5GXQA

The crystal structure of the nucleosome containing h3.6
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAHSIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqA00
4H9RB 1P3OA 3KWQA 3W97D 3MGPA 3AZFD 3LELA 4X23A 5FUGB 5AVBB 3C1BB 3WKJA 5AVBC 5CPKD 1ZLAD 3A6NA 3O62C 5AV6C 3REHB 1R4VA 5JA4B 3AZID 3REHC 3AZKD 3REKA 3AV1A 4KHAB 5CHLB 3UT9A 3B6GA 3AZHC 1EQZB 4H9OB 1EQZC 4Z66C 4WU9D 2CV5B 4Z2MG 5B33B 4KGCB 2CV5C 4KGCC 1M19C 3LZ0B 5BS7C 1P3GC 5B0ZB 4J8WB 1P3PA 1BH8A 2BYMA 4G92B 4G92C 3NQJB 5G49B 1WWSA 2BYKA 3AZLB 5B2IB 4ZUXC 5B2IC 4H9RA 1P3AD 1P3PD 4EO5B 1S32D 4EO5C 3AYWD 5FUGA 5AVBA 3B0CW 3C1BA 3B6FD 5B31G 1U35C 2HUEB 1M1AB 4J8VC 3REHA 5JA4A 1KX3B 5DNNB 2AROD 5JRGB 5DNNC 3NQUB 3LZ1C 4KHAA 5F99D 5AY8B 3X1VB 3X1VC 5AY8C 3V9RB 4E45A 5B24B 4Z2MH 1P3KB 3MNNC 2PYOB 1P3KC 3MGQD 4H9OA 4E44A 3O62D 3MVDB 5AV6D 1EQZA 2PYOC 3MGSD 5DNMB 2CV5A 5B33A 3REHD 3AZNB 1F66B 4KGCA 5GSUB 3AZNC 1P3IC 1F66C 3X1SD 5GSUC 4J8UB 4H9PB 4WNNB 5BS7A 4NE3A 3B0CT 3AZHD 5B0ZA 4J8WA 5GT3D 4Z66D 4YS3C 2JSSA 3UTAD 1KU5A 1M19D 3W97B 3NQJA 5G49A 3AZLA 1P3BD 5B2IA 1P3GD 3W98D 1ZLAB 2CWEA 1ZLAC 1M18D 3AZIB 2NQBC 4WZSB 3AZKB 3AZIC 4Z5TD 5BNXB 4ZUXD 1M1AA 1KX3A 5DNNA 3RELB 5JRGA 3NQUA 4WU9B 3X1VA 5AY8A 3RELC 3V9RA 5B24A 1P3KA 1A7WA 2PYOA 3MVDA 1U35D 4J8VD 1HTAA 5B1MB 3AZNA 1F66A 5GSUA 4LD9D 5B1MC 1P3LB 3LZ1D 5DNND 4J8UA 4H9PA 1P3LC 1BH9B 3MNND 2FJ7D 3WA9D 1P3ID 3W97A 3WTPD 1P3MD 1P3AB 1F1EA 4ZBJB 3C1CD 1HQ3C 4ZBJC 5B40B 1S32B 4WU8D 3AYWB 3B0DB 5B40C 1S32C 3AYWC 3B0DC 3B6FB 5B31B 1ZLAA 5AV8C 5B31C 4YS3D 3AZIA 3AZKA 2AROB 5BNXA 2AROC 4G91C 5F99B 5AVCD 5F99C 4H9QB 3UTBD 3VH5W 3MGQB 3O62B 5AV6B 3RELA 3MGQC 3MGSB 4WU9A 2NQBD 3MGSC 5B1LD 3X1SB 3KXBD 3X1SC 3VH5A 3AZHB 5B1MA 2RVQD 2F8ND 2F8NG 1P3LA 5GT3B 4Z66B 3RELD 5GT3C 3UTAB 1WWIA 3UTAC 1M19B 1BH9A 1P3BB 4KUDC 1TZYD 3VH5T 3X1TB 1P3BC 4WV4B 3X1TC 1P3GB 3W98B 5B1MD 5C3IB 3W98C 4YM6D 5C3IC 1P3AA 1P3LD 1M18B 5B40A 1S32A 1M18C 3B0BA 5GXQC 3AYWA 4Z5TB 5B32G 5B32D 3MGRC 5AV8A 2IO5C 4Z5TC 3B6FA 5B31A 4ZUXB 2L5AA 2AROA 1HQ3D 5F99A 5B40D 3LJAD 4H9QA 1H3OB 5CP6C 2HIOC 5AV8D 1P34D 3MGQA 5B31D 3REID 3O62A 1U35B 5AV6A 4J8VB 3MGSA 4J8XD 3AZED 4LD9B 3LZ1B 3X1SA 4LD9C 2F8NH 3AZJD 3AZHA 4QLCC 3MNNB 2FJ7B 1Q9CA 1ULYA 2FJ7C 5GT3A 4Z66A 2F8NK 4XZQC 3UTAA 5AV9C 3WA9B 1P3IB 3WTPB 1P3MB 1M19A 3WA9C 3WTPC 1P3MC 1P3FB 1P3BA 3C1CB 3X1TA 1P3FC 4WU8B 3C1CC 1P3GA 3AV2B 3WAAD 4WU8C 3AV2C 3W98A 5B0YC 3VH6W 5B2JD 4NFTA 4YS3B 1M18A 4JJNC 4Z5TA 3AZGD 4KUDD 5GT0D 3AZMD 4ZUXA 5AVCB 3X1TD 5AVCC 3VH6A 3UTBB 3UTBC 5BNVB 2NQBB 1ID3C 1TAFA 5GXQD 5B1LB 3MGRD 5B1LC 1H3OA 3KXBB 3KXBC 3TU4C 1U35A 4J8VA 3VH6T 4XUJD 3W96D 2F8NB 4LD9A 2RVQC 4R8PD 3LZ1A 4M6BA 5CP6D 2HIOD 3MNNA 2FJ7A 1JFIB 1TZYB 4XZQA 5AV9A 1TZYC 3WA9A 4HGAC 3WTPA 1P3IA 1P3MA 5BT1C 4YM6B 5CPJC 1P3FA 4YM6C 3C1CA 4WU8A 4QLCD 3AV2A 5B32B 3KWQC 5B32C 2LY8A 3MGPC 4YS3A 4XZQD 5AV9D 3KSYA 4X23C 1AOIB 5BO0B 3A6NC 1AOIC 1HQ3B 5AV5B 1P3FD 5AVCA 1KX5B 5AV5C 3LJAB 1KX5C 3LJAC 3UTBA 3AV2D 5B0YD 5AV8B 1P34B 3AV1C 3REIB 4UUZB 5E5AD 5BNVA 1P34C 3REIC 4J8XB 4JJND 2NQBA 3B6GC 5B1LA 4J8XC 3AZEB 4G91B 3KXBA 3AZEC 3AZJB 3AZJC 4DRAA 2F8NA 3KUYD 1ID3D 3TU4D 1JFIA 1TZYA 3WAAB 3WAAC 5B2JB 4YM6A 5B2JC 3X1UD 5B32A 3AZGB 4KUDB 5GT0B 3AZGC 3AZMB 5GT0C 1BFMA 3AZMC 3REJD 3AFAD 3C1BC 5BT1D 3B6FC 1AOIA 5CPJD 5BO0A 1HQ3A 5AV5A 3AN2B 1P3OD 5GXQB 1KX5A 3LJAA 3AN2C 3MGRB 5CPIB 3KWQD 2IO5B 5CPIC 1P34A 3MGPD 3REIA 4UUZA 3WTPE 3LELD 4XUJB 4H9SC 4X23D 4J8XA 3W99B 4XUJC 3W96B 3WKJD 4NE5A 3AZEA 3W99C 3W96C 4R8PB 3A6ND 1AOID 4R8PC 3AZJA 5AV5D 1TAFB 1KX5D 5B33C 5CP6B 2HIOB 1KX4B 3REKD 3AV1D 1KX4C 3LZ0C 3UT9D 3B6GD 4CSRB 5B0ZC 4J8WC 4QLCB 4CAYB 3WAAA 5B2JA 3AZLC 4XZQB 5AV9B 4H9NB 3AZGA 4KUDA 5GT0A 3AZMA 5B0YB 5E5AB 4JJNB 2YFWB 5E5AC 2HUEC 3AN2A 1M1AC 5GXQA 3MGRA 5CPIA 1KX3C 5JRGC 4H9SA 4XUJA 5AVBD 3W99A 3W96A 3C1BD 5B24C 3KUYB 4DRBA 4R8PA 3KUYC 2NZDB 3MVDC 1ID3B 2NZDC 5DNMC 3AN2D 5CP6A 2HIOA 5CPID 1KX4A 3R45B 3LZ0A 4J8UC 3TU4B 4CSRA 2YFVB 3W99D 1EQZD 3X1UB 5KDMB 3X1UC 2CV5D 1N1JB 5B33D 4QLCA 4KGCD 4CAYA 3W97C 1KX4D 3LZ0D 3AZFB 3AZFC 3REJB 3AFAB 3REJC 4HGAB 5B0ZD 4J8WD 3AFAC 5CPKB 5CPJB 5CPKC 4H9NA 5CPJA 1P3OB 1P3OC 3KWQB 3AZKC 5B0YA 3MGPB 3AZLD 5B2ID 5E5AA 3LELB 4JJNA 2YFWA 4X23B 3LELC 3WKJB 3A6NB 3WKJC 4WU9C 3REKB 3AV1B 3KUYA 1B6WA 3REKC 3UT9B 3B6GB 2NZDA 5DNMA 1M1AD 3UT9C 1ID3A 1KX3D 4NE6A 4WNNA 3R45A 5JRGD 4AWLB 3TU4A 3X1VD 5AY8D 4AWLC 2YFVA 5B24D 1P3KD 2PYOD 3MVDD 3X1UA 2NZDD 5KDMA 5DNMD 1N1JA 3AZND 1F66D 5GSUD 1P3PB 1BH8B 4J8UD 2BYMB 1P3AC 3AZFA 1P3PC 3REJA 3AFAA 5CPKA 2BYKB 1B67A
chains in the Genus database with same CATH superfamily
4H9RB 1P3OA 3KWQA 3W97D 3MGPA 3AZFD 3LELA 4X23A 5FUGB 5AVBB 3C1BB 3WKJA 5AVBC 5CPKD 1ZLAD 3A6NA 3O62C 5AV6C 3REHB 1R4VA 5JA4B 3AZID 3REHC 3AZKD 3REKA 3AV1A 4KHAB 5CHLB 3UT9A 3B6GA 3AZHC 1EQZB 4H9OB 4WJ3C 1EQZC 4Z66C 4WU9D 2CV5B 4Z2MG 5B33B 4KGCB 2CV5C 4KGCC 1M19C 3LZ0B 5BS7C 1P3GC 5B0ZB 4J8WB 1P3PA 1BH8A 2BYMA 4G92B 2Y2IA 4G92C 4UPKA 2Y2JA 3NQJB 5G49B 1WWSA 2BYKA 3AZLB 5B2IB 4ZUXC 5B2IC 4H9RA 2UWXA 1P3AD 1P3PD 4EO5B 1S32D 4EO5C 3AYWD 2ZY2A 5FUGA 5AVBA 3B0CW 3C1BA 3B6FD 5B31G 1U35C 2HUEB 1M1AB 4J8VC 3REHA 2F2AC 5JA4A 1KX3B 5DNNB 2AROD 5JRGB 5DNNC 3NQUB 3LZ1C 4KHAA 5F99D 5AY8B 3X1VB 3X1VC 5AY8C 3V9RB 4E45A 5B24B 4Z2MH 1P3KB 3MNNC 2PYOB 1P3KC 3MGQD 4H9OA 4E44A 3O62D 3MVDB 5AV6D 1EQZA 2PYOC 3MGSD 5DNMB 2CV5A 5B33A 3REHD 3AZNB 1F66B 4KGCA 5GSUB 3AZNC 1P3IC 1F66C 3X1SD 5GSUC 4J8UB 4H9PB 4WNNB 5BS7A 4NE3A 3B0CT 2G5IC 3AZHD 5B0ZA 4J8WA 3H0MC 5GT3D 4Z66D 4YS3C 2JSSA 3UTAD 1KU5A 1M19D 3W97B 3NQJA 5G49A 3AZLA 1P3BD 5B2IA 1P3GD 3W98D 1ZLAB 2CWEA 1ZLAC 1M18D 3AZIB 2NQBC 4WZSB 3AZKB 3AZIC 4Z5TD 5BNXB 3F6TA 4ZUXD 1M1AA 1KX3A 2VQRA 5DNNA 3RELB 5JRGA 3NQUA 4WU9B 3X1VA 5AY8A 3RELC 3V9RA 5B24A 1P3KA 1A7WA 2PYOA 3MVDA 1U35D 4J8VD 1HTAA 3H0LC 5B1MB 3AZNA 1F66A 5GSUA 4LD9D 5B1MC 1P3LB 3LZ1D 5DNND 4J8UA 2Y2PA 4H9PA 1P3LC 2Y2GA 1BH9B 3MNND 2FJ7D 3WA9D 1P3ID 3W97A 3WTPD 1P3MD 1P3AB 1F1EA 4ZBJB 3C1CD 1HQ3C 4ZBJC 5B40B 1S32B 4WU8D 3AYWB 3B0DB 5B40C 1S32C 3AYWC 3B0DC 3FDDA 3B6FB 5B31B 1ZLAA 5AV8C 3P5JB 5B31C 4YS3D 3EG5B 1T3UA 3AZIA 3AZKA 2AROB 5BNXA 2AROC 4G91C 5F99B 5AVCD 5F99C 4H9QB 3UTBD 3VH5W 3MGQB 3O62B 5AV6B 3RELA 3MGQC 3MGSB 4WU9A 2NQBD 3MGSC 5B1LD 3A1KA 3EPHA 3X1SB 3KXBD 3X1SC 3VH5A 3AZHB 5B1MA 2RVQD 2F8ND 2F8NG 1P3LA 5GT3B 4Z66B 3RELD 5GT3C 3UTAB 1WWIA 3EPLA 3UTAC 1M19B 1BH9A 3EPKA 1P3BB 4KUDC 1TZYD 3VH5T 3X1TB 1P3BC 4WV4B 3X1TC 1P3GB 3W98B 5B1MD 5C3IB 3W98C 4YM6D 5C3IC 1P3AA 1P3LD 1M18B 5B40A 1S32A 1M18C 3B0BA 5GXQC 3AYWA 2DF4C 4Z5TB 5B32G 5B32D 3MGRC 5AV8A 2IO5C 4Z5TC 3B6FA 5B31A 4ZUXB 2L5AA 2AROA 1HQ3D 5F99A 3H0RC 2XD1A 5B40D 3LJAD 1H3OB 4H9QA 5CP6C 2HIOC 5AV8D 1P34D 3MGQA 5B31D 3REID 3O62A 1U35B 5AV6A 4J8VB 3MGSA 4J8XD 3AZED 4LD9B 4DQYB 3LZ1B 3X1SA 4LD9C 2F8NH 3AZJD 2Y2KA 3AZHA 4QLCC 3MNNB 2FJ7B 1Q9CA 1ULYA 2FJ7C 5GT3A 4Z66A 2F8NK 2Y2OA 4XZQC 3UTAA 5AV9C 3WA9B 1P3IB 3WTPB 1P3MB 1M19A 3WA9C 3WTPC 1P3MC 1P3FB 2W8SA 1P3BA 3C1CB 3X1TA 1P3FC 4WU8B 2FFFB 3C1CC 1P3GA 2J8PA 3AV2B 3WAAD 4WU8C 1W2EA 3AV2C 3W98A 5B0YC 3VH6W 5B2JD 4NFTA 4YS3B 1M18A 4JJNC 4Z5TA 3AZGD 4KUDD 5GT0D 3AZMD 4ZUXA 5AVCB 3X1TD 5AVCC 3VH6A 3UTBB 3UTBC 5BNVB 1Z2CB 2NQBB 1ID3C 1TAFA 5GXQD 5B1LB 3MGRD 5B1LC 1H3OA 3KXBB 3KXBC 3TU4C 1U35A 4J8VA 3VH6T 4XUJD 3A1IA 3W96D 2F8NB 4LD9A 2RVQC 4R8PD 3LZ1A 4M6BA 3IP4C 5CP6D 2HIOD 3MNNA 2FJ7A 1JFIB 1TZYB 4XZQA 5AV9A 1TZYC 3WA9A 2ZY5A 4HGAC 3WTPA 1P3IA 1P3MA 5BT1C 4YM6B 5CPJC 1P3FA 4YM6C 3C1CA 4WU8A 4QLCD 3AV2A 5B32B 3KWQC 5B32C 2LY8A 3MGPC 4YS3A 4XZQD 5AV9D 3KSYA 4X23C 1AOIB 5BO0B 3A6NC 1AOIC 1HQ3B 5AV5B 1P3FD 5AVCA 1KX5B 5AV5C 3LJAB 1KX5C 3LJAC 3UTBA 3AV2D 5B0YD 5AV8B 1P34B 2JCHA 3AV1C 3REIB 4UUZB 5E5AD 5BNVA 1P34C 3REIC 4J8XB 4JJND 2NQBA 3B6GC 5B1LA 4J8XC 3AZEB 4G91B 3KXBA 3AZEC 3AZJB 3AZJC 4DRAA 2F8NA 3KUYD 1ID3D 3EPJA 2Y2QA 3TU4D 1JFIA 1TZYA 3WAAB 3WAAC 5B2JB 4YM6A 5B2JC 3X1UD 2RIQA 2Y2HA 5B32A 3AZGB 4KUDB 5GT0B 3AZGC 3AZMB 5GT0C 1BFMA 3AZMC 3REJD 2Y2LA 3AFAD 3C1BC 5BT1D 3B6FC 1AOIA 5CPJD 5BO0A 1HQ3A 5AV5A 3AN2B 1P3OD 5GXQB 1KX5A 3LJAA 3AN2C 3MGRB 5CPIB 3KWQD 2IO5B 5CPIC 1P34A 3MGPD 3REIA 4UUZA 3WTPE 3LELD 4XUJB 4H9SC 4X23D 4J8XA 3W99B 4XUJC 3W96B 3WKJD 4NE5A 3AZEA 3W99C 3W96C 4R8PB 3A6ND 1AOID 4R8PC 3AZJA 5AV5D 1TAFB 1KX5D 5B33C 3AL0C 5CP6B 2HIOB 1KX4B 3REKD 3AV1D 1KX4C 3LZ0C 2ZY3A 3UT9D 4CSRB 3B6GD 5B0ZC 4J8WC 4QLCB 4CAYB 3WAAA 5B2JA 3AZLC 4XZQB 5AV9B 4H9NB 3AZGA 4KUDA 2Y2NA 5GT0A 3AZMA 5B0YB 3KFUG 5E5AB 4JJNB 2YFWB 5E5AC 2HUEC 3AN2A 1M1AC 5GXQA 3MGRA 5CPIA 1KX3C 2ZY4A 5JRGC 4H9SA 4XUJA 5AVBD 3W99A 3W96A 3C1BD 5B24C 3KUYB 4DRBA 4R8PA 3KUYC 2NZDB 2Y2MA 3MVDC 1ID3B 2NZDC 5DNMC 3AN2D 5CP6A 2HIOA 5CPID 1KX4A 2G5HC 3R45B 3LZ0A 4J8UC 3TU4B 4CSRA 2YFVB 3W99D 1EQZD 3X1UB 5KDMB 3X1UC 2CV5D 1N1JB 5B33D 4QLCA 4KGCD 4CAYA 3W97C 1KX4D 2DQNC 3LZ0D 3AZFB 3AZFC 3REJB 3AFAB 3REJC 4HGAB 5B0ZD 4J8WD 3AFAC 5CPKB 5CPJB 5CPKC 4H9NA 5CPJA 1P3OB 1PZRA 1P3OC 3KWQB 3AZKC 5B0YA 2BG1A 3MGPB 3AZLD 5B2ID 5E5AA 3LELB 2ZM5A 2YFWA 4X23B 4JJNA 3LELC 3WKJB 3A6NB 3WKJC 4WU9C 2JE5A 3REKB 3AV1B 3KUYA 1B6WA 3REKC 3UT9B 3B6GB 2NZDA 5DNMA 1M1AD 3UT9C 1ID3A 1KX3D 4NE6A 2XD5A 4WNNA 3R45A 5JRGD 4AWLB 3TU4A 3X1VD 5AY8D 4AWLC 2YFVA 5B24D 1P3KD 2PYOD 3MVDD 3X1UA 2NZDD 5KDMA 5DNMD 1N1JA 3AZND 1F66D 5GSUD 1P3PB 1BH8B 4J8UD 2BYMB 1P3AC 3AZFA 1P3PC 3REJA 3AFAA 5CPKA 2BYKB 1B67A
chains in the Genus database with same CATH topology
4H9RB 1P3OA 3KWQA 3W97D 3MGPA 3AZFD 3LELA 4X23A 5FUGB 5AVBB 3C1BB 3WKJA 5AVBC 5CPKD 1ZLAD 3A6NA 3O62C 5AV6C 3REHB 1R4VA 5JA4B 3AZID 3REHC 3AZKD 3REKA 3AV1A 4KHAB 5CHLB 3UT9A 3B6GA 3AZHC 1EQZB 4H9OB 4WJ3C 1EQZC 4Z66C 4WU9D 2CV5B 4Z2MG 5B33B 4KGCB 2CV5C 4KGCC 1M19C 3LZ0B 5BS7C 1P3GC 5B0ZB 4J8WB 1P3PA 1BH8A 2BYMA 4G92B 2Y2IA 4G92C 4UPKA 2Y2JA 3NQJB 5G49B 1WWSA 2BYKA 3AZLB 5B2IB 4ZUXC 5B2IC 4H9RA 2UWXA 1P3AD 1P3PD 4EO5B 1S32D 4EO5C 3AYWD 2ZY2A 5FUGA 5AVBA 3B0CW 3C1BA 3B6FD 5B31G 1U35C 2HUEB 1M1AB 4J8VC 3REHA 2F2AC 5JA4A 1KX3B 5DNNB 2AROD 5JRGB 5DNNC 3NQUB 3LZ1C 4KHAA 5F99D 5AY8B 3X1VB 3X1VC 5AY8C 3V9RB 4E45A 5B24B 4Z2MH 1P3KB 3MNNC 2PYOB 1P3KC 3MGQD 4H9OA 4E44A 3O62D 3MVDB 5AV6D 1EQZA 2PYOC 3MGSD 5DNMB 2CV5A 5B33A 3REHD 3AZNB 1F66B 4KGCA 5GSUB 3AZNC 1P3IC 1F66C 3X1SD 5GSUC 4J8UB 4H9PB 4WNNB 5BS7A 4NE3A 3B0CT 2G5IC 3AZHD 5B0ZA 4J8WA 3H0MC 5GT3D 4Z66D 4YS3C 2JSSA 3UTAD 1KU5A 1M19D 3W97B 3NQJA 5G49A 3AZLA 1P3BD 5B2IA 1P3GD 3W98D 1ZLAB 2CWEA 1ZLAC 1M18D 3AZIB 2NQBC 4WZSB 3AZKB 3AZIC 4Z5TD 5BNXB 3F6TA 4ZUXD 1M1AA 1KX3A 2VQRA 5DNNA 3RELB 5JRGA 3NQUA 4WU9B 3X1VA 5AY8A 3RELC 3V9RA 5B24A 1P3KA 1A7WA 2PYOA 3MVDA 1U35D 4J8VD 1HTAA 3H0LC 5B1MB 3AZNA 1F66A 5GSUA 4LD9D 5B1MC 1P3LB 3LZ1D 5DNND 4J8UA 2Y2PA 4H9PA 1P3LC 2Y2GA 1BH9B 3MNND 2FJ7D 3WA9D 1P3ID 3W97A 3WTPD 1P3MD 1P3AB 1F1EA 4ZBJB 3C1CD 1HQ3C 4ZBJC 5B40B 1S32B 4WU8D 3AYWB 3B0DB 5B40C 1S32C 3AYWC 3B0DC 3FDDA 3B6FB 5B31B 1ZLAA 5AV8C 3P5JB 5B31C 4YS3D 3EG5B 1T3UA 3AZIA 3AZKA 2AROB 5BNXA 2AROC 4G91C 5F99B 5AVCD 5F99C 4H9QB 3UTBD 3VH5W 3MGQB 3O62B 5AV6B 3RELA 3MGQC 3MGSB 4WU9A 2NQBD 3MGSC 5B1LD 3A1KA 3EPHA 3X1SB 3KXBD 3X1SC 3VH5A 3AZHB 5B1MA 2RVQD 2F8ND 2F8NG 1P3LA 5GT3B 4Z66B 3RELD 5GT3C 3UTAB 1WWIA 3EPLA 3UTAC 1M19B 1BH9A 3EPKA 1P3BB 4KUDC 1TZYD 3VH5T 3X1TB 1P3BC 4WV4B 3X1TC 1P3GB 3W98B 5B1MD 5C3IB 3W98C 4YM6D 5C3IC 1P3AA 1P3LD 1M18B 5B40A 1S32A 1M18C 3B0BA 5GXQC 3AYWA 2DF4C 4Z5TB 5B32G 5B32D 3MGRC 5AV8A 2IO5C 4Z5TC 3B6FA 5B31A 4ZUXB 2L5AA 2AROA 1HQ3D 5F99A 3H0RC 2XD1A 5B40D 3LJAD 1H3OB 4H9QA 5CP6C 2HIOC 5AV8D 1P34D 3MGQA 5B31D 3REID 3O62A 1U35B 5AV6A 4J8VB 3MGSA 4J8XD 3AZED 4LD9B 4DQYB 3LZ1B 3X1SA 4LD9C 2F8NH 3AZJD 2Y2KA 3AZHA 4QLCC 3MNNB 2FJ7B 1Q9CA 1ULYA 2FJ7C 5GT3A 4Z66A 2F8NK 2Y2OA 4XZQC 3UTAA 5AV9C 3WA9B 1P3IB 3WTPB 1P3MB 1M19A 3WA9C 3WTPC 1P3MC 1P3FB 2W8SA 1P3BA 3C1CB 3X1TA 1P3FC 4WU8B 2FFFB 3C1CC 1P3GA 2J8PA 3AV2B 3WAAD 4WU8C 1W2EA 3AV2C 3W98A 5B0YC 3VH6W 5B2JD 4NFTA 4YS3B 1M18A 4JJNC 4Z5TA 3AZGD 4KUDD 5GT0D 3AZMD 4ZUXA 5AVCB 3X1TD 5AVCC 3VH6A 3UTBB 3UTBC 5BNVB 1Z2CB 2NQBB 1ID3C 1TAFA 5GXQD 5B1LB 3MGRD 5B1LC 1H3OA 3KXBB 3KXBC 3TU4C 1U35A 4J8VA 3VH6T 4XUJD 3A1IA 3W96D 2F8NB 4LD9A 2RVQC 4R8PD 3LZ1A 4M6BA 3IP4C 5CP6D 2HIOD 3MNNA 2FJ7A 1JFIB 1TZYB 4XZQA 5AV9A 1TZYC 3WA9A 2ZY5A 4HGAC 3WTPA 1P3IA 1P3MA 5BT1C 4YM6B 5CPJC 1P3FA 4YM6C 3C1CA 4WU8A 4QLCD 3AV2A 5B32B 3KWQC 5B32C 2LY8A 3MGPC 4YS3A 4XZQD 5AV9D 3KSYA 4X23C 1AOIB 5BO0B 3A6NC 1AOIC 1HQ3B 5AV5B 1P3FD 5AVCA 1KX5B 5AV5C 3LJAB 1KX5C 3LJAC 3UTBA 3AV2D 5B0YD 5AV8B 1P34B 2JCHA 3AV1C 3REIB 4UUZB 5E5AD 5BNVA 1P34C 3REIC 4J8XB 4JJND 2NQBA 3B6GC 5B1LA 4J8XC 3AZEB 4G91B 3KXBA 3AZEC 3AZJB 3AZJC 4DRAA 2F8NA 3KUYD 1ID3D 3EPJA 2Y2QA 3TU4D 1JFIA 1TZYA 3WAAB 3WAAC 5B2JB 4YM6A 5B2JC 3X1UD 2RIQA 2Y2HA 5B32A 3AZGB 4KUDB 5GT0B 3AZGC 3AZMB 5GT0C 1BFMA 3AZMC 3REJD 2Y2LA 3AFAD 3C1BC 5BT1D 3B6FC 1AOIA 5CPJD 5BO0A 1HQ3A 5AV5A 3AN2B 1P3OD 5GXQB 1KX5A 3LJAA 3AN2C 3MGRB 5CPIB 3KWQD 2IO5B 5CPIC 1P34A 3MGPD 3REIA 4UUZA 3WTPE 3LELD 4XUJB 4H9SC 4X23D 4J8XA 3W99B 4XUJC 3W96B 3WKJD 4NE5A 3AZEA 3W99C 3W96C 4R8PB 3A6ND 1AOID 4R8PC 3AZJA 5AV5D 1TAFB 1KX5D 5B33C 3AL0C 5CP6B 2HIOB 1KX4B 3REKD 3AV1D 1KX4C 3LZ0C 2ZY3A 3UT9D 4CSRB 3B6GD 5B0ZC 4J8WC 4QLCB 4CAYB 3WAAA 5B2JA 3AZLC 4XZQB 5AV9B 4H9NB 3AZGA 4KUDA 2Y2NA 5GT0A 3AZMA 5B0YB 3KFUG 5E5AB 4JJNB 2YFWB 5E5AC 2HUEC 3AN2A 1M1AC 5GXQA 3MGRA 5CPIA 1KX3C 2ZY4A 5JRGC 4H9SA 4XUJA 5AVBD 3W99A 3W96A 3C1BD 5B24C 3KUYB 4DRBA 4R8PA 3KUYC 2NZDB 2Y2MA 3MVDC 1ID3B 2NZDC 5DNMC 3AN2D 5CP6A 2HIOA 5CPID 1KX4A 2G5HC 3R45B 3LZ0A 4J8UC 3TU4B 4CSRA 2YFVB 3W99D 1EQZD 3X1UB 5KDMB 3X1UC 2CV5D 1N1JB 5B33D 4QLCA 4KGCD 4CAYA 3W97C 1KX4D 2DQNC 3LZ0D 3AZFB 3AZFC 3REJB 3AFAB 3REJC 4HGAB 5B0ZD 4J8WD 3AFAC 5CPKB 5CPJB 5CPKC 4H9NA 5CPJA 1P3OB 1PZRA 1P3OC 3KWQB 3AZKC 5B0YA 2BG1A 3MGPB 3AZLD 5B2ID 5E5AA 3LELB 2ZM5A 2YFWA 4X23B 4JJNA 3LELC 3WKJB 3A6NB 3WKJC 4WU9C 2JE5A 3REKB 3AV1B 3KUYA 1B6WA 3REKC 3UT9B 3B6GB 2NZDA 5DNMA 1M1AD 3UT9C 1ID3A 1KX3D 4NE6A 2XD5A 4WNNA 3R45A 5JRGD 4AWLB 3TU4A 3X1VD 5AY8D 4AWLC 2YFVA 5B24D 1P3KD 2PYOD 3MVDD 3X1UA 2NZDD 5KDMA 5DNMD 1N1JA 3AZND 1F66D 5GSUD 1P3PB 1BH8B 4J8UD 2BYMB 1P3AC 3AZFA 1P3PC 3REJA 3AFAA 5CPKA 2BYKB 1B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R B;  1P3O A;  3KWQ A;  3W97 D;  3MGP A;  3AZF D;  3LEL A;  4X23 A;  5FUG B;  5AVB B;  3C1B B;  3WKJ A;  5AVB C;  5CPK D;  1ZLA D;  3A6N A;  3O62 C;  5AV6 C;  3REH B;  1R4V A;  5JA4 B;  3AZI D;  3REH C;  3AZK D;  3REK A;  3AV1 A;  4KHA B;  5CHL B;  3UT9 A;  3B6G A;  3AZH C;  1EQZ B;  4H9O B;  1EQZ C;  4Z66 C;  4WU9 D;  2CV5 B;  4Z2M G;  5B33 B;  4KGC B;  2CV5 C;  4KGC C;  1M19 C;  3LZ0 B;  5BS7 C;  1P3G C;  5B0Z B;  4J8W B;  1P3P A;  1BH8 A;  2BYM A;  4G92 B;  4G92 C;  3NQJ B;  5G49 B;  1WWS A;  2BYK A;  3AZL B;  5B2I B;  4ZUX C;  5B2I C;  4H9R A;  1P3A D;  1P3P D;  4EO5 B;  1S32 D;  4EO5 C;  3AYW D;  5FUG A;  5AVB A;  3B0C W;  3C1B A;  3B6F D;  5B31 G;  1U35 C;  2HUE B;  1M1A B;  4J8V C;  3REH A;  5JA4 A;  1KX3 B;  5DNN B;  2ARO D;  5JRG B;  5DNN C;  3NQU B;  3LZ1 C;  4KHA A;  5F99 D;  5AY8 B;  3X1V B;  3X1V C;  5AY8 C;  3V9R B;  4E45 A;  5B24 B;  4Z2M H;  1P3K B;  3MNN C;  2PYO B;  1P3K C;  3MGQ D;  4H9O A;  4E44 A;  3O62 D;  3MVD B;  5AV6 D;  1EQZ A;  2PYO C;  3MGS D;  5DNM B;  2CV5 A;  5B33 A;  3REH D;  3AZN B;  1F66 B;  4KGC A;  5GSU B;  3AZN C;  1P3I C;  1F66 C;  3X1S D;  5GSU C;  4J8U B;  4H9P B;  4WNN B;  5BS7 A;  4NE3 A;  3B0C T;  3AZH D;  5B0Z A;  4J8W A;  5GT3 D;  4Z66 D;  4YS3 C;  2JSS A;  3UTA D;  1KU5 A;  1M19 D;  3W97 B;  3NQJ A;  5G49 A;  3AZL A;  1P3B D;  5B2I A;  1P3G D;  3W98 D;  1ZLA B;  2CWE A;  1ZLA C;  1M18 D;  3AZI B;  2NQB C;  4WZS B;  3AZK B;  3AZI C;  4Z5T D;  5BNX B;  4ZUX D;  1M1A A;  1KX3 A;  5DNN A;  3REL B;  5JRG A;  3NQU A;  4WU9 B;  3X1V A;  5AY8 A;  3REL C;  3V9R A;  5B24 A;  1P3K A;  1A7W A;  2PYO A;  3MVD A;  1U35 D;  4J8V D;  1HTA A;  5B1M B;  3AZN A;  1F66 A;  5GSU A;  4LD9 D;  5B1M C;  1P3L B;  3LZ1 D;  5DNN D;  4J8U A;  4H9P A;  1P3L C;  1BH9 B;  3MNN D;  2FJ7 D;  3WA9 D;  1P3I D;  3W97 A;  3WTP D;  1P3M D;  1P3A B;  1F1E A;  4ZBJ B;  3C1C D;  1HQ3 C;  4ZBJ C;  5B40 B;  1S32 B;  4WU8 D;  3AYW B;  3B0D B;  5B40 C;  1S32 C;  3AYW C;  3B0D C;  3B6F B;  5B31 B;  1ZLA A;  5AV8 C;  5B31 C;  4YS3 D;  3AZI A;  3AZK A;  2ARO B;  5BNX A;  2ARO C;  4G91 C;  5F99 B;  5AVC D;  5F99 C;  4H9Q B;  3UTB D;  3VH5 W;  3MGQ B;  3O62 B;  5AV6 B;  3REL A;  3MGQ C;  3MGS B;  4WU9 A;  2NQB D;  3MGS C;  5B1L D;  3X1S B;  3KXB D;  3X1S C;  3VH5 A;  3AZH B;  5B1M A;  2RVQ D;  2F8N D;  2F8N G;  1P3L A;  5GT3 B;  4Z66 B;  3REL D;  5GT3 C;  3UTA B;  1WWI A;  3UTA C;  1M19 B;  1BH9 A;  1P3B B;  4KUD C;  1TZY D;  3VH5 T;  3X1T B;  1P3B C;  4WV4 B;  3X1T C;  1P3G B;  3W98 B;  5B1M D;  5C3I B;  3W98 C;  4YM6 D;  5C3I C;  1P3A A;  1P3L D;  1M18 B;  5B40 A;  1S32 A;  1M18 C;  3B0B A;  5GXQ C;  3AYW A;  4Z5T B;  5B32 G;  5B32 D;  3MGR C;  5AV8 A;  2IO5 C;  4Z5T C;  3B6F A;  5B31 A;  4ZUX B;  2L5A A;  2ARO A;  1HQ3 D;  5F99 A;  5B40 D;  3LJA D;  4H9Q A;  1H3O B;  5CP6 C;  2HIO C;  5AV8 D;  1P34 D;  3MGQ A;  5B31 D;  3REI D;  3O62 A;  1U35 B;  5AV6 A;  4J8V B;  3MGS A;  4J8X D;  3AZE D;  4LD9 B;  3LZ1 B;  3X1S A;  4LD9 C;  2F8N H;  3AZJ D;  3AZH A;  4QLC C;  3MNN B;  2FJ7 B;  1Q9C A;  1ULY A;  2FJ7 C;  5GT3 A;  4Z66 A;  2F8N K;  4XZQ C;  3UTA A;  5AV9 C;  3WA9 B;  1P3I B;  3WTP B;  1P3M B;  1M19 A;  3WA9 C;  3WTP C;  1P3M C;  1P3F B;  1P3B A;  3C1C B;  3X1T A;  1P3F C;  4WU8 B;  3C1C C;  1P3G A;  3AV2 B;  3WAA D;  4WU8 C;  3AV2 C;  3W98 A;  5B0Y C;  3VH6 W;  5B2J D;  4NFT A;  4YS3 B;  1M18 A;  4JJN C;  4Z5T A;  3AZG D;  4KUD D;  5GT0 D;  3AZM D;  4ZUX A;  5AVC B;  3X1T D;  5AVC C;  3VH6 A;  3UTB B;  3UTB C;  5BNV B;  2NQB B;  1ID3 C;  1TAF A;  5GXQ D;  5B1L B;  3MGR D;  5B1L C;  1H3O A;  3KXB B;  3KXB C;  3TU4 C;  1U35 A;  4J8V A;  3VH6 T;  4XUJ D;  3W96 D;  2F8N B;  4LD9 A;  2RVQ C;  4R8P D;  3LZ1 A;  4M6B A;  5CP6 D;  2HIO D;  3MNN A;  2FJ7 A;  1JFI B;  1TZY B;  4XZQ A;  5AV9 A;  1TZY C;  3WA9 A;  4HGA C;  3WTP A;  1P3I A;  1P3M A;  5BT1 C;  4YM6 B;  5CPJ C;  1P3F A;  4YM6 C;  3C1C A;  4WU8 A;  4QLC D;  3AV2 A;  5B32 B;  3KWQ C;  5B32 C;  2LY8 A;  3MGP C;  4YS3 A;  4XZQ D;  5AV9 D;  3KSY A;  4X23 C;  1AOI B;  5BO0 B;  3A6N C;  1AOI C;  1HQ3 B;  5AV5 B;  1P3F D;  5AVC A;  1KX5 B;  5AV5 C;  3LJA B;  1KX5 C;  3LJA C;  3UTB A;  3AV2 D;  5B0Y D;  5AV8 B;  1P34 B;  3AV1 C;  3REI B;  4UUZ B;  5E5A D;  5BNV A;  1P34 C;  3REI C;  4J8X B;  4JJN D;  2NQB A;  3B6G C;  5B1L A;  4J8X C;  3AZE B;  4G91 B;  3KXB A;  3AZE C;  3AZJ B;  3AZJ C;  4DRA A;  2F8N A;  3KUY D;  1ID3 D;  3TU4 D;  1JFI A;  1TZY A;  3WAA B;  3WAA C;  5B2J B;  4YM6 A;  5B2J C;  3X1U D;  5B32 A;  3AZG B;  4KUD B;  5GT0 B;  3AZG C;  3AZM B;  5GT0 C;  1BFM A;  3AZM C;  3REJ D;  3AFA D;  3C1B C;  5BT1 D;  3B6F C;  1AOI A;  5CPJ D;  5BO0 A;  1HQ3 A;  5AV5 A;  3AN2 B;  1P3O D;  5GXQ B;  1KX5 A;  3LJA A;  3AN2 C;  3MGR B;  5CPI B;  3KWQ D;  2IO5 B;  5CPI C;  1P34 A;  3MGP D;  3REI A;  4UUZ A;  3WTP E;  3LEL D;  4XUJ B;  4H9S C;  4X23 D;  4J8X A;  3W99 B;  4XUJ C;  3W96 B;  3WKJ D;  4NE5 A;  3AZE A;  3W99 C;  3W96 C;  4R8P B;  3A6N D;  1AOI D;  4R8P C;  3AZJ A;  5AV5 D;  1TAF B;  1KX5 D;  5B33 C;  5CP6 B;  2HIO B;  1KX4 B;  3REK D;  3AV1 D;  1KX4 C;  3LZ0 C;  3UT9 D;  3B6G D;  4CSR B;  5B0Z C;  4J8W C;  4QLC B;  4CAY B;  3WAA A;  5B2J A;  3AZL C;  4XZQ B;  5AV9 B;  4H9N B;  3AZG A;  4KUD A;  5GT0 A;  3AZM A;  5B0Y B;  5E5A B;  4JJN B;  2YFW B;  5E5A C;  2HUE C;  3AN2 A;  1M1A C;  5GXQ A;  3MGR A;  5CPI A;  1KX3 C;  5JRG C;  4H9S A;  4XUJ A;  5AVB D;  3W99 A;  3W96 A;  3C1B D;  5B24 C;  3KUY B;  4DRB A;  4R8P A;  3KUY C;  2NZD B;  3MVD C;  1ID3 B;  2NZD C;  5DNM C;  3AN2 D;  5CP6 A;  2HIO A;  5CPI D;  1KX4 A;  3R45 B;  3LZ0 A;  4J8U C;  3TU4 B;  4CSR A;  2YFV B;  3W99 D;  1EQZ D;  3X1U B;  5KDM B;  3X1U C;  2CV5 D;  1N1J B;  5B33 D;  4QLC A;  4KGC D;  4CAY A;  3W97 C;  1KX4 D;  3LZ0 D;  3AZF B;  3AZF C;  3REJ B;  3AFA B;  3REJ C;  4HGA B;  5B0Z D;  4J8W D;  3AFA C;  5CPK B;  5CPJ B;  5CPK C;  4H9N A;  5CPJ A;  1P3O B;  1P3O C;  3KWQ B;  3AZK C;  5B0Y A;  3MGP B;  3AZL D;  5B2I D;  5E5A A;  3LEL B;  4JJN A;  2YFW A;  4X23 B;  3LEL C;  3WKJ B;  3A6N B;  3WKJ C;  4WU9 C;  3REK B;  3AV1 B;  3KUY A;  1B6W A;  3REK C;  3UT9 B;  3B6G B;  2NZD A;  5DNM A;  1M1A D;  3UT9 C;  1ID3 A;  1KX3 D;  4NE6 A;  4WNN A;  3R45 A;  5JRG D;  4AWL B;  3TU4 A;  3X1V D;  5AY8 D;  4AWL C;  2YFV A;  5B24 D;  1P3K D;  2PYO D;  3MVD D;  3X1U A;  2NZD D;  5KDM A;  5DNM D;  1N1J A;  3AZN D;  1F66 D;  5GSU D;  1P3P B;  1BH8 B;  4J8U D;  2BYM B;  1P3A C;  3AZF A;  1P3P C;  3REJ A;  3AFA A;  5CPK A;  2BYK B;  1B67 A; 
#chains in the Genus database with same CATH topology
 4H9R B;  1P3O A;  3KWQ A;  3W97 D;  3MGP A;  3AZF D;  3LEL A;  4X23 A;  5FUG B;  5AVB B;  3C1B B;  3WKJ A;  5AVB C;  5CPK D;  1ZLA D;  3A6N A;  3O62 C;  5AV6 C;  3REH B;  1R4V A;  5JA4 B;  3AZI D;  3REH C;  3AZK D;  3REK A;  3AV1 A;  4KHA B;  5CHL B;  3UT9 A;  3B6G A;  3AZH C;  1EQZ B;  4H9O B;  4WJ3 C;  1EQZ C;  4Z66 C;  4WU9 D;  2CV5 B;  4Z2M G;  5B33 B;  4KGC B;  2CV5 C;  4KGC C;  1M19 C;  3LZ0 B;  5BS7 C;  1P3G C;  5B0Z B;  4J8W B;  1P3P A;  1BH8 A;  2BYM A;  4G92 B;  2Y2I A;  4G92 C;  4UPK A;  2Y2J A;  3NQJ B;  5G49 B;  1WWS A;  2BYK A;  3AZL B;  5B2I B;  4ZUX C;  5B2I C;  4H9R A;  2UWX A;  1P3A D;  1P3P D;  4EO5 B;  1S32 D;  4EO5 C;  3AYW D;  2ZY2 A;  5FUG A;  5AVB A;  3B0C W;  3C1B A;  3B6F D;  5B31 G;  1U35 C;  2HUE B;  1M1A B;  4J8V C;  3REH A;  2F2A C;  5JA4 A;  1KX3 B;  5DNN B;  2ARO D;  5JRG B;  5DNN C;  3NQU B;  3LZ1 C;  4KHA A;  5F99 D;  5AY8 B;  3X1V B;  3X1V C;  5AY8 C;  3V9R B;  4E45 A;  5B24 B;  4Z2M H;  1P3K B;  3MNN C;  2PYO B;  1P3K C;  3MGQ D;  4H9O A;  4E44 A;  3O62 D;  3MVD B;  5AV6 D;  1EQZ A;  2PYO C;  3MGS D;  5DNM B;  2CV5 A;  5B33 A;  3REH D;  3AZN B;  1F66 B;  4KGC A;  5GSU B;  3AZN C;  1P3I C;  1F66 C;  3X1S D;  5GSU C;  4J8U B;  4H9P B;  4WNN B;  5BS7 A;  4NE3 A;  3B0C T;  2G5I C;  3AZH D;  5B0Z A;  4J8W A;  3H0M C;  5GT3 D;  4Z66 D;  4YS3 C;  2JSS A;  3UTA D;  1KU5 A;  1M19 D;  3W97 B;  3NQJ A;  5G49 A;  3AZL A;  1P3B D;  5B2I A;  1P3G D;  3W98 D;  1ZLA B;  2CWE A;  1ZLA C;  1M18 D;  3AZI B;  2NQB C;  4WZS B;  3AZK B;  3AZI C;  4Z5T D;  5BNX B;  3F6T A;  4ZUX D;  1M1A A;  1KX3 A;  2VQR A;  5DNN A;  3REL B;  5JRG A;  3NQU A;  4WU9 B;  3X1V A;  5AY8 A;  3REL C;  3V9R A;  5B24 A;  1P3K A;  1A7W A;  2PYO A;  3MVD A;  1U35 D;  4J8V D;  1HTA A;  3H0L C;  5B1M B;  3AZN A;  1F66 A;  5GSU A;  4LD9 D;  5B1M C;  1P3L B;  3LZ1 D;  5DNN D;  4J8U A;  2Y2P A;  4H9P A;  1P3L C;  2Y2G A;  1BH9 B;  3MNN D;  2FJ7 D;  3WA9 D;  1P3I D;  3W97 A;  3WTP D;  1P3M D;  1P3A B;  1F1E A;  4ZBJ B;  3C1C D;  1HQ3 C;  4ZBJ C;  5B40 B;  1S32 B;  4WU8 D;  3AYW B;  3B0D B;  5B40 C;  1S32 C;  3AYW C;  3B0D C;  3FDD A;  3B6F B;  5B31 B;  1ZLA A;  5AV8 C;  3P5J B;  5B31 C;  4YS3 D;  3EG5 B;  1T3U A;  3AZI A;  3AZK A;  2ARO B;  5BNX A;  2ARO C;  4G91 C;  5F99 B;  5AVC D;  5F99 C;  4H9Q B;  3UTB D;  3VH5 W;  3MGQ B;  3O62 B;  5AV6 B;  3REL A;  3MGQ C;  3MGS B;  4WU9 A;  2NQB D;  3MGS C;  5B1L D;  3A1K A;  3EPH A;  3X1S B;  3KXB D;  3X1S C;  3VH5 A;  3AZH B;  5B1M A;  2RVQ D;  2F8N D;  2F8N G;  1P3L A;  5GT3 B;  4Z66 B;  3REL D;  5GT3 C;  3UTA B;  1WWI A;  3EPL A;  3UTA C;  1M19 B;  1BH9 A;  3EPK A;  1P3B B;  4KUD C;  1TZY D;  3VH5 T;  3X1T B;  1P3B C;  4WV4 B;  3X1T C;  1P3G B;  3W98 B;  5B1M D;  5C3I B;  3W98 C;  4YM6 D;  5C3I C;  1P3A A;  1P3L D;  1M18 B;  5B40 A;  1S32 A;  1M18 C;  3B0B A;  5GXQ C;  3AYW A;  2DF4 C;  4Z5T B;  5B32 G;  5B32 D;  3MGR C;  5AV8 A;  2IO5 C;  4Z5T C;  3B6F A;  5B31 A;  4ZUX B;  2L5A A;  2ARO A;  1HQ3 D;  5F99 A;  3H0R C;  2XD1 A;  5B40 D;  3LJA D;  1H3O B;  4H9Q A;  5CP6 C;  2HIO C;  5AV8 D;  1P34 D;  3MGQ A;  5B31 D;  3REI D;  3O62 A;  1U35 B;  5AV6 A;  4J8V B;  3MGS A;  4J8X D;  3AZE D;  4LD9 B;  4DQY B;  3LZ1 B;  3X1S A;  4LD9 C;  2F8N H;  3AZJ D;  2Y2K A;  3AZH A;  4QLC C;  3MNN B;  2FJ7 B;  1Q9C A;  1ULY A;  2FJ7 C;  5GT3 A;  4Z66 A;  2F8N K;  2Y2O A;  4XZQ C;  3UTA A;  5AV9 C;  3WA9 B;  1P3I B;  3WTP B;  1P3M B;  1M19 A;  3WA9 C;  3WTP C;  1P3M C;  1P3F B;  2W8S A;  1P3B A;  3C1C B;  3X1T A;  1P3F C;  4WU8 B;  2FFF B;  3C1C C;  1P3G A;  2J8P A;  3AV2 B;  3WAA D;  4WU8 C;  1W2E A;  3AV2 C;  3W98 A;  5B0Y C;  3VH6 W;  5B2J D;  4NFT A;  4YS3 B;  1M18 A;  4JJN C;  4Z5T A;  3AZG D;  4KUD D;  5GT0 D;  3AZM D;  4ZUX A;  5AVC B;  3X1T D;  5AVC C;  3VH6 A;  3UTB B;  3UTB C;  5BNV B;  1Z2C B;  2NQB B;  1ID3 C;  1TAF A;  5GXQ D;  5B1L B;  3MGR D;  5B1L C;  1H3O A;  3KXB B;  3KXB C;  3TU4 C;  1U35 A;  4J8V A;  3VH6 T;  4XUJ D;  3A1I A;  3W96 D;  2F8N B;  4LD9 A;  2RVQ C;  4R8P D;  3LZ1 A;  4M6B A;  3IP4 C;  5CP6 D;  2HIO D;  3MNN A;  2FJ7 A;  1JFI B;  1TZY B;  4XZQ A;  5AV9 A;  1TZY C;  3WA9 A;  2ZY5 A;  4HGA C;  3WTP A;  1P3I A;  1P3M A;  5BT1 C;  4YM6 B;  5CPJ C;  1P3F A;  4YM6 C;  3C1C A;  4WU8 A;  4QLC D;  3AV2 A;  5B32 B;  3KWQ C;  5B32 C;  2LY8 A;  3MGP C;  4YS3 A;  4XZQ D;  5AV9 D;  3KSY A;  4X23 C;  1AOI B;  5BO0 B;  3A6N C;  1AOI C;  1HQ3 B;  5AV5 B;  1P3F D;  5AVC A;  1KX5 B;  5AV5 C;  3LJA B;  1KX5 C;  3LJA C;  3UTB A;  3AV2 D;  5B0Y D;  5AV8 B;  1P34 B;  2JCH A;  3AV1 C;  3REI B;  4UUZ B;  5E5A D;  5BNV A;  1P34 C;  3REI C;  4J8X B;  4JJN D;  2NQB A;  3B6G C;  5B1L A;  4J8X C;  3AZE B;  4G91 B;  3KXB A;  3AZE C;  3AZJ B;  3AZJ C;  4DRA A;  2F8N A;  3KUY D;  1ID3 D;  3EPJ A;  2Y2Q A;  3TU4 D;  1JFI A;  1TZY A;  3WAA B;  3WAA C;  5B2J B;  4YM6 A;  5B2J C;  3X1U D;  2RIQ A;  2Y2H A;  5B32 A;  3AZG B;  4KUD B;  5GT0 B;  3AZG C;  3AZM B;  5GT0 C;  1BFM A;  3AZM C;  3REJ D;  2Y2L A;  3AFA D;  3C1B C;  5BT1 D;  3B6F C;  1AOI A;  5CPJ D;  5BO0 A;  1HQ3 A;  5AV5 A;  3AN2 B;  1P3O D;  5GXQ B;  1KX5 A;  3LJA A;  3AN2 C;  3MGR B;  5CPI B;  3KWQ D;  2IO5 B;  5CPI C;  1P34 A;  3MGP D;  3REI A;  4UUZ A;  3WTP E;  3LEL D;  4XUJ B;  4H9S C;  4X23 D;  4J8X A;  3W99 B;  4XUJ C;  3W96 B;  3WKJ D;  4NE5 A;  3AZE A;  3W99 C;  3W96 C;  4R8P B;  3A6N D;  1AOI D;  4R8P C;  3AZJ A;  5AV5 D;  1TAF B;  1KX5 D;  5B33 C;  3AL0 C;  5CP6 B;  2HIO B;  1KX4 B;  3REK D;  3AV1 D;  1KX4 C;  3LZ0 C;  2ZY3 A;  3UT9 D;  4CSR B;  3B6G D;  5B0Z C;  4J8W C;  4QLC B;  4CAY B;  3WAA A;  5B2J A;  3AZL C;  4XZQ B;  5AV9 B;  4H9N B;  3AZG A;  4KUD A;  2Y2N A;  5GT0 A;  3AZM A;  5B0Y B;  3KFU G;  5E5A B;  4JJN B;  2YFW B;  5E5A C;  2HUE C;  3AN2 A;  1M1A C;  5GXQ A;  3MGR A;  5CPI A;  1KX3 C;  2ZY4 A;  5JRG C;  4H9S A;  4XUJ A;  5AVB D;  3W99 A;  3W96 A;  3C1B D;  5B24 C;  3KUY B;  4DRB A;  4R8P A;  3KUY C;  2NZD B;  2Y2M A;  3MVD C;  1ID3 B;  2NZD C;  5DNM C;  3AN2 D;  5CP6 A;  2HIO A;  5CPI D;  1KX4 A;  2G5H C;  3R45 B;  3LZ0 A;  4J8U C;  3TU4 B;  4CSR A;  2YFV B;  3W99 D;  1EQZ D;  3X1U B;  5KDM B;  3X1U C;  2CV5 D;  1N1J B;  5B33 D;  4QLC A;  4KGC D;  4CAY A;  3W97 C;  1KX4 D;  2DQN C;  3LZ0 D;  3AZF B;  3AZF C;  3REJ B;  3AFA B;  3REJ C;  4HGA B;  5B0Z D;  4J8W D;  3AFA C;  5CPK B;  5CPJ B;  5CPK C;  4H9N A;  5CPJ A;  1P3O B;  1PZR A;  1P3O C;  3KWQ B;  3AZK C;  5B0Y A;  2BG1 A;  3MGP B;  3AZL D;  5B2I D;  5E5A A;  3LEL B;  2ZM5 A;  2YFW A;  4X23 B;  4JJN A;  3LEL C;  3WKJ B;  3A6N B;  3WKJ C;  4WU9 C;  2JE5 A;  3REK B;  3AV1 B;  3KUY A;  1B6W A;  3REK C;  3UT9 B;  3B6G B;  2NZD A;  5DNM A;  1M1A D;  3UT9 C;  1ID3 A;  1KX3 D;  4NE6 A;  2XD5 A;  4WNN A;  3R45 A;  5JRG D;  4AWL B;  3TU4 A;  3X1V D;  5AY8 D;  4AWL C;  2YFV A;  5B24 D;  1P3K D;  2PYO D;  3MVD D;  3X1U A;  2NZD D;  5KDM A;  5DNM D;  1N1J A;  3AZN D;  1F66 D;  5GSU D;  1P3P B;  1BH8 B;  4J8U D;  2BYM B;  1P3A C;  3AZF A;  1P3P C;  3REJ A;  3AFA A;  5CPK A;  2BYK B;  1B67 A; 
#chains in the Genus database with same CATH homology
 4H9R B;  1P3O A;  3KWQ A;  3W97 D;  3MGP A;  3AZF D;  3LEL A;  4X23 A;  5FUG B;  5AVB B;  3C1B B;  3WKJ A;  5AVB C;  5CPK D;  1ZLA D;  3A6N A;  3O62 C;  5AV6 C;  3REH B;  1R4V A;  5JA4 B;  3AZI D;  3REH C;  3AZK D;  3REK A;  3AV1 A;  4KHA B;  5CHL B;  3UT9 A;  3B6G A;  3AZH C;  1EQZ B;  4H9O B;  4WJ3 C;  1EQZ C;  4Z66 C;  4WU9 D;  2CV5 B;  4Z2M G;  5B33 B;  4KGC B;  2CV5 C;  4KGC C;  1M19 C;  3LZ0 B;  5BS7 C;  1P3G C;  5B0Z B;  4J8W B;  1P3P A;  1BH8 A;  2BYM A;  4G92 B;  2Y2I A;  4G92 C;  4UPK A;  2Y2J A;  3NQJ B;  5G49 B;  1WWS A;  2BYK A;  3AZL B;  5B2I B;  4ZUX C;  5B2I C;  4H9R A;  2UWX A;  1P3A D;  1P3P D;  4EO5 B;  1S32 D;  4EO5 C;  3AYW D;  2ZY2 A;  5FUG A;  5AVB A;  3B0C W;  3C1B A;  3B6F D;  5B31 G;  1U35 C;  2HUE B;  1M1A B;  4J8V C;  3REH A;  2F2A C;  5JA4 A;  1KX3 B;  5DNN B;  2ARO D;  5JRG B;  5DNN C;  3NQU B;  3LZ1 C;  4KHA A;  5F99 D;  5AY8 B;  3X1V B;  3X1V C;  5AY8 C;  3V9R B;  4E45 A;  5B24 B;  4Z2M H;  1P3K B;  3MNN C;  2PYO B;  1P3K C;  3MGQ D;  4H9O A;  4E44 A;  3O62 D;  3MVD B;  5AV6 D;  1EQZ A;  2PYO C;  3MGS D;  5DNM B;  2CV5 A;  5B33 A;  3REH D;  3AZN B;  1F66 B;  4KGC A;  5GSU B;  3AZN C;  1P3I C;  1F66 C;  3X1S D;  5GSU C;  4J8U B;  4H9P B;  4WNN B;  5BS7 A;  4NE3 A;  3B0C T;  2G5I C;  3AZH D;  5B0Z A;  4J8W A;  3H0M C;  5GT3 D;  4Z66 D;  4YS3 C;  2JSS A;  3UTA D;  1KU5 A;  1M19 D;  3W97 B;  3NQJ A;  5G49 A;  3AZL A;  1P3B D;  5B2I A;  1P3G D;  3W98 D;  1ZLA B;  2CWE A;  1ZLA C;  1M18 D;  3AZI B;  2NQB C;  4WZS B;  3AZK B;  3AZI C;  4Z5T D;  5BNX B;  3F6T A;  4ZUX D;  1M1A A;  1KX3 A;  2VQR A;  5DNN A;  3REL B;  5JRG A;  3NQU A;  4WU9 B;  3X1V A;  5AY8 A;  3REL C;  3V9R A;  5B24 A;  1P3K A;  1A7W A;  2PYO A;  3MVD A;  1U35 D;  4J8V D;  1HTA A;  3H0L C;  5B1M B;  3AZN A;  1F66 A;  5GSU A;  4LD9 D;  5B1M C;  1P3L B;  3LZ1 D;  5DNN D;  4J8U A;  2Y2P A;  4H9P A;  1P3L C;  2Y2G A;  1BH9 B;  3MNN D;  2FJ7 D;  3WA9 D;  1P3I D;  3W97 A;  3WTP D;  1P3M D;  1P3A B;  1F1E A;  4ZBJ B;  3C1C D;  1HQ3 C;  4ZBJ C;  5B40 B;  1S32 B;  4WU8 D;  3AYW B;  3B0D B;  5B40 C;  1S32 C;  3AYW C;  3B0D C;  3FDD A;  3B6F B;  5B31 B;  1ZLA A;  5AV8 C;  3P5J B;  5B31 C;  4YS3 D;  3EG5 B;  1T3U A;  3AZI A;  3AZK A;  2ARO B;  5BNX A;  2ARO C;  4G91 C;  5F99 B;  5AVC D;  5F99 C;  4H9Q B;  3UTB D;  3VH5 W;  3MGQ B;  3O62 B;  5AV6 B;  3REL A;  3MGQ C;  3MGS B;  4WU9 A;  2NQB D;  3MGS C;  5B1L D;  3A1K A;  3EPH A;  3X1S B;  3KXB D;  3X1S C;  3VH5 A;  3AZH B;  5B1M A;  2RVQ D;  2F8N D;  2F8N G;  1P3L A;  5GT3 B;  4Z66 B;  3REL D;  5GT3 C;  3UTA B;  1WWI A;  3EPL A;  3UTA C;  1M19 B;  1BH9 A;  3EPK A;  1P3B B;  4KUD C;  1TZY D;  3VH5 T;  3X1T B;  1P3B C;  4WV4 B;  3X1T C;  1P3G B;  3W98 B;  5B1M D;  5C3I B;  3W98 C;  4YM6 D;  5C3I C;  1P3A A;  1P3L D;  1M18 B;  5B40 A;  1S32 A;  1M18 C;  3B0B A;  5GXQ C;  3AYW A;  2DF4 C;  4Z5T B;  5B32 G;  5B32 D;  3MGR C;  5AV8 A;  2IO5 C;  4Z5T C;  3B6F A;  5B31 A;  4ZUX B;  2L5A A;  2ARO A;  1HQ3 D;  5F99 A;  3H0R C;  2XD1 A;  5B40 D;  3LJA D;  1H3O B;  4H9Q A;  5CP6 C;  2HIO C;  5AV8 D;  1P34 D;  3MGQ A;  5B31 D;  3REI D;  3O62 A;  1U35 B;  5AV6 A;  4J8V B;  3MGS A;  4J8X D;  3AZE D;  4LD9 B;  4DQY B;  3LZ1 B;  3X1S A;  4LD9 C;  2F8N H;  3AZJ D;  2Y2K A;  3AZH A;  4QLC C;  3MNN B;  2FJ7 B;  1Q9C A;  1ULY A;  2FJ7 C;  5GT3 A;  4Z66 A;  2F8N K;  2Y2O A;  4XZQ C;  3UTA A;  5AV9 C;  3WA9 B;  1P3I B;  3WTP B;  1P3M B;  1M19 A;  3WA9 C;  3WTP C;  1P3M C;  1P3F B;  2W8S A;  1P3B A;  3C1C B;  3X1T A;  1P3F C;  4WU8 B;  2FFF B;  3C1C C;  1P3G A;  2J8P A;  3AV2 B;  3WAA D;  4WU8 C;  1W2E A;  3AV2 C;  3W98 A;  5B0Y C;  3VH6 W;  5B2J D;  4NFT A;  4YS3 B;  1M18 A;  4JJN C;  4Z5T A;  3AZG D;  4KUD D;  5GT0 D;  3AZM D;  4ZUX A;  5AVC B;  3X1T D;  5AVC C;  3VH6 A;  3UTB B;  3UTB C;  5BNV B;  1Z2C B;  2NQB B;  1ID3 C;  1TAF A;  5GXQ D;  5B1L B;  3MGR D;  5B1L C;  1H3O A;  3KXB B;  3KXB C;  3TU4 C;  1U35 A;  4J8V A;  3VH6 T;  4XUJ D;  3A1I A;  3W96 D;  2F8N B;  4LD9 A;  2RVQ C;  4R8P D;  3LZ1 A;  4M6B A;  3IP4 C;  5CP6 D;  2HIO D;  3MNN A;  2FJ7 A;  1JFI B;  1TZY B;  4XZQ A;  5AV9 A;  1TZY C;  3WA9 A;  2ZY5 A;  4HGA C;  3WTP A;  1P3I A;  1P3M A;  5BT1 C;  4YM6 B;  5CPJ C;  1P3F A;  4YM6 C;  3C1C A;  4WU8 A;  4QLC D;  3AV2 A;  5B32 B;  3KWQ C;  5B32 C;  2LY8 A;  3MGP C;  4YS3 A;  4XZQ D;  5AV9 D;  3KSY A;  4X23 C;  1AOI B;  5BO0 B;  3A6N C;  1AOI C;  1HQ3 B;  5AV5 B;  1P3F D;  5AVC A;  1KX5 B;  5AV5 C;  3LJA B;  1KX5 C;  3LJA C;  3UTB A;  3AV2 D;  5B0Y D;  5AV8 B;  1P34 B;  2JCH A;  3AV1 C;  3REI B;  4UUZ B;  5E5A D;  5BNV A;  1P34 C;  3REI C;  4J8X B;  4JJN D;  2NQB A;  3B6G C;  5B1L A;  4J8X C;  3AZE B;  4G91 B;  3KXB A;  3AZE C;  3AZJ B;  3AZJ C;  4DRA A;  2F8N A;  3KUY D;  1ID3 D;  3EPJ A;  2Y2Q A;  3TU4 D;  1JFI A;  1TZY A;  3WAA B;  3WAA C;  5B2J B;  4YM6 A;  5B2J C;  3X1U D;  2RIQ A;  2Y2H A;  5B32 A;  3AZG B;  4KUD B;  5GT0 B;  3AZG C;  3AZM B;  5GT0 C;  1BFM A;  3AZM C;  3REJ D;  2Y2L A;  3AFA D;  3C1B C;  5BT1 D;  3B6F C;  1AOI A;  5CPJ D;  5BO0 A;  1HQ3 A;  5AV5 A;  3AN2 B;  1P3O D;  5GXQ B;  1KX5 A;  3LJA A;  3AN2 C;  3MGR B;  5CPI B;  3KWQ D;  2IO5 B;  5CPI C;  1P34 A;  3MGP D;  3REI A;  4UUZ A;  3WTP E;  3LEL D;  4XUJ B;  4H9S C;  4X23 D;  4J8X A;  3W99 B;  4XUJ C;  3W96 B;  3WKJ D;  4NE5 A;  3AZE A;  3W99 C;  3W96 C;  4R8P B;  3A6N D;  1AOI D;  4R8P C;  3AZJ A;  5AV5 D;  1TAF B;  1KX5 D;  5B33 C;  3AL0 C;  5CP6 B;  2HIO B;  1KX4 B;  3REK D;  3AV1 D;  1KX4 C;  3LZ0 C;  2ZY3 A;  3UT9 D;  4CSR B;  3B6G D;  5B0Z C;  4J8W C;  4QLC B;  4CAY B;  3WAA A;  5B2J A;  3AZL C;  4XZQ B;  5AV9 B;  4H9N B;  3AZG A;  4KUD A;  2Y2N A;  5GT0 A;  3AZM A;  5B0Y B;  3KFU G;  5E5A B;  4JJN B;  2YFW B;  5E5A C;  2HUE C;  3AN2 A;  1M1A C;  5GXQ A;  3MGR A;  5CPI A;  1KX3 C;  2ZY4 A;  5JRG C;  4H9S A;  4XUJ A;  5AVB D;  3W99 A;  3W96 A;  3C1B D;  5B24 C;  3KUY B;  4DRB A;  4R8P A;  3KUY C;  2NZD B;  2Y2M A;  3MVD C;  1ID3 B;  2NZD C;  5DNM C;  3AN2 D;  5CP6 A;  2HIO A;  5CPI D;  1KX4 A;  2G5H C;  3R45 B;  3LZ0 A;  4J8U C;  3TU4 B;  4CSR A;  2YFV B;  3W99 D;  1EQZ D;  3X1U B;  5KDM B;  3X1U C;  2CV5 D;  1N1J B;  5B33 D;  4QLC A;  4KGC D;  4CAY A;  3W97 C;  1KX4 D;  2DQN C;  3LZ0 D;  3AZF B;  3AZF C;  3REJ B;  3AFA B;  3REJ C;  4HGA B;  5B0Z D;  4J8W D;  3AFA C;  5CPK B;  5CPJ B;  5CPK C;  4H9N A;  5CPJ A;  1P3O B;  1PZR A;  1P3O C;  3KWQ B;  3AZK C;  5B0Y A;  2BG1 A;  3MGP B;  3AZL D;  5B2I D;  5E5A A;  3LEL B;  2ZM5 A;  2YFW A;  4X23 B;  4JJN A;  3LEL C;  3WKJ B;  3A6N B;  3WKJ C;  4WU9 C;  2JE5 A;  3REK B;  3AV1 B;  3KUY A;  1B6W A;  3REK C;  3UT9 B;  3B6G B;  2NZD A;  5DNM A;  1M1A D;  3UT9 C;  1ID3 A;  1KX3 D;  4NE6 A;  2XD5 A;  4WNN A;  3R45 A;  5JRG D;  4AWL B;  3TU4 A;  3X1V D;  5AY8 D;  4AWL C;  2YFV A;  5B24 D;  1P3K D;  2PYO D;  3MVD D;  3X1U A;  2NZD D;  5KDM A;  5DNM D;  1N1J A;  3AZN D;  1F66 D;  5GSU D;  1P3P B;  1BH8 B;  4J8U D;  2BYM B;  1P3A C;  3AZF A;  1P3P C;  3REJ A;  3AFA A;  5CPK A;  2BYK B;  1B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...