KX3A 3EG5B 1M1AB 5B33B 3AZEB 1P3OB 3A6NC 3X1SB 4E45A 2Y2QA 3KXBB 3UTBA 3RELA 5GSUD 1M19D 4XUJC 3UT9A 5B2JC 2IO5C 2NQBC 3KWQB 1P34B 5AV9D 3MNND 5BT1D 4X23C 4HGAC 1H3OA 2AROB 2ZY2A 4NE6A 3MGSA 5GT0A 3REHB 4WU9C 5CPIB 3WAAA 3VH6T 1F66C 2CV5D 3REJC 1P3KD 2NZDA 4Z66B 3MGRD 2Y2GA 3AV1A 5B2IB 1W2EA 5B33C 3KUYB 1P3OC 2DF4C 1KX5D 3AZMC 5CP6A 1AOID 3W96B 2LY8A 3KXBC 3X1TD 3AZFC 1U35D 4KHAA 3W97B 3UTAA 3LZ0D 5B31D 5CHLB 2F8NH 2YFVA 3AV2A 1P34C 4J8WD 3AZHB 2F8NK 4Z5TB 2AROC 1TZYB 4UUZB 4AWLC 5CPIC 1P3MB 4KGCC 1P3IB 2ZM5A 2HIOB 4J8XD 1P3PA 5B0YA 2PYOB 3W99C 3KFUG 4H9RB 3LZ1B 4Z66C 3WTPE 5B24A 3AFAB 4LD9B 5B0ZA 3AZLA 1WWIA 3X1VD 3AZGD 3KUYC 5B40B 3AZID 5B32B 5KDMB 2Y2JA 3W96C 4H9NB 2BYMB 5F99B 3R45A 1P3GD 5AV8D 2VQRA 3W97C 5G49B 5AY8A 5CPKB 3B6FA 3TU4D 1ID3B 4Z5TC 3UTBC 3WTPD 3AZJA 3MGPB 1P3MC 3W98C 3UT9C 2HIOC 3X1UD 5BNXA 2PYOC 4CAYB 3VH6W 3MGSC 3C1BD 3LELA 1M19B 5GSUB 1P3FC 5B40C 1HQ3D 5B32C 4H9OB 1P3BA 1S32A 5AV9B 5F99C 3MNNB 2F8NG 4WV4B 3AL0C 4DRBA 3AZKC 4ZBJB 5CP6C 5GT3A 2CV5B 1P3KB 3KSYA 1ID3C 3MGRB 3AN2D 3MGPC 4XUJA 5B1LC 2ZY3A 5B2JA 3VH5A 1JFIA 2NQBA 5AVCA 4JJNA 1AOIB 4WU9A 5CPJA 1M19C 5GSUC 4YS3A 3MVDA 3V9RA 4J8VD 5B0YC 3LZ0B 1F66A 5B31B 3AZNC 5B24C 1M18D 1PZRA 4J8WB 5AV9C 5BT1C 3MGQD 5B33A 3AZEA 1P3OA 4J8XB 3X1SA 1P3KC 1T3UA 3MGRC 5AV5D 3KXBA 4J8UD 2FJ7D 3B6FC 3X1VB 3LJAD 3AZGB 4H9QB 3KWQA 3AZIB 2Y2IA 1P34A 1AOIC 3WKJB 3AZJC 1R4VA 3REHA 2AROA 1P3GB 5AV8B 5CPIA 2L5AA 1KX3D 1BH9B 3LZ0C 1EQZD 3TU4B 4Z66A 5FUGB 3LELC 1N1JB 3WTPB 5B2IA 3H0RC 3KUYA 1ZLAD 3NQJB 1WWSA 1P3BC 3W96A 3X1UB 1F1EA 3C1BB 2UWXA 3W97A 5AV6C 5DNMD 3WAAD 5GT0D 5GT3C 1B6WA 3AZGC 3AZIC 1HQ3B 3AZHA 3WKJC 4Z5TA 2NZDD 1TZYA 4UUZA 2F2AC 1P3MA 3W98A 3AV1D 2HIOA 3B6GD 5AVCC 3O62D 4JJNC 2PYOA 4H9RA 3LZ1A 3AFAA 4QLCD 2XD1A 4LD9A 2ZY5A 2ZY4A 3WTPC 3AN2B 5CPJC 4YS3C 3MVDC 4YM6D 1P3FA 5B40A 4EO5B 5B32A 5KDMA 4H9NA 2BYMA 5F99A 2YFWB 4KUDD 3C1BC 1M1AC 3AZEC 5G49A 3AZKA 3X1SC 4J8VB 5CPKA 4WU8D 1HQ3C 5JA4B 1ID3A 5B1MB 1M18B 3MGPA 5B1LA 3AZLD 3KWQC 1B67A 4CAYA 1P3LB 3REHC 5AV5B 5JRGD 1M19A 5GSUA 4J8UB 2Y2NA 2FJ7B 3AZNA 3LJAB 5AY8D 4H9OA 5AV9A 3MNNA 5B2IC 5GXQD 2Y2HA 4J8VC 3C1CD 3REID 4UPKA 2CV5A 1Z2CB 2BYKB 1P3KA 1EQZB 1KU5A 3WA9D 5B1MC 3MGRA 2F8ND 4WJ3C 4XZQD 2RVQD 1ZLAB 4ZUXD 4CSRB 3AZHC 3REKD 1AOIA 3H0MC 1P3LC 1TZYC 4NE5A 5AV5C 4R8PD 1P3IC 5DNMB 3LZ0A 5B31A 3WAAB 3LZ1C 1P3AD 3AFAC 3A6ND 4J8WA 4LD9C 2NZDB 2Y2LA 2HUEB 3AV1B 4J8XA 1TAFB 3B6GB 3O62B 1EQZC 4QLCB 3AYWD 5AV6A 4X23D 5CPKC 4WU9D 4YM6B 3AZGA 1ZLAC 4H9QA 3AZIA 3WKJA 3REJD 1P3GA 5AV8A 4KUDB 2Y2KA 1BH9A 3EPKA 1KX5B 4WU8B 4WZSB 3TU4A 5FUGA 3AZMD 1BFMA 1N1JA 3X1TB 3WTPA 1U35B 5BNVA 2HUEC 5E5AD 3AZFD 3NQJA 5BO0B 2DQNC 3AZLB 3X1UA 3MNNC 2Y2PA 3C1BA 1M1AA 5JRGB 4ZBJC 5AVBD 4KGCD 2CV5C 5DNND 2BG1A 1KX4D 1HQ3A 5AY8B 3W99D 4KUDC 5GXQB 3B0CT 3A1IA 1KX5C 3C1CB 4WU8C 3REIB 3WA9B 2F8NB 3X1TC 3AN2A 1U35C 4XZQB 1Q9CA 5B31C 2JCHA 4ZUXB 4J8WC 3P5JB 3REKB 2J8PA 4R8PB 3A1KA 3RELD 3UTBD 4J8XC 4J8VA 1P3MD 3W98D 3UT9D 4WNNB 5JA4A 5BS7C 2Y2OA 1P3AB 5B1MA 4H9PB 3A6NB 1M18A 3MGSD 3X1VC 3C1CC 1P3FD 1P3LA 3VH6A 1P3GC 5AV8C 5AV5A 1P3IA 3AYWB 2RVQC 4J8UA 1BH8B 4HGAB 4X23B 2FJ7A 4WU9B 3TU4C 2XD5A 3AZKD 5CP6D 2JE5A 4DQYB 3REJB 4G92B 3UTAD 3X1UC 5B1LD 1EQZA 2BYKA 4H9SC 3AV2D 3EPJA 1P3AC 3AZMB 1ULYA 5E5AB 1ZLAA 3AZFB 4CSRA 1P3PD 5B0YD 3AZND 3B0CW 3H0LC 5B32G 5B24D 3MGQB 3AYWC 5B0ZD 4NFTA 2FFFB 4E44A 5DNMA 4DRAA 5AVBB 4AWLB 3NQUB 4NE3A 5DNNB 4KGCB 1KX4B 3VH5W 3AN2C 3W99B 4G92C 4EO5C 1TAFA 3B6GA 3O62A 3B6FD 4QLCA 3AZJD 1KX3B 5E5AC 3IP4C 4YM6A 2RIQA 1M18C 2W8SA 3FDDA 3MGQC 4KUDA 3LELD 3UTBB 3RELB 1KX5A 5AVBC 5DNNC 4WU8A 3W98B 3UT9B 1KX4C 1P3BD 2Y2MA 3X1TA 1S32D 1U35A 4J8UC 1H3OB 2FJ7C 3MGSB 5GT0B 3EPHA 3LJAC 5BO0A 5AV6D 3B0DB 5GT3D 1P3FB 3WKJD 5JRGA 5C3IB 1KX3C 1HTAA 4XUJD 5B2JD 5BS7A 2NQBD 5B31G 3AZKB 5AVCD 4JJND 5CP6B 5GXQA 3X1VA 5CPJD 3RELC
chains in the Genus database with same CATH topology
4KHAB 4YS3D 3MVDD 3C1CA 3UTAB 1F66D 5B1LB 3REIA 3WA9A 2YFVB 3AV2B 2F8NA 4M6BA 4XZQA 5DNMC 3WAAC 5GT0C 1M1AD 5B33D 3AZED 1P3OD 4ZUXA 3X1SD 2G5HC 1P3PB 3REKA 3B0DC 5B0YB 2NZDC 3AZNB 5B24B 3KXBD 4R8PA 5C3IC 3AV1C 4Z2MH 5B0ZB 3B6GC 3O62C 4WNNA 3B0BA 4H9SA 1P3AA 4QLCC 3KWQD 4H9PA 3A6NA 1P34D 3F6TA 2AROD 2JSSA 3R45B 3REHD 4YM6C 5CPID 4G91B 3UTAC 3B6FB 3AV2C 3EPLA 4Z66D 3AYWA 3AZJB 1BH8A 5B2ID 4X23A 3KUYD 1P3PC 3W96D 5BNXB 3REJA 3VH5T 5B1MD 5B0ZC 3LELB 3AZLC 3W97D 2CWEA 2YFWA 3AZHD 4Z5TD 3AZMA 1P3BB 5JRGC 1P3LD 1S32B 1TZYD 5E5AA 4G91C 3AZFA 1P3ID 2HIOD 5AY8C 5AV6B 2PYOD 3LZ1D 5GT3B 3AFAD 5GXQC 3MGQA 4LD9D 4XUJB 5AVBA 4KGCA 3REIC 3NQUA 5DNNA 1A7WA 5B40D 3WA9C 5B2JB 2IO5B 1KX4A 4Z2MG 5B32D 1JFIB 2NQBB 5AVCB 4XZQC 4JJNB 5F99D 3W99A 3LJAA 5CPJB 4ZUXC 4YS3B 5BNVB 3V9RB 3MVDB 3REKC 5CPKD 1F66B 1ID3D 4R8PC 2G5IC 1S32C 3MGPD 1KX3A 3EG5B 1M1AB 5B33B 3AZEB 1P3OB 3A6NC 3X1SB 4E45A 2Y2QA 3KXBB 3UTBA 3RELA 5GSUD 1M19D 4XUJC 3UT9A 5B2JC 2IO5C 2NQBC 3KWQB 1P34B 5AV9D 3MNND 5BT1D 4X23C 4HGAC 1H3OA 2AROB 2ZY2A 4NE6A 3MGSA 5GT0A 3REHB 4WU9C 5CPIB 3WAAA 3VH6T 1F66C 2CV5D 3REJC 1P3KD 2NZDA 4Z66B 3MGRD 2Y2GA 3AV1A 5B2IB 1W2EA 5B33C 3KUYB 1P3OC 2DF4C 1KX5D 3AZMC 5CP6A 1AOID 3W96B 2LY8A 3KXBC 3X1TD 3AZFC 1U35D 4KHAA 3W97B 3UTAA 3LZ0D 5B31D 5CHLB 2F8NH 2YFVA 3AV2A 1P34C 4J8WD 3AZHB 2F8NK 4Z5TB 2AROC 1TZYB 4UUZB 4AWLC 5CPIC 1P3MB 4KGCC 1P3IB 2ZM5A 2HIOB 4J8XD 1P3PA 5B0YA 2PYOB 3W99C 3KFUG 4H9RB 3LZ1B 4Z66C 3WTPE 5B24A 3AFAB 4LD9B 5B0ZA 3AZLA 1WWIA 3X1VD 3AZGD 3KUYC 5B40B 3AZID 5B32B 5KDMB 2Y2JA 3W96C 4H9NB 2BYMB 5F99B 3R45A 1P3GD 5AV8D 2VQRA 3W97C 5G49B 5AY8A 5CPKB 3B6FA 3TU4D 1ID3B 4Z5TC 3UTBC 3WTPD 3AZJA 3MGPB 1P3MC 3W98C 3UT9C 2HIOC 3X1UD 5BNXA 2PYOC 4CAYB 3VH6W 3MGSC 3C1BD 3LELA 1M19B 5GSUB 1P3FC 5B40C 1HQ3D 5B32C 4H9OB 1P3BA 1S32A 5AV9B 5F99C 3MNNB 2F8NG 4WV4B 3AL0C 4DRBA 3AZKC 4ZBJB 5CP6C 5GT3A 2CV5B 1P3KB 3KSYA 1ID3C 3MGRB 3AN2D 3MGPC 4XUJA 5B1LC 2ZY3A 5B2JA 3VH5A 1JFIA 2NQBA 5AVCA 4JJNA 1AOIB 4WU9A 5CPJA 1M19C 5GSUC 4YS3A 3MVDA 3V9RA 4J8VD 5B0YC 3LZ0B 1F66A 5B31B 3AZNC 5B24C 1M18D 1PZRA 4J8WB 5AV9C 5BT1C 3MGQD 5B33A 3AZEA 1P3OA 4J8XB 3X1SA 1P3KC 1T3UA 3MGRC 5AV5D 3KXBA 4J8UD 2FJ7D 3B6FC 3X1VB 3LJAD 3AZGB 4H9QB 3KWQA 3AZIB 2Y2IA 1P34A 1AOIC 3WKJB 3AZJC 1R4VA 3REHA 2AROA 1P3GB 5AV8B 5CPIA 2L5AA 1KX3D 1BH9B 3LZ0C 1EQZD 3TU4B 4Z66A 5FUGB 3LELC 1N1JB 3WTPB 5B2IA 3H0RC 3KUYA 1ZLAD 3NQJB 1WWSA 1P3BC 3W96A 3X1UB 1F1EA 3C1BB 2UWXA 3W97A 5AV6C 5DNMD 3WAAD 5GT0D 5GT3C 1B6WA 3AZGC 3AZIC 1HQ3B 3AZHA 3WKJC 4Z5TA 2NZDD 1TZYA 4UUZA 2F2AC 1P3MA 3W98A 3AV1D 2HIOA 3B6GD 5AVCC 3O62D 4JJNC 2PYOA 4H9RA 3LZ1A 3AFAA 4QLCD 2XD1A 4LD9A 2ZY5A 2ZY4A 3WTPC 3AN2B 5CPJC 4YS3C 3MVDC 4YM6D 1P3FA 5B40A 4EO5B 5B32A 5KDMA 4H9NA 2BYMA 5F99A 2YFWB 4KUDD 3C1BC 1M1AC 3AZEC 5G49A 3AZKA 3X1SC 4J8VB 5CPKA 4WU8D 1HQ3C 5JA4B 1ID3A 5B1MB 1M18B 3MGPA 5B1LA 3AZLD 3KWQC 1B67A 4CAYA 1P3LB 3REHC 5AV5B 5JRGD 1M19A 5GSUA 4J8UB 2Y2NA 2FJ7B 3AZNA 3LJAB 5AY8D 4H9OA 5AV9A 3MNNA 5B2IC 5GXQD 2Y2HA 4J8VC 3C1CD 3REID 4UPKA 2CV5A 1Z2CB 2BYKB 1P3KA 1EQZB 1KU5A 3WA9D 5B1MC 3MGRA 2F8ND 4WJ3C 4XZQD 2RVQD 1ZLAB 4ZUXD 4CSRB 3AZHC 3REKD 1AOIA 3H0MC 1P3LC 1TZYC 4NE5A 5AV5C 4R8PD 1P3IC 5DNMB 3LZ0A 5B31A 3WAAB 3LZ1C 1P3AD 3AFAC 3A6ND 4J8WA 4LD9C 2NZDB 2Y2LA 2HUEB 3AV1B 4J8XA 1TAFB 3B6GB 3O62B 1EQZC 4QLCB 3AYWD 5AV6A 4X23D 5CPKC 4WU9D 4YM6B 3AZGA 1ZLAC 4H9QA 3AZIA 3WKJA 3REJD 1P3GA 5AV8A 4KUDB 2Y2KA 1BH9A 3EPKA 1KX5B 4WU8B 4WZSB 3TU4A 5FUGA 3AZMD 1BFMA 1N1JA 3X1TB 3WTPA 1U35B 5BNVA 2HUEC 5E5AD 3AZFD 3NQJA 5BO0B 2DQNC 3AZLB 3X1UA 3MNNC 2Y2PA 3C1BA 1M1AA 5JRGB 4ZBJC 5AVBD 4KGCD 2CV5C 5DNND 2BG1A 1KX4D 1HQ3A 5AY8B 3W99D 4KUDC 5GXQB 3B0CT 3A1IA 1KX5C 3C1CB 4WU8C 3REIB 3WA9B 2F8NB 3X1TC 3AN2A 1U35C 4XZQB 1Q9CA 5B31C 2JCHA 4ZUXB 4J8WC 3P5JB 3REKB 2J8PA 4R8PB 3A1KA 3RELD 3UTBD 4J8XC 4J8VA 1P3MD 3W98D 3UT9D 4WNNB 5JA4A 5BS7C 2Y2OA 1P3AB 5B1MA 4H9PB 3A6NB 1M18A 3MGSD 3X1VC 3C1CC 1P3FD 1P3LA 3VH6A 1P3GC 5AV8C 5AV5A 1P3IA 3AYWB 2RVQC 4J8UA 1BH8B 4HGAB 4X23B 2FJ7A 4WU9B 3TU4C 2XD5A 3AZKD 5CP6D 2JE5A 4DQYB 3REJB 4G92B 3UTAD 3X1UC 5B1LD 1EQZA 2BYKA 4H9SC 3AV2D 3EPJA 1P3AC 3AZMB 1ULYA 5E5AB 1ZLAA 3AZFB 4CSRA 1P3PD 5B0YD 3AZND 3B0CW 3H0LC 5B32G 5B24D 3MGQB 3AYWC 5B0ZD 4NFTA 2FFFB 4E44A 5DNMA 4DRAA 5AVBB 4AWLB 3NQUB 4NE3A 5DNNB 4KGCB 1KX4B 3VH5W 3AN2C 3W99B 4G92C 4EO5C 1TAFA 3B6GA 3O62A 3B6FD 4QLCA 3AZJD 1KX3B 5E5AC 3IP4C 4YM6A 2RIQA 1M18C 2W8SA 3FDDA 3MGQC 4KUDA 3LELD 3UTBB 3RELB 1KX5A 5AVBC 5DNNC 4WU8A 3W98B 3UT9B 1KX4C 1P3BD 2Y2MA 3X1TA 1S32D 1U35A 4J8UC 1H3OB 2FJ7C 3MGSB 5GT0B 3EPHA 3LJAC 5BO0A 5AV6D 3B0DB 5GT3D 1P3FB 3WKJD 5JRGA 5C3IB 1KX3C 1HTAA 4XUJD 5B2JD 5BS7A 2NQBD 5B31G 3AZKB 5AVCD 4JJND 5CP6B 5GXQA 3X1VA 5CPJD 3RELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA B;  4YS3 D;  3MVD D;  3C1C A;  3UTA B;  1F66 D;  5B1L B;  3REI A;  3WA9 A;  2YFV B;  3AV2 B;  2F8N A;  4M6B A;  4XZQ A;  5DNM C;  3WAA C;  5GT0 C;  1M1A D;  5B33 D;  3AZE D;  1P3O D;  4ZUX A;  3X1S D;  1P3P B;  3REK A;  3B0D C;  5B0Y B;  2NZD C;  3AZN B;  5B24 B;  3KXB D;  4R8P A;  5C3I C;  3AV1 C;  4Z2M H;  5B0Z B;  3B6G C;  3O62 C;  4WNN A;  3B0B A;  4H9S A;  1P3A A;  4QLC C;  3KWQ D;  4H9P A;  3A6N A;  1P34 D;  3REH D;  2ARO D;  2JSS A;  3R45 B;  4YM6 C;  5CPI D;  4G91 B;  3UTA C;  3B6F B;  3AV2 C;  4Z66 D;  3AYW A;  3AZJ B;  1BH8 A;  5B2I D;  4X23 A;  3KUY D;  1P3P C;  3W96 D;  5BNX B;  3REJ A;  3VH5 T;  5B1M D;  5B0Z C;  3LEL B;  3AZL C;  3W97 D;  2CWE A;  2YFW A;  3AZH D;  4Z5T D;  3AZM A;  1P3B B;  5JRG C;  1P3L D;  1S32 B;  1TZY D;  5E5A A;  4G91 C;  3AZF A;  1P3I D;  2HIO D;  5AY8 C;  5AV6 B;  2PYO D;  3LZ1 D;  5GT3 B;  3AFA D;  5GXQ C;  3MGQ A;  4LD9 D;  4XUJ B;  5AVB A;  4KGC A;  3REI C;  3NQU A;  5DNN A;  1A7W A;  5B40 D;  3WA9 C;  5B2J B;  2IO5 B;  1KX4 A;  4Z2M G;  5B32 D;  1JFI B;  2NQB B;  5AVC B;  4XZQ C;  4JJN B;  5F99 D;  3W99 A;  3LJA A;  5CPJ B;  4ZUX C;  4YS3 B;  5BNV B;  3V9R B;  3MVD B;  3REK C;  5CPK D;  1F66 B;  1ID3 D;  4R8P C;  1S32 C;  3MGP D;  1KX3 A;  1M1A B;  5B33 B;  3AZE B;  1P3O B;  3A6N C;  3X1S B;  4E45 A;  3KXB B;  3UTB A;  3REL A;  5GSU D;  1M19 D;  4XUJ C;  3UT9 A;  5B2J C;  2IO5 C;  2NQB C;  3KWQ B;  1P34 B;  5AV9 D;  3MNN D;  5BT1 D;  4X23 C;  4HGA C;  1H3O A;  2ARO B;  4NE6 A;  3REH B;  3MGS A;  5GT0 A;  4WU9 C;  5CPI B;  3WAA A;  3VH6 T;  1F66 C;  2CV5 D;  3REJ C;  1P3K D;  2NZD A;  4Z66 B;  3MGR D;  3AV1 A;  5B2I B;  5B33 C;  3KUY B;  1P3O C;  1KX5 D;  3AZM C;  5CP6 A;  1AOI D;  3W96 B;  2LY8 A;  3KXB C;  3X1T D;  3AZF C;  1U35 D;  4KHA A;  3W97 B;  3UTA A;  3LZ0 D;  5B31 D;  5CHL B;  2F8N H;  2YFV A;  3AV2 A;  1P34 C;  4J8W D;  3AZH B;  2F8N K;  4Z5T B;  2ARO C;  1TZY B;  4UUZ B;  4AWL C;  5CPI C;  1P3M B;  4KGC C;  1P3I B;  4J8X D;  2HIO B;  1P3P A;  5B0Y A;  2PYO B;  3W99 C;  4H9R B;  3LZ1 B;  4Z66 C;  3WTP E;  5B24 A;  3AFA B;  4LD9 B;  5B0Z A;  3AZL A;  1WWI A;  3X1V D;  3AZG D;  3KUY C;  5B40 B;  3AZI D;  5B32 B;  5KDM B;  3W96 C;  4H9N B;  2BYM B;  5F99 B;  3R45 A;  1P3G D;  5AV8 D;  3W97 C;  5G49 B;  5AY8 A;  5CPK B;  3B6F A;  3TU4 D;  1ID3 B;  4Z5T C;  3UTB C;  3WTP D;  3AZJ A;  3MGP B;  1P3M C;  3W98 C;  3UT9 C;  2HIO C;  3X1U D;  5BNX A;  2PYO C;  4CAY B;  3VH6 W;  3MGS C;  3C1B D;  3LEL A;  1M19 B;  5GSU B;  1P3F C;  5B40 C;  1HQ3 D;  5B32 C;  4H9O B;  1P3B A;  1S32 A;  5AV9 B;  5F99 C;  3MNN B;  2F8N G;  4WV4 B;  4DRB A;  3AZK C;  4ZBJ B;  5CP6 C;  5GT3 A;  2CV5 B;  1P3K B;  3KSY A;  1ID3 C;  3MGR B;  3AN2 D;  3MGP C;  4XUJ A;  5B1L C;  5B2J A;  3VH5 A;  1JFI A;  2NQB A;  5AVC A;  4JJN A;  1AOI B;  4WU9 A;  5CPJ A;  1M19 C;  5GSU C;  4YS3 A;  3MVD A;  3V9R A;  4J8V D;  5B0Y C;  3LZ0 B;  1F66 A;  5B31 B;  3AZN C;  5B24 C;  1M18 D;  4J8W B;  5AV9 C;  5BT1 C;  3MGQ D;  5B33 A;  3AZE A;  1P3O A;  4J8X B;  3X1S A;  1P3K C;  3MGR C;  5AV5 D;  3KXB A;  4J8U D;  2FJ7 D;  3B6F C;  3X1V B;  3LJA D;  3AZG B;  4H9Q B;  3KWQ A;  3AZI B;  1P34 A;  1AOI C;  3WKJ B;  3AZJ C;  1R4V A;  3REH A;  2ARO A;  1P3G B;  5AV8 B;  5CPI A;  2L5A A;  1KX3 D;  1BH9 B;  3LZ0 C;  1EQZ D;  3TU4 B;  4Z66 A;  5FUG B;  3LEL C;  1N1J B;  3WTP B;  5B2I A;  3KUY A;  1ZLA D;  3NQJ B;  1WWS A;  1P3B C;  3W96 A;  3X1U B;  1F1E A;  3C1B B;  3W97 A;  5AV6 C;  5DNM D;  3WAA D;  5GT0 D;  5GT3 C;  1B6W A;  3AZG C;  3AZI C;  1HQ3 B;  3AZH A;  3WKJ C;  4Z5T A;  2NZD D;  1TZY A;  4UUZ A;  1P3M A;  3W98 A;  3AV1 D;  2HIO A;  3B6G D;  5AVC C;  3O62 D;  4JJN C;  2PYO A;  4H9R A;  3LZ1 A;  3AFA A;  4QLC D;  4LD9 A;  5CPJ C;  3WTP C;  3AN2 B;  4YS3 C;  3MVD C;  4YM6 D;  1P3F A;  5B40 A;  4EO5 B;  5B32 A;  5KDM A;  4H9N A;  2BYM A;  5F99 A;  2YFW B;  4KUD D;  3C1B C;  1M1A C;  3AZE C;  5G49 A;  3AZK A;  3X1S C;  4J8V B;  5CPK A;  4WU8 D;  1HQ3 C;  5JA4 B;  1ID3 A;  5B1M B;  1M18 B;  3MGP A;  5B1L A;  3AZL D;  3KWQ C;  1B67 A;  4CAY A;  1P3L B;  3REH C;  5AV5 B;  5JRG D;  1M19 A;  5GSU A;  4J8U B;  2FJ7 B;  3AZN A;  3LJA B;  5AY8 D;  4H9O A;  5AV9 A;  3MNN A;  5B2I C;  5GXQ D;  4J8V C;  3C1C D;  3REI D;  2CV5 A;  1P3K A;  1EQZ B;  2BYK B;  3WA9 D;  1KU5 A;  5B1M C;  3MGR A;  2F8N D;  4XZQ D;  2RVQ D;  1ZLA B;  4ZUX D;  4CSR B;  3AZH C;  3REK D;  1AOI A;  1P3L C;  1TZY C;  4NE5 A;  5AV5 C;  4R8P D;  1P3I C;  5DNM B;  3LZ0 A;  5B31 A;  3WAA B;  3LZ1 C;  1P3A D;  3AFA C;  3A6N D;  4J8W A;  4LD9 C;  2NZD B;  2HUE B;  3AV1 B;  4J8X A;  1TAF B;  3B6G B;  3O62 B;  1EQZ C;  4QLC B;  3AYW D;  5AV6 A;  4X23 D;  5CPK C;  4WU9 D;  4YM6 B;  3AZG A;  1ZLA C;  4H9Q A;  3AZI A;  3WKJ A;  3REJ D;  1P3G A;  5AV8 A;  4KUD B;  1BH9 A;  1KX5 B;  4WU8 B;  4WZS B;  3TU4 A;  5FUG A;  3AZM D;  1BFM A;  1N1J A;  3X1T B;  3WTP A;  1U35 B;  5BNV A;  2HUE C;  5E5A D;  3AZF D;  3NQJ A;  5BO0 B;  3AZL B;  3X1U A;  3MNN C;  3C1B A;  1M1A A;  5JRG B;  4ZBJ C;  5AVB D;  4KGC D;  2CV5 C;  5DNN D;  1KX4 D;  1HQ3 A;  5AY8 B;  3W99 D;  4KUD C;  5GXQ B;  3B0C T;  1KX5 C;  3C1C B;  4WU8 C;  3REI B;  3WA9 B;  2F8N B;  3X1T C;  3AN2 A;  1U35 C;  4XZQ B;  1Q9C A;  5B31 C;  4ZUX B;  4J8W C;  3REK B;  4R8P B;  3REL D;  3UTB D;  4J8X C;  4J8V A;  1P3M D;  3W98 D;  3UT9 D;  4WNN B;  5JA4 A;  5BS7 C;  1P3A B;  5B1M A;  4H9P B;  3A6N B;  1M18 A;  3MGS D;  3X1V C;  3C1C C;  1P3F D;  1P3L A;  3VH6 A;  1P3G C;  5AV8 C;  5AV5 A;  1P3I A;  3AYW B;  2RVQ C;  4J8U A;  1BH8 B;  4HGA B;  4X23 B;  2FJ7 A;  4WU9 B;  3TU4 C;  3AZK D;  5CP6 D;  3REJ B;  4G92 B;  3UTA D;  3X1U C;  5B1L D;  1EQZ A;  2BYK A;  4H9S C;  3AV2 D;  1P3A C;  3AZM B;  1ULY A;  5E5A B;  1ZLA A;  3AZF B;  4CSR A;  1P3P D;  5B0Y D;  3AZN D;  3B0C W;  5B32 G;  5B24 D;  3MGQ B;  3AYW C;  5B0Z D;  4NFT A;  4E44 A;  5DNM A;  4DRA A;  5AVB B;  4AWL B;  3NQU B;  4NE3 A;  5DNN B;  4KGC B;  1KX4 B;  3VH5 W;  3AN2 C;  3W99 B;  4G92 C;  4EO5 C;  1TAF A;  3B6G A;  3O62 A;  3B6F D;  4QLC A;  3AZJ D;  1KX3 B;  5E5A C;  4YM6 A;  1M18 C;  3MGQ C;  4KUD A;  3LEL D;  3UTB B;  3REL B;  1KX5 A;  5AVB C;  5DNN C;  4WU8 A;  3W98 B;  3UT9 B;  1KX4 C;  1P3B D;  3X1T A;  1S32 D;  1U35 A;  4J8U C;  1H3O B;  2FJ7 C;  3MGS B;  5GT0 B;  3LJA C;  5BO0 A;  5AV6 D;  3B0D B;  5GT3 D;  1P3F B;  3WKJ D;  5JRG A;  5C3I B;  1KX3 C;  1HTA A;  4XUJ D;  5B2J D;  5BS7 A;  2NQB D;  5B31 G;  3AZK B;  5AVC D;  4JJN D;  5CP6 B;  5GXQ A;  3X1V A;  5CPJ D;  3REL C; 
#chains in the Genus database with same CATH topology
 4KHA B;  4YS3 D;  3MVD D;  3C1C A;  3UTA B;  1F66 D;  5B1L B;  3REI A;  3WA9 A;  2YFV B;  3AV2 B;  2F8N A;  4M6B A;  4XZQ A;  5DNM C;  3WAA C;  5GT0 C;  1M1A D;  5B33 D;  3AZE D;  1P3O D;  4ZUX A;  3X1S D;  2G5H C;  1P3P B;  3REK A;  3B0D C;  5B0Y B;  2NZD C;  3AZN B;  5B24 B;  3KXB D;  4R8P A;  5C3I C;  3AV1 C;  4Z2M H;  5B0Z B;  3B6G C;  3O62 C;  4WNN A;  3B0B A;  4H9S A;  1P3A A;  4QLC C;  3KWQ D;  4H9P A;  3A6N A;  1P34 D;  3F6T A;  2ARO D;  2JSS A;  3R45 B;  3REH D;  4YM6 C;  5CPI D;  4G91 B;  3UTA C;  3B6F B;  3AV2 C;  3EPL A;  4Z66 D;  3AYW A;  3AZJ B;  1BH8 A;  5B2I D;  4X23 A;  3KUY D;  1P3P C;  3W96 D;  5BNX B;  3REJ A;  3VH5 T;  5B1M D;  5B0Z C;  3LEL B;  3AZL C;  3W97 D;  2CWE A;  2YFW A;  3AZH D;  4Z5T D;  3AZM A;  1P3B B;  5JRG C;  1P3L D;  1S32 B;  1TZY D;  5E5A A;  4G91 C;  3AZF A;  1P3I D;  2HIO D;  5AY8 C;  5AV6 B;  2PYO D;  3LZ1 D;  5GT3 B;  3AFA D;  5GXQ C;  3MGQ A;  4LD9 D;  4XUJ B;  5AVB A;  4KGC A;  3REI C;  3NQU A;  5DNN A;  1A7W A;  5B40 D;  3WA9 C;  5B2J B;  2IO5 B;  1KX4 A;  4Z2M G;  5B32 D;  1JFI B;  2NQB B;  5AVC B;  4XZQ C;  4JJN B;  5F99 D;  3W99 A;  3LJA A;  5CPJ B;  4ZUX C;  4YS3 B;  5BNV B;  3V9R B;  3MVD B;  3REK C;  5CPK D;  1F66 B;  1ID3 D;  4R8P C;  2G5I C;  1S32 C;  3MGP D;  1KX3 A;  3EG5 B;  1M1A B;  5B33 B;  3AZE B;  1P3O B;  3A6N C;  3X1S B;  4E45 A;  2Y2Q A;  3KXB B;  3UTB A;  3REL A;  5GSU D;  1M19 D;  4XUJ C;  3UT9 A;  5B2J C;  2IO5 C;  2NQB C;  3KWQ B;  1P34 B;  5AV9 D;  3MNN D;  5BT1 D;  4X23 C;  4HGA C;  1H3O A;  2ARO B;  2ZY2 A;  4NE6 A;  3MGS A;  5GT0 A;  3REH B;  4WU9 C;  5CPI B;  3WAA A;  3VH6 T;  1F66 C;  2CV5 D;  3REJ C;  1P3K D;  2NZD A;  4Z66 B;  3MGR D;  2Y2G A;  3AV1 A;  5B2I B;  1W2E A;  5B33 C;  3KUY B;  1P3O C;  2DF4 C;  1KX5 D;  3AZM C;  5CP6 A;  1AOI D;  3W96 B;  2LY8 A;  3KXB C;  3X1T D;  3AZF C;  1U35 D;  4KHA A;  3W97 B;  3UTA A;  3LZ0 D;  5B31 D;  5CHL B;  2F8N H;  2YFV A;  3AV2 A;  1P34 C;  4J8W D;  3AZH B;  2F8N K;  4Z5T B;  2ARO C;  1TZY B;  4UUZ B;  4AWL C;  5CPI C;  1P3M B;  4KGC C;  1P3I B;  2ZM5 A;  2HIO B;  4J8X D;  1P3P A;  5B0Y A;  2PYO B;  3W99 C;  3KFU G;  4H9R B;  3LZ1 B;  4Z66 C;  3WTP E;  5B24 A;  3AFA B;  4LD9 B;  5B0Z A;  3AZL A;  1WWI A;  3X1V D;  3AZG D;  3KUY C;  5B40 B;  3AZI D;  5B32 B;  5KDM B;  2Y2J A;  3W96 C;  4H9N B;  2BYM B;  5F99 B;  3R45 A;  1P3G D;  5AV8 D;  2VQR A;  3W97 C;  5G49 B;  5AY8 A;  5CPK B;  3B6F A;  3TU4 D;  1ID3 B;  4Z5T C;  3UTB C;  3WTP D;  3AZJ A;  3MGP B;  1P3M C;  3W98 C;  3UT9 C;  2HIO C;  3X1U D;  5BNX A;  2PYO C;  4CAY B;  3VH6 W;  3MGS C;  3C1B D;  3LEL A;  1M19 B;  5GSU B;  1P3F C;  5B40 C;  1HQ3 D;  5B32 C;  4H9O B;  1P3B A;  1S32 A;  5AV9 B;  5F99 C;  3MNN B;  2F8N G;  4WV4 B;  3AL0 C;  4DRB A;  3AZK C;  4ZBJ B;  5CP6 C;  5GT3 A;  2CV5 B;  1P3K B;  3KSY A;  1ID3 C;  3MGR B;  3AN2 D;  3MGP C;  4XUJ A;  5B1L C;  2ZY3 A;  5B2J A;  3VH5 A;  1JFI A;  2NQB A;  5AVC A;  4JJN A;  1AOI B;  4WU9 A;  5CPJ A;  1M19 C;  5GSU C;  4YS3 A;  3MVD A;  3V9R A;  4J8V D;  5B0Y C;  3LZ0 B;  1F66 A;  5B31 B;  3AZN C;  5B24 C;  1M18 D;  1PZR A;  4J8W B;  5AV9 C;  5BT1 C;  3MGQ D;  5B33 A;  3AZE A;  1P3O A;  4J8X B;  3X1S A;  1P3K C;  1T3U A;  3MGR C;  5AV5 D;  3KXB A;  4J8U D;  2FJ7 D;  3B6F C;  3X1V B;  3LJA D;  3AZG B;  4H9Q B;  3KWQ A;  3AZI B;  2Y2I A;  1P34 A;  1AOI C;  3WKJ B;  3AZJ C;  1R4V A;  3REH A;  2ARO A;  1P3G B;  5AV8 B;  5CPI A;  2L5A A;  1KX3 D;  1BH9 B;  3LZ0 C;  1EQZ D;  3TU4 B;  4Z66 A;  5FUG B;  3LEL C;  1N1J B;  3WTP B;  5B2I A;  3H0R C;  3KUY A;  1ZLA D;  3NQJ B;  1WWS A;  1P3B C;  3W96 A;  3X1U B;  1F1E A;  3C1B B;  2UWX A;  3W97 A;  5AV6 C;  5DNM D;  3WAA D;  5GT0 D;  5GT3 C;  1B6W A;  3AZG C;  3AZI C;  1HQ3 B;  3AZH A;  3WKJ C;  4Z5T A;  2NZD D;  1TZY A;  4UUZ A;  2F2A C;  1P3M A;  3W98 A;  3AV1 D;  2HIO A;  3B6G D;  5AVC C;  3O62 D;  4JJN C;  2PYO A;  4H9R A;  3LZ1 A;  3AFA A;  4QLC D;  2XD1 A;  4LD9 A;  2ZY5 A;  2ZY4 A;  3WTP C;  3AN2 B;  5CPJ C;  4YS3 C;  3MVD C;  4YM6 D;  1P3F A;  5B40 A;  4EO5 B;  5B32 A;  5KDM A;  4H9N A;  2BYM A;  5F99 A;  2YFW B;  4KUD D;  3C1B C;  1M1A C;  3AZE C;  5G49 A;  3AZK A;  3X1S C;  4J8V B;  5CPK A;  4WU8 D;  1HQ3 C;  5JA4 B;  1ID3 A;  5B1M B;  1M18 B;  3MGP A;  5B1L A;  3AZL D;  3KWQ C;  1B67 A;  4CAY A;  1P3L B;  3REH C;  5AV5 B;  5JRG D;  1M19 A;  5GSU A;  4J8U B;  2Y2N A;  2FJ7 B;  3AZN A;  3LJA B;  5AY8 D;  4H9O A;  5AV9 A;  3MNN A;  5B2I C;  5GXQ D;  2Y2H A;  4J8V C;  3C1C D;  3REI D;  4UPK A;  2CV5 A;  1Z2C B;  2BYK B;  1P3K A;  1EQZ B;  1KU5 A;  3WA9 D;  5B1M C;  3MGR A;  2F8N D;  4WJ3 C;  4XZQ D;  2RVQ D;  1ZLA B;  4ZUX D;  4CSR B;  3AZH C;  3REK D;  1AOI A;  3H0M C;  1P3L C;  1TZY C;  4NE5 A;  5AV5 C;  4R8P D;  1P3I C;  5DNM B;  3LZ0 A;  5B31 A;  3WAA B;  3LZ1 C;  1P3A D;  3AFA C;  3A6N D;  4J8W A;  4LD9 C;  2NZD B;  2Y2L A;  2HUE B;  3AV1 B;  4J8X A;  1TAF B;  3B6G B;  3O62 B;  1EQZ C;  4QLC B;  3AYW D;  5AV6 A;  4X23 D;  5CPK C;  4WU9 D;  4YM6 B;  3AZG A;  1ZLA C;  4H9Q A;  3AZI A;  3WKJ A;  3REJ D;  1P3G A;  5AV8 A;  4KUD B;  2Y2K A;  1BH9 A;  3EPK A;  1KX5 B;  4WU8 B;  4WZS B;  3TU4 A;  5FUG A;  3AZM D;  1BFM A;  1N1J A;  3X1T B;  3WTP A;  1U35 B;  5BNV A;  2HUE C;  5E5A D;  3AZF D;  3NQJ A;  5BO0 B;  2DQN C;  3AZL B;  3X1U A;  3MNN C;  2Y2P A;  3C1B A;  1M1A A;  5JRG B;  4ZBJ C;  5AVB D;  4KGC D;  2CV5 C;  5DNN D;  2BG1 A;  1KX4 D;  1HQ3 A;  5AY8 B;  3W99 D;  4KUD C;  5GXQ B;  3B0C T;  3A1I A;  1KX5 C;  3C1C B;  4WU8 C;  3REI B;  3WA9 B;  2F8N B;  3X1T C;  3AN2 A;  1U35 C;  4XZQ B;  1Q9C A;  5B31 C;  2JCH A;  4ZUX B;  4J8W C;  3P5J B;  3REK B;  2J8P A;  4R8P B;  3A1K A;  3REL D;  3UTB D;  4J8X C;  4J8V A;  1P3M D;  3W98 D;  3UT9 D;  4WNN B;  5JA4 A;  5BS7 C;  2Y2O A;  1P3A B;  5B1M A;  4H9P B;  3A6N B;  1M18 A;  3MGS D;  3X1V C;  3C1C C;  1P3F D;  1P3L A;  3VH6 A;  1P3G C;  5AV8 C;  5AV5 A;  1P3I A;  3AYW B;  2RVQ C;  4J8U A;  1BH8 B;  4HGA B;  4X23 B;  2FJ7 A;  4WU9 B;  3TU4 C;  2XD5 A;  3AZK D;  5CP6 D;  2JE5 A;  4DQY B;  3REJ B;  4G92 B;  3UTA D;  3X1U C;  5B1L D;  1EQZ A;  2BYK A;  4H9S C;  3AV2 D;  3EPJ A;  1P3A C;  3AZM B;  1ULY A;  5E5A B;  1ZLA A;  3AZF B;  4CSR A;  1P3P D;  5B0Y D;  3AZN D;  3B0C W;  3H0L C;  5B32 G;  5B24 D;  3MGQ B;  3AYW C;  5B0Z D;  4NFT A;  2FFF B;  4E44 A;  5DNM A;  4DRA A;  5AVB B;  4AWL B;  3NQU B;  4NE3 A;  5DNN B;  4KGC B;  1KX4 B;  3VH5 W;  3AN2 C;  3W99 B;  4G92 C;  4EO5 C;  1TAF A;  3B6G A;  3O62 A;  3B6F D;  4QLC A;  3AZJ D;  1KX3 B;  5E5A C;  3IP4 C;  4YM6 A;  2RIQ A;  1M18 C;  2W8S A;  3FDD A;  3MGQ C;  4KUD A;  3LEL D;  3UTB B;  3REL B;  1KX5 A;  5AVB C;  5DNN C;  4WU8 A;  3W98 B;  3UT9 B;  1KX4 C;  1P3B D;  2Y2M A;  3X1T A;  1S32 D;  1U35 A;  4J8U C;  1H3O B;  2FJ7 C;  3MGS B;  5GT0 B;  3EPH A;  3LJA C;  5BO0 A;  5AV6 D;  3B0D B;  5GT3 D;  1P3F B;  3WKJ D;  5JRG A;  5C3I B;  1KX3 C;  1HTA A;  4XUJ D;  5B2J D;  5BS7 A;  2NQB D;  5B31 G;  3AZK B;  5AVC D;  4JJN D;  5CP6 B;  5GXQ A;  3X1V A;  5CPJ D;  3REL C; 
#chains in the Genus database with same CATH homology
 4KHA B;  4YS3 D;  3MVD D;  3C1C A;  3UTA B;  1F66 D;  5B1L B;  3REI A;  3WA9 A;  2YFV B;  3AV2 B;  2F8N A;  4M6B A;  4XZQ A;  5DNM C;  3WAA C;  5GT0 C;  1M1A D;  5B33 D;  3AZE D;  1P3O D;  4ZUX A;  3X1S D;  2G5H C;  1P3P B;  3REK A;  3B0D C;  5B0Y B;  2NZD C;  3AZN B;  5B24 B;  3KXB D;  4R8P A;  5C3I C;  3AV1 C;  4Z2M H;  5B0Z B;  3B6G C;  3O62 C;  4WNN A;  3B0B A;  4H9S A;  1P3A A;  4QLC C;  3KWQ D;  4H9P A;  3A6N A;  1P34 D;  3F6T A;  2ARO D;  2JSS A;  3R45 B;  3REH D;  4YM6 C;  5CPI D;  4G91 B;  3UTA C;  3B6F B;  3AV2 C;  3EPL A;  4Z66 D;  3AYW A;  3AZJ B;  1BH8 A;  5B2I D;  4X23 A;  3KUY D;  1P3P C;  3W96 D;  5BNX B;  3REJ A;  3VH5 T;  5B1M D;  5B0Z C;  3LEL B;  3AZL C;  3W97 D;  2CWE A;  2YFW A;  3AZH D;  4Z5T D;  3AZM A;  1P3B B;  5JRG C;  1P3L D;  1S32 B;  1TZY D;  5E5A A;  4G91 C;  3AZF A;  1P3I D;  2HIO D;  5AY8 C;  5AV6 B;  2PYO D;  3LZ1 D;  5GT3 B;  3AFA D;  5GXQ C;  3MGQ A;  4LD9 D;  4XUJ B;  5AVB A;  4KGC A;  3REI C;  3NQU A;  5DNN A;  1A7W A;  5B40 D;  3WA9 C;  5B2J B;  2IO5 B;  1KX4 A;  4Z2M G;  5B32 D;  1JFI B;  2NQB B;  5AVC B;  4XZQ C;  4JJN B;  5F99 D;  3W99 A;  3LJA A;  5CPJ B;  4ZUX C;  4YS3 B;  5BNV B;  3V9R B;  3MVD B;  3REK C;  5CPK D;  1F66 B;  1ID3 D;  4R8P C;  2G5I C;  1S32 C;  3MGP D;  1KX3 A;  3EG5 B;  1M1A B;  5B33 B;  3AZE B;  1P3O B;  3A6N C;  3X1S B;  4E45 A;  2Y2Q A;  3KXB B;  3UTB A;  3REL A;  5GSU D;  1M19 D;  4XUJ C;  3UT9 A;  5B2J C;  2IO5 C;  2NQB C;  3KWQ B;  1P34 B;  5AV9 D;  3MNN D;  5BT1 D;  4X23 C;  4HGA C;  1H3O A;  2ARO B;  2ZY2 A;  4NE6 A;  3MGS A;  5GT0 A;  3REH B;  4WU9 C;  5CPI B;  3WAA A;  3VH6 T;  1F66 C;  2CV5 D;  3REJ C;  1P3K D;  2NZD A;  4Z66 B;  3MGR D;  2Y2G A;  3AV1 A;  5B2I B;  1W2E A;  5B33 C;  3KUY B;  1P3O C;  2DF4 C;  1KX5 D;  3AZM C;  5CP6 A;  1AOI D;  3W96 B;  2LY8 A;  3KXB C;  3X1T D;  3AZF C;  1U35 D;  4KHA A;  3W97 B;  3UTA A;  3LZ0 D;  5B31 D;  5CHL B;  2F8N H;  2YFV A;  3AV2 A;  1P34 C;  4J8W D;  3AZH B;  2F8N K;  4Z5T B;  2ARO C;  1TZY B;  4UUZ B;  4AWL C;  5CPI C;  1P3M B;  4KGC C;  1P3I B;  2ZM5 A;  2HIO B;  4J8X D;  1P3P A;  5B0Y A;  2PYO B;  3W99 C;  3KFU G;  4H9R B;  3LZ1 B;  4Z66 C;  3WTP E;  5B24 A;  3AFA B;  4LD9 B;  5B0Z A;  3AZL A;  1WWI A;  3X1V D;  3AZG D;  3KUY C;  5B40 B;  3AZI D;  5B32 B;  5KDM B;  2Y2J A;  3W96 C;  4H9N B;  2BYM B;  5F99 B;  3R45 A;  1P3G D;  5AV8 D;  2VQR A;  3W97 C;  5G49 B;  5AY8 A;  5CPK B;  3B6F A;  3TU4 D;  1ID3 B;  4Z5T C;  3UTB C;  3WTP D;  3AZJ A;  3MGP B;  1P3M C;  3W98 C;  3UT9 C;  2HIO C;  3X1U D;  5BNX A;  2PYO C;  4CAY B;  3VH6 W;  3MGS C;  3C1B D;  3LEL A;  1M19 B;  5GSU B;  1P3F C;  5B40 C;  1HQ3 D;  5B32 C;  4H9O B;  1P3B A;  1S32 A;  5AV9 B;  5F99 C;  3MNN B;  2F8N G;  4WV4 B;  3AL0 C;  4DRB A;  3AZK C;  4ZBJ B;  5CP6 C;  5GT3 A;  2CV5 B;  1P3K B;  3KSY A;  1ID3 C;  3MGR B;  3AN2 D;  3MGP C;  4XUJ A;  5B1L C;  2ZY3 A;  5B2J A;  3VH5 A;  1JFI A;  2NQB A;  5AVC A;  4JJN A;  1AOI B;  4WU9 A;  5CPJ A;  1M19 C;  5GSU C;  4YS3 A;  3MVD A;  3V9R A;  4J8V D;  5B0Y C;  3LZ0 B;  1F66 A;  5B31 B;  3AZN C;  5B24 C;  1M18 D;  1PZR A;  4J8W B;  5AV9 C;  5BT1 C;  3MGQ D;  5B33 A;  3AZE A;  1P3O A;  4J8X B;  3X1S A;  1P3K C;  1T3U A;  3MGR C;  5AV5 D;  3KXB A;  4J8U D;  2FJ7 D;  3B6F C;  3X1V B;  3LJA D;  3AZG B;  4H9Q B;  3KWQ A;  3AZI B;  2Y2I A;  1P34 A;  1AOI C;  3WKJ B;  3AZJ C;  1R4V A;  3REH A;  2ARO A;  1P3G B;  5AV8 B;  5CPI A;  2L5A A;  1KX3 D;  1BH9 B;  3LZ0 C;  1EQZ D;  3TU4 B;  4Z66 A;  5FUG B;  3LEL C;  1N1J B;  3WTP B;  5B2I A;  3H0R C;  3KUY A;  1ZLA D;  3NQJ B;  1WWS A;  1P3B C;  3W96 A;  3X1U B;  1F1E A;  3C1B B;  2UWX A;  3W97 A;  5AV6 C;  5DNM D;  3WAA D;  5GT0 D;  5GT3 C;  1B6W A;  3AZG C;  3AZI C;  1HQ3 B;  3AZH A;  3WKJ C;  4Z5T A;  2NZD D;  1TZY A;  4UUZ A;  2F2A C;  1P3M A;  3W98 A;  3AV1 D;  2HIO A;  3B6G D;  5AVC C;  3O62 D;  4JJN C;  2PYO A;  4H9R A;  3LZ1 A;  3AFA A;  4QLC D;  2XD1 A;  4LD9 A;  2ZY5 A;  2ZY4 A;  3WTP C;  3AN2 B;  5CPJ C;  4YS3 C;  3MVD C;  4YM6 D;  1P3F A;  5B40 A;  4EO5 B;  5B32 A;  5KDM A;  4H9N A;  2BYM A;  5F99 A;  2YFW B;  4KUD D;  3C1B C;  1M1A C;  3AZE C;  5G49 A;  3AZK A;  3X1S C;  4J8V B;  5CPK A;  4WU8 D;  1HQ3 C;  5JA4 B;  1ID3 A;  5B1M B;  1M18 B;  3MGP A;  5B1L A;  3AZL D;  3KWQ C;  1B67 A;  4CAY A;  1P3L B;  3REH C;  5AV5 B;  5JRG D;  1M19 A;  5GSU A;  4J8U B;  2Y2N A;  2FJ7 B;  3AZN A;  3LJA B;  5AY8 D;  4H9O A;  5AV9 A;  3MNN A;  5B2I C;  5GXQ D;  2Y2H A;  4J8V C;  3C1C D;  3REI D;  4UPK A;  2CV5 A;  1Z2C B;  2BYK B;  1P3K A;  1EQZ B;  1KU5 A;  3WA9 D;  5B1M C;  3MGR A;  2F8N D;  4WJ3 C;  4XZQ D;  2RVQ D;  1ZLA B;  4ZUX D;  4CSR B;  3AZH C;  3REK D;  1AOI A;  3H0M C;  1P3L C;  1TZY C;  4NE5 A;  5AV5 C;  4R8P D;  1P3I C;  5DNM B;  3LZ0 A;  5B31 A;  3WAA B;  3LZ1 C;  1P3A D;  3AFA C;  3A6N D;  4J8W A;  4LD9 C;  2NZD B;  2Y2L A;  2HUE B;  3AV1 B;  4J8X A;  1TAF B;  3B6G B;  3O62 B;  1EQZ C;  4QLC B;  3AYW D;  5AV6 A;  4X23 D;  5CPK C;  4WU9 D;  4YM6 B;  3AZG A;  1ZLA C;  4H9Q A;  3AZI A;  3WKJ A;  3REJ D;  1P3G A;  5AV8 A;  4KUD B;  2Y2K A;  1BH9 A;  3EPK A;  1KX5 B;  4WU8 B;  4WZS B;  3TU4 A;  5FUG A;  3AZM D;  1BFM A;  1N1J A;  3X1T B;  3WTP A;  1U35 B;  5BNV A;  2HUE C;  5E5A D;  3AZF D;  3NQJ A;  5BO0 B;  2DQN C;  3AZL B;  3X1U A;  3MNN C;  2Y2P A;  3C1B A;  1M1A A;  5JRG B;  4ZBJ C;  5AVB D;  4KGC D;  2CV5 C;  5DNN D;  2BG1 A;  1KX4 D;  1HQ3 A;  5AY8 B;  3W99 D;  4KUD C;  5GXQ B;  3B0C T;  3A1I A;  1KX5 C;  3C1C B;  4WU8 C;  3REI B;  3WA9 B;  2F8N B;  3X1T C;  3AN2 A;  1U35 C;  4XZQ B;  1Q9C A;  5B31 C;  2JCH A;  4ZUX B;  4J8W C;  3P5J B;  3REK B;  2J8P A;  4R8P B;  3A1K A;  3REL D;  3UTB D;  4J8X C;  4J8V A;  1P3M D;  3W98 D;  3UT9 D;  4WNN B;  5JA4 A;  5BS7 C;  2Y2O A;  1P3A B;  5B1M A;  4H9P B;  3A6N B;  1M18 A;  3MGS D;  3X1V C;  3C1C C;  1P3F D;  1P3L A;  3VH6 A;  1P3G C;  5AV8 C;  5AV5 A;  1P3I A;  3AYW B;  2RVQ C;  4J8U A;  1BH8 B;  4HGA B;  4X23 B;  2FJ7 A;  4WU9 B;  3TU4 C;  2XD5 A;  3AZK D;  5CP6 D;  2JE5 A;  4DQY B;  3REJ B;  4G92 B;  3UTA D;  3X1U C;  5B1L D;  1EQZ A;  2BYK A;  4H9S C;  3AV2 D;  3EPJ A;  1P3A C;  3AZM B;  1ULY A;  5E5A B;  1ZLA A;  3AZF B;  4CSR A;  1P3P D;  5B0Y D;  3AZN D;  3B0C W;  3H0L C;  5B32 G;  5B24 D;  3MGQ B;  3AYW C;  5B0Z D;  4NFT A;  2FFF B;  4E44 A;  5DNM A;  4DRA A;  5AVB B;  4AWL B;  3NQU B;  4NE3 A;  5DNN B;  4KGC B;  1KX4 B;  3VH5 W;  3AN2 C;  3W99 B;  4G92 C;  4EO5 C;  1TAF A;  3B6G A;  3O62 A;  3B6F D;  4QLC A;  3AZJ D;  1KX3 B;  5E5A C;  3IP4 C;  4YM6 A;  2RIQ A;  1M18 C;  2W8S A;  3FDD A;  3MGQ C;  4KUD A;  3LEL D;  3UTB B;  3REL B;  1KX5 A;  5AVB C;  5DNN C;  4WU8 A;  3W98 B;  3UT9 B;  1KX4 C;  1P3B D;  2Y2M A;  3X1T A;  1S32 D;  1U35 A;  4J8U C;  1H3O B;  2FJ7 C;  3MGS B;  5GT0 B;  3EPH A;  3LJA C;  5BO0 A;  5AV6 D;  3B0D B;  5GT3 D;  1P3F B;  3WKJ D;  5JRG A;  5C3I B;  1KX3 C;  1HTA A;  4XUJ D;  5B2J D;  5BS7 A;  2NQB D;  5B31 G;  3AZK B;  5AVC D;  4JJN D;  5CP6 B;  5GXQ A;  3X1V A;  5CPJ D;  3REL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...