5GXQA

The crystal structure of the nucleosome containing h3.6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAHSIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqA00
5C3IB 3O62A 1S32B 2AROD 3LZ0D 3MGRA 3AV1B 3AZMD 5B1MA 5B2IA 4AWLC 3C1BD 3UTAD 5AV8A 3AZNB 2HIOC 5B32B 5AY8B 5AV6D 3WTPE 3KXBC 4XZQD 3REHD 5GT3A 3LELC 1HQ3D 5B40B 1H3OA 3REKA 3UTBA 1P3GC 2FJ7B 5AVCD 2CV5B 4J8XC 3W98A 4WU8A 4KGCD 3MGSC 3C1CD 1P34D 5AV5A 3B6GC 1N1JA 4X23D 5F99D 1P3BB 5CPKA 3MGPD 4KUDB 2JSSA 4H9OA 4G91B 4Z5TD 3LZ0A 3AZMB 4JJND 3C1BA 1EQZB 3AZHA 1BH8A 3O62C 3REHA 3KUYB 4CSRA 3MGRC 5CHLB 5CPJA 5B1MC 5B2IC 1P34A 3C1CB 5AV9D 3X1TD 5AV8C 3B0DC 3REKC 3UTBC 5GT3C 3MGPB 3MNNC 3WA9B 1B6WA 4Z5TA 3W98C 4HGAB 5B31G 4WU8C 2BYKA 1ID3A 2NQBD 5AV5C 5BNVB 4YS3D 3AZEA 4Z66D 1P3LD 3V9RB 3LZ0C 3B6FB 1P3AD 1F66D 1M18D 5BT1D 3C1BC 1KX4A 2PYOD 5AV9A 3X1TA 3UTAC 1P3IB 3AZKD 4J8VB 4E44A 3UT9D 3REHC 1HQ3C 3R45A 5KDMA 5B31A 5CPJC 3A6ND 4CAYA 4KGCC 3WTPD 4R8PD 1P34C 3WKJB 1WWIA 4YS3A 4X23C 4Z66A 3AV2D 1P3LA 1KX5B 3REJD 5DNMB 1JFIA 3AZGA 4Z5TC 2F8ND 5B1LB 5BO0A 1ID3C 5B24D 1P3AA 1F66A 4JJNC 3VH5T 2RVQD 2PYOB 3AZEC 3AZKA 3UT9A 4H9RB 3REID 3MVDD 3MGQD 1KX4C 4R8PA 4YM6D 5AV9C 3X1TC 4UUZA 1TAFA 2HIOD 3W99A 3AV2A 1TZYB 3LELD 4H9PB 3AZLB 4J8WB 5CPIB 3KWQA 5DNND 3AZIA 2F8NA 4J8XD 2IO5B 5B24A 3LZ1B 4YS3C 5B2JD 4Z66C 1P3LC 2HUEC 3REIA 3AZFA 3X1VA 1P3AC 1F66C 1M18C 5BT1C 4AWLB 4YM6A 5JA4A 5JRGA 3AFAA 3AZKC 2HIOB 3UT9C 3KXBB 1BH9A 3AN2D 1P3GB 3W96A 3W97A 3LELB 3VH6A 5DNNA 3MGRD 3A6NC 4R8PC 5B2ID 3VH6T 3MGSB 4EO5C 3B6GB 3W99C 3AV2C 5GT0D 3REJC 3KWQC 3X1SD 5B24C 4WU8D 5AVBD 4NE6A 2RVQC 4WU9D 1R4VA 3O62B 5GSUD 3LJAB 3AN2A 5CPKD 3REIC 3MVDC 3MGQC 3AZFC 5CP6A 3X1VC 5BNXA 3MGRB 4J8UA 5B1MB 5B2IB 4YM6C 3NQUA 3AYWD 5AV8B 3AFAC 3B0DB 3AZHD 1P3FA 1HTAA 3TU4A 5GT0A 3REKB 3UTBB 5GT3B 3W96C 5B32G 1M1AD 3MNNB 5DNNC 4NE5A 5CPJD 3W98B 3X1SA 2YFVB 5AVBA 5AV5B 3RELB 4WU9A 5B2JC 1N1JB 4NFTA 5GSUA 2AROB 2YFWB 4H9OB 3LZ0B 1ID3D 4KHAA 3AYWA 3AV1A 3C1BB 3VH5W 3UTAB 3AZED 4XUJD 1BH8B 5AV6B 3REHB 1Q9CA 5AY8A 4XZQB 5B32A 1HQ3B 3AN2C 1M1AA 4CSRB 5B40A 5AVCB 5CP6C 2FJ7A 4KGCB 4NE3A 1KX4D 1P34B 4X23B 5GT0C 5F99B 2LY8A 4Z5TB 5B31D 3X1SC 5AVBC 4JJNB 1P3PD 4WU9C 4XUJA 1BFMA 3B0BA 1EQZA 5C3IC 4Z2MG 5GSUC 5CPKC 1WWSA 3KUYA 1KU5A 3AZGD 4LD9D 3AZJD 3AYWC 1KX4B 5B0YD 5FUGA 5AV9B 3X1TB 3X1UA 4H9QA 3AZHC 5GXQD 1M1AC 1P3KA 3R45B 2FJ7C 4CAYB 2NQBB 1P3PA 4YS3B 3W99D 4Z66B 1P3LB 2HUEB 4ZUXD 1JFIB 1AOIA 4LD9A 3KWQD 3AZID 3AZJA 4Z2MH 1P3AB 1F66B 1M18B 5B0YA 1P3MD 4XUJC 1M19D 3AZKB 1P3IA 5GXQA 5E5AD 3UT9B 4J8VA 3AZFD 4DRAA 3A6NB 3X1VD 3WTPB 4R8PB 3X1UC 1A7WA 5JRGD 3AFAD 4UUZB 4EO5B 3AV2B 4ZUXA 3W97D 3W96D 3REJB 1P3KC 5B31C 2F8NB 5B24B 4HGAC 4DRBA 5B1LA 4WNNA 1P3PC 1P3MA 5B0ZD 1M19A 4H9NB 5E5AA 3NQJB 3REIB 4H9RA 4WZSB 3WAAD 3AZGC 1AOIC 4LD9C 3MVDB 3MGQB 3AZFB 3AZJC 5B0YC 4YM6B 5JA4B 5GXQC 3B0CT 1U35D 4J8VC 3W96B 4H9PA 5DNNB 5CP6D 3AZLA 4J8XB 4J8UD 3LZ1A 5B0ZA 5B2JB 1P3FD 3TU4D 1KX3D 4ZUXC 4ZBJC 3WAAA 5G49A 4G92C 3AZIC 2BYMA 5B1LC 1ZLAD 1P3MC 1M19C 2NZDA 5E5AC 1U35A 3AN2B 5BS7A 3KXBA 1P3GA 1S32D 3NQUB 3AV1D 5JRGC 1P3OA 1KX3A 5B33A 3AZND 5GT0B 5AY8D 5B32D 2CWEA 3W97C 1H3OB 5B40D 3AZLC 2FJ7D 3X1SB 4WU8B 2CV5D 5AVBB 2IO5C 1ZLAA 3LZ1C 4QLCA 5B0ZC 4WU9B 5GSUB 1P3BD 5CPKB 3WAAC 3LJAA 1S32A 4KUDD 4KHAB 3AYWB 2NZDC 3AZHB 1EQZD 3AZNA 1U35C 5BS7C 1M1AB 3KUYD 3MNNA 5CPJB 4J8UC 2L5AA 2CV5A 2F8NK 2YFVA 3X1UD 1P3OC 1P3FC 3RELA 5B33C 3TU4C 1KX3C 1P3BA 1P3KD 4KUDA 2AROA 3WA9D 2YFWA 2BYKB 1ID3B 1ULYA 1ZLAC 3AZMA 4QLCC 3AZEB 4XUJB 3UTAA 4WV4B 5AV6A 1B67A 4XZQA 3LJAC 1HQ3A 3KSYA 1S32C 1AOID 5AVCA 3B6FD 3AV1C 5FUGB 4KGCA 3X1UB 4H9QB 3C1CA 1P3ID 3AZNC 5AY8C 5B32C 4J8VD 4X23A 3B0CW 5F99A 5B40C 1P3KB 5KDMB 3MGPA 3WA9A 5B31B 2CV5C 4JJNA 3VH6W 1P3PB 3WKJD 5BNVA 3RELC 1P3BC 4E45A 1KX5D 3AZGB 3V9RA 2AROC 1AOIB 4KUDC 5DNMD 4LD9B 5BO0B 3AZJB 4G91C 5B1LD 5B0YB 3B6FA 3AZMC 5GXQB 1EQZC 5AV6C 4XZQC 3KUYC 5AVCC 3C1CC 2NQBA 3WKJA 1TAFB 3W99B 4ZUXB 5F99C 4ZBJB 1TZYD 4H9SA 1KX5A 3MGPC 4G92B 3KWQB 3AZIB 5DNMA 4J8WD 3VH5A 3AZLD 5CPID 3WA9C 4WNNB 2F8NG 1P3MB 1M18A 3LZ1D 2PYOA 1M19B 5E5AB 3X1VB 3B6FC 3A6NA 3WTPA 5JRGB 1F1EA 3AFAB 1P3IC 2NZDD 1BH9B 3W97B 3KXBD 1TZYA 1P3GD 3REJA 4J8WA 5CPIA 2NQBC 3MGSD 1P3OD 3WKJC 5B0ZB 5B33D 3B6GD 4H9NA 2F8NH 4H9SC 1KX5C 3WAAB 3NQJA 5G49B 5DNMC 2BYMB 3MVDA 3MGQA 4QLCD 2PYOC 2NZDB 1U35B 2HIOA 3O62D 3LJAD 3LELA 5CP6B 5BNXB 4J8UB 4J8XA 5B1MD 3WTPC 3MGSA 1P3OB 1P3FB 5AV8D 5B33B 3TU4B 1KX3B 5B2JA 3B6GA 4M6BA 1TZYC 3REKD 5GT3D 3UTBD 3MNND 4J8WC 5CPIC 3W98D 1ZLAB 5AV5D 4QLCB 3RELD
chains in the Genus database with same CATH superfamily
5C3IB 3O62A 1S32B 2AROD 3LZ0D 3MGRA 3AV1B 3AZMD 5B1MA 5B2IA 4AWLC 3C1BD 3UTAD 5AV8A 3AZNB 2HIOC 5B32B 5AY8B 5AV6D 3WTPE 3KXBC 4XZQD 3REHD 5GT3A 3LELC 1HQ3D 5B40B 1H3OA 3REKA 3UTBA 1P3GC 2Y2KA 2FJ7B 5AVCD 2CV5B 4J8XC 3W98A 4WU8A 4KGCD 3MGSC 3C1CD 1P34D 5AV5A 3B6GC 1N1JA 4X23D 5F99D 1P3BB 5CPKA 3MGPD 4KUDB 2JSSA 4H9OA 4G91B 4Z5TD 3LZ0A 3AZMB 4JJND 1Z2CB 3C1BA 1EQZB 3AZHA 1BH8A 3O62C 3REHA 3KUYB 3EG5B 3EPLA 4CSRA 3MGRC 5CHLB 5CPJA 5B1MC 5B2IC 1P34A 3C1CB 5AV9D 3X1TD 5AV8C 3B0DC 3EPHA 3REKC 3UTBC 5GT3C 3MGPB 2Y2IA 3MNNC 3WA9B 1B6WA 4Z5TA 3W98C 4HGAB 5B31G 4WU8C 2BYKA 1ID3A 1W2EA 2NQBD 5AV5C 5BNVB 4YS3D 3AZEA 4Z66D 1P3LD 3V9RB 3LZ0C 3B6FB 1P3AD 1F66D 1M18D 5BT1D 3C1BC 1KX4A 2PYOD 5AV9A 3X1TA 3UTAC 1P3IB 3AZKD 4J8VB 4E44A 3UT9D 3REHC 1HQ3C 3R45A 5KDMA 5B31A 5CPJC 3A6ND 4CAYA 4KGCC 3WTPD 4R8PD 1P34C 3WKJB 1WWIA 4YS3A 2Y2PA 4X23C 4Z66A 3AV2D 1P3LA 1KX5B 3REJD 5DNMB 1JFIA 3AZGA 4Z5TC 2F8ND 5B1LB 5BO0A 1ID3C 5B24D 2UWXA 1P3AA 4JJNC 1F66A 3VH5T 2RVQD 2PYOB 3AZEC 3AZKA 3UT9A 4H9RB 3REID 3MVDD 3MGQD 2ZY4A 1KX4C 4R8PA 4YM6D 5AV9C 3X1TC 4UUZA 1TAFA 2HIOD 2ZY2A 3W99A 3AV2A 1TZYB 3LELD 4H9PB 3AZLB 4J8WB 5CPIB 3KWQA 5DNND 3AZIA 2F8NA 4J8XD 2IO5B 5B24A 3LZ1B 4YS3C 2F2AC 5B2JD 4Z66C 1P3LC 2HUEC 3REIA 3AL0C 3AZFA 3X1VA 1P3AC 1F66C 1M18C 5BT1C 4AWLB 4YM6A 2JCHA 5JA4A 5JRGA 3AFAA 2ZY3A 3AZKC 2HIOB 3UT9C 3KXBB 1BH9A 3AN2D 1P3GB 3W96A 3W97A 3LELB 3VH6A 5DNNA 3MGRD 3A6NC 4R8PC 5B2ID 3VH6T 3MGSB 4EO5C 3A1KA 3B6GB 3W99C 3AV2C 5GT0D 3REJC 3KWQC 3X1SD 5B24C 4WU8D 5AVBD 4NE6A 2RVQC 4WU9D 1R4VA 3O62B 5GSUD 3LJAB 3AN2A 5CPKD 3P5JB 3REIC 1T3UA 3MVDC 3MGQC 3AZFC 5CP6A 3X1VC 5BNXA 3MGRB 4J8UA 5B1MB 1PZRA 5B2IB 3NQUA 4YM6C 3AYWD 5AV8B 3AFAC 3B0DB 3AZHD 1P3FA 1HTAA 3TU4A 5GT0A 3REKB 3UTBB 5GT3B 3W96C 5B32G 1M1AD 2XD1A 3MNNB 5DNNC 4NE5A 5CPJD 2FFFB 3X1SA 3W98B 2YFVB 5AVBA 5AV5B 3RELB 3EPKA 4WU9A 5B2JC 1N1JB 4NFTA 5GSUA 2AROB 2YFWB 4H9OB 3LZ0B 3A1IA 1ID3D 4KHAA 3AYWA 3AV1A 3C1BB 3VH5W 3UTAB 3AZED 4XUJD 1BH8B 5AV6B 3REHB 1Q9CA 2Y2JA 5AY8A 4XZQB 1HQ3B 5B32A 3AN2C 2VQRA 1M1AA 4CSRB 5B40A 5AVCB 5CP6C 2FJ7A 4KGCB 4NE3A 1KX4D 1P34B 4X23B 5GT0C 5F99B 2LY8A 4Z5TB 5B31D 3X1SC 5AVBC 4JJNB 2ZY5A 1P3PD 4WU9C 4XUJA 1BFMA 3B0BA 1EQZA 5C3IC 4Z2MG 5GSUC 5CPKC 1WWSA 3KUYA 1KU5A 3AZGD 4LD9D 3AZJD 3AYWC 1KX4B 5B0YD 5FUGA 5AV9B 3X1TB 3X1UA 4H9QA 3AZHC 5GXQD 1M1AC 2XD5A 1P3KA 3R45B 2FJ7C 4CAYB 2NQBB 1P3PA 4YS3B 3W99D 4Z66B 1P3LB 2HUEB 2W8SA 4ZUXD 1JFIB 1AOIA 4LD9A 3KWQD 3AZID 3AZJA 4Z2MH 1P3AB 1F66B 1M18B 5B0YA 1P3MD 4XUJC 1M19D 3AZKB 1P3IA 5GXQA 5E5AD 3UT9B 4J8VA 3AZFD 4DRAA 3A6NB 3X1VD 3WTPB 4R8PB 3X1UC 1A7WA 5JRGD 3AFAD 4UUZB 4EO5B 3AV2B 4ZUXA 3W97D 3W96D 3REJB 1P3KC 5B31C 2F8NB 5B24B 4HGAC 4DRBA 5B1LA 4WNNA 1P3PC 1P3MA 5B0ZD 1M19A 4H9NB 5E5AA 3NQJB 3REIB 4H9RA 4WZSB 3WAAD 4UPKA 3AZGC 1AOIC 3MVDB 3MGQB 3AZFB 4LD9C 3AZJC 5B0YC 4YM6B 2Y2QA 5JA4B 5GXQC 3B0CT 1U35D 4J8VC 3W96B 2Y2NA 4H9PA 5DNNB 5CP6D 3AZLA 4J8XB 4J8UD 3LZ1A 5B0ZA 5B2JB 1P3FD 3TU4D 1KX3D 4DQYB 4ZUXC 4ZBJC 3WAAA 5G49A 3H0RC 4G92C 3AZIC 2BYMA 5B1LC 1ZLAD 1P3MC 1M19C 2NZDA 5E5AC 1U35A 3AN2B 5BS7A 3KXBA 1P3GA 1S32D 3NQUB 3AV1D 3H0LC 5JRGC 1P3OA 1KX3A 5B33A 3AZND 5GT0B 5AY8D 5B32D 2CWEA 3W97C 1H3OB 5B40D 3AZLC 2FJ7D 3X1SB 4WU8B 2CV5D 5AVBB 2IO5C 1ZLAA 3FDDA 3LZ1C 4QLCA 5B0ZC 4WU9B 4WJ3C 5GSUB 1P3BD 5CPKB 3WAAC 3LJAA 1S32A 4KUDD 4KHAB 3AYWB 2NZDC 3AZHB 1EQZD 3AZNA 1U35C 5BS7C 2G5HC 1M1AB 3KUYD 3MNNA 5CPJB 4J8UC 2L5AA 2CV5A 2F8NK 2YFVA 3X1UD 1P3OC 1P3FC 3RELA 5B33C 3TU4C 1KX3C 1P3BA 1P3KD 4KUDA 2AROA 3WA9D 2YFWA 2BYKB 1ID3B 1ULYA 1ZLAC 3AZMA 4QLCC 3AZEB 4XUJB 3UTAA 4WV4B 5AV6A 1B67A 4XZQA 3LJAC 1HQ3A 3KSYA 1S32C 1AOID 5AVCA 3B6FD 3AV1C 5FUGB 4KGCA 3X1UB 2Y2LA 4H9QB 3C1CA 1P3ID 3AZNC 2Y2GA 5AY8C 5B32C 4J8VD 2ZM5A 3IP4C 4X23A 3B0CW 5F99A 2Y2HA 5B40C 1P3KB 5KDMB 3MGPA 3WA9A 5B31B 2CV5C 4JJNA 3VH6W 1P3PB 3WKJD 5BNVA 3RELC 1P3BC 4E45A 1KX5D 3AZGB 3V9RA 2AROC 1AOIB 4KUDC 5DNMD 4LD9B 5BO0B 3AZJB 4G91C 5B1LD 5B0YB 3B6FA 3AZMC 3EPJA 5GXQB 1EQZC 5AV6C 4XZQC 3KUYC 2DQNC 5AVCC 3C1CC 2NQBA 3WKJA 1TAFB 3W99B 4ZUXB 5F99C 4ZBJB 1TZYD 4H9SA 1KX5A 3MGPC 4G92B 3KWQB 3AZIB 5DNMA 4J8WD 3VH5A 3AZLD 5CPID 3WA9C 4WNNB 2F8NG 1P3MB 1M18A 3LZ1D 2PYOA 1M19B 5E5AB 2DF4C 2J8PA 2RIQA 3X1VB 3B6FC 3A6NA 3WTPA 5JRGB 1F1EA 3AFAB 1P3IC 2NZDD 1BH9B 3W97B 3KXBD 1TZYA 1P3GD 3REJA 4J8WA 5CPIA 2NQBC 3MGSD 1P3OD 3WKJC 5B0ZB 3F6TA 5B33D 3B6GD 4H9NA 2F8NH 4H9SC 1KX5C 3WAAB 3NQJA 5G49B 5DNMC 2BYMB 3MVDA 3MGQA 3H0MC 4QLCD 2PYOC 2NZDB 1U35B 2HIOA 2BG1A 3O62D 3LJAD 3LELA 5CP6B 5BNXB 4J8UB 4J8XA 5B1MD 3WTPC 3MGSA 2Y2MA 1P3OB 1P3FB 5AV8D 5B33B 3TU4B 1KX3B 2Y2OA 5B2JA 3B6GA 4M6BA 1TZYC 3REKD 5GT3D 3UTBD 3MNND 3KFUG 4J8WC 5CPIC 2G5IC 3W98D 2JE5A 1ZLAB 5AV5D 4QLCB 3RELD
chains in the Genus database with same CATH topology
5C3IB 3O62A 1S32B 2AROD 3LZ0D 3MGRA 3AV1B 3AZMD 5B1MA 5B2IA 4AWLC 3C1BD 3UTAD 5AV8A 3AZNB 2HIOC 5B32B 5AY8B 5AV6D 3WTPE 3KXBC 4XZQD 3REHD 5GT3A 3LELC 1HQ3D 5B40B 1H3OA 3REKA 3UTBA 1P3GC 2Y2KA 2FJ7B 5AVCD 2CV5B 4J8XC 3W98A 4WU8A 4KGCD 3MGSC 3C1CD 1P34D 5AV5A 3B6GC 1N1JA 4X23D 5F99D 1P3BB 5CPKA 3MGPD 4KUDB 2JSSA 4H9OA 4G91B 4Z5TD 3LZ0A 3AZMB 4JJND 1Z2CB 3C1BA 1EQZB 3AZHA 1BH8A 3O62C 3REHA 3KUYB 3EG5B 3EPLA 4CSRA 3MGRC 5CHLB 5CPJA 5B1MC 5B2IC 1P34A 3C1CB 5AV9D 3X1TD 5AV8C 3B0DC 3EPHA 3REKC 3UTBC 5GT3C 3MGPB 2Y2IA 3MNNC 3WA9B 1B6WA 4Z5TA 3W98C 4HGAB 5B31G 4WU8C 2BYKA 1ID3A 1W2EA 2NQBD 5AV5C 5BNVB 4YS3D 3AZEA 4Z66D 1P3LD 3V9RB 3LZ0C 3B6FB 1P3AD 1F66D 1M18D 5BT1D 3C1BC 1KX4A 2PYOD 5AV9A 3X1TA 3UTAC 1P3IB 3AZKD 4J8VB 4E44A 3UT9D 3REHC 1HQ3C 3R45A 5KDMA 5B31A 5CPJC 3A6ND 4CAYA 4KGCC 3WTPD 4R8PD 1P34C 3WKJB 1WWIA 4YS3A 2Y2PA 4X23C 4Z66A 3AV2D 1P3LA 1KX5B 3REJD 5DNMB 1JFIA 3AZGA 4Z5TC 2F8ND 5B1LB 5BO0A 1ID3C 5B24D 2UWXA 1P3AA 4JJNC 1F66A 3VH5T 2RVQD 2PYOB 3AZEC 3AZKA 3UT9A 4H9RB 3REID 3MVDD 3MGQD 2ZY4A 1KX4C 4R8PA 4YM6D 5AV9C 3X1TC 4UUZA 1TAFA 2HIOD 2ZY2A 3W99A 3AV2A 1TZYB 3LELD 4H9PB 3AZLB 4J8WB 5CPIB 3KWQA 5DNND 3AZIA 2F8NA 4J8XD 2IO5B 5B24A 3LZ1B 4YS3C 2F2AC 5B2JD 4Z66C 1P3LC 2HUEC 3REIA 3AL0C 3AZFA 3X1VA 1P3AC 1F66C 1M18C 5BT1C 4AWLB 4YM6A 2JCHA 5JA4A 5JRGA 3AFAA 2ZY3A 3AZKC 2HIOB 3UT9C 3KXBB 1BH9A 3AN2D 1P3GB 3W96A 3W97A 3LELB 3VH6A 5DNNA 3MGRD 3A6NC 4R8PC 5B2ID 3VH6T 3MGSB 4EO5C 3A1KA 3B6GB 3W99C 3AV2C 5GT0D 3REJC 3KWQC 3X1SD 5B24C 4WU8D 5AVBD 4NE6A 2RVQC 4WU9D 1R4VA 3O62B 5GSUD 3LJAB 3AN2A 5CPKD 3P5JB 3REIC 1T3UA 3MVDC 3MGQC 3AZFC 5CP6A 3X1VC 5BNXA 3MGRB 4J8UA 5B1MB 1PZRA 5B2IB 3NQUA 4YM6C 3AYWD 5AV8B 3AFAC 3B0DB 3AZHD 1P3FA 1HTAA 3TU4A 5GT0A 3REKB 3UTBB 5GT3B 3W96C 5B32G 1M1AD 2XD1A 3MNNB 5DNNC 4NE5A 5CPJD 2FFFB 3X1SA 3W98B 2YFVB 5AVBA 5AV5B 3RELB 3EPKA 4WU9A 5B2JC 1N1JB 4NFTA 5GSUA 2AROB 2YFWB 4H9OB 3LZ0B 3A1IA 1ID3D 4KHAA 3AYWA 3AV1A 3C1BB 3VH5W 3UTAB 3AZED 4XUJD 1BH8B 5AV6B 3REHB 1Q9CA 2Y2JA 5AY8A 4XZQB 1HQ3B 5B32A 3AN2C 2VQRA 1M1AA 4CSRB 5B40A 5AVCB 5CP6C 2FJ7A 4KGCB 4NE3A 1KX4D 1P34B 4X23B 5GT0C 5F99B 2LY8A 4Z5TB 5B31D 3X1SC 5AVBC 4JJNB 2ZY5A 1P3PD 4WU9C 4XUJA 1BFMA 3B0BA 1EQZA 5C3IC 4Z2MG 5GSUC 5CPKC 1WWSA 3KUYA 1KU5A 3AZGD 4LD9D 3AZJD 3AYWC 1KX4B 5B0YD 5FUGA 5AV9B 3X1TB 3X1UA 4H9QA 3AZHC 5GXQD 1M1AC 2XD5A 1P3KA 3R45B 2FJ7C 4CAYB 2NQBB 1P3PA 4YS3B 3W99D 4Z66B 1P3LB 2HUEB 2W8SA 4ZUXD 1JFIB 1AOIA 4LD9A 3KWQD 3AZID 3AZJA 4Z2MH 1P3AB 1F66B 1M18B 5B0YA 1P3MD 4XUJC 1M19D 3AZKB 1P3IA 5GXQA 5E5AD 3UT9B 4J8VA 3AZFD 4DRAA 3A6NB 3X1VD 3WTPB 4R8PB 3X1UC 1A7WA 5JRGD 3AFAD 4UUZB 4EO5B 3AV2B 4ZUXA 3W97D 3W96D 3REJB 1P3KC 5B31C 2F8NB 5B24B 4HGAC 4DRBA 5B1LA 4WNNA 1P3PC 1P3MA 5B0ZD 1M19A 4H9NB 5E5AA 3NQJB 3REIB 4H9RA 4WZSB 3WAAD 4UPKA 3AZGC 1AOIC 3MVDB 3MGQB 3AZFB 4LD9C 3AZJC 5B0YC 4YM6B 2Y2QA 5JA4B 5GXQC 3B0CT 1U35D 4J8VC 3W96B 2Y2NA 4H9PA 5DNNB 5CP6D 3AZLA 4J8XB 4J8UD 3LZ1A 5B0ZA 5B2JB 1P3FD 3TU4D 1KX3D 4DQYB 4ZUXC 4ZBJC 3WAAA 5G49A 3H0RC 4G92C 3AZIC 2BYMA 5B1LC 1ZLAD 1P3MC 1M19C 2NZDA 5E5AC 1U35A 3AN2B 5BS7A 3KXBA 1P3GA 1S32D 3NQUB 3AV1D 3H0LC 5JRGC 1P3OA 1KX3A 5B33A 3AZND 5GT0B 5AY8D 5B32D 2CWEA 3W97C 1H3OB 5B40D 3AZLC 2FJ7D 3X1SB 4WU8B 2CV5D 5AVBB 2IO5C 1ZLAA 3FDDA 3LZ1C 4QLCA 5B0ZC 4WU9B 4WJ3C 5GSUB 1P3BD 5CPKB 3WAAC 3LJAA 1S32A 4KUDD 4KHAB 3AYWB 2NZDC 3AZHB 1EQZD 3AZNA 1U35C 5BS7C 2G5HC 1M1AB 3KUYD 3MNNA 5CPJB 4J8UC 2L5AA 2CV5A 2F8NK 2YFVA 3X1UD 1P3OC 1P3FC 3RELA 5B33C 3TU4C 1KX3C 1P3BA 1P3KD 4KUDA 2AROA 3WA9D 2YFWA 2BYKB 1ID3B 1ULYA 1ZLAC 3AZMA 4QLCC 3AZEB 4XUJB 3UTAA 4WV4B 5AV6A 1B67A 4XZQA 3LJAC 1HQ3A 3KSYA 1S32C 1AOID 5AVCA 3B6FD 3AV1C 5FUGB 4KGCA 3X1UB 2Y2LA 4H9QB 3C1CA 1P3ID 3AZNC 2Y2GA 5AY8C 5B32C 4J8VD 2ZM5A 3IP4C 4X23A 3B0CW 5F99A 2Y2HA 5B40C 1P3KB 5KDMB 3MGPA 3WA9A 5B31B 2CV5C 4JJNA 3VH6W 1P3PB 3WKJD 5BNVA 3RELC 1P3BC 4E45A 1KX5D 3AZGB 3V9RA 2AROC 1AOIB 4KUDC 5DNMD 4LD9B 5BO0B 3AZJB 4G91C 5B1LD 5B0YB 3B6FA 3AZMC 3EPJA 5GXQB 1EQZC 5AV6C 4XZQC 3KUYC 2DQNC 5AVCC 3C1CC 2NQBA 3WKJA 1TAFB 3W99B 4ZUXB 5F99C 4ZBJB 1TZYD 4H9SA 1KX5A 3MGPC 4G92B 3KWQB 3AZIB 5DNMA 4J8WD 3VH5A 3AZLD 5CPID 3WA9C 4WNNB 2F8NG 1P3MB 1M18A 3LZ1D 2PYOA 1M19B 5E5AB 2DF4C 2J8PA 2RIQA 3X1VB 3B6FC 3A6NA 3WTPA 5JRGB 1F1EA 3AFAB 1P3IC 2NZDD 1BH9B 3W97B 3KXBD 1TZYA 1P3GD 3REJA 4J8WA 5CPIA 2NQBC 3MGSD 1P3OD 3WKJC 5B0ZB 3F6TA 5B33D 3B6GD 4H9NA 2F8NH 4H9SC 1KX5C 3WAAB 3NQJA 5G49B 5DNMC 2BYMB 3MVDA 3MGQA 3H0MC 4QLCD 2PYOC 2NZDB 1U35B 2HIOA 2BG1A 3O62D 3LJAD 3LELA 5CP6B 5BNXB 4J8UB 4J8XA 5B1MD 3WTPC 3MGSA 2Y2MA 1P3OB 1P3FB 5AV8D 5B33B 3TU4B 1KX3B 2Y2OA 5B2JA 3B6GA 4M6BA 1TZYC 3REKD 5GT3D 3UTBD 3MNND 3KFUG 4J8WC 5CPIC 2G5IC 3W98D 2JE5A 1ZLAB 5AV5D 4QLCB 3RELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I B;  3O62 A;  1S32 B;  2ARO D;  3LZ0 D;  3MGR A;  3AV1 B;  3AZM D;  5B1M A;  5B2I A;  4AWL C;  3C1B D;  3UTA D;  5AV8 A;  3AZN B;  2HIO C;  5B32 B;  5AY8 B;  5AV6 D;  3WTP E;  3KXB C;  4XZQ D;  3REH D;  5GT3 A;  3LEL C;  1HQ3 D;  5B40 B;  1H3O A;  3REK A;  3UTB A;  1P3G C;  2FJ7 B;  5AVC D;  2CV5 B;  4J8X C;  3W98 A;  4WU8 A;  4KGC D;  3MGS C;  3C1C D;  1P34 D;  5AV5 A;  3B6G C;  1N1J A;  4X23 D;  5F99 D;  1P3B B;  5CPK A;  3MGP D;  4KUD B;  2JSS A;  4H9O A;  4G91 B;  4Z5T D;  3LZ0 A;  3AZM B;  4JJN D;  3C1B A;  1EQZ B;  3AZH A;  1BH8 A;  3O62 C;  3REH A;  3KUY B;  4CSR A;  3MGR C;  5CHL B;  5CPJ A;  5B1M C;  5B2I C;  1P34 A;  3C1C B;  5AV9 D;  3X1T D;  5AV8 C;  3B0D C;  3REK C;  3UTB C;  5GT3 C;  3MGP B;  3MNN C;  3WA9 B;  1B6W A;  4Z5T A;  3W98 C;  4HGA B;  5B31 G;  4WU8 C;  2BYK A;  1ID3 A;  2NQB D;  5AV5 C;  5BNV B;  4YS3 D;  3AZE A;  4Z66 D;  1P3L D;  3V9R B;  3LZ0 C;  3B6F B;  1P3A D;  1F66 D;  1M18 D;  5BT1 D;  3C1B C;  1KX4 A;  2PYO D;  5AV9 A;  3X1T A;  3UTA C;  1P3I B;  3AZK D;  4J8V B;  4E44 A;  3UT9 D;  3REH C;  1HQ3 C;  3R45 A;  5KDM A;  5B31 A;  5CPJ C;  3A6N D;  4CAY A;  4KGC C;  3WTP D;  4R8P D;  1P34 C;  3WKJ B;  1WWI A;  4YS3 A;  4X23 C;  4Z66 A;  3AV2 D;  1P3L A;  1KX5 B;  3REJ D;  5DNM B;  1JFI A;  3AZG A;  4Z5T C;  2F8N D;  5B1L B;  5BO0 A;  1ID3 C;  5B24 D;  1P3A A;  1F66 A;  4JJN C;  3VH5 T;  2RVQ D;  2PYO B;  3AZE C;  3AZK A;  3UT9 A;  4H9R B;  3REI D;  3MVD D;  3MGQ D;  1KX4 C;  4R8P A;  4YM6 D;  5AV9 C;  3X1T C;  4UUZ A;  1TAF A;  2HIO D;  3W99 A;  3AV2 A;  1TZY B;  3LEL D;  4H9P B;  3AZL B;  4J8W B;  5CPI B;  3KWQ A;  5DNN D;  3AZI A;  2F8N A;  4J8X D;  2IO5 B;  5B24 A;  3LZ1 B;  4YS3 C;  5B2J D;  4Z66 C;  1P3L C;  2HUE C;  3REI A;  3AZF A;  3X1V A;  1P3A C;  1F66 C;  1M18 C;  5BT1 C;  4AWL B;  4YM6 A;  5JA4 A;  5JRG A;  3AFA A;  3AZK C;  2HIO B;  3UT9 C;  3KXB B;  1BH9 A;  3AN2 D;  1P3G B;  3W96 A;  3W97 A;  3LEL B;  3VH6 A;  5DNN A;  3MGR D;  3A6N C;  4R8P C;  5B2I D;  3VH6 T;  3MGS B;  4EO5 C;  3B6G B;  3W99 C;  3AV2 C;  5GT0 D;  3REJ C;  3KWQ C;  3X1S D;  5B24 C;  4WU8 D;  5AVB D;  4NE6 A;  2RVQ C;  4WU9 D;  1R4V A;  3O62 B;  5GSU D;  3LJA B;  3AN2 A;  5CPK D;  3REI C;  3MVD C;  3MGQ C;  3AZF C;  5CP6 A;  3X1V C;  5BNX A;  3MGR B;  4J8U A;  5B1M B;  5B2I B;  4YM6 C;  3NQU A;  3AYW D;  5AV8 B;  3AFA C;  3B0D B;  3AZH D;  1P3F A;  1HTA A;  3TU4 A;  5GT0 A;  3REK B;  3UTB B;  5GT3 B;  3W96 C;  5B32 G;  1M1A D;  3MNN B;  5DNN C;  4NE5 A;  5CPJ D;  3W98 B;  3X1S A;  2YFV B;  5AVB A;  5AV5 B;  3REL B;  4WU9 A;  5B2J C;  1N1J B;  4NFT A;  5GSU A;  2ARO B;  2YFW B;  4H9O B;  3LZ0 B;  1ID3 D;  4KHA A;  3AYW A;  3AV1 A;  3C1B B;  3VH5 W;  3UTA B;  3AZE D;  4XUJ D;  1BH8 B;  5AV6 B;  3REH B;  1Q9C A;  5AY8 A;  4XZQ B;  5B32 A;  1HQ3 B;  3AN2 C;  1M1A A;  4CSR B;  5B40 A;  5AVC B;  5CP6 C;  2FJ7 A;  4KGC B;  4NE3 A;  1KX4 D;  1P34 B;  4X23 B;  5GT0 C;  5F99 B;  2LY8 A;  4Z5T B;  5B31 D;  3X1S C;  5AVB C;  4JJN B;  1P3P D;  4WU9 C;  4XUJ A;  1BFM A;  3B0B A;  1EQZ A;  5C3I C;  4Z2M G;  5GSU C;  5CPK C;  1WWS A;  3KUY A;  1KU5 A;  3AZG D;  4LD9 D;  3AZJ D;  3AYW C;  1KX4 B;  5B0Y D;  5FUG A;  5AV9 B;  3X1T B;  3X1U A;  4H9Q A;  3AZH C;  5GXQ D;  1M1A C;  1P3K A;  3R45 B;  2FJ7 C;  4CAY B;  2NQB B;  1P3P A;  4YS3 B;  3W99 D;  4Z66 B;  1P3L B;  2HUE B;  4ZUX D;  1JFI B;  1AOI A;  4LD9 A;  3KWQ D;  3AZI D;  3AZJ A;  4Z2M H;  1P3A B;  1F66 B;  1M18 B;  5B0Y A;  1P3M D;  4XUJ C;  1M19 D;  3AZK B;  1P3I A;  5GXQ A;  5E5A D;  3UT9 B;  4J8V A;  3AZF D;  4DRA A;  3A6N B;  3X1V D;  3WTP B;  4R8P B;  3X1U C;  1A7W A;  5JRG D;  3AFA D;  4UUZ B;  4EO5 B;  3AV2 B;  4ZUX A;  3W97 D;  3W96 D;  3REJ B;  1P3K C;  5B31 C;  2F8N B;  5B24 B;  4HGA C;  4DRB A;  5B1L A;  4WNN A;  1P3P C;  1P3M A;  5B0Z D;  1M19 A;  4H9N B;  5E5A A;  3NQJ B;  3REI B;  4H9R A;  4WZS B;  3WAA D;  3AZG C;  1AOI C;  4LD9 C;  3MVD B;  3MGQ B;  3AZF B;  3AZJ C;  5B0Y C;  4YM6 B;  5JA4 B;  5GXQ C;  3B0C T;  1U35 D;  4J8V C;  3W96 B;  4H9P A;  5DNN B;  5CP6 D;  3AZL A;  4J8X B;  4J8U D;  3LZ1 A;  5B0Z A;  5B2J B;  1P3F D;  3TU4 D;  1KX3 D;  4ZUX C;  4ZBJ C;  3WAA A;  5G49 A;  4G92 C;  3AZI C;  2BYM A;  5B1L C;  1ZLA D;  1P3M C;  1M19 C;  2NZD A;  5E5A C;  1U35 A;  3AN2 B;  5BS7 A;  3KXB A;  1P3G A;  1S32 D;  3NQU B;  3AV1 D;  5JRG C;  1P3O A;  1KX3 A;  5B33 A;  3AZN D;  5GT0 B;  5AY8 D;  5B32 D;  2CWE A;  3W97 C;  1H3O B;  5B40 D;  3AZL C;  2FJ7 D;  3X1S B;  4WU8 B;  2CV5 D;  5AVB B;  2IO5 C;  1ZLA A;  3LZ1 C;  4QLC A;  5B0Z C;  4WU9 B;  5GSU B;  1P3B D;  5CPK B;  3WAA C;  3LJA A;  1S32 A;  4KUD D;  4KHA B;  3AYW B;  2NZD C;  3AZH B;  1EQZ D;  3AZN A;  1U35 C;  5BS7 C;  1M1A B;  3KUY D;  3MNN A;  5CPJ B;  4J8U C;  2L5A A;  2CV5 A;  2F8N K;  2YFV A;  3X1U D;  1P3O C;  1P3F C;  3REL A;  5B33 C;  3TU4 C;  1KX3 C;  1P3B A;  1P3K D;  4KUD A;  2ARO A;  3WA9 D;  2YFW A;  2BYK B;  1ID3 B;  1ULY A;  1ZLA C;  3AZM A;  4QLC C;  3AZE B;  4XUJ B;  3UTA A;  4WV4 B;  5AV6 A;  1B67 A;  4XZQ A;  3LJA C;  1HQ3 A;  3KSY A;  1S32 C;  1AOI D;  5AVC A;  3B6F D;  3AV1 C;  5FUG B;  4KGC A;  3X1U B;  4H9Q B;  3C1C A;  1P3I D;  3AZN C;  5AY8 C;  5B32 C;  4J8V D;  4X23 A;  3B0C W;  5F99 A;  5B40 C;  1P3K B;  5KDM B;  3MGP A;  3WA9 A;  5B31 B;  2CV5 C;  4JJN A;  3VH6 W;  1P3P B;  3WKJ D;  5BNV A;  3REL C;  1P3B C;  4E45 A;  1KX5 D;  3AZG B;  3V9R A;  2ARO C;  1AOI B;  4KUD C;  5DNM D;  4LD9 B;  5BO0 B;  3AZJ B;  4G91 C;  5B1L D;  5B0Y B;  3B6F A;  3AZM C;  5GXQ B;  1EQZ C;  5AV6 C;  4XZQ C;  3KUY C;  5AVC C;  3C1C C;  2NQB A;  3WKJ A;  1TAF B;  3W99 B;  4ZUX B;  5F99 C;  4ZBJ B;  1TZY D;  4H9S A;  1KX5 A;  3MGP C;  4G92 B;  3KWQ B;  3AZI B;  5DNM A;  4J8W D;  3VH5 A;  3AZL D;  5CPI D;  3WA9 C;  4WNN B;  2F8N G;  1P3M B;  1M18 A;  3LZ1 D;  2PYO A;  1M19 B;  5E5A B;  3X1V B;  3B6F C;  3A6N A;  3WTP A;  5JRG B;  1F1E A;  3AFA B;  1P3I C;  2NZD D;  1BH9 B;  3W97 B;  3KXB D;  1TZY A;  1P3G D;  3REJ A;  4J8W A;  5CPI A;  2NQB C;  3MGS D;  1P3O D;  3WKJ C;  5B0Z B;  5B33 D;  3B6G D;  4H9N A;  2F8N H;  4H9S C;  1KX5 C;  3WAA B;  3NQJ A;  5G49 B;  5DNM C;  2BYM B;  3MVD A;  3MGQ A;  4QLC D;  2PYO C;  2NZD B;  1U35 B;  2HIO A;  3O62 D;  3LJA D;  3LEL A;  5CP6 B;  5BNX B;  4J8U B;  4J8X A;  5B1M D;  3WTP C;  3MGS A;  1P3O B;  1P3F B;  5AV8 D;  5B33 B;  3TU4 B;  1KX3 B;  5B2J A;  3B6G A;  4M6B A;  1TZY C;  3REK D;  5GT3 D;  3UTB D;  3MNN D;  4J8W C;  5CPI C;  3W98 D;  1ZLA B;  5AV5 D;  4QLC B;  3REL D; 
#chains in the Genus database with same CATH topology
 5C3I B;  3O62 A;  1S32 B;  2ARO D;  3LZ0 D;  3MGR A;  3AV1 B;  3AZM D;  5B1M A;  5B2I A;  4AWL C;  3C1B D;  3UTA D;  5AV8 A;  3AZN B;  2HIO C;  5B32 B;  5AY8 B;  5AV6 D;  3WTP E;  3KXB C;  4XZQ D;  3REH D;  5GT3 A;  3LEL C;  1HQ3 D;  5B40 B;  1H3O A;  3REK A;  3UTB A;  1P3G C;  2Y2K A;  2FJ7 B;  5AVC D;  2CV5 B;  4J8X C;  3W98 A;  4WU8 A;  4KGC D;  3MGS C;  3C1C D;  1P34 D;  5AV5 A;  3B6G C;  1N1J A;  4X23 D;  5F99 D;  1P3B B;  5CPK A;  3MGP D;  4KUD B;  2JSS A;  4H9O A;  4G91 B;  4Z5T D;  3LZ0 A;  3AZM B;  4JJN D;  1Z2C B;  3C1B A;  1EQZ B;  3AZH A;  1BH8 A;  3O62 C;  3REH A;  3KUY B;  3EG5 B;  3EPL A;  4CSR A;  3MGR C;  5CHL B;  5CPJ A;  5B1M C;  5B2I C;  1P34 A;  3C1C B;  5AV9 D;  3X1T D;  5AV8 C;  3B0D C;  3EPH A;  3REK C;  3UTB C;  5GT3 C;  3MGP B;  2Y2I A;  3MNN C;  3WA9 B;  1B6W A;  4Z5T A;  3W98 C;  4HGA B;  5B31 G;  4WU8 C;  2BYK A;  1ID3 A;  1W2E A;  2NQB D;  5AV5 C;  5BNV B;  4YS3 D;  3AZE A;  4Z66 D;  1P3L D;  3V9R B;  3LZ0 C;  3B6F B;  1P3A D;  1F66 D;  1M18 D;  5BT1 D;  3C1B C;  1KX4 A;  2PYO D;  5AV9 A;  3X1T A;  3UTA C;  1P3I B;  3AZK D;  4J8V B;  4E44 A;  3UT9 D;  3REH C;  1HQ3 C;  3R45 A;  5KDM A;  5B31 A;  5CPJ C;  3A6N D;  4CAY A;  4KGC C;  3WTP D;  4R8P D;  1P34 C;  3WKJ B;  1WWI A;  4YS3 A;  2Y2P A;  4X23 C;  4Z66 A;  3AV2 D;  1P3L A;  1KX5 B;  3REJ D;  5DNM B;  1JFI A;  3AZG A;  4Z5T C;  2F8N D;  5B1L B;  5BO0 A;  1ID3 C;  5B24 D;  2UWX A;  1P3A A;  4JJN C;  1F66 A;  3VH5 T;  2RVQ D;  2PYO B;  3AZE C;  3AZK A;  3UT9 A;  4H9R B;  3REI D;  3MVD D;  3MGQ D;  2ZY4 A;  1KX4 C;  4R8P A;  4YM6 D;  5AV9 C;  3X1T C;  4UUZ A;  1TAF A;  2HIO D;  2ZY2 A;  3W99 A;  3AV2 A;  1TZY B;  3LEL D;  4H9P B;  3AZL B;  4J8W B;  5CPI B;  3KWQ A;  5DNN D;  3AZI A;  2F8N A;  4J8X D;  2IO5 B;  5B24 A;  3LZ1 B;  4YS3 C;  2F2A C;  5B2J D;  4Z66 C;  1P3L C;  2HUE C;  3REI A;  3AL0 C;  3AZF A;  3X1V A;  1P3A C;  1F66 C;  1M18 C;  5BT1 C;  4AWL B;  4YM6 A;  2JCH A;  5JA4 A;  5JRG A;  3AFA A;  2ZY3 A;  3AZK C;  2HIO B;  3UT9 C;  3KXB B;  1BH9 A;  3AN2 D;  1P3G B;  3W96 A;  3W97 A;  3LEL B;  3VH6 A;  5DNN A;  3MGR D;  3A6N C;  4R8P C;  5B2I D;  3VH6 T;  3MGS B;  4EO5 C;  3A1K A;  3B6G B;  3W99 C;  3AV2 C;  5GT0 D;  3REJ C;  3KWQ C;  3X1S D;  5B24 C;  4WU8 D;  5AVB D;  4NE6 A;  2RVQ C;  4WU9 D;  1R4V A;  3O62 B;  5GSU D;  3LJA B;  3AN2 A;  5CPK D;  3P5J B;  3REI C;  1T3U A;  3MVD C;  3MGQ C;  3AZF C;  5CP6 A;  3X1V C;  5BNX A;  3MGR B;  4J8U A;  5B1M B;  1PZR A;  5B2I B;  3NQU A;  4YM6 C;  3AYW D;  5AV8 B;  3AFA C;  3B0D B;  3AZH D;  1P3F A;  1HTA A;  3TU4 A;  5GT0 A;  3REK B;  3UTB B;  5GT3 B;  3W96 C;  5B32 G;  1M1A D;  2XD1 A;  3MNN B;  5DNN C;  4NE5 A;  5CPJ D;  2FFF B;  3X1S A;  3W98 B;  2YFV B;  5AVB A;  5AV5 B;  3REL B;  3EPK A;  4WU9 A;  5B2J C;  1N1J B;  4NFT A;  5GSU A;  2ARO B;  2YFW B;  4H9O B;  3LZ0 B;  3A1I A;  1ID3 D;  4KHA A;  3AYW A;  3AV1 A;  3C1B B;  3VH5 W;  3UTA B;  3AZE D;  4XUJ D;  1BH8 B;  5AV6 B;  3REH B;  1Q9C A;  2Y2J A;  5AY8 A;  4XZQ B;  1HQ3 B;  5B32 A;  3AN2 C;  2VQR A;  1M1A A;  4CSR B;  5B40 A;  5AVC B;  5CP6 C;  2FJ7 A;  4KGC B;  4NE3 A;  1KX4 D;  1P34 B;  4X23 B;  5GT0 C;  5F99 B;  2LY8 A;  4Z5T B;  5B31 D;  3X1S C;  5AVB C;  4JJN B;  2ZY5 A;  1P3P D;  4WU9 C;  4XUJ A;  1BFM A;  3B0B A;  1EQZ A;  5C3I C;  4Z2M G;  5GSU C;  5CPK C;  1WWS A;  3KUY A;  1KU5 A;  3AZG D;  4LD9 D;  3AZJ D;  3AYW C;  1KX4 B;  5B0Y D;  5FUG A;  5AV9 B;  3X1T B;  3X1U A;  4H9Q A;  3AZH C;  5GXQ D;  1M1A C;  2XD5 A;  1P3K A;  3R45 B;  2FJ7 C;  4CAY B;  2NQB B;  1P3P A;  4YS3 B;  3W99 D;  4Z66 B;  1P3L B;  2HUE B;  2W8S A;  4ZUX D;  1JFI B;  1AOI A;  4LD9 A;  3KWQ D;  3AZI D;  3AZJ A;  4Z2M H;  1P3A B;  1F66 B;  1M18 B;  5B0Y A;  1P3M D;  4XUJ C;  1M19 D;  3AZK B;  1P3I A;  5GXQ A;  5E5A D;  3UT9 B;  4J8V A;  3AZF D;  4DRA A;  3A6N B;  3X1V D;  3WTP B;  4R8P B;  3X1U C;  1A7W A;  5JRG D;  3AFA D;  4UUZ B;  4EO5 B;  3AV2 B;  4ZUX A;  3W97 D;  3W96 D;  3REJ B;  1P3K C;  5B31 C;  2F8N B;  5B24 B;  4HGA C;  4DRB A;  5B1L A;  4WNN A;  1P3P C;  1P3M A;  5B0Z D;  1M19 A;  4H9N B;  5E5A A;  3NQJ B;  3REI B;  4H9R A;  4WZS B;  3WAA D;  4UPK A;  3AZG C;  1AOI C;  3MVD B;  3MGQ B;  3AZF B;  4LD9 C;  3AZJ C;  5B0Y C;  4YM6 B;  2Y2Q A;  5JA4 B;  5GXQ C;  3B0C T;  1U35 D;  4J8V C;  3W96 B;  2Y2N A;  4H9P A;  5DNN B;  5CP6 D;  3AZL A;  4J8X B;  4J8U D;  3LZ1 A;  5B0Z A;  5B2J B;  1P3F D;  3TU4 D;  1KX3 D;  4DQY B;  4ZUX C;  4ZBJ C;  3WAA A;  5G49 A;  3H0R C;  4G92 C;  3AZI C;  2BYM A;  5B1L C;  1ZLA D;  1P3M C;  1M19 C;  2NZD A;  5E5A C;  1U35 A;  3AN2 B;  5BS7 A;  3KXB A;  1P3G A;  1S32 D;  3NQU B;  3AV1 D;  3H0L C;  5JRG C;  1P3O A;  1KX3 A;  5B33 A;  3AZN D;  5GT0 B;  5AY8 D;  5B32 D;  2CWE A;  3W97 C;  1H3O B;  5B40 D;  3AZL C;  2FJ7 D;  3X1S B;  4WU8 B;  2CV5 D;  5AVB B;  2IO5 C;  1ZLA A;  3FDD A;  3LZ1 C;  4QLC A;  5B0Z C;  4WU9 B;  4WJ3 C;  5GSU B;  1P3B D;  5CPK B;  3WAA C;  3LJA A;  1S32 A;  4KUD D;  4KHA B;  3AYW B;  2NZD C;  3AZH B;  1EQZ D;  3AZN A;  1U35 C;  5BS7 C;  2G5H C;  1M1A B;  3KUY D;  3MNN A;  5CPJ B;  4J8U C;  2L5A A;  2CV5 A;  2F8N K;  2YFV A;  3X1U D;  1P3O C;  1P3F C;  3REL A;  5B33 C;  3TU4 C;  1KX3 C;  1P3B A;  1P3K D;  4KUD A;  2ARO A;  3WA9 D;  2YFW A;  2BYK B;  1ID3 B;  1ULY A;  1ZLA C;  3AZM A;  4QLC C;  3AZE B;  4XUJ B;  3UTA A;  4WV4 B;  5AV6 A;  1B67 A;  4XZQ A;  3LJA C;  1HQ3 A;  3KSY A;  1S32 C;  1AOI D;  5AVC A;  3B6F D;  3AV1 C;  5FUG B;  4KGC A;  3X1U B;  2Y2L A;  4H9Q B;  3C1C A;  1P3I D;  3AZN C;  2Y2G A;  5AY8 C;  5B32 C;  4J8V D;  2ZM5 A;  3IP4 C;  4X23 A;  3B0C W;  5F99 A;  2Y2H A;  5B40 C;  1P3K B;  5KDM B;  3MGP A;  3WA9 A;  5B31 B;  2CV5 C;  4JJN A;  3VH6 W;  1P3P B;  3WKJ D;  5BNV A;  3REL C;  1P3B C;  4E45 A;  1KX5 D;  3AZG B;  3V9R A;  2ARO C;  1AOI B;  4KUD C;  5DNM D;  4LD9 B;  5BO0 B;  3AZJ B;  4G91 C;  5B1L D;  5B0Y B;  3B6F A;  3AZM C;  3EPJ A;  5GXQ B;  1EQZ C;  5AV6 C;  4XZQ C;  3KUY C;  2DQN C;  5AVC C;  3C1C C;  2NQB A;  3WKJ A;  1TAF B;  3W99 B;  4ZUX B;  5F99 C;  4ZBJ B;  1TZY D;  4H9S A;  1KX5 A;  3MGP C;  4G92 B;  3KWQ B;  3AZI B;  5DNM A;  4J8W D;  3VH5 A;  3AZL D;  5CPI D;  3WA9 C;  4WNN B;  2F8N G;  1P3M B;  1M18 A;  3LZ1 D;  2PYO A;  1M19 B;  5E5A B;  2DF4 C;  2J8P A;  2RIQ A;  3X1V B;  3B6F C;  3A6N A;  3WTP A;  5JRG B;  1F1E A;  3AFA B;  1P3I C;  2NZD D;  1BH9 B;  3W97 B;  3KXB D;  1TZY A;  1P3G D;  3REJ A;  4J8W A;  5CPI A;  2NQB C;  3MGS D;  1P3O D;  3WKJ C;  5B0Z B;  3F6T A;  5B33 D;  3B6G D;  4H9N A;  2F8N H;  4H9S C;  1KX5 C;  3WAA B;  3NQJ A;  5G49 B;  5DNM C;  2BYM B;  3MVD A;  3MGQ A;  3H0M C;  4QLC D;  2PYO C;  2NZD B;  1U35 B;  2HIO A;  2BG1 A;  3O62 D;  3LJA D;  3LEL A;  5CP6 B;  5BNX B;  4J8U B;  4J8X A;  5B1M D;  3WTP C;  3MGS A;  2Y2M A;  1P3O B;  1P3F B;  5AV8 D;  5B33 B;  3TU4 B;  1KX3 B;  2Y2O A;  5B2J A;  3B6G A;  4M6B A;  1TZY C;  3REK D;  5GT3 D;  3UTB D;  3MNN D;  3KFU G;  4J8W C;  5CPI C;  2G5I C;  3W98 D;  2JE5 A;  1ZLA B;  5AV5 D;  4QLC B;  3REL D; 
#chains in the Genus database with same CATH homology
 5C3I B;  3O62 A;  1S32 B;  2ARO D;  3LZ0 D;  3MGR A;  3AV1 B;  3AZM D;  5B1M A;  5B2I A;  4AWL C;  3C1B D;  3UTA D;  5AV8 A;  3AZN B;  2HIO C;  5B32 B;  5AY8 B;  5AV6 D;  3WTP E;  3KXB C;  4XZQ D;  3REH D;  5GT3 A;  3LEL C;  1HQ3 D;  5B40 B;  1H3O A;  3REK A;  3UTB A;  1P3G C;  2Y2K A;  2FJ7 B;  5AVC D;  2CV5 B;  4J8X C;  3W98 A;  4WU8 A;  4KGC D;  3MGS C;  3C1C D;  1P34 D;  5AV5 A;  3B6G C;  1N1J A;  4X23 D;  5F99 D;  1P3B B;  5CPK A;  3MGP D;  4KUD B;  2JSS A;  4H9O A;  4G91 B;  4Z5T D;  3LZ0 A;  3AZM B;  4JJN D;  1Z2C B;  3C1B A;  1EQZ B;  3AZH A;  1BH8 A;  3O62 C;  3REH A;  3KUY B;  3EG5 B;  3EPL A;  4CSR A;  3MGR C;  5CHL B;  5CPJ A;  5B1M C;  5B2I C;  1P34 A;  3C1C B;  5AV9 D;  3X1T D;  5AV8 C;  3B0D C;  3EPH A;  3REK C;  3UTB C;  5GT3 C;  3MGP B;  2Y2I A;  3MNN C;  3WA9 B;  1B6W A;  4Z5T A;  3W98 C;  4HGA B;  5B31 G;  4WU8 C;  2BYK A;  1ID3 A;  1W2E A;  2NQB D;  5AV5 C;  5BNV B;  4YS3 D;  3AZE A;  4Z66 D;  1P3L D;  3V9R B;  3LZ0 C;  3B6F B;  1P3A D;  1F66 D;  1M18 D;  5BT1 D;  3C1B C;  1KX4 A;  2PYO D;  5AV9 A;  3X1T A;  3UTA C;  1P3I B;  3AZK D;  4J8V B;  4E44 A;  3UT9 D;  3REH C;  1HQ3 C;  3R45 A;  5KDM A;  5B31 A;  5CPJ C;  3A6N D;  4CAY A;  4KGC C;  3WTP D;  4R8P D;  1P34 C;  3WKJ B;  1WWI A;  4YS3 A;  2Y2P A;  4X23 C;  4Z66 A;  3AV2 D;  1P3L A;  1KX5 B;  3REJ D;  5DNM B;  1JFI A;  3AZG A;  4Z5T C;  2F8N D;  5B1L B;  5BO0 A;  1ID3 C;  5B24 D;  2UWX A;  1P3A A;  4JJN C;  1F66 A;  3VH5 T;  2RVQ D;  2PYO B;  3AZE C;  3AZK A;  3UT9 A;  4H9R B;  3REI D;  3MVD D;  3MGQ D;  2ZY4 A;  1KX4 C;  4R8P A;  4YM6 D;  5AV9 C;  3X1T C;  4UUZ A;  1TAF A;  2HIO D;  2ZY2 A;  3W99 A;  3AV2 A;  1TZY B;  3LEL D;  4H9P B;  3AZL B;  4J8W B;  5CPI B;  3KWQ A;  5DNN D;  3AZI A;  2F8N A;  4J8X D;  2IO5 B;  5B24 A;  3LZ1 B;  4YS3 C;  2F2A C;  5B2J D;  4Z66 C;  1P3L C;  2HUE C;  3REI A;  3AL0 C;  3AZF A;  3X1V A;  1P3A C;  1F66 C;  1M18 C;  5BT1 C;  4AWL B;  4YM6 A;  2JCH A;  5JA4 A;  5JRG A;  3AFA A;  2ZY3 A;  3AZK C;  2HIO B;  3UT9 C;  3KXB B;  1BH9 A;  3AN2 D;  1P3G B;  3W96 A;  3W97 A;  3LEL B;  3VH6 A;  5DNN A;  3MGR D;  3A6N C;  4R8P C;  5B2I D;  3VH6 T;  3MGS B;  4EO5 C;  3A1K A;  3B6G B;  3W99 C;  3AV2 C;  5GT0 D;  3REJ C;  3KWQ C;  3X1S D;  5B24 C;  4WU8 D;  5AVB D;  4NE6 A;  2RVQ C;  4WU9 D;  1R4V A;  3O62 B;  5GSU D;  3LJA B;  3AN2 A;  5CPK D;  3P5J B;  3REI C;  1T3U A;  3MVD C;  3MGQ C;  3AZF C;  5CP6 A;  3X1V C;  5BNX A;  3MGR B;  4J8U A;  5B1M B;  1PZR A;  5B2I B;  3NQU A;  4YM6 C;  3AYW D;  5AV8 B;  3AFA C;  3B0D B;  3AZH D;  1P3F A;  1HTA A;  3TU4 A;  5GT0 A;  3REK B;  3UTB B;  5GT3 B;  3W96 C;  5B32 G;  1M1A D;  2XD1 A;  3MNN B;  5DNN C;  4NE5 A;  5CPJ D;  2FFF B;  3X1S A;  3W98 B;  2YFV B;  5AVB A;  5AV5 B;  3REL B;  3EPK A;  4WU9 A;  5B2J C;  1N1J B;  4NFT A;  5GSU A;  2ARO B;  2YFW B;  4H9O B;  3LZ0 B;  3A1I A;  1ID3 D;  4KHA A;  3AYW A;  3AV1 A;  3C1B B;  3VH5 W;  3UTA B;  3AZE D;  4XUJ D;  1BH8 B;  5AV6 B;  3REH B;  1Q9C A;  2Y2J A;  5AY8 A;  4XZQ B;  1HQ3 B;  5B32 A;  3AN2 C;  2VQR A;  1M1A A;  4CSR B;  5B40 A;  5AVC B;  5CP6 C;  2FJ7 A;  4KGC B;  4NE3 A;  1KX4 D;  1P34 B;  4X23 B;  5GT0 C;  5F99 B;  2LY8 A;  4Z5T B;  5B31 D;  3X1S C;  5AVB C;  4JJN B;  2ZY5 A;  1P3P D;  4WU9 C;  4XUJ A;  1BFM A;  3B0B A;  1EQZ A;  5C3I C;  4Z2M G;  5GSU C;  5CPK C;  1WWS A;  3KUY A;  1KU5 A;  3AZG D;  4LD9 D;  3AZJ D;  3AYW C;  1KX4 B;  5B0Y D;  5FUG A;  5AV9 B;  3X1T B;  3X1U A;  4H9Q A;  3AZH C;  5GXQ D;  1M1A C;  2XD5 A;  1P3K A;  3R45 B;  2FJ7 C;  4CAY B;  2NQB B;  1P3P A;  4YS3 B;  3W99 D;  4Z66 B;  1P3L B;  2HUE B;  2W8S A;  4ZUX D;  1JFI B;  1AOI A;  4LD9 A;  3KWQ D;  3AZI D;  3AZJ A;  4Z2M H;  1P3A B;  1F66 B;  1M18 B;  5B0Y A;  1P3M D;  4XUJ C;  1M19 D;  3AZK B;  1P3I A;  5GXQ A;  5E5A D;  3UT9 B;  4J8V A;  3AZF D;  4DRA A;  3A6N B;  3X1V D;  3WTP B;  4R8P B;  3X1U C;  1A7W A;  5JRG D;  3AFA D;  4UUZ B;  4EO5 B;  3AV2 B;  4ZUX A;  3W97 D;  3W96 D;  3REJ B;  1P3K C;  5B31 C;  2F8N B;  5B24 B;  4HGA C;  4DRB A;  5B1L A;  4WNN A;  1P3P C;  1P3M A;  5B0Z D;  1M19 A;  4H9N B;  5E5A A;  3NQJ B;  3REI B;  4H9R A;  4WZS B;  3WAA D;  4UPK A;  3AZG C;  1AOI C;  3MVD B;  3MGQ B;  3AZF B;  4LD9 C;  3AZJ C;  5B0Y C;  4YM6 B;  2Y2Q A;  5JA4 B;  5GXQ C;  3B0C T;  1U35 D;  4J8V C;  3W96 B;  2Y2N A;  4H9P A;  5DNN B;  5CP6 D;  3AZL A;  4J8X B;  4J8U D;  3LZ1 A;  5B0Z A;  5B2J B;  1P3F D;  3TU4 D;  1KX3 D;  4DQY B;  4ZUX C;  4ZBJ C;  3WAA A;  5G49 A;  3H0R C;  4G92 C;  3AZI C;  2BYM A;  5B1L C;  1ZLA D;  1P3M C;  1M19 C;  2NZD A;  5E5A C;  1U35 A;  3AN2 B;  5BS7 A;  3KXB A;  1P3G A;  1S32 D;  3NQU B;  3AV1 D;  3H0L C;  5JRG C;  1P3O A;  1KX3 A;  5B33 A;  3AZN D;  5GT0 B;  5AY8 D;  5B32 D;  2CWE A;  3W97 C;  1H3O B;  5B40 D;  3AZL C;  2FJ7 D;  3X1S B;  4WU8 B;  2CV5 D;  5AVB B;  2IO5 C;  1ZLA A;  3FDD A;  3LZ1 C;  4QLC A;  5B0Z C;  4WU9 B;  4WJ3 C;  5GSU B;  1P3B D;  5CPK B;  3WAA C;  3LJA A;  1S32 A;  4KUD D;  4KHA B;  3AYW B;  2NZD C;  3AZH B;  1EQZ D;  3AZN A;  1U35 C;  5BS7 C;  2G5H C;  1M1A B;  3KUY D;  3MNN A;  5CPJ B;  4J8U C;  2L5A A;  2CV5 A;  2F8N K;  2YFV A;  3X1U D;  1P3O C;  1P3F C;  3REL A;  5B33 C;  3TU4 C;  1KX3 C;  1P3B A;  1P3K D;  4KUD A;  2ARO A;  3WA9 D;  2YFW A;  2BYK B;  1ID3 B;  1ULY A;  1ZLA C;  3AZM A;  4QLC C;  3AZE B;  4XUJ B;  3UTA A;  4WV4 B;  5AV6 A;  1B67 A;  4XZQ A;  3LJA C;  1HQ3 A;  3KSY A;  1S32 C;  1AOI D;  5AVC A;  3B6F D;  3AV1 C;  5FUG B;  4KGC A;  3X1U B;  2Y2L A;  4H9Q B;  3C1C A;  1P3I D;  3AZN C;  2Y2G A;  5AY8 C;  5B32 C;  4J8V D;  2ZM5 A;  3IP4 C;  4X23 A;  3B0C W;  5F99 A;  2Y2H A;  5B40 C;  1P3K B;  5KDM B;  3MGP A;  3WA9 A;  5B31 B;  2CV5 C;  4JJN A;  3VH6 W;  1P3P B;  3WKJ D;  5BNV A;  3REL C;  1P3B C;  4E45 A;  1KX5 D;  3AZG B;  3V9R A;  2ARO C;  1AOI B;  4KUD C;  5DNM D;  4LD9 B;  5BO0 B;  3AZJ B;  4G91 C;  5B1L D;  5B0Y B;  3B6F A;  3AZM C;  3EPJ A;  5GXQ B;  1EQZ C;  5AV6 C;  4XZQ C;  3KUY C;  2DQN C;  5AVC C;  3C1C C;  2NQB A;  3WKJ A;  1TAF B;  3W99 B;  4ZUX B;  5F99 C;  4ZBJ B;  1TZY D;  4H9S A;  1KX5 A;  3MGP C;  4G92 B;  3KWQ B;  3AZI B;  5DNM A;  4J8W D;  3VH5 A;  3AZL D;  5CPI D;  3WA9 C;  4WNN B;  2F8N G;  1P3M B;  1M18 A;  3LZ1 D;  2PYO A;  1M19 B;  5E5A B;  2DF4 C;  2J8P A;  2RIQ A;  3X1V B;  3B6F C;  3A6N A;  3WTP A;  5JRG B;  1F1E A;  3AFA B;  1P3I C;  2NZD D;  1BH9 B;  3W97 B;  3KXB D;  1TZY A;  1P3G D;  3REJ A;  4J8W A;  5CPI A;  2NQB C;  3MGS D;  1P3O D;  3WKJ C;  5B0Z B;  3F6T A;  5B33 D;  3B6G D;  4H9N A;  2F8N H;  4H9S C;  1KX5 C;  3WAA B;  3NQJ A;  5G49 B;  5DNM C;  2BYM B;  3MVD A;  3MGQ A;  3H0M C;  4QLC D;  2PYO C;  2NZD B;  1U35 B;  2HIO A;  2BG1 A;  3O62 D;  3LJA D;  3LEL A;  5CP6 B;  5BNX B;  4J8U B;  4J8X A;  5B1M D;  3WTP C;  3MGS A;  2Y2M A;  1P3O B;  1P3F B;  5AV8 D;  5B33 B;  3TU4 B;  1KX3 B;  2Y2O A;  5B2J A;  3B6G A;  4M6B A;  1TZY C;  3REK D;  5GT3 D;  3UTB D;  3MNN D;  3KFU G;  4J8W C;  5CPI C;  2G5I C;  3W98 D;  2JE5 A;  1ZLA B;  5AV5 D;  4QLC B;  3REL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...