5GXQA

The crystal structure of the nucleosome containing h3.6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAHSIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.6
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqA00
3MGPC 3MVDD 3X1SB 3W99C 5AV5B 5GXQA 2NQBB 1P3IC 1B6WA 2HIOD 3MVDC 3VH6T 4NE6A 3WAAC 4QLCA 5B0YC 1TAFB 3X1VB 3UTAD 3VH6W 4H9QA 1P3AB 2CV5D 5B40C 3UT9D 5CHLB 3KWQB 3LZ0C 3LZ0B 3AZGB 4H9OA 3X1TB 5AV5D 5CP6A 5BNXB 5CP6D 3REHC 3AN2B 3B6GB 5CPIC 3REIB 4Z66C 5CPIB 5BT1D 4XUJB 3W96A 5AV8A 3R45A 3RELB 5E5AD 1A7WA 4JJNB 5GXQC 1P3LA 1ZLAC 5DNNC 4R8PC 3AN2A 5B33D 5JA4B 1BFMA 1U35D 3AN2D 5CP6B 2CV5C 5C3IC 1P3AC 4LD9C 3LZ0D 4H9SC 1P3MA 3AV1C 5B0ZD 3NQJA 5B1MB 2YFWA 1TAFA 3X1VA 4JJND 4JJNA 3MNNC 3X1SC 5BT1C 5BS7C 2HIOB 3KXBB 2PYOA 3LELA 5GT3C 5B32B 4J8UA 4YM6A 3REKA 3UTBA 5GT3B 5B32C 3AZMC 3AZMB 3W98B 3W98C 4J8UD 3REKD 5B32D 1P3LC 4Z66D 1EQZD 4X23A 5B24C 3UT9B 5B2IB 5E5AA 2CV5B 5GXQD 5B24D 1KX5B 3B6FA 3AZHA 5JRGB 5B2JB 1P3IA 5B0ZA 3VH6A 1U35C 3KUYC 3WAAA 5BO0A 1P34B 5BNVA 3AZKD 1P3FA 2F8NA 4QLCC 4LD9D 2BYKA 4ZBJC 2NZDD 1P3OC 5G49B 3MNNA 2BYMA 1AOIB 5B40A 2FJ7D 1S32C 5DNNB 4Z5TB 5CPKB 3MGQA 5CPKC 3O62C 5CPJA 1S32B 1M1AD 5KDMB 5CP6C 5B32A 2AROC 5AVBD 4WU9C 3REHA 3A6NC 2HUEB 4Z5TA 3AV2D 2PYOD 4G91C 5B40B 4KGCC 4HGAB 1BH9A 4H9RA 2BYKB 2YFWB 3X1TC 4J8XC 5JRGC 5B2JC 5AVCA 3LJAA 3W97D 4XZQB 5DNNA 3AZKC 3AN2C 3AYWA 3KWQD 3X1UC 3W97C 3W97B 1P3KB 2YFVB 4J8WB 5B0YD 2CV5A 1P3MD 1KX3D 5B31A 3LZ1A 4CAYA 4R8PB 1B67A 3B0DC 5B1LB 3AV1A 1F66D 3O62A 2FJ7A 5B2IA 3AZFA 3WA9A 4WU9B 4YS3A 1P3GC 3A6NB 4WU9A 4YS3B 4E44A 5B1MC 1M1AC 1ULYA 1WWSA 3MGPB 3LELC 4NE3A 3AV1B 3VH5A 4J8UC 3REKC 3AZIA 2NZDB 2BYMB 1AOIA 4YM6B 1M18B 4J8XA 1EQZA 2F8NK 1WWIA 4R8PD 4X23C 5BO0B 1P34A 3X1UA 1KX4C 3TU4B 5JRGD 5B2JD 3AZJA 1KX5D 1N1JB 5B0YB 3AFAB 3B6FC 4M6BA 3UTAA 3AZEB 5AVCB 3AFAC 1KX5A 3B6FB 5B31B 3KWQC 3KUYA 1F66C 3TU4A 2NQBA 3AZLB 1P3FC 3UT9C 4KGCB 3AZIB 2NZDA 4XZQA 3W98D 2FJ7C 1P3PA 3REHB 4J8XB 1F1EA 4G92C 5B31G 3B6GA 1S32A 3KXBA 5AV9B 2JSSA 2PYOB 3WTPC 3MGQC 5CPKA 5GT0A 4XUJA 1AOIC 3C1CA 4H9OB 5G49A 3A6NA 1Q9CA 5B1MD 3REJB 4X23D 3B0DB 4KGCD 3O62B 3WAAB 1N1JA 5B0YA 1P3KA 4H9QB 5B31D 4WU8A 4LD9B 3AYWD 5C3IB 3LJAC 3KWQA 3X1UD 1P3FD 3LJAB 2YFVA 3AYWC 1M18A 3MGRA 3AZJB 3RELD 3AZNB 3RELA 4KHAA 1P3PC 3REID 1EQZB 4Z2MH 5CPIA 4Z66B 4Z66A 3KXBC 3AZFB 3REIC 5KDMA 3W96C 4YS3D 3WKJB 5GT3D 3AZMD 3AZFC 4J8VD 3X1TD 5FUGA 4R8PA 1P3BC 3MGQD 3AV2C 1M1AA 1P3LD 4H9PA 1HQ3A 1ID3D 3AZIC 3WTPE 3W99A 4KHAB 1P3AA 3X1VD 4LD9A 4J8WD 4H9NA 3MVDA 5AY8D 5B0ZB 3KUYB 4CAYB 3MGRB 4QLCB 1M19A 5B32G 1P34C 5BNVB 1M19D 4XZQD 3MGRC 1M18C 5AVCD 3NQUB 3AZJC 1P3PD 3AFAD 4H9NB 3MVDB 5AV5A 4NE5A 1P3IB 4DRBA 3X1SA 3TU4D 3W99B 5AV8B 4EO5C 1F66A 4KUDC 5BS7A 1HQ3B 5AV9A 4AWLB 3UT9A 5GT3A 3AZMA 4ZUXA 4KUDB 4J8VC 3LELD 5FUGB 4YM6D 4ZUXD 3C1CB 3R45B 4G91B 2IO5C 4UUZA 3C1BA 5CPID 5GT0B 1JFIA 5GSUD 3AZGA 5GT0C 5E5AC 3B0BA 1P3PB 3VH5T 5BNXA 3AZNA 1ZLAA 5AV6D 4G92B 3AZKB 3MGRD 1P3AD 1P3KC 4J8WA 3UTAB 1P3MB 5CPJD 5AV5C 1P3MC 5B2ID 1P3LB 3MGSA 1ZLAB 5DNMC 3X1SD 3UTBB 4J8VA 5DNMD 5DNMB 3WA9B 5F99C 2HUEC 5GT0D 1HTAA 4YM6C 3W98A 4ZUXB 3AZND 4CSRB 3LELB 3AZNC 5GSUC 1HQ3D 4NFTA 4H9SA 4Z5TD 3AV2A 3MNNB 1HQ3C 1R4VA 1TZYB 5AV6B 1TZYC 3REKB 3X1VC 5AV6C 5B31C 3AZEA 1M19B 1TZYD 1KU5A 4QLCD 1BH9B 3MNND 1M19C 1JFIB 3UTBC 5E5AB 5B2IC 4WZSB 5B24B 4YS3C 1H3OB 4XUJD 2CWEA 4KUDD 3MGQB 4KUDA 5AV9C 3B6GD 5B24A 4ZUXC 3AZHD 5F99D 1P3ID 3KSYA 4Z5TC 3AZFD 3AZHC 5B33A 4EO5B 5GSUA 3AZGD 5AY8C 1U35A 2F8NB 1P3BD 1KX4B 3KUYD 5B1LA 5AY8B 3AZED 3X1TA 1ID3C 1TZYA 5B2JA 5AVCC 5JRGA 3AZJD 3AZEC 1KX3A 1ID3B 3W97A 3LJAD 1P3FB 4H9PB 3AYWB 4WU8B 5CPJC 4XZQC 1M18D 3LZ1C 3WKJD 1U35B 3B6GC 5GSUB 3VH5W 4DRAA 3WTPB 4X23B 3WTPA 2PYOC 5DNMA 3W96B 4XUJC 3B0CT 1P3OB 4WU8D 5AV9D 5B33C 3NQJB 5B1MA 3B0CW 5B1LD 2HIOA 3AZLC 5AV8D 1BH8A 4WV4B 5B1LC 1KX3B 3AZID 1KX3C 5B0ZC 1KX4D 3WAAD 2F8ND 1KX4A 3B6FD 4E45A 5AV6A 3AZHB 1P3OA 1P3GA 3TU4C 2NQBC 4Z2MG 3C1BD 5JA4A 5AVBA 2NQBD 3WKJC 5AVBB 4J8VB 3MGPA 3REHD 2F8NG 4WNNA 2AROA 3MGPD 2AROB 2F8NH 1P3BA 3WTPD 3MGSB 2IO5B 4KGCA 1AOID 3AZLA 2FJ7B 2RVQC 2L5AA 1P3GB 2RVQD 3AFAA 1KX5C 3V9RB 3AZKA 5AY8A 3LZ0A 3X1UB 1BH8B 2NZDC 1ID3A 5GXQB 1P3KD 4ZBJB 3AV1D 1P3BB 3REJC 3O62D 3MGSD 4AWLC 4WNNB 3REJD 3LZ1D 2AROD 5AVBC 3A6ND 5F99B 3UTBD 1H3OA 3WA9C 3C1CC 3C1BC 3KXBD 1F66B 1ZLAD 3AZGC 4UUZB 3C1BB 4HGAC 3REIA 4J8XD 5CPJB 4WU8C 3LZ1B 2LY8A 1EQZC 3AZLD 2HIOC 4J8WC 3NQUA 4JJNC 3UTAC 3RELC 1P34D 4CSRA 3MGSC 5B33B 3V9RA 3REJA 5B40D 4H9RB 3AV2B 1P3GD 3C1CD 1P3OD 5F99A 3W96D 1S32D 1M1AB 5CPKD 5DNND 3W99D 3WA9D 4J8UB 3WKJA 5AV8C 4WU9D
chains in the Genus database with same CATH superfamily
3MGPC 3MVDD 3X1SB 3W99C 5AV5B 5GXQA 2NQBB 1P3IC 1B6WA 2HIOD 3MVDC 3VH6T 4NE6A 3WAAC 4QLCA 5B0YC 1TAFB 3X1VB 3UTAD 3VH6W 4H9QA 1P3AB 2CV5D 5B40C 2W8SA 5CHLB 3UT9D 3KWQB 3LZ0C 3LZ0B 3AZGB 4H9OA 3X1TB 5AV5D 5CP6A 5BNXB 5CP6D 3EPKA 3REHC 3A1KA 3AN2B 2Y2MA 3B6GB 5CPIC 3REIB 4Z66C 5CPIB 2Y2HA 5BT1D 4XUJB 3W96A 5AV8A 3R45A 3RELB 5E5AD 1A7WA 4JJNB 5GXQC 1P3LA 1ZLAC 5DNNC 4R8PC 3AN2A 5B33D 5JA4B 1BFMA 1U35D 3H0RC 3AN2D 5CP6B 3EPJA 2CV5C 5C3IC 1P3AC 4LD9C 3LZ0D 4H9SC 1P3MA 2ZY5A 3AV1C 2G5IC 5B0ZD 3NQJA 3EG5B 2YFWA 5B1MB 1TAFA 3X1VA 4JJND 4JJNA 3MNNC 3X1SC 5BT1C 5BS7C 2HIOB 3KXBB 2PYOA 3LELA 5GT3C 5B32B 4J8UA 4YM6A 3REKA 3UTBA 5GT3B 5B32C 3AZMC 3AZMB 3W98B 3W98C 4J8UD 3REKD 5B32D 1P3LC 4Z66D 1EQZD 4X23A 5B24C 3UT9B 5B2IB 5E5AA 2CV5B 5GXQD 5B24D 1KX5B 3B6FA 2JE5A 5JRGB 5B2JB 2ZM5A 3AZHA 1P3IA 5B0ZA 3VH6A 1U35C 3KUYC 3WAAA 5BO0A 1P34B 5BNVA 3AZKD 1P3FA 2F8NA 4QLCC 4LD9D 2BYKA 4ZBJC 2NZDD 1P3OC 5G49B 3MNNA 2BYMA 1AOIB 5B40A 2FJ7D 1S32C 2ZY4A 5DNNB 4DQYB 2Y2GA 4Z5TB 5CPKB 3MGQA 5CPKC 3O62C 5CPJA 1S32B 1M1AD 5KDMB 5CP6C 5B32A 2AROC 5AVBD 4WU9C 3REHA 3A6NC 2HUEB 2RIQA 4Z5TA 3AV2D 2PYOD 4G91C 5B40B 4KGCC 4HGAB 1BH9A 4H9RA 2BYKB 2YFWB 3X1TC 4J8XC 5JRGC 5B2JC 5AVCA 3LJAA 3W97D 4XZQB 5DNNA 3AZKC 3AN2C 3AYWA 3KWQD 3X1UC 3W97C 3W97B 1P3KB 2YFVB 4J8WB 5B0YD 2CV5A 1P3MD 1KX3D 5B31A 3LZ1A 4CAYA 4UPKA 4R8PB 1B67A 3B0DC 5B1LB 3AV1A 1F66D 3O62A 2FJ7A 5B2IA 3AZFA 3WA9A 4WU9B 4YS3A 1P3GC 3A6NB 4WU9A 4YS3B 4E44A 5B1MC 1M1AC 1ULYA 1WWSA 3MGPB 3LELC 4NE3A 3AV1B 3VH5A 4J8UC 3REKC 3AZIA 2NZDB 2BYMB 1AOIA 4YM6B 1M18B 4J8XA 1EQZA 2F8NK 1WWIA 4R8PD 4X23C 5BO0B 1P34A 3X1UA 2Y2KA 1KX4C 3TU4B 5JRGD 5B2JD 3AZJA 1KX5D 1N1JB 5B0YB 3AFAB 3B6FC 4M6BA 3UTAA 3AZEB 5AVCB 3AFAC 1KX5A 3B6FB 5B31B 3KWQC 3EPHA 3KUYA 1F66C 3TU4A 2NQBA 3AZLB 1P3FC 3UT9C 4KGCB 3AZIB 2NZDA 4XZQA 3W98D 2FJ7C 1P3PA 3REHB 4J8XB 1F1EA 4G92C 5B31G 3B6GA 1S32A 3KXBA 5AV9B 2JSSA 2PYOB 3WTPC 3MGQC 5CPKA 5GT0A 4XUJA 1AOIC 2JCHA 3C1CA 4H9OB 5G49A 3A6NA 1Q9CA 5B1MD 3REJB 4X23D 3B0DB 4KGCD 3O62B 3WAAB 1N1JA 5B0YA 1P3KA 4H9QB 5B31D 4WU8A 2ZY2A 4LD9B 3AYWD 5C3IB 3LJAC 3KWQA 3X1UD 1P3FD 3LJAB 2YFVA 3AYWC 1M18A 3MGRA 3AZJB 3RELD 3AZNB 3RELA 4KHAA 1P3PC 3REID 1EQZB 4Z2MH 5CPIA 4Z66B 4Z66A 3KXBC 3AZFB 3REIC 5KDMA 3W96C 4YS3D 3F6TA 2FFFB 3WKJB 5GT3D 3AZMD 3AZFC 4J8VD 3X1TD 5FUGA 4R8PA 1P3BC 3MGQD 3AV2C 1M1AA 1P3LD 4H9PA 1HQ3A 2G5HC 1ID3D 3AZIC 1W2EA 3WTPE 4KHAB 3W99A 1P3AA 3X1VD 4LD9A 4J8WD 4H9NA 3MVDA 5AY8D 2XD1A 5B0ZB 3KUYB 4CAYB 3MGRB 1PZRA 4QLCB 1M19A 5B32G 1P34C 5BNVB 1M19D 4XZQD 3MGRC 1M18C 5AVCD 3NQUB 3AZJC 1P3PD 3AFAD 4H9NB 3MVDB 5AV5A 4NE5A 1P3IB 4DRBA 3X1SA 3TU4D 3W99B 5AV8B 4EO5C 1F66A 3EPLA 4KUDC 5BS7A 1HQ3B 5AV9A 4AWLB 3UT9A 5GT3A 3AZMA 4ZUXA 4KUDB 4J8VC 3LELD 5FUGB 4YM6D 4ZUXD 3C1CB 3R45B 4G91B 2IO5C 4UUZA 3C1BA 5CPID 5GT0B 1JFIA 5GSUD 3AZGA 5GT0C 5E5AC 3B0BA 1P3PB 3VH5T 5BNXA 3AZNA 1ZLAA 5AV6D 4G92B 3AZKB 3MGRD 1P3AD 1P3KC 4J8WA 3UTAB 1P3MB 5CPJD 5AV5C 1P3MC 5B2ID 1P3LB 3MGSA 1ZLAB 5DNMC 3X1SD 2ZY3A 3UTBB 4J8VA 5DNMD 5DNMB 3H0MC 3WA9B 5F99C 2HUEC 5GT0D 1HTAA 2DF4C 4YM6C 3W98A 4ZUXB 3AZND 4CSRB 3LELB 2Y2OA 3AZNC 5GSUC 1HQ3D 2Y2QA 4H9SA 4NFTA 4Z5TD 3AV2A 3MNNB 1HQ3C 1R4VA 1TZYB 5AV6B 1TZYC 3REKB 3X1VC 5AV6C 5B31C 3AZEA 1M19B 1TZYD 1KU5A 4QLCD 2Y2IA 1BH9B 3MNND 1M19C 1JFIB 3UTBC 2UWXA 5E5AB 5B2IC 4WZSB 5B24B 4YS3C 1H3OB 4XUJD 2CWEA 4KUDD 3FDDA 3MGQB 4KUDA 5AV9C 3B6GD 5B24A 4ZUXC 3AZHD 2Y2NA 5F99D 1P3ID 3KSYA 4Z5TC 3AZFD 3AZHC 5B33A 3H0LC 4EO5B 5GSUA 3AZGD 5AY8C 1U35A 2F8NB 1P3BD 1KX4B 3KUYD 5B1LA 5AY8B 3AZED 3X1TA 1ID3C 1TZYA 5B2JA 5AVCC 5JRGA 3AZJD 3AZEC 1KX3A 1ID3B 3W97A 3LJAD 1P3FB 4H9PB 3AYWB 4WU8B 5CPJC 4XZQC 1M18D 3LZ1C 3WKJD 1U35B 3B6GC 5GSUB 1Z2CB 3VH5W 3WTPB 4DRAA 4X23B 3WTPA 1T3UA 5DNMA 2PYOC 3W96B 4XUJC 3B0CT 2VQRA 1P3OB 3AL0C 4WU8D 5AV9D 3A1IA 2Y2JA 5B33C 3NQJB 5B1MA 3B0CW 5B1LD 2HIOA 3AZLC 5AV8D 1BH8A 4WV4B 5B1LC 1KX3B 3AZID 1KX3C 5B0ZC 1KX4D 3WAAD 2F8ND 1KX4A 2Y2PA 3KFUG 3B6FD 4E45A 5AV6A 3AZHB 1P3OA 1P3GA 3TU4C 2NQBC 4Z2MG 3C1BD 5JA4A 5AVBA 2NQBD 3WKJC 5AVBB 4J8VB 3MGPA 3REHD 2F8NG 4WNNA 2AROA 3MGPD 2AROB 2F8NH 1P3BA 3WTPD 3MGSB 2IO5B 4WJ3C 4KGCA 1AOID 3AZLA 2FJ7B 2RVQC 2L5AA 2XD5A 1P3GB 2RVQD 3AFAA 1KX5C 2DQNC 3V9RB 3AZKA 5AY8A 3LZ0A 3X1UB 1BH8B 2NZDC 2F2AC 1ID3A 2Y2LA 2BG1A 5GXQB 1P3KD 4ZBJB 3AV1D 1P3BB 3REJC 3O62D 3MGSD 4AWLC 4WNNB 3REJD 3LZ1D 2AROD 5AVBC 3A6ND 5F99B 3UTBD 1H3OA 3WA9C 3C1CC 3C1BC 3KXBD 1F66B 1ZLAD 3AZGC 4UUZB 3C1BB 4HGAC 3REIA 4J8XD 5CPJB 4WU8C 3LZ1B 2LY8A 1EQZC 3AZLD 3P5JB 2HIOC 4J8WC 3NQUA 3IP4C 4JJNC 2J8PA 3UTAC 3RELC 1P34D 4CSRA 3MGSC 5B33B 3V9RA 3REJA 5B40D 4H9RB 3AV2B 1P3GD 3C1CD 1P3OD 5F99A 3W96D 1S32D 1M1AB 5CPKD 5DNND 3W99D 3WA9D 4J8UB 3WKJA 5AV8C 4WU9D
chains in the Genus database with same CATH topology
3MGPC 3MVDD 3X1SB 3W99C 5AV5B 5GXQA 2NQBB 1P3IC 1B6WA 2HIOD 3MVDC 3VH6T 4NE6A 3WAAC 4QLCA 5B0YC 1TAFB 3X1VB 3UTAD 3VH6W 4H9QA 1P3AB 2CV5D 5B40C 2W8SA 5CHLB 3UT9D 3KWQB 3LZ0C 3LZ0B 3AZGB 4H9OA 3X1TB 5AV5D 5CP6A 5BNXB 5CP6D 3EPKA 3REHC 3A1KA 3AN2B 2Y2MA 3B6GB 5CPIC 3REIB 4Z66C 5CPIB 2Y2HA 5BT1D 4XUJB 3W96A 5AV8A 3R45A 3RELB 5E5AD 1A7WA 4JJNB 5GXQC 1P3LA 1ZLAC 5DNNC 4R8PC 3AN2A 5B33D 5JA4B 1BFMA 1U35D 3H0RC 3AN2D 5CP6B 3EPJA 2CV5C 5C3IC 1P3AC 4LD9C 3LZ0D 4H9SC 1P3MA 2ZY5A 3AV1C 2G5IC 5B0ZD 3NQJA 3EG5B 2YFWA 5B1MB 1TAFA 3X1VA 4JJND 4JJNA 3MNNC 3X1SC 5BT1C 5BS7C 2HIOB 3KXBB 2PYOA 3LELA 5GT3C 5B32B 4J8UA 4YM6A 3REKA 3UTBA 5GT3B 5B32C 3AZMC 3AZMB 3W98B 3W98C 4J8UD 3REKD 5B32D 1P3LC 4Z66D 1EQZD 4X23A 5B24C 3UT9B 5B2IB 5E5AA 2CV5B 5GXQD 5B24D 1KX5B 3B6FA 2JE5A 5JRGB 5B2JB 2ZM5A 3AZHA 1P3IA 5B0ZA 3VH6A 1U35C 3KUYC 3WAAA 5BO0A 1P34B 5BNVA 3AZKD 1P3FA 2F8NA 4QLCC 4LD9D 2BYKA 4ZBJC 2NZDD 1P3OC 5G49B 3MNNA 2BYMA 1AOIB 5B40A 2FJ7D 1S32C 2ZY4A 5DNNB 4DQYB 2Y2GA 4Z5TB 5CPKB 3MGQA 5CPKC 3O62C 5CPJA 1S32B 1M1AD 5KDMB 5CP6C 5B32A 2AROC 5AVBD 4WU9C 3REHA 3A6NC 2HUEB 2RIQA 4Z5TA 3AV2D 2PYOD 4G91C 5B40B 4KGCC 4HGAB 1BH9A 4H9RA 2BYKB 2YFWB 3X1TC 4J8XC 5JRGC 5B2JC 5AVCA 3LJAA 3W97D 4XZQB 5DNNA 3AZKC 3AN2C 3AYWA 3KWQD 3X1UC 3W97C 3W97B 1P3KB 2YFVB 4J8WB 5B0YD 2CV5A 1P3MD 1KX3D 5B31A 3LZ1A 4CAYA 4UPKA 4R8PB 1B67A 3B0DC 5B1LB 3AV1A 1F66D 3O62A 2FJ7A 5B2IA 3AZFA 3WA9A 4WU9B 4YS3A 1P3GC 3A6NB 4WU9A 4YS3B 4E44A 5B1MC 1M1AC 1ULYA 1WWSA 3MGPB 3LELC 4NE3A 3AV1B 3VH5A 4J8UC 3REKC 3AZIA 2NZDB 2BYMB 1AOIA 4YM6B 1M18B 4J8XA 1EQZA 2F8NK 1WWIA 4R8PD 4X23C 5BO0B 1P34A 3X1UA 2Y2KA 1KX4C 3TU4B 5JRGD 5B2JD 3AZJA 1KX5D 1N1JB 5B0YB 3AFAB 3B6FC 4M6BA 3UTAA 3AZEB 5AVCB 3AFAC 1KX5A 3B6FB 5B31B 3KWQC 3EPHA 3KUYA 1F66C 3TU4A 2NQBA 3AZLB 1P3FC 3UT9C 4KGCB 3AZIB 2NZDA 4XZQA 3W98D 2FJ7C 1P3PA 3REHB 4J8XB 1F1EA 4G92C 5B31G 3B6GA 1S32A 3KXBA 5AV9B 2JSSA 2PYOB 3WTPC 3MGQC 5CPKA 5GT0A 4XUJA 1AOIC 2JCHA 3C1CA 4H9OB 5G49A 3A6NA 1Q9CA 5B1MD 3REJB 4X23D 3B0DB 4KGCD 3O62B 3WAAB 1N1JA 5B0YA 1P3KA 4H9QB 5B31D 4WU8A 2ZY2A 4LD9B 3AYWD 5C3IB 3LJAC 3KWQA 3X1UD 1P3FD 3LJAB 2YFVA 3AYWC 1M18A 3MGRA 3AZJB 3RELD 3AZNB 3RELA 4KHAA 1P3PC 3REID 1EQZB 4Z2MH 5CPIA 4Z66B 4Z66A 3KXBC 3AZFB 3REIC 5KDMA 3W96C 4YS3D 3F6TA 2FFFB 3WKJB 5GT3D 3AZMD 3AZFC 4J8VD 3X1TD 5FUGA 4R8PA 1P3BC 3MGQD 3AV2C 1M1AA 1P3LD 4H9PA 1HQ3A 2G5HC 1ID3D 3AZIC 1W2EA 3WTPE 4KHAB 3W99A 1P3AA 3X1VD 4LD9A 4J8WD 4H9NA 3MVDA 5AY8D 2XD1A 5B0ZB 3KUYB 4CAYB 3MGRB 1PZRA 4QLCB 1M19A 5B32G 1P34C 5BNVB 1M19D 4XZQD 3MGRC 1M18C 5AVCD 3NQUB 3AZJC 1P3PD 3AFAD 4H9NB 3MVDB 5AV5A 4NE5A 1P3IB 4DRBA 3X1SA 3TU4D 3W99B 5AV8B 4EO5C 1F66A 3EPLA 4KUDC 5BS7A 1HQ3B 5AV9A 4AWLB 3UT9A 5GT3A 3AZMA 4ZUXA 4KUDB 4J8VC 3LELD 5FUGB 4YM6D 4ZUXD 3C1CB 3R45B 4G91B 2IO5C 4UUZA 3C1BA 5CPID 5GT0B 1JFIA 5GSUD 3AZGA 5GT0C 5E5AC 3B0BA 1P3PB 3VH5T 5BNXA 3AZNA 1ZLAA 5AV6D 4G92B 3AZKB 3MGRD 1P3AD 1P3KC 4J8WA 3UTAB 1P3MB 5CPJD 5AV5C 1P3MC 5B2ID 1P3LB 3MGSA 1ZLAB 5DNMC 3X1SD 2ZY3A 3UTBB 4J8VA 5DNMD 5DNMB 3H0MC 3WA9B 5F99C 2HUEC 5GT0D 1HTAA 2DF4C 4YM6C 3W98A 4ZUXB 3AZND 4CSRB 3LELB 2Y2OA 3AZNC 5GSUC 1HQ3D 2Y2QA 4H9SA 4NFTA 4Z5TD 3AV2A 3MNNB 1HQ3C 1R4VA 1TZYB 5AV6B 1TZYC 3REKB 3X1VC 5AV6C 5B31C 3AZEA 1M19B 1TZYD 1KU5A 4QLCD 2Y2IA 1BH9B 3MNND 1M19C 1JFIB 3UTBC 2UWXA 5E5AB 5B2IC 4WZSB 5B24B 4YS3C 1H3OB 4XUJD 2CWEA 4KUDD 3FDDA 3MGQB 4KUDA 5AV9C 3B6GD 5B24A 4ZUXC 3AZHD 2Y2NA 5F99D 1P3ID 3KSYA 4Z5TC 3AZFD 3AZHC 5B33A 3H0LC 4EO5B 5GSUA 3AZGD 5AY8C 1U35A 2F8NB 1P3BD 1KX4B 3KUYD 5B1LA 5AY8B 3AZED 3X1TA 1ID3C 1TZYA 5B2JA 5AVCC 5JRGA 3AZJD 3AZEC 1KX3A 1ID3B 3W97A 3LJAD 1P3FB 4H9PB 3AYWB 4WU8B 5CPJC 4XZQC 1M18D 3LZ1C 3WKJD 1U35B 3B6GC 5GSUB 1Z2CB 3VH5W 3WTPB 4DRAA 4X23B 3WTPA 1T3UA 5DNMA 2PYOC 3W96B 4XUJC 3B0CT 2VQRA 1P3OB 3AL0C 4WU8D 5AV9D 3A1IA 2Y2JA 5B33C 3NQJB 5B1MA 3B0CW 5B1LD 2HIOA 3AZLC 5AV8D 1BH8A 4WV4B 5B1LC 1KX3B 3AZID 1KX3C 5B0ZC 1KX4D 3WAAD 2F8ND 1KX4A 2Y2PA 3KFUG 3B6FD 4E45A 5AV6A 3AZHB 1P3OA 1P3GA 3TU4C 2NQBC 4Z2MG 3C1BD 5JA4A 5AVBA 2NQBD 3WKJC 5AVBB 4J8VB 3MGPA 3REHD 2F8NG 4WNNA 2AROA 3MGPD 2AROB 2F8NH 1P3BA 3WTPD 3MGSB 2IO5B 4WJ3C 4KGCA 1AOID 3AZLA 2FJ7B 2RVQC 2L5AA 2XD5A 1P3GB 2RVQD 3AFAA 1KX5C 2DQNC 3V9RB 3AZKA 5AY8A 3LZ0A 3X1UB 1BH8B 2NZDC 2F2AC 1ID3A 2Y2LA 2BG1A 5GXQB 1P3KD 4ZBJB 3AV1D 1P3BB 3REJC 3O62D 3MGSD 4AWLC 4WNNB 3REJD 3LZ1D 2AROD 5AVBC 3A6ND 5F99B 3UTBD 1H3OA 3WA9C 3C1CC 3C1BC 3KXBD 1F66B 1ZLAD 3AZGC 4UUZB 3C1BB 4HGAC 3REIA 4J8XD 5CPJB 4WU8C 3LZ1B 2LY8A 1EQZC 3AZLD 3P5JB 2HIOC 4J8WC 3NQUA 3IP4C 4JJNC 2J8PA 3UTAC 3RELC 1P34D 4CSRA 3MGSC 5B33B 3V9RA 3REJA 5B40D 4H9RB 3AV2B 1P3GD 3C1CD 1P3OD 5F99A 3W96D 1S32D 1M1AB 5CPKD 5DNND 3W99D 3WA9D 4J8UB 3WKJA 5AV8C 4WU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP C;  3MVD D;  3X1S B;  3W99 C;  5AV5 B;  5GXQ A;  2NQB B;  1P3I C;  1B6W A;  2HIO D;  3MVD C;  3VH6 T;  4NE6 A;  3WAA C;  4QLC A;  5B0Y C;  1TAF B;  3X1V B;  3UTA D;  3VH6 W;  4H9Q A;  1P3A B;  2CV5 D;  5B40 C;  3UT9 D;  5CHL B;  3KWQ B;  3LZ0 C;  3LZ0 B;  3AZG B;  4H9O A;  3X1T B;  5AV5 D;  5CP6 A;  5BNX B;  5CP6 D;  3REH C;  3AN2 B;  3B6G B;  5CPI C;  3REI B;  4Z66 C;  5CPI B;  5BT1 D;  4XUJ B;  3W96 A;  5AV8 A;  3R45 A;  3REL B;  5E5A D;  1A7W A;  4JJN B;  5GXQ C;  1P3L A;  1ZLA C;  5DNN C;  4R8P C;  3AN2 A;  5B33 D;  5JA4 B;  1BFM A;  1U35 D;  3AN2 D;  5CP6 B;  2CV5 C;  5C3I C;  1P3A C;  4LD9 C;  3LZ0 D;  4H9S C;  1P3M A;  3AV1 C;  5B0Z D;  3NQJ A;  5B1M B;  2YFW A;  1TAF A;  3X1V A;  4JJN D;  4JJN A;  3MNN C;  3X1S C;  5BT1 C;  5BS7 C;  2HIO B;  3KXB B;  2PYO A;  3LEL A;  5GT3 C;  5B32 B;  4J8U A;  4YM6 A;  3REK A;  3UTB A;  5GT3 B;  5B32 C;  3AZM C;  3AZM B;  3W98 B;  3W98 C;  4J8U D;  3REK D;  5B32 D;  1P3L C;  4Z66 D;  1EQZ D;  4X23 A;  5B24 C;  3UT9 B;  5B2I B;  5E5A A;  2CV5 B;  5GXQ D;  5B24 D;  1KX5 B;  3B6F A;  3AZH A;  5JRG B;  5B2J B;  1P3I A;  5B0Z A;  3VH6 A;  1U35 C;  3KUY C;  3WAA A;  5BO0 A;  1P34 B;  5BNV A;  3AZK D;  1P3F A;  2F8N A;  4QLC C;  4LD9 D;  2BYK A;  4ZBJ C;  2NZD D;  1P3O C;  5G49 B;  3MNN A;  2BYM A;  1AOI B;  5B40 A;  2FJ7 D;  1S32 C;  5DNN B;  4Z5T B;  5CPK B;  3MGQ A;  5CPK C;  3O62 C;  5CPJ A;  1S32 B;  1M1A D;  5KDM B;  5CP6 C;  5B32 A;  2ARO C;  5AVB D;  4WU9 C;  3REH A;  3A6N C;  2HUE B;  4Z5T A;  3AV2 D;  2PYO D;  4G91 C;  5B40 B;  4KGC C;  4HGA B;  1BH9 A;  4H9R A;  2BYK B;  2YFW B;  3X1T C;  4J8X C;  5JRG C;  5B2J C;  5AVC A;  3LJA A;  3W97 D;  4XZQ B;  5DNN A;  3AZK C;  3AN2 C;  3AYW A;  3KWQ D;  3X1U C;  3W97 C;  3W97 B;  1P3K B;  2YFV B;  4J8W B;  5B0Y D;  2CV5 A;  1P3M D;  1KX3 D;  5B31 A;  3LZ1 A;  4CAY A;  4R8P B;  1B67 A;  3B0D C;  5B1L B;  3AV1 A;  1F66 D;  3O62 A;  2FJ7 A;  5B2I A;  3AZF A;  3WA9 A;  4WU9 B;  4YS3 A;  1P3G C;  3A6N B;  4WU9 A;  4YS3 B;  4E44 A;  5B1M C;  1M1A C;  1ULY A;  1WWS A;  3MGP B;  3LEL C;  4NE3 A;  3AV1 B;  3VH5 A;  4J8U C;  3REK C;  3AZI A;  2NZD B;  2BYM B;  1AOI A;  4YM6 B;  1M18 B;  4J8X A;  1EQZ A;  2F8N K;  1WWI A;  4R8P D;  4X23 C;  5BO0 B;  1P34 A;  3X1U A;  1KX4 C;  3TU4 B;  5JRG D;  5B2J D;  3AZJ A;  1KX5 D;  1N1J B;  5B0Y B;  3AFA B;  3B6F C;  4M6B A;  3UTA A;  3AZE B;  5AVC B;  3AFA C;  1KX5 A;  3B6F B;  5B31 B;  3KWQ C;  3KUY A;  1F66 C;  3TU4 A;  2NQB A;  3AZL B;  1P3F C;  3UT9 C;  4KGC B;  3AZI B;  2NZD A;  4XZQ A;  3W98 D;  2FJ7 C;  1P3P A;  3REH B;  4J8X B;  1F1E A;  4G92 C;  5B31 G;  3B6G A;  1S32 A;  3KXB A;  5AV9 B;  2JSS A;  2PYO B;  3WTP C;  3MGQ C;  5CPK A;  5GT0 A;  4XUJ A;  1AOI C;  3C1C A;  4H9O B;  5G49 A;  3A6N A;  1Q9C A;  5B1M D;  3REJ B;  4X23 D;  3B0D B;  4KGC D;  3O62 B;  3WAA B;  1N1J A;  5B0Y A;  1P3K A;  4H9Q B;  5B31 D;  4WU8 A;  4LD9 B;  3AYW D;  5C3I B;  3LJA C;  3KWQ A;  3X1U D;  1P3F D;  3LJA B;  2YFV A;  3AYW C;  1M18 A;  3MGR A;  3AZJ B;  3REL D;  3AZN B;  3REL A;  4KHA A;  1P3P C;  3REI D;  1EQZ B;  4Z2M H;  5CPI A;  4Z66 B;  4Z66 A;  3KXB C;  3AZF B;  3REI C;  5KDM A;  3W96 C;  4YS3 D;  3WKJ B;  5GT3 D;  3AZM D;  3AZF C;  4J8V D;  3X1T D;  5FUG A;  4R8P A;  1P3B C;  3MGQ D;  3AV2 C;  1M1A A;  1P3L D;  4H9P A;  1HQ3 A;  1ID3 D;  3AZI C;  3WTP E;  3W99 A;  4KHA B;  1P3A A;  3X1V D;  4LD9 A;  4J8W D;  4H9N A;  3MVD A;  5AY8 D;  5B0Z B;  3KUY B;  4CAY B;  3MGR B;  4QLC B;  1M19 A;  5B32 G;  1P34 C;  5BNV B;  1M19 D;  4XZQ D;  3MGR C;  1M18 C;  5AVC D;  3NQU B;  3AZJ C;  1P3P D;  3AFA D;  4H9N B;  3MVD B;  5AV5 A;  4NE5 A;  1P3I B;  4DRB A;  3X1S A;  3TU4 D;  3W99 B;  5AV8 B;  4EO5 C;  1F66 A;  4KUD C;  5BS7 A;  1HQ3 B;  5AV9 A;  4AWL B;  3UT9 A;  5GT3 A;  3AZM A;  4ZUX A;  4KUD B;  4J8V C;  3LEL D;  5FUG B;  4YM6 D;  4ZUX D;  3C1C B;  3R45 B;  4G91 B;  2IO5 C;  4UUZ A;  3C1B A;  5CPI D;  5GT0 B;  1JFI A;  5GSU D;  3AZG A;  5GT0 C;  5E5A C;  3B0B A;  1P3P B;  3VH5 T;  5BNX A;  3AZN A;  1ZLA A;  5AV6 D;  4G92 B;  3AZK B;  3MGR D;  1P3A D;  1P3K C;  4J8W A;  3UTA B;  1P3M B;  5CPJ D;  5AV5 C;  1P3M C;  5B2I D;  1P3L B;  3MGS A;  1ZLA B;  5DNM C;  3X1S D;  3UTB B;  4J8V A;  5DNM D;  5DNM B;  3WA9 B;  5F99 C;  2HUE C;  5GT0 D;  1HTA A;  4YM6 C;  3W98 A;  4ZUX B;  3AZN D;  4CSR B;  3LEL B;  3AZN C;  5GSU C;  1HQ3 D;  4NFT A;  4H9S A;  4Z5T D;  3AV2 A;  3MNN B;  1HQ3 C;  1R4V A;  1TZY B;  5AV6 B;  1TZY C;  3REK B;  3X1V C;  5AV6 C;  5B31 C;  3AZE A;  1M19 B;  1TZY D;  1KU5 A;  4QLC D;  1BH9 B;  3MNN D;  1M19 C;  1JFI B;  3UTB C;  5E5A B;  5B2I C;  4WZS B;  5B24 B;  4YS3 C;  1H3O B;  4XUJ D;  2CWE A;  4KUD D;  3MGQ B;  4KUD A;  5AV9 C;  3B6G D;  5B24 A;  4ZUX C;  3AZH D;  5F99 D;  1P3I D;  3KSY A;  4Z5T C;  3AZF D;  3AZH C;  5B33 A;  4EO5 B;  5GSU A;  3AZG D;  5AY8 C;  1U35 A;  2F8N B;  1P3B D;  1KX4 B;  3KUY D;  5B1L A;  5AY8 B;  3AZE D;  3X1T A;  1ID3 C;  1TZY A;  5B2J A;  5AVC C;  5JRG A;  3AZJ D;  3AZE C;  1KX3 A;  1ID3 B;  3W97 A;  3LJA D;  1P3F B;  4H9P B;  3AYW B;  4WU8 B;  5CPJ C;  4XZQ C;  1M18 D;  3LZ1 C;  3WKJ D;  1U35 B;  3B6G C;  5GSU B;  3VH5 W;  4DRA A;  3WTP B;  4X23 B;  3WTP A;  2PYO C;  5DNM A;  3W96 B;  4XUJ C;  3B0C T;  1P3O B;  4WU8 D;  5AV9 D;  5B33 C;  3NQJ B;  5B1M A;  3B0C W;  5B1L D;  2HIO A;  3AZL C;  5AV8 D;  1BH8 A;  4WV4 B;  5B1L C;  1KX3 B;  3AZI D;  1KX3 C;  5B0Z C;  1KX4 D;  3WAA D;  2F8N D;  1KX4 A;  3B6F D;  4E45 A;  5AV6 A;  3AZH B;  1P3O A;  1P3G A;  3TU4 C;  2NQB C;  4Z2M G;  3C1B D;  5JA4 A;  5AVB A;  2NQB D;  3WKJ C;  5AVB B;  4J8V B;  3MGP A;  3REH D;  2F8N G;  4WNN A;  2ARO A;  3MGP D;  2ARO B;  2F8N H;  1P3B A;  3WTP D;  3MGS B;  2IO5 B;  4KGC A;  1AOI D;  3AZL A;  2FJ7 B;  2RVQ C;  2L5A A;  1P3G B;  2RVQ D;  3AFA A;  1KX5 C;  3V9R B;  3AZK A;  5AY8 A;  3LZ0 A;  3X1U B;  1BH8 B;  2NZD C;  1ID3 A;  5GXQ B;  1P3K D;  4ZBJ B;  3AV1 D;  1P3B B;  3REJ C;  3O62 D;  3MGS D;  4AWL C;  4WNN B;  3REJ D;  3LZ1 D;  2ARO D;  5AVB C;  3A6N D;  5F99 B;  3UTB D;  1H3O A;  3WA9 C;  3C1C C;  3C1B C;  3KXB D;  1F66 B;  1ZLA D;  3AZG C;  4UUZ B;  3C1B B;  4HGA C;  3REI A;  4J8X D;  5CPJ B;  4WU8 C;  3LZ1 B;  2LY8 A;  1EQZ C;  3AZL D;  2HIO C;  4J8W C;  3NQU A;  4JJN C;  3UTA C;  3REL C;  1P34 D;  4CSR A;  3MGS C;  5B33 B;  3V9R A;  3REJ A;  5B40 D;  4H9R B;  3AV2 B;  1P3G D;  3C1C D;  1P3O D;  5F99 A;  3W96 D;  1S32 D;  1M1A B;  5CPK D;  5DNN D;  3W99 D;  3WA9 D;  4J8U B;  3WKJ A;  5AV8 C;  4WU9 D; 
#chains in the Genus database with same CATH topology
 3MGP C;  3MVD D;  3X1S B;  3W99 C;  5AV5 B;  5GXQ A;  2NQB B;  1P3I C;  1B6W A;  2HIO D;  3MVD C;  3VH6 T;  4NE6 A;  3WAA C;  4QLC A;  5B0Y C;  1TAF B;  3X1V B;  3UTA D;  3VH6 W;  4H9Q A;  1P3A B;  2CV5 D;  5B40 C;  2W8S A;  5CHL B;  3UT9 D;  3KWQ B;  3LZ0 C;  3LZ0 B;  3AZG B;  4H9O A;  3X1T B;  5AV5 D;  5CP6 A;  5BNX B;  5CP6 D;  3EPK A;  3REH C;  3A1K A;  3AN2 B;  2Y2M A;  3B6G B;  5CPI C;  3REI B;  4Z66 C;  5CPI B;  2Y2H A;  5BT1 D;  4XUJ B;  3W96 A;  5AV8 A;  3R45 A;  3REL B;  5E5A D;  1A7W A;  4JJN B;  5GXQ C;  1P3L A;  1ZLA C;  5DNN C;  4R8P C;  3AN2 A;  5B33 D;  5JA4 B;  1BFM A;  1U35 D;  3H0R C;  3AN2 D;  5CP6 B;  3EPJ A;  2CV5 C;  5C3I C;  1P3A C;  4LD9 C;  3LZ0 D;  4H9S C;  1P3M A;  2ZY5 A;  3AV1 C;  2G5I C;  5B0Z D;  3NQJ A;  3EG5 B;  2YFW A;  5B1M B;  1TAF A;  3X1V A;  4JJN D;  4JJN A;  3MNN C;  3X1S C;  5BT1 C;  5BS7 C;  2HIO B;  3KXB B;  2PYO A;  3LEL A;  5GT3 C;  5B32 B;  4J8U A;  4YM6 A;  3REK A;  3UTB A;  5GT3 B;  5B32 C;  3AZM C;  3AZM B;  3W98 B;  3W98 C;  4J8U D;  3REK D;  5B32 D;  1P3L C;  4Z66 D;  1EQZ D;  4X23 A;  5B24 C;  3UT9 B;  5B2I B;  5E5A A;  2CV5 B;  5GXQ D;  5B24 D;  1KX5 B;  3B6F A;  2JE5 A;  5JRG B;  5B2J B;  2ZM5 A;  3AZH A;  1P3I A;  5B0Z A;  3VH6 A;  1U35 C;  3KUY C;  3WAA A;  5BO0 A;  1P34 B;  5BNV A;  3AZK D;  1P3F A;  2F8N A;  4QLC C;  4LD9 D;  2BYK A;  4ZBJ C;  2NZD D;  1P3O C;  5G49 B;  3MNN A;  2BYM A;  1AOI B;  5B40 A;  2FJ7 D;  1S32 C;  2ZY4 A;  5DNN B;  4DQY B;  2Y2G A;  4Z5T B;  5CPK B;  3MGQ A;  5CPK C;  3O62 C;  5CPJ A;  1S32 B;  1M1A D;  5KDM B;  5CP6 C;  5B32 A;  2ARO C;  5AVB D;  4WU9 C;  3REH A;  3A6N C;  2HUE B;  2RIQ A;  4Z5T A;  3AV2 D;  2PYO D;  4G91 C;  5B40 B;  4KGC C;  4HGA B;  1BH9 A;  4H9R A;  2BYK B;  2YFW B;  3X1T C;  4J8X C;  5JRG C;  5B2J C;  5AVC A;  3LJA A;  3W97 D;  4XZQ B;  5DNN A;  3AZK C;  3AN2 C;  3AYW A;  3KWQ D;  3X1U C;  3W97 C;  3W97 B;  1P3K B;  2YFV B;  4J8W B;  5B0Y D;  2CV5 A;  1P3M D;  1KX3 D;  5B31 A;  3LZ1 A;  4CAY A;  4UPK A;  4R8P B;  1B67 A;  3B0D C;  5B1L B;  3AV1 A;  1F66 D;  3O62 A;  2FJ7 A;  5B2I A;  3AZF A;  3WA9 A;  4WU9 B;  4YS3 A;  1P3G C;  3A6N B;  4WU9 A;  4YS3 B;  4E44 A;  5B1M C;  1M1A C;  1ULY A;  1WWS A;  3MGP B;  3LEL C;  4NE3 A;  3AV1 B;  3VH5 A;  4J8U C;  3REK C;  3AZI A;  2NZD B;  2BYM B;  1AOI A;  4YM6 B;  1M18 B;  4J8X A;  1EQZ A;  2F8N K;  1WWI A;  4R8P D;  4X23 C;  5BO0 B;  1P34 A;  3X1U A;  2Y2K A;  1KX4 C;  3TU4 B;  5JRG D;  5B2J D;  3AZJ A;  1KX5 D;  1N1J B;  5B0Y B;  3AFA B;  3B6F C;  4M6B A;  3UTA A;  3AZE B;  5AVC B;  3AFA C;  1KX5 A;  3B6F B;  5B31 B;  3KWQ C;  3EPH A;  3KUY A;  1F66 C;  3TU4 A;  2NQB A;  3AZL B;  1P3F C;  3UT9 C;  4KGC B;  3AZI B;  2NZD A;  4XZQ A;  3W98 D;  2FJ7 C;  1P3P A;  3REH B;  4J8X B;  1F1E A;  4G92 C;  5B31 G;  3B6G A;  1S32 A;  3KXB A;  5AV9 B;  2JSS A;  2PYO B;  3WTP C;  3MGQ C;  5CPK A;  5GT0 A;  4XUJ A;  1AOI C;  2JCH A;  3C1C A;  4H9O B;  5G49 A;  3A6N A;  1Q9C A;  5B1M D;  3REJ B;  4X23 D;  3B0D B;  4KGC D;  3O62 B;  3WAA B;  1N1J A;  5B0Y A;  1P3K A;  4H9Q B;  5B31 D;  4WU8 A;  2ZY2 A;  4LD9 B;  3AYW D;  5C3I B;  3LJA C;  3KWQ A;  3X1U D;  1P3F D;  3LJA B;  2YFV A;  3AYW C;  1M18 A;  3MGR A;  3AZJ B;  3REL D;  3AZN B;  3REL A;  4KHA A;  1P3P C;  3REI D;  1EQZ B;  4Z2M H;  5CPI A;  4Z66 B;  4Z66 A;  3KXB C;  3AZF B;  3REI C;  5KDM A;  3W96 C;  4YS3 D;  3F6T A;  2FFF B;  3WKJ B;  5GT3 D;  3AZM D;  3AZF C;  4J8V D;  3X1T D;  5FUG A;  4R8P A;  1P3B C;  3MGQ D;  3AV2 C;  1M1A A;  1P3L D;  4H9P A;  1HQ3 A;  2G5H C;  1ID3 D;  3AZI C;  1W2E A;  3WTP E;  4KHA B;  3W99 A;  1P3A A;  3X1V D;  4LD9 A;  4J8W D;  4H9N A;  3MVD A;  5AY8 D;  2XD1 A;  5B0Z B;  3KUY B;  4CAY B;  3MGR B;  1PZR A;  4QLC B;  1M19 A;  5B32 G;  1P34 C;  5BNV B;  1M19 D;  4XZQ D;  3MGR C;  1M18 C;  5AVC D;  3NQU B;  3AZJ C;  1P3P D;  3AFA D;  4H9N B;  3MVD B;  5AV5 A;  4NE5 A;  1P3I B;  4DRB A;  3X1S A;  3TU4 D;  3W99 B;  5AV8 B;  4EO5 C;  1F66 A;  3EPL A;  4KUD C;  5BS7 A;  1HQ3 B;  5AV9 A;  4AWL B;  3UT9 A;  5GT3 A;  3AZM A;  4ZUX A;  4KUD B;  4J8V C;  3LEL D;  5FUG B;  4YM6 D;  4ZUX D;  3C1C B;  3R45 B;  4G91 B;  2IO5 C;  4UUZ A;  3C1B A;  5CPI D;  5GT0 B;  1JFI A;  5GSU D;  3AZG A;  5GT0 C;  5E5A C;  3B0B A;  1P3P B;  3VH5 T;  5BNX A;  3AZN A;  1ZLA A;  5AV6 D;  4G92 B;  3AZK B;  3MGR D;  1P3A D;  1P3K C;  4J8W A;  3UTA B;  1P3M B;  5CPJ D;  5AV5 C;  1P3M C;  5B2I D;  1P3L B;  3MGS A;  1ZLA B;  5DNM C;  3X1S D;  2ZY3 A;  3UTB B;  4J8V A;  5DNM D;  5DNM B;  3H0M C;  3WA9 B;  5F99 C;  2HUE C;  5GT0 D;  1HTA A;  2DF4 C;  4YM6 C;  3W98 A;  4ZUX B;  3AZN D;  4CSR B;  3LEL B;  2Y2O A;  3AZN C;  5GSU C;  1HQ3 D;  2Y2Q A;  4H9S A;  4NFT A;  4Z5T D;  3AV2 A;  3MNN B;  1HQ3 C;  1R4V A;  1TZY B;  5AV6 B;  1TZY C;  3REK B;  3X1V C;  5AV6 C;  5B31 C;  3AZE A;  1M19 B;  1TZY D;  1KU5 A;  4QLC D;  2Y2I A;  1BH9 B;  3MNN D;  1M19 C;  1JFI B;  3UTB C;  2UWX A;  5E5A B;  5B2I C;  4WZS B;  5B24 B;  4YS3 C;  1H3O B;  4XUJ D;  2CWE A;  4KUD D;  3FDD A;  3MGQ B;  4KUD A;  5AV9 C;  3B6G D;  5B24 A;  4ZUX C;  3AZH D;  2Y2N A;  5F99 D;  1P3I D;  3KSY A;  4Z5T C;  3AZF D;  3AZH C;  5B33 A;  3H0L C;  4EO5 B;  5GSU A;  3AZG D;  5AY8 C;  1U35 A;  2F8N B;  1P3B D;  1KX4 B;  3KUY D;  5B1L A;  5AY8 B;  3AZE D;  3X1T A;  1ID3 C;  1TZY A;  5B2J A;  5AVC C;  5JRG A;  3AZJ D;  3AZE C;  1KX3 A;  1ID3 B;  3W97 A;  3LJA D;  1P3F B;  4H9P B;  3AYW B;  4WU8 B;  5CPJ C;  4XZQ C;  1M18 D;  3LZ1 C;  3WKJ D;  1U35 B;  3B6G C;  5GSU B;  1Z2C B;  3VH5 W;  3WTP B;  4DRA A;  4X23 B;  3WTP A;  1T3U A;  5DNM A;  2PYO C;  3W96 B;  4XUJ C;  3B0C T;  2VQR A;  1P3O B;  3AL0 C;  4WU8 D;  5AV9 D;  3A1I A;  2Y2J A;  5B33 C;  3NQJ B;  5B1M A;  3B0C W;  5B1L D;  2HIO A;  3AZL C;  5AV8 D;  1BH8 A;  4WV4 B;  5B1L C;  1KX3 B;  3AZI D;  1KX3 C;  5B0Z C;  1KX4 D;  3WAA D;  2F8N D;  1KX4 A;  2Y2P A;  3KFU G;  3B6F D;  4E45 A;  5AV6 A;  3AZH B;  1P3O A;  1P3G A;  3TU4 C;  2NQB C;  4Z2M G;  3C1B D;  5JA4 A;  5AVB A;  2NQB D;  3WKJ C;  5AVB B;  4J8V B;  3MGP A;  3REH D;  2F8N G;  4WNN A;  2ARO A;  3MGP D;  2ARO B;  2F8N H;  1P3B A;  3WTP D;  3MGS B;  2IO5 B;  4WJ3 C;  4KGC A;  1AOI D;  3AZL A;  2FJ7 B;  2RVQ C;  2L5A A;  2XD5 A;  1P3G B;  2RVQ D;  3AFA A;  1KX5 C;  2DQN C;  3V9R B;  3AZK A;  5AY8 A;  3LZ0 A;  3X1U B;  1BH8 B;  2NZD C;  2F2A C;  1ID3 A;  2Y2L A;  2BG1 A;  5GXQ B;  1P3K D;  4ZBJ B;  3AV1 D;  1P3B B;  3REJ C;  3O62 D;  3MGS D;  4AWL C;  4WNN B;  3REJ D;  3LZ1 D;  2ARO D;  5AVB C;  3A6N D;  5F99 B;  3UTB D;  1H3O A;  3WA9 C;  3C1C C;  3C1B C;  3KXB D;  1F66 B;  1ZLA D;  3AZG C;  4UUZ B;  3C1B B;  4HGA C;  3REI A;  4J8X D;  5CPJ B;  4WU8 C;  3LZ1 B;  2LY8 A;  1EQZ C;  3AZL D;  3P5J B;  2HIO C;  4J8W C;  3NQU A;  3IP4 C;  4JJN C;  2J8P A;  3UTA C;  3REL C;  1P34 D;  4CSR A;  3MGS C;  5B33 B;  3V9R A;  3REJ A;  5B40 D;  4H9R B;  3AV2 B;  1P3G D;  3C1C D;  1P3O D;  5F99 A;  3W96 D;  1S32 D;  1M1A B;  5CPK D;  5DNN D;  3W99 D;  3WA9 D;  4J8U B;  3WKJ A;  5AV8 C;  4WU9 D; 
#chains in the Genus database with same CATH homology
 3MGP C;  3MVD D;  3X1S B;  3W99 C;  5AV5 B;  5GXQ A;  2NQB B;  1P3I C;  1B6W A;  2HIO D;  3MVD C;  3VH6 T;  4NE6 A;  3WAA C;  4QLC A;  5B0Y C;  1TAF B;  3X1V B;  3UTA D;  3VH6 W;  4H9Q A;  1P3A B;  2CV5 D;  5B40 C;  2W8S A;  5CHL B;  3UT9 D;  3KWQ B;  3LZ0 C;  3LZ0 B;  3AZG B;  4H9O A;  3X1T B;  5AV5 D;  5CP6 A;  5BNX B;  5CP6 D;  3EPK A;  3REH C;  3A1K A;  3AN2 B;  2Y2M A;  3B6G B;  5CPI C;  3REI B;  4Z66 C;  5CPI B;  2Y2H A;  5BT1 D;  4XUJ B;  3W96 A;  5AV8 A;  3R45 A;  3REL B;  5E5A D;  1A7W A;  4JJN B;  5GXQ C;  1P3L A;  1ZLA C;  5DNN C;  4R8P C;  3AN2 A;  5B33 D;  5JA4 B;  1BFM A;  1U35 D;  3H0R C;  3AN2 D;  5CP6 B;  3EPJ A;  2CV5 C;  5C3I C;  1P3A C;  4LD9 C;  3LZ0 D;  4H9S C;  1P3M A;  2ZY5 A;  3AV1 C;  2G5I C;  5B0Z D;  3NQJ A;  3EG5 B;  2YFW A;  5B1M B;  1TAF A;  3X1V A;  4JJN D;  4JJN A;  3MNN C;  3X1S C;  5BT1 C;  5BS7 C;  2HIO B;  3KXB B;  2PYO A;  3LEL A;  5GT3 C;  5B32 B;  4J8U A;  4YM6 A;  3REK A;  3UTB A;  5GT3 B;  5B32 C;  3AZM C;  3AZM B;  3W98 B;  3W98 C;  4J8U D;  3REK D;  5B32 D;  1P3L C;  4Z66 D;  1EQZ D;  4X23 A;  5B24 C;  3UT9 B;  5B2I B;  5E5A A;  2CV5 B;  5GXQ D;  5B24 D;  1KX5 B;  3B6F A;  2JE5 A;  5JRG B;  5B2J B;  2ZM5 A;  3AZH A;  1P3I A;  5B0Z A;  3VH6 A;  1U35 C;  3KUY C;  3WAA A;  5BO0 A;  1P34 B;  5BNV A;  3AZK D;  1P3F A;  2F8N A;  4QLC C;  4LD9 D;  2BYK A;  4ZBJ C;  2NZD D;  1P3O C;  5G49 B;  3MNN A;  2BYM A;  1AOI B;  5B40 A;  2FJ7 D;  1S32 C;  2ZY4 A;  5DNN B;  4DQY B;  2Y2G A;  4Z5T B;  5CPK B;  3MGQ A;  5CPK C;  3O62 C;  5CPJ A;  1S32 B;  1M1A D;  5KDM B;  5CP6 C;  5B32 A;  2ARO C;  5AVB D;  4WU9 C;  3REH A;  3A6N C;  2HUE B;  2RIQ A;  4Z5T A;  3AV2 D;  2PYO D;  4G91 C;  5B40 B;  4KGC C;  4HGA B;  1BH9 A;  4H9R A;  2BYK B;  2YFW B;  3X1T C;  4J8X C;  5JRG C;  5B2J C;  5AVC A;  3LJA A;  3W97 D;  4XZQ B;  5DNN A;  3AZK C;  3AN2 C;  3AYW A;  3KWQ D;  3X1U C;  3W97 C;  3W97 B;  1P3K B;  2YFV B;  4J8W B;  5B0Y D;  2CV5 A;  1P3M D;  1KX3 D;  5B31 A;  3LZ1 A;  4CAY A;  4UPK A;  4R8P B;  1B67 A;  3B0D C;  5B1L B;  3AV1 A;  1F66 D;  3O62 A;  2FJ7 A;  5B2I A;  3AZF A;  3WA9 A;  4WU9 B;  4YS3 A;  1P3G C;  3A6N B;  4WU9 A;  4YS3 B;  4E44 A;  5B1M C;  1M1A C;  1ULY A;  1WWS A;  3MGP B;  3LEL C;  4NE3 A;  3AV1 B;  3VH5 A;  4J8U C;  3REK C;  3AZI A;  2NZD B;  2BYM B;  1AOI A;  4YM6 B;  1M18 B;  4J8X A;  1EQZ A;  2F8N K;  1WWI A;  4R8P D;  4X23 C;  5BO0 B;  1P34 A;  3X1U A;  2Y2K A;  1KX4 C;  3TU4 B;  5JRG D;  5B2J D;  3AZJ A;  1KX5 D;  1N1J B;  5B0Y B;  3AFA B;  3B6F C;  4M6B A;  3UTA A;  3AZE B;  5AVC B;  3AFA C;  1KX5 A;  3B6F B;  5B31 B;  3KWQ C;  3EPH A;  3KUY A;  1F66 C;  3TU4 A;  2NQB A;  3AZL B;  1P3F C;  3UT9 C;  4KGC B;  3AZI B;  2NZD A;  4XZQ A;  3W98 D;  2FJ7 C;  1P3P A;  3REH B;  4J8X B;  1F1E A;  4G92 C;  5B31 G;  3B6G A;  1S32 A;  3KXB A;  5AV9 B;  2JSS A;  2PYO B;  3WTP C;  3MGQ C;  5CPK A;  5GT0 A;  4XUJ A;  1AOI C;  2JCH A;  3C1C A;  4H9O B;  5G49 A;  3A6N A;  1Q9C A;  5B1M D;  3REJ B;  4X23 D;  3B0D B;  4KGC D;  3O62 B;  3WAA B;  1N1J A;  5B0Y A;  1P3K A;  4H9Q B;  5B31 D;  4WU8 A;  2ZY2 A;  4LD9 B;  3AYW D;  5C3I B;  3LJA C;  3KWQ A;  3X1U D;  1P3F D;  3LJA B;  2YFV A;  3AYW C;  1M18 A;  3MGR A;  3AZJ B;  3REL D;  3AZN B;  3REL A;  4KHA A;  1P3P C;  3REI D;  1EQZ B;  4Z2M H;  5CPI A;  4Z66 B;  4Z66 A;  3KXB C;  3AZF B;  3REI C;  5KDM A;  3W96 C;  4YS3 D;  3F6T A;  2FFF B;  3WKJ B;  5GT3 D;  3AZM D;  3AZF C;  4J8V D;  3X1T D;  5FUG A;  4R8P A;  1P3B C;  3MGQ D;  3AV2 C;  1M1A A;  1P3L D;  4H9P A;  1HQ3 A;  2G5H C;  1ID3 D;  3AZI C;  1W2E A;  3WTP E;  4KHA B;  3W99 A;  1P3A A;  3X1V D;  4LD9 A;  4J8W D;  4H9N A;  3MVD A;  5AY8 D;  2XD1 A;  5B0Z B;  3KUY B;  4CAY B;  3MGR B;  1PZR A;  4QLC B;  1M19 A;  5B32 G;  1P34 C;  5BNV B;  1M19 D;  4XZQ D;  3MGR C;  1M18 C;  5AVC D;  3NQU B;  3AZJ C;  1P3P D;  3AFA D;  4H9N B;  3MVD B;  5AV5 A;  4NE5 A;  1P3I B;  4DRB A;  3X1S A;  3TU4 D;  3W99 B;  5AV8 B;  4EO5 C;  1F66 A;  3EPL A;  4KUD C;  5BS7 A;  1HQ3 B;  5AV9 A;  4AWL B;  3UT9 A;  5GT3 A;  3AZM A;  4ZUX A;  4KUD B;  4J8V C;  3LEL D;  5FUG B;  4YM6 D;  4ZUX D;  3C1C B;  3R45 B;  4G91 B;  2IO5 C;  4UUZ A;  3C1B A;  5CPI D;  5GT0 B;  1JFI A;  5GSU D;  3AZG A;  5GT0 C;  5E5A C;  3B0B A;  1P3P B;  3VH5 T;  5BNX A;  3AZN A;  1ZLA A;  5AV6 D;  4G92 B;  3AZK B;  3MGR D;  1P3A D;  1P3K C;  4J8W A;  3UTA B;  1P3M B;  5CPJ D;  5AV5 C;  1P3M C;  5B2I D;  1P3L B;  3MGS A;  1ZLA B;  5DNM C;  3X1S D;  2ZY3 A;  3UTB B;  4J8V A;  5DNM D;  5DNM B;  3H0M C;  3WA9 B;  5F99 C;  2HUE C;  5GT0 D;  1HTA A;  2DF4 C;  4YM6 C;  3W98 A;  4ZUX B;  3AZN D;  4CSR B;  3LEL B;  2Y2O A;  3AZN C;  5GSU C;  1HQ3 D;  2Y2Q A;  4H9S A;  4NFT A;  4Z5T D;  3AV2 A;  3MNN B;  1HQ3 C;  1R4V A;  1TZY B;  5AV6 B;  1TZY C;  3REK B;  3X1V C;  5AV6 C;  5B31 C;  3AZE A;  1M19 B;  1TZY D;  1KU5 A;  4QLC D;  2Y2I A;  1BH9 B;  3MNN D;  1M19 C;  1JFI B;  3UTB C;  2UWX A;  5E5A B;  5B2I C;  4WZS B;  5B24 B;  4YS3 C;  1H3O B;  4XUJ D;  2CWE A;  4KUD D;  3FDD A;  3MGQ B;  4KUD A;  5AV9 C;  3B6G D;  5B24 A;  4ZUX C;  3AZH D;  2Y2N A;  5F99 D;  1P3I D;  3KSY A;  4Z5T C;  3AZF D;  3AZH C;  5B33 A;  3H0L C;  4EO5 B;  5GSU A;  3AZG D;  5AY8 C;  1U35 A;  2F8N B;  1P3B D;  1KX4 B;  3KUY D;  5B1L A;  5AY8 B;  3AZE D;  3X1T A;  1ID3 C;  1TZY A;  5B2J A;  5AVC C;  5JRG A;  3AZJ D;  3AZE C;  1KX3 A;  1ID3 B;  3W97 A;  3LJA D;  1P3F B;  4H9P B;  3AYW B;  4WU8 B;  5CPJ C;  4XZQ C;  1M18 D;  3LZ1 C;  3WKJ D;  1U35 B;  3B6G C;  5GSU B;  1Z2C B;  3VH5 W;  3WTP B;  4DRA A;  4X23 B;  3WTP A;  1T3U A;  5DNM A;  2PYO C;  3W96 B;  4XUJ C;  3B0C T;  2VQR A;  1P3O B;  3AL0 C;  4WU8 D;  5AV9 D;  3A1I A;  2Y2J A;  5B33 C;  3NQJ B;  5B1M A;  3B0C W;  5B1L D;  2HIO A;  3AZL C;  5AV8 D;  1BH8 A;  4WV4 B;  5B1L C;  1KX3 B;  3AZI D;  1KX3 C;  5B0Z C;  1KX4 D;  3WAA D;  2F8N D;  1KX4 A;  2Y2P A;  3KFU G;  3B6F D;  4E45 A;  5AV6 A;  3AZH B;  1P3O A;  1P3G A;  3TU4 C;  2NQB C;  4Z2M G;  3C1B D;  5JA4 A;  5AVB A;  2NQB D;  3WKJ C;  5AVB B;  4J8V B;  3MGP A;  3REH D;  2F8N G;  4WNN A;  2ARO A;  3MGP D;  2ARO B;  2F8N H;  1P3B A;  3WTP D;  3MGS B;  2IO5 B;  4WJ3 C;  4KGC A;  1AOI D;  3AZL A;  2FJ7 B;  2RVQ C;  2L5A A;  2XD5 A;  1P3G B;  2RVQ D;  3AFA A;  1KX5 C;  2DQN C;  3V9R B;  3AZK A;  5AY8 A;  3LZ0 A;  3X1U B;  1BH8 B;  2NZD C;  2F2A C;  1ID3 A;  2Y2L A;  2BG1 A;  5GXQ B;  1P3K D;  4ZBJ B;  3AV1 D;  1P3B B;  3REJ C;  3O62 D;  3MGS D;  4AWL C;  4WNN B;  3REJ D;  3LZ1 D;  2ARO D;  5AVB C;  3A6N D;  5F99 B;  3UTB D;  1H3O A;  3WA9 C;  3C1C C;  3C1B C;  3KXB D;  1F66 B;  1ZLA D;  3AZG C;  4UUZ B;  3C1B B;  4HGA C;  3REI A;  4J8X D;  5CPJ B;  4WU8 C;  3LZ1 B;  2LY8 A;  1EQZ C;  3AZL D;  3P5J B;  2HIO C;  4J8W C;  3NQU A;  3IP4 C;  4JJN C;  2J8P A;  3UTA C;  3REL C;  1P34 D;  4CSR A;  3MGS C;  5B33 B;  3V9R A;  3REJ A;  5B40 D;  4H9R B;  3AV2 B;  1P3G D;  3C1C D;  1P3O D;  5F99 A;  3W96 D;  1S32 D;  1M1A B;  5CPK D;  5DNN D;  3W99 D;  3WA9 D;  4J8U B;  3WKJ A;  5AV8 C;  4WU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...