5AV9B

Human nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9B00
3W97C 1P3GB 3AZIC 3B6GC 2RVQD 4YM6B 5B32G 5E5AA 5AV9C 3AZJD 3KXBD 1P3KA 1ZLAB 1KX3D 4JJND 3MGSD 2YFWB 5AY8B 5CPJA 1P3OB 5B31G 1F66B 1B67A 3AZED 4YM6A 3AV2B 5B0YB 2F8ND 1HQ3A 1P3MD 4J8WA 3REHC 1P3LA 2NQBD 2AROA 5AV5D 5GT0D 3UTBB 1P3IA 1F66A 4UUZA 2F8NG 3AFAC 3A6NB 4H9PB 5B0YA 3AV1C 5AVBA 4H9QB 1M19C 3LELD 3MVDD 3LZ0D 3B0BA 2PYOA 3B6FB 3UTBA 3W99A 3W97D 3AZID 3B6GD 3VH5T 1P3KC 2F8NK 5AV9D 3UT9B 1M18B 4NE3A 5CPKB 5CPJC 3MGPC 1P3GC 1U35B 4YM6C 4H9OA 1BFMA 4WV4B 1HQ3C 4J8WC 1P3LC 1M1AB 1ZLAC 4Z66A 1P34A 1ULYA 5JA4B 3UT9A 4HGAB 5AY8C 3REHD 1F66C 3WAAA 1F1EA 5B1LD 5B0YC 5AVBC 3VH6A 5B40B 3AFAD 2F8NH 3AV1D 2FJ7B 2PYOC 1TZYB 1M19D 3UTBC 4R8PA 3W99C 3AYWB 5B32B 1S32B 5E5AD 1KX5A 5B40A 1P3KD 4G92B 5B31B 3AZJB 3VH5A 5CPJD 3KXBB 4YS3B 1KX3B 4YM6D 3MGSB 4JJNB 4Z66C 1P34C 1HQ3D 1ID3A 3C1BA 3UT9C 2BYMB 3NQJB 3WAAC 4J8WD 1P3LD 3AZEB 1P3BA 5B31A 2AROD 2F8NB 1P3MB 1P3ID 1F66D 3NQUA 4YS3A 5BT1C 3MNNA 5AV5B 5GT0B 5B0YD 1BH8B 5AVBD 4R8PC 2PYOD 2HIOA 3UTBD 3W99D 5FUGB 1KX5C 3LZ0B 5B40C 3B0CW 3W97B 1TZYC 4J8XA 3AZIB 3B6GB 1P3PA 5B32C 4KUDA 5AV9B 1S32C 1ID3C 3C1BC 1TAFB 4Z66D 1P34D 1P3BC 4G92C 5B31C 3UT9D 5G49B 3WAAD 4EO5C 3AZLB 4YS3C 3MNNC 3R45B 3MGSC 3UTAA 3REHB 3X1VA 3WTPA 2L5AA 5B33A 3W98B 5BT1D 3TU4A 2HIOC 5B1LB 4CAYB 4Z2MG 3X1TA 3MGQA 4R8PD 3AZLA 3AFAB 4DRBA 3AV1B 3AZFA 5DNNA 1M19B 3AZHA 2CWEA 5B40D 5KDMA 4J8XC 1P3PC 1KX5D 3W98A 4KUDC 5E5AB 1JFIA 1P3KB 1AOIA 3W96A 5AV6A 1ID3D 3C1BD 4J8UA 3WKJA 1WWIA 1P3BD 5B31D 1HQ3B 3X1VC 4J8WB 3WTPC 1P3LB 4YS3D 4E45A 3MNND 2AROB 5B2IA 3TU4C 1P3IB 4UUZB 3X1TC 3MGQC 3AZLC 3LZ1B 5F99A 2HIOD 3AZFC 5AVBB 4Z2MH 1N1JA 3AZHC 4H9NA 4AWLC 2PYOB 4ZUXA 3W98C 3W99B 5B1LC 4J8XD 1P3PD 3REIA 3LZ1A 1AOIC 4KUDD 2NZDB 2CV5A 3W96C 5AV6C 4J8UC 3WKJC 1B6WA 4H9OB 5E5AC 5B24A 4Z66B 1P34B 2NZDA 3UTAD 2YFVA 3X1VD 3WTPD 3WAAB 5B2JA 5DNMA 1P3FA 5F99C 3TU4D 3X1TD 3MGQD 3AZLD 1S32D 3B0CT 3AZFD 4ZUXC 5DNND 3AN2A 2AROC 1BH9A 4R8PB 3AZHD 1P3IC 3REIC 3W98D 3X1SA 3LZ1C 2CV5C 3X1UA 4CSRA 1KX5B 1AOID 1KX4A 3W96D 5AV6D 5JRGA 4J8UD 3WKJD 5B24C 2NZDC 1ID3B 3C1BB 5B2JC 3REJA 1P3BB 4NE5A 1P3FC 5B2ID 4EO5B 3NQUB 3KWQA 3MNNB 5F99D 1P3AB 4H9SA 3AN2C 5GXQB 3KUYB 2HIOB 4ZUXD 3X1SC 3C1CA 3V9RA 1WWSA 5BNXA 3REID 3LZ1D 2IO5C 4QLCA 3AZKB 2CV5D 1P3AA 4XZQA 1KX4C 4J8XB 5JRGC 5GXQA 3KUYA 1P3PB 4KUDB 4KHAB 3VH6W 5B24D 3AZMA 1HTAA 3REJC 2NZDD 3AZKA 5B0ZA 4NE6A 2JSSA 5B2JD 5DNMD 3KWQC 1P3FD 3UTAB 3B0DC 4KHAA 5GSUA 3X1VB 3WTPB 4H9SC 5B33B 3TU4B 1KU5A 3VH5W 4WZSB 3C1CC 4J8VA 3MGQB 1R4VA 3AZNA 3AN2D 3X1TB 5C3IC 5BNVA 3X1SD 3AZFB 3MGRA 5CHLB 5DNNB 4QLCC 1P3AC 3AZHB 3X1UD 5KDMB 5GXQC 3KUYC 4AWLB 3REKA 2NQBA 1KX4D 5AVCA 1JFIB 5JRGD 4M6BA 1A7WA 1AOIB 3AZMC 3W96B 5AV6B 3AZKC 4J8UB 3WKJB 3AZGA 3LJAA 3REJD 4WU8B 5CPIB 5B1MA 1EQZA 3RELA 3KWQD 4LD9B 5B2IB 3O62A 4J8VC 3AZNC 5F99B 4WU8A 3C1CD 5CPIA 3MGRC 1N1JB 3UTAC 3WA9A 4H9NB 5CP6B 5AV8A 5B33C 4ZUXB 1P3AD 4QLCD 4LD9A 4XZQD 5AVCC 5GXQD 3KUYD 3REIB 2CV5B 5DNNC 3AZMD 5CP6A 3AZGC 3AZKD 5B1MC 5B0ZD 5B24B 5GT3A 4WU9A 1EQZC 3RELC 5GSUD 1Q9CA 2YFVB 3O62C 5B2JB 5DNMB 1P3FB 4X23A 4WU8C 5BO0B 5CPIC 4J8VD 3AZND 3WA9C 4XUJB 3MGPA 4KGCB 5AV8C 1P3GA 3MGRD 3AN2B 4LD9C 1BH9B 5B2IC 2BYKB 5B33D 3REKD 3X1SB 1ZLAA 3VH6T 5AVCD 5BO0A 3X1UB 2YFWA 5AY8A 4CSRB 1P3OA 4XUJA 4KGCA 2IO5B 5CP6C 1KX4B 3AV2A 4Z5TB 5JRGB 2BYKA 3AZGD 5GT3C 4WU9C 3LJAD 5B1MD 1EQZD 3RELD 3REJB 3A6NA 4H9PA 4X23C 4Z5TA 2HUEC 3O62D 4H9QA 3KWQB 3B0DB 4WU8D 5CPID 3B6FA 3WA9D 5AV8D 5DNMC 3C1CB 4LD9D 3V9RB 5C3IB 1M18A 5BNXB 5CPKA 4ZBJB 1P3OC 4XUJC 4KGCC 4QLCB 1U35A 4XZQB 4E44A 3KSYA 3AV2C 5CP6D 5BS7A 1M1AA 5JA4A 3AZMB 5GT3D 3X1UC 4WU9D 4WNNB 3A6NC 5B0ZB 4Z5TC 4X23D 5GSUB 2FJ7A 1TZYA 3B6FC 3MGPD 3AYWA 4WNNA 5B32A 1P3GD 4J8VB 3AZNB 1S32A 5BNVB 1M18C 5CPKC 1ZLAD 3MGRB 1U35C 3AZJA 5AY8D 1P3OD 3KXBA 4XUJD 3REKB 4KGCD 2NQBB 5BS7C 1KX3A 5AVCB 4JJNA 3MGSA 3AV2D 1M1AC 2BYMA 3NQJA 4HGAC 4ZBJC 2LY8A 3AZEA 4XZQC 2F8NA 1P3MA 3LELB 3AZGB 3MVDB 3LJAB 3A6ND 5B1MB 5AV5A 4Z5TD 4H9RB 4G91B 1BH8A 5GT0A 1EQZB 3RELB 2FJ7C 3AYWC 3O62B 3B6FD 5B0ZC 3LELA 5FUGA 3MVDA 4DRAA 1H3OB 3LZ0A 2RVQC 5GSUC 4H9RA 3WA9B 1M18D 3AZJC 3W97A 5AV8B 5CPKD 3AZIA 3KXBC 3B6GA 1U35D 1KX3C 5AV9A 4JJNC 4NFTA 1H3OA 1TAFA 1M1AD 3AZEC 5G49A 1P3MC 3REKC 2NQBC 3R45A 5AV5C 5GT0C 5GT3B 3REHA 4WU9B 2FJ7D 5B1LA 1TZYD 4CAYA 3WTPE 3LELC 3AFAA 3AYWD 5B32D 4X23B 3MVDC 3LJAC 3AV1A 2HUEB 3LZ0C 1M19A 5CPJB 4G91C 3MGPB
chains in the Genus database with same CATH superfamily
3W97C 1P3GB 3AZIC 3B6GC 2RVQD 4YM6B 5B32G 5E5AA 5AV9C 3EPKA 3AZJD 3KXBD 1P3KA 1ZLAB 1KX3D 4JJND 3MGSD 2YFWB 5AY8B 5CPJA 1P3OB 5B31G 1F66B 1B67A 3AZED 4YM6A 3AV2B 5B0YB 2F8ND 1HQ3A 1P3MD 4J8WA 3REHC 1P3LA 2NQBD 2AROA 5AV5D 5GT0D 3UTBB 1P3IA 1F66A 4UUZA 2F8NG 3AFAC 3A6NB 4H9PB 5B0YA 3AV1C 5AVBA 4H9QB 1M19C 3LELD 3MVDD 3LZ0D 3B0BA 2PYOA 3B6FB 3UTBA 3W99A 3W97D 3AZID 3B6GD 3VH5T 1P3KC 2ZY3A 2F8NK 5AV9D 3UT9B 1M18B 4NE3A 5CPKB 5CPJC 3MGPC 1P3GC 1U35B 4YM6C 4H9OA 1BFMA 4WV4B 1HQ3C 4J8WC 1P3LC 1M1AB 1ZLAC 4Z66A 1P34A 1ULYA 5JA4B 3UT9A 4HGAB 5AY8C 3REHD 1F66C 3WAAA 1F1EA 5B1LD 5B0YC 5AVBC 3VH6A 2UWXA 5B40B 3AFAD 2F8NH 3AV1D 2FJ7B 2PYOC 1TZYB 1M19D 3UTBC 4R8PA 3W99C 3AYWB 5B32B 1S32B 5E5AD 1KX5A 5B40A 1P3KD 4G92B 5B31B 3AZJB 3VH5A 5CPJD 3KXBB 2VQRA 4YS3B 1KX3B 4YM6D 3MGSB 4JJNB 4Z66C 1P34C 1HQ3D 1ID3A 3C1BA 3UT9C 2BYMB 3NQJB 3WAAC 4J8WD 1P3LD 3AZEB 4WJ3C 1P3BA 5B31A 2AROD 2F8NB 1P3MB 1P3ID 1F66D 3EPHA 3NQUA 4YS3A 5BT1C 3MNNA 5AV5B 5GT0B 5B0YD 1BH8B 5AVBD 4R8PC 2FFFB 2PYOD 2HIOA 3UTBD 3W99D 5FUGB 2ZM5A 3H0RC 1KX5C 3LZ0B 5B40C 3B0CW 3W97B 1TZYC 4J8XA 3AZIB 3B6GB 1P3PA 5B32C 4KUDA 5AV9B 1S32C 1ID3C 3C1BC 1Z2CB 1TAFB 4Z66D 1P34D 1P3BC 4G92C 5B31C 3UT9D 5G49B 3WAAD 4EO5C 3AZLB 4YS3C 1W2EA 2Y2HA 3MNNC 3R45B 3MGSC 3UTAA 3REHB 2DQNC 3WTPA 2L5AA 3X1VA 5B33A 3W98B 5BT1D 3TU4A 2HIOC 5B1LB 4CAYB 4Z2MG 3X1TA 3MGQA 4R8PD 3AZLA 3AFAB 4DRBA 3AV1B 3AZFA 5DNNA 1M19B 3AZHA 2CWEA 5B40D 5KDMA 4J8XC 2ZY2A 1P3PC 1KX5D 3W98A 2XD5A 4KUDC 5E5AB 3P5JB 1JFIA 1P3KB 1AOIA 2JCHA 3W96A 5AV6A 1ID3D 3C1BD 4J8UA 1T3UA 3WKJA 1WWIA 1P3BD 5B31D 1HQ3B 3X1VC 4J8WB 3WTPC 1P3LB 4YS3D 4E45A 3MNND 2AROB 5B2IA 3TU4C 1P3IB 4UUZB 3X1TC 3MGQC 3AZLC 3LZ1B 5F99A 2HIOD 3AZFC 5AVBB 4Z2MH 1N1JA 3AZHC 4H9NA 4AWLC 2PYOB 4ZUXA 3W98C 3W99B 5B1LC 4J8XD 1P3PD 3REIA 3LZ1A 1AOIC 4KUDD 2NZDB 2CV5A 3W96C 5AV6C 2Y2OA 4J8UC 3WKJC 1B6WA 4H9OB 5E5AC 5B24A 4Z66B 1P34B 2NZDA 3UTAD 2YFVA 3X1VD 3WTPD 3WAAB 5B2JA 5DNMA 1P3FA 5F99C 3TU4D 3X1TD 3MGQD 3AZLD 1S32D 2W8SA 3B0CT 3AZFD 4ZUXC 5DNND 3AN2A 2AROC 1BH9A 4R8PB 3AZHD 1P3IC 3REIC 3W98D 3X1SA 3LZ1C 2CV5C 3X1UA 4CSRA 1KX5B 1AOID 1KX4A 3W96D 5AV6D 5JRGA 4J8UD 3WKJD 5B24C 2NZDC 2Y2PA 1ID3B 3C1BB 5B2JC 3REJA 1P3BB 4NE5A 1P3FC 5B2ID 4EO5B 3NQUB 3KWQA 3MNNB 5F99D 1P3AB 4H9SA 3AN2C 5GXQB 3KUYB 2HIOB 4ZUXD 3X1SC 3C1CA 3V9RA 1WWSA 5BNXA 3REID 3LZ1D 2IO5C 4QLCA 3AZKB 2Y2JA 2CV5D 4XZQA 1P3AA 1KX4C 4J8XB 5JRGC 5GXQA 3KUYA 1P3PB 4KUDB 4KHAB 3VH6W 5B24D 3AZMA 1HTAA 3REJC 2NZDD 2DF4C 3AZKA 5B0ZA 4NE6A 2JSSA 5B2JD 5DNMD 3KWQC 1P3FD 3UTAB 3B0DC 4KHAA 5GSUA 3KFUG 3X1VB 3WTPB 4H9SC 5B33B 3TU4B 1KU5A 3VH5W 4WZSB 3C1CC 4J8VA 3MGQB 1R4VA 3AZNA 3AN2D 3X1TB 5C3IC 5BNVA 3X1SD 3AZFB 3MGRA 5CHLB 5DNNB 4QLCC 3EPLA 1P3AC 3AZHB 3X1UD 5KDMB 5GXQC 3KUYC 4AWLB 3REKA 2NQBA 1KX4D 5AVCA 1JFIB 5JRGD 4M6BA 2Y2LA 1A7WA 3EG5B 1AOIB 3AZMC 3W96B 5AV6B 3AZKC 4J8UB 3WKJB 3AZGA 3LJAA 3REJD 4WU8B 5CPIB 5B1MA 1EQZA 3RELA 3KWQD 4LD9B 5B2IB 3O62A 4J8VC 3AZNC 5F99B 4WU8A 3C1CD 5CPIA 3MGRC 1N1JB 2ZY4A 3UTAC 2ZY5A 4H9NB 3WA9A 5CP6B 5AV8A 5B33C 3F6TA 3MGPB 4ZUXB 1P3AD 4QLCD 4LD9A 4XZQD 5AVCC 5GXQD 3KUYD 3REIB 2CV5B 5DNNC 3AZMD 5CP6A 3AZGC 3AZKD 5B1MC 5B0ZD 5B24B 5GT3A 4WU9A 1EQZC 3RELC 5GSUD 1Q9CA 2YFVB 3O62C 5B2JB 5DNMB 1P3FB 4X23A 4WU8C 5BO0B 5CPIC 4J8VD 3AZND 3WA9C 4XUJB 3MGPA 4KGCB 5AV8C 1P3GA 3MGRD 3AN2B 4LD9C 1BH9B 5B2IC 2BYKB 5B33D 2Y2KA 3REKD 3X1SB 1ZLAA 3VH6T 5AVCD 2Y2QA 5BO0A 2YFWA 5AY8A 4CSRB 3X1UB 1P3OA 4XUJA 4KGCA 2IO5B 5CP6C 1KX4B 3AV2A 4Z5TB 5JRGB 2BYKA 3AZGD 5GT3C 4WU9C 3LJAD 5B1MD 1EQZD 3RELD 3FDDA 3REJB 2F2AC 3A6NA 4H9PA 4X23C 4Z5TA 2HUEC 3O62D 2Y2NA 4H9QA 3KWQB 3B0DB 4WU8D 5CPID 3B6FA 3WA9D 5AV8D 5DNMC 4UPKA 3C1CB 4LD9D 3V9RB 2Y2IA 5C3IB 3A1KA 1M18A 5BNXB 5CPKA 4ZBJB 1P3OC 4XUJC 4KGCC 3AL0C 4QLCB 1U35A 4XZQB 4E44A 3KSYA 3AV2C 5CP6D 5BS7A 1M1AA 5JA4A 3AZMB 3IP4C 5GT3D 3X1UC 2RIQA 4WU9D 4WNNB 2BG1A 3A6NC 3A1IA 5B0ZB 4Z5TC 4X23D 2J8PA 5GSUB 2FJ7A 1TZYA 3B6FC 3MGPD 3AYWA 4WNNA 5B32A 1P3GD 4J8VB 3AZNB 1S32A 2G5HC 5BNVB 1M18C 3H0MC 5CPKC 1ZLAD 3MGRB 1U35C 3AZJA 5AY8D 1P3OD 3KXBA 4XUJD 3REKB 4KGCD 2NQBB 5BS7C 1KX3A 5AVCB 4JJNA 3MGSA 3AV2D 1M1AC 3EPJA 2BYMA 3NQJA 4HGAC 4ZBJC 2LY8A 3AZEA 4XZQC 2F8NA 1P3MA 3LELB 3AZGB 3MVDB 3LJAB 3A6ND 5B1MB 5AV5A 4Z5TD 4H9RB 4G91B 1BH8A 5GT0A 1EQZB 3RELB 2FJ7C 3AYWC 4DQYB 3O62B 3B6FD 5B0ZC 3LELA 5FUGA 3MVDA 4DRAA 1H3OB 3LZ0A 2RVQC 1PZRA 2JE5A 5GSUC 4H9RA 3WA9B 1M18D 3AZJC 3W97A 5AV8B 5CPKD 3AZIA 3KXBC 3B6GA 1U35D 1KX3C 5AV9A 4JJNC 2G5IC 4NFTA 1H3OA 1TAFA 2Y2GA 3AZEC 1M1AD 5G49A 1P3MC 3REKC 2NQBC 3R45A 5AV5C 5GT0C 2XD1A 5GT3B 3REHA 4WU9B 2FJ7D 5B1LA 1TZYD 4CAYA 3WTPE 3LELC 3AFAA 3AYWD 5B32D 4X23B 3MVDC 3LJAC 3AV1A 2HUEB 3LZ0C 2Y2MA 1M19A 5CPJB 4G91C 3H0LC
chains in the Genus database with same CATH topology
3W97C 1P3GB 3AZIC 3B6GC 2RVQD 4YM6B 5B32G 5E5AA 5AV9C 3EPKA 3AZJD 3KXBD 1P3KA 1ZLAB 1KX3D 4JJND 3MGSD 2YFWB 5AY8B 5CPJA 1P3OB 5B31G 1F66B 1B67A 3AZED 4YM6A 3AV2B 5B0YB 2F8ND 1HQ3A 1P3MD 4J8WA 3REHC 1P3LA 2NQBD 2AROA 5AV5D 5GT0D 3UTBB 1P3IA 1F66A 4UUZA 2F8NG 3AFAC 3A6NB 4H9PB 5B0YA 3AV1C 5AVBA 4H9QB 1M19C 3LELD 3MVDD 3LZ0D 3B0BA 2PYOA 3B6FB 3UTBA 3W99A 3W97D 3AZID 3B6GD 3VH5T 1P3KC 2ZY3A 2F8NK 5AV9D 3UT9B 1M18B 4NE3A 5CPKB 5CPJC 3MGPC 1P3GC 1U35B 4YM6C 4H9OA 1BFMA 4WV4B 1HQ3C 4J8WC 1P3LC 1M1AB 1ZLAC 4Z66A 1P34A 1ULYA 5JA4B 3UT9A 4HGAB 5AY8C 3REHD 1F66C 3WAAA 1F1EA 5B1LD 5B0YC 5AVBC 3VH6A 2UWXA 5B40B 3AFAD 2F8NH 3AV1D 2FJ7B 2PYOC 1TZYB 1M19D 3UTBC 4R8PA 3W99C 3AYWB 5B32B 1S32B 5E5AD 1KX5A 5B40A 1P3KD 4G92B 5B31B 3AZJB 3VH5A 5CPJD 3KXBB 2VQRA 4YS3B 1KX3B 4YM6D 3MGSB 4JJNB 4Z66C 1P34C 1HQ3D 1ID3A 3C1BA 3UT9C 2BYMB 3NQJB 3WAAC 4J8WD 1P3LD 3AZEB 4WJ3C 1P3BA 5B31A 2AROD 2F8NB 1P3MB 1P3ID 1F66D 3EPHA 3NQUA 4YS3A 5BT1C 3MNNA 5AV5B 5GT0B 5B0YD 1BH8B 5AVBD 4R8PC 2FFFB 2PYOD 2HIOA 3UTBD 3W99D 5FUGB 2ZM5A 3H0RC 1KX5C 3LZ0B 5B40C 3B0CW 3W97B 1TZYC 4J8XA 3AZIB 3B6GB 1P3PA 5B32C 4KUDA 5AV9B 1S32C 1ID3C 3C1BC 1Z2CB 1TAFB 4Z66D 1P34D 1P3BC 4G92C 5B31C 3UT9D 5G49B 3WAAD 4EO5C 3AZLB 4YS3C 1W2EA 2Y2HA 3MNNC 3R45B 3MGSC 3UTAA 3REHB 2DQNC 3WTPA 2L5AA 3X1VA 5B33A 3W98B 5BT1D 3TU4A 2HIOC 5B1LB 4CAYB 4Z2MG 3X1TA 3MGQA 4R8PD 3AZLA 3AFAB 4DRBA 3AV1B 3AZFA 5DNNA 1M19B 3AZHA 2CWEA 5B40D 5KDMA 4J8XC 2ZY2A 1P3PC 1KX5D 3W98A 2XD5A 4KUDC 5E5AB 3P5JB 1JFIA 1P3KB 1AOIA 2JCHA 3W96A 5AV6A 1ID3D 3C1BD 4J8UA 1T3UA 3WKJA 1WWIA 1P3BD 5B31D 1HQ3B 3X1VC 4J8WB 3WTPC 1P3LB 4YS3D 4E45A 3MNND 2AROB 5B2IA 3TU4C 1P3IB 4UUZB 3X1TC 3MGQC 3AZLC 3LZ1B 5F99A 2HIOD 3AZFC 5AVBB 4Z2MH 1N1JA 3AZHC 4H9NA 4AWLC 2PYOB 4ZUXA 3W98C 3W99B 5B1LC 4J8XD 1P3PD 3REIA 3LZ1A 1AOIC 4KUDD 2NZDB 2CV5A 3W96C 5AV6C 2Y2OA 4J8UC 3WKJC 1B6WA 4H9OB 5E5AC 5B24A 4Z66B 1P34B 2NZDA 3UTAD 2YFVA 3X1VD 3WTPD 3WAAB 5B2JA 5DNMA 1P3FA 5F99C 3TU4D 3X1TD 3MGQD 3AZLD 1S32D 2W8SA 3B0CT 3AZFD 4ZUXC 5DNND 3AN2A 2AROC 1BH9A 4R8PB 3AZHD 1P3IC 3REIC 3W98D 3X1SA 3LZ1C 2CV5C 3X1UA 4CSRA 1KX5B 1AOID 1KX4A 3W96D 5AV6D 5JRGA 4J8UD 3WKJD 5B24C 2NZDC 2Y2PA 1ID3B 3C1BB 5B2JC 3REJA 1P3BB 4NE5A 1P3FC 5B2ID 4EO5B 3NQUB 3KWQA 3MNNB 5F99D 1P3AB 4H9SA 3AN2C 5GXQB 3KUYB 2HIOB 4ZUXD 3X1SC 3C1CA 3V9RA 1WWSA 5BNXA 3REID 3LZ1D 2IO5C 4QLCA 3AZKB 2Y2JA 2CV5D 4XZQA 1P3AA 1KX4C 4J8XB 5JRGC 5GXQA 3KUYA 1P3PB 4KUDB 4KHAB 3VH6W 5B24D 3AZMA 1HTAA 3REJC 2NZDD 2DF4C 3AZKA 5B0ZA 4NE6A 2JSSA 5B2JD 5DNMD 3KWQC 1P3FD 3UTAB 3B0DC 4KHAA 5GSUA 3KFUG 3X1VB 3WTPB 4H9SC 5B33B 3TU4B 1KU5A 3VH5W 4WZSB 3C1CC 4J8VA 3MGQB 1R4VA 3AZNA 3AN2D 3X1TB 5C3IC 5BNVA 3X1SD 3AZFB 3MGRA 5CHLB 5DNNB 4QLCC 3EPLA 1P3AC 3AZHB 3X1UD 5KDMB 5GXQC 3KUYC 4AWLB 3REKA 2NQBA 1KX4D 5AVCA 1JFIB 5JRGD 4M6BA 2Y2LA 1A7WA 3EG5B 1AOIB 3AZMC 3W96B 5AV6B 3AZKC 4J8UB 3WKJB 3AZGA 3LJAA 3REJD 4WU8B 5CPIB 5B1MA 1EQZA 3RELA 3KWQD 4LD9B 5B2IB 3O62A 4J8VC 3AZNC 5F99B 4WU8A 3C1CD 5CPIA 3MGRC 1N1JB 2ZY4A 3UTAC 2ZY5A 4H9NB 3WA9A 5CP6B 5AV8A 5B33C 3F6TA 3MGPB 4ZUXB 1P3AD 4QLCD 4LD9A 4XZQD 5AVCC 5GXQD 3KUYD 3REIB 2CV5B 5DNNC 3AZMD 5CP6A 3AZGC 3AZKD 5B1MC 5B0ZD 5B24B 5GT3A 4WU9A 1EQZC 3RELC 5GSUD 1Q9CA 2YFVB 3O62C 5B2JB 5DNMB 1P3FB 4X23A 4WU8C 5BO0B 5CPIC 4J8VD 3AZND 3WA9C 4XUJB 3MGPA 4KGCB 5AV8C 1P3GA 3MGRD 3AN2B 4LD9C 1BH9B 5B2IC 2BYKB 5B33D 2Y2KA 3REKD 3X1SB 1ZLAA 3VH6T 5AVCD 2Y2QA 5BO0A 2YFWA 5AY8A 4CSRB 3X1UB 1P3OA 4XUJA 4KGCA 2IO5B 5CP6C 1KX4B 3AV2A 4Z5TB 5JRGB 2BYKA 3AZGD 5GT3C 4WU9C 3LJAD 5B1MD 1EQZD 3RELD 3FDDA 3REJB 2F2AC 3A6NA 4H9PA 4X23C 4Z5TA 2HUEC 3O62D 2Y2NA 4H9QA 3KWQB 3B0DB 4WU8D 5CPID 3B6FA 3WA9D 5AV8D 5DNMC 4UPKA 3C1CB 4LD9D 3V9RB 2Y2IA 5C3IB 3A1KA 1M18A 5BNXB 5CPKA 4ZBJB 1P3OC 4XUJC 4KGCC 3AL0C 4QLCB 1U35A 4XZQB 4E44A 3KSYA 3AV2C 5CP6D 5BS7A 1M1AA 5JA4A 3AZMB 3IP4C 5GT3D 3X1UC 2RIQA 4WU9D 4WNNB 2BG1A 3A6NC 3A1IA 5B0ZB 4Z5TC 4X23D 2J8PA 5GSUB 2FJ7A 1TZYA 3B6FC 3MGPD 3AYWA 4WNNA 5B32A 1P3GD 4J8VB 3AZNB 1S32A 2G5HC 5BNVB 1M18C 3H0MC 5CPKC 1ZLAD 3MGRB 1U35C 3AZJA 5AY8D 1P3OD 3KXBA 4XUJD 3REKB 4KGCD 2NQBB 5BS7C 1KX3A 5AVCB 4JJNA 3MGSA 3AV2D 1M1AC 3EPJA 2BYMA 3NQJA 4HGAC 4ZBJC 2LY8A 3AZEA 4XZQC 2F8NA 1P3MA 3LELB 3AZGB 3MVDB 3LJAB 3A6ND 5B1MB 5AV5A 4Z5TD 4H9RB 4G91B 1BH8A 5GT0A 1EQZB 3RELB 2FJ7C 3AYWC 4DQYB 3O62B 3B6FD 5B0ZC 3LELA 5FUGA 3MVDA 4DRAA 1H3OB 3LZ0A 2RVQC 1PZRA 2JE5A 5GSUC 4H9RA 3WA9B 1M18D 3AZJC 3W97A 5AV8B 5CPKD 3AZIA 3KXBC 3B6GA 1U35D 1KX3C 5AV9A 4JJNC 2G5IC 4NFTA 1H3OA 1TAFA 2Y2GA 3AZEC 1M1AD 5G49A 1P3MC 3REKC 2NQBC 3R45A 5AV5C 5GT0C 2XD1A 5GT3B 3REHA 4WU9B 2FJ7D 5B1LA 1TZYD 4CAYA 3WTPE 3LELC 3AFAA 3AYWD 5B32D 4X23B 3MVDC 3LJAC 3AV1A 2HUEB 3LZ0C 2Y2MA 1M19A 5CPJB 4G91C 3H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 C;  1P3G B;  3AZI C;  3B6G C;  2RVQ D;  4YM6 B;  5B32 G;  5E5A A;  5AV9 C;  3AZJ D;  3KXB D;  1P3K A;  1ZLA B;  1KX3 D;  4JJN D;  3MGS D;  2YFW B;  5AY8 B;  5CPJ A;  1P3O B;  5B31 G;  1F66 B;  1B67 A;  3AZE D;  4YM6 A;  3AV2 B;  5B0Y B;  2F8N D;  1HQ3 A;  1P3M D;  4J8W A;  3REH C;  1P3L A;  2NQB D;  2ARO A;  5AV5 D;  5GT0 D;  3UTB B;  1P3I A;  1F66 A;  4UUZ A;  2F8N G;  3AFA C;  3A6N B;  4H9P B;  5B0Y A;  3AV1 C;  5AVB A;  4H9Q B;  1M19 C;  3LEL D;  3MVD D;  3LZ0 D;  3B0B A;  2PYO A;  3B6F B;  3UTB A;  3W99 A;  3W97 D;  3AZI D;  3B6G D;  3VH5 T;  1P3K C;  2F8N K;  5AV9 D;  3UT9 B;  1M18 B;  4NE3 A;  5CPK B;  5CPJ C;  3MGP C;  1P3G C;  1U35 B;  4YM6 C;  4H9O A;  1BFM A;  4WV4 B;  1HQ3 C;  4J8W C;  1P3L C;  1M1A B;  1ZLA C;  4Z66 A;  1P34 A;  1ULY A;  5JA4 B;  3UT9 A;  4HGA B;  5AY8 C;  3REH D;  1F66 C;  3WAA A;  1F1E A;  5B1L D;  5B0Y C;  5AVB C;  3VH6 A;  5B40 B;  3AFA D;  2F8N H;  3AV1 D;  2FJ7 B;  2PYO C;  1TZY B;  1M19 D;  3UTB C;  4R8P A;  3W99 C;  3AYW B;  5B32 B;  1S32 B;  5E5A D;  1KX5 A;  5B40 A;  1P3K D;  4G92 B;  5B31 B;  3AZJ B;  3VH5 A;  5CPJ D;  3KXB B;  4YS3 B;  1KX3 B;  4YM6 D;  3MGS B;  4JJN B;  4Z66 C;  1P34 C;  1HQ3 D;  1ID3 A;  3C1B A;  3UT9 C;  2BYM B;  3NQJ B;  3WAA C;  4J8W D;  1P3L D;  3AZE B;  1P3B A;  5B31 A;  2ARO D;  2F8N B;  1P3M B;  1P3I D;  1F66 D;  3NQU A;  4YS3 A;  5BT1 C;  3MNN A;  5AV5 B;  5GT0 B;  5B0Y D;  1BH8 B;  5AVB D;  4R8P C;  2PYO D;  2HIO A;  3UTB D;  3W99 D;  5FUG B;  1KX5 C;  3LZ0 B;  5B40 C;  3B0C W;  3W97 B;  1TZY C;  4J8X A;  3AZI B;  3B6G B;  1P3P A;  5B32 C;  4KUD A;  5AV9 B;  1S32 C;  1ID3 C;  3C1B C;  1TAF B;  4Z66 D;  1P34 D;  1P3B C;  4G92 C;  5B31 C;  3UT9 D;  5G49 B;  3WAA D;  4EO5 C;  3AZL B;  4YS3 C;  3MNN C;  3R45 B;  3MGS C;  3UTA A;  3REH B;  3X1V A;  3WTP A;  2L5A A;  5B33 A;  3W98 B;  5BT1 D;  3TU4 A;  2HIO C;  5B1L B;  4CAY B;  4Z2M G;  3X1T A;  3MGQ A;  4R8P D;  3AZL A;  3AFA B;  4DRB A;  3AV1 B;  3AZF A;  5DNN A;  1M19 B;  3AZH A;  2CWE A;  5B40 D;  5KDM A;  4J8X C;  1P3P C;  1KX5 D;  3W98 A;  4KUD C;  5E5A B;  1JFI A;  1P3K B;  1AOI A;  3W96 A;  5AV6 A;  1ID3 D;  3C1B D;  4J8U A;  3WKJ A;  1WWI A;  1P3B D;  5B31 D;  1HQ3 B;  3X1V C;  4J8W B;  3WTP C;  1P3L B;  4YS3 D;  4E45 A;  3MNN D;  2ARO B;  5B2I A;  3TU4 C;  1P3I B;  4UUZ B;  3X1T C;  3MGQ C;  3AZL C;  3LZ1 B;  5F99 A;  2HIO D;  3AZF C;  5AVB B;  4Z2M H;  1N1J A;  3AZH C;  4H9N A;  4AWL C;  2PYO B;  4ZUX A;  3W98 C;  3W99 B;  5B1L C;  4J8X D;  1P3P D;  3REI A;  3LZ1 A;  1AOI C;  4KUD D;  2NZD B;  2CV5 A;  3W96 C;  5AV6 C;  4J8U C;  3WKJ C;  1B6W A;  4H9O B;  5E5A C;  5B24 A;  4Z66 B;  1P34 B;  2NZD A;  3UTA D;  2YFV A;  3X1V D;  3WTP D;  3WAA B;  5B2J A;  5DNM A;  1P3F A;  5F99 C;  3TU4 D;  3X1T D;  3MGQ D;  3AZL D;  1S32 D;  3B0C T;  3AZF D;  4ZUX C;  5DNN D;  3AN2 A;  2ARO C;  1BH9 A;  4R8P B;  3AZH D;  1P3I C;  3REI C;  3W98 D;  3X1S A;  3LZ1 C;  2CV5 C;  3X1U A;  4CSR A;  1KX5 B;  1AOI D;  1KX4 A;  3W96 D;  5AV6 D;  5JRG A;  4J8U D;  3WKJ D;  5B24 C;  2NZD C;  1ID3 B;  3C1B B;  5B2J C;  3REJ A;  1P3B B;  4NE5 A;  1P3F C;  5B2I D;  4EO5 B;  3NQU B;  3KWQ A;  3MNN B;  5F99 D;  1P3A B;  4H9S A;  3AN2 C;  5GXQ B;  3KUY B;  2HIO B;  4ZUX D;  3X1S C;  3C1C A;  3V9R A;  1WWS A;  5BNX A;  3REI D;  3LZ1 D;  2IO5 C;  4QLC A;  3AZK B;  2CV5 D;  1P3A A;  4XZQ A;  1KX4 C;  4J8X B;  5JRG C;  5GXQ A;  3KUY A;  1P3P B;  4KUD B;  4KHA B;  3VH6 W;  5B24 D;  3AZM A;  1HTA A;  3REJ C;  2NZD D;  3AZK A;  5B0Z A;  4NE6 A;  2JSS A;  5B2J D;  5DNM D;  3KWQ C;  1P3F D;  3UTA B;  3B0D C;  4KHA A;  5GSU A;  3X1V B;  3WTP B;  4H9S C;  5B33 B;  3TU4 B;  1KU5 A;  3VH5 W;  4WZS B;  3C1C C;  4J8V A;  3MGQ B;  1R4V A;  3AZN A;  3AN2 D;  3X1T B;  5C3I C;  5BNV A;  3X1S D;  3AZF B;  3MGR A;  5CHL B;  5DNN B;  4QLC C;  1P3A C;  3AZH B;  3X1U D;  5KDM B;  5GXQ C;  3KUY C;  4AWL B;  3REK A;  2NQB A;  1KX4 D;  5AVC A;  1JFI B;  5JRG D;  4M6B A;  1A7W A;  1AOI B;  3AZM C;  3W96 B;  5AV6 B;  3AZK C;  4J8U B;  3WKJ B;  3AZG A;  3LJA A;  3REJ D;  4WU8 B;  5CPI B;  5B1M A;  1EQZ A;  3REL A;  3KWQ D;  4LD9 B;  5B2I B;  3O62 A;  4J8V C;  3AZN C;  5F99 B;  4WU8 A;  3C1C D;  5CPI A;  3MGR C;  1N1J B;  3UTA C;  3WA9 A;  4H9N B;  5CP6 B;  5AV8 A;  5B33 C;  4ZUX B;  1P3A D;  4QLC D;  4LD9 A;  4XZQ D;  5AVC C;  5GXQ D;  3KUY D;  3REI B;  2CV5 B;  5DNN C;  3AZM D;  5CP6 A;  3AZG C;  3AZK D;  5B1M C;  5B0Z D;  5B24 B;  5GT3 A;  4WU9 A;  1EQZ C;  3REL C;  5GSU D;  1Q9C A;  2YFV B;  3O62 C;  5B2J B;  5DNM B;  1P3F B;  4X23 A;  4WU8 C;  5BO0 B;  5CPI C;  4J8V D;  3AZN D;  3WA9 C;  4XUJ B;  3MGP A;  4KGC B;  5AV8 C;  1P3G A;  3MGR D;  3AN2 B;  4LD9 C;  1BH9 B;  5B2I C;  2BYK B;  5B33 D;  3REK D;  3X1S B;  1ZLA A;  3VH6 T;  5AVC D;  5BO0 A;  3X1U B;  2YFW A;  5AY8 A;  4CSR B;  1P3O A;  4XUJ A;  4KGC A;  2IO5 B;  5CP6 C;  1KX4 B;  3AV2 A;  4Z5T B;  5JRG B;  2BYK A;  3AZG D;  5GT3 C;  4WU9 C;  3LJA D;  5B1M D;  1EQZ D;  3REL D;  3REJ B;  3A6N A;  4H9P A;  4X23 C;  4Z5T A;  2HUE C;  3O62 D;  4H9Q A;  3KWQ B;  3B0D B;  4WU8 D;  5CPI D;  3B6F A;  3WA9 D;  5AV8 D;  5DNM C;  3C1C B;  4LD9 D;  3V9R B;  5C3I B;  1M18 A;  5BNX B;  5CPK A;  4ZBJ B;  1P3O C;  4XUJ C;  4KGC C;  4QLC B;  1U35 A;  4XZQ B;  4E44 A;  3KSY A;  3AV2 C;  5CP6 D;  5BS7 A;  1M1A A;  5JA4 A;  3AZM B;  5GT3 D;  3X1U C;  4WU9 D;  4WNN B;  3A6N C;  5B0Z B;  4Z5T C;  4X23 D;  5GSU B;  2FJ7 A;  1TZY A;  3B6F C;  3MGP D;  3AYW A;  4WNN A;  5B32 A;  1P3G D;  4J8V B;  3AZN B;  1S32 A;  5BNV B;  1M18 C;  5CPK C;  1ZLA D;  3MGR B;  1U35 C;  3AZJ A;  5AY8 D;  1P3O D;  3KXB A;  4XUJ D;  3REK B;  4KGC D;  2NQB B;  5BS7 C;  1KX3 A;  5AVC B;  4JJN A;  3MGS A;  3AV2 D;  1M1A C;  2BYM A;  3NQJ A;  4HGA C;  4ZBJ C;  2LY8 A;  3AZE A;  4XZQ C;  2F8N A;  1P3M A;  3LEL B;  3AZG B;  3MVD B;  3LJA B;  3A6N D;  5B1M B;  5AV5 A;  4Z5T D;  4H9R B;  4G91 B;  1BH8 A;  5GT0 A;  1EQZ B;  3REL B;  2FJ7 C;  3AYW C;  3O62 B;  3B6F D;  5B0Z C;  3LEL A;  5FUG A;  3MVD A;  4DRA A;  1H3O B;  3LZ0 A;  2RVQ C;  5GSU C;  4H9R A;  3WA9 B;  1M18 D;  3AZJ C;  3W97 A;  5AV8 B;  5CPK D;  3AZI A;  3KXB C;  3B6G A;  1U35 D;  1KX3 C;  5AV9 A;  4JJN C;  4NFT A;  1H3O A;  1TAF A;  1M1A D;  3AZE C;  5G49 A;  1P3M C;  3REK C;  2NQB C;  3R45 A;  5AV5 C;  5GT0 C;  5GT3 B;  3REH A;  4WU9 B;  2FJ7 D;  5B1L A;  1TZY D;  4CAY A;  3WTP E;  3LEL C;  3AFA A;  3AYW D;  5B32 D;  4X23 B;  3MVD C;  3LJA C;  3AV1 A;  2HUE B;  3LZ0 C;  1M19 A;  5CPJ B;  4G91 C;  3MGP B; 
#chains in the Genus database with same CATH topology
 3W97 C;  1P3G B;  3AZI C;  3B6G C;  2RVQ D;  4YM6 B;  5B32 G;  5E5A A;  5AV9 C;  3EPK A;  3AZJ D;  3KXB D;  1P3K A;  1ZLA B;  1KX3 D;  4JJN D;  3MGS D;  2YFW B;  5AY8 B;  5CPJ A;  1P3O B;  5B31 G;  1F66 B;  1B67 A;  3AZE D;  4YM6 A;  3AV2 B;  5B0Y B;  2F8N D;  1HQ3 A;  1P3M D;  4J8W A;  3REH C;  1P3L A;  2NQB D;  2ARO A;  5AV5 D;  5GT0 D;  3UTB B;  1P3I A;  1F66 A;  4UUZ A;  2F8N G;  3AFA C;  3A6N B;  4H9P B;  5B0Y A;  3AV1 C;  5AVB A;  4H9Q B;  1M19 C;  3LEL D;  3MVD D;  3LZ0 D;  3B0B A;  2PYO A;  3B6F B;  3UTB A;  3W99 A;  3W97 D;  3AZI D;  3B6G D;  3VH5 T;  1P3K C;  2ZY3 A;  2F8N K;  5AV9 D;  3UT9 B;  1M18 B;  4NE3 A;  5CPK B;  5CPJ C;  3MGP C;  1P3G C;  1U35 B;  4YM6 C;  4H9O A;  1BFM A;  4WV4 B;  1HQ3 C;  4J8W C;  1P3L C;  1M1A B;  1ZLA C;  4Z66 A;  1P34 A;  1ULY A;  5JA4 B;  3UT9 A;  4HGA B;  5AY8 C;  3REH D;  1F66 C;  3WAA A;  1F1E A;  5B1L D;  5B0Y C;  5AVB C;  3VH6 A;  2UWX A;  5B40 B;  3AFA D;  2F8N H;  3AV1 D;  2FJ7 B;  2PYO C;  1TZY B;  1M19 D;  3UTB C;  4R8P A;  3W99 C;  3AYW B;  5B32 B;  1S32 B;  5E5A D;  1KX5 A;  5B40 A;  1P3K D;  4G92 B;  5B31 B;  3AZJ B;  3VH5 A;  5CPJ D;  3KXB B;  2VQR A;  4YS3 B;  1KX3 B;  4YM6 D;  3MGS B;  4JJN B;  4Z66 C;  1P34 C;  1HQ3 D;  1ID3 A;  3C1B A;  3UT9 C;  2BYM B;  3NQJ B;  3WAA C;  4J8W D;  1P3L D;  3AZE B;  4WJ3 C;  1P3B A;  5B31 A;  2ARO D;  2F8N B;  1P3M B;  1P3I D;  1F66 D;  3EPH A;  3NQU A;  4YS3 A;  5BT1 C;  3MNN A;  5AV5 B;  5GT0 B;  5B0Y D;  1BH8 B;  5AVB D;  4R8P C;  2FFF B;  2PYO D;  2HIO A;  3UTB D;  3W99 D;  5FUG B;  2ZM5 A;  3H0R C;  1KX5 C;  3LZ0 B;  5B40 C;  3B0C W;  3W97 B;  1TZY C;  4J8X A;  3AZI B;  3B6G B;  1P3P A;  5B32 C;  4KUD A;  5AV9 B;  1S32 C;  1ID3 C;  3C1B C;  1Z2C B;  1TAF B;  4Z66 D;  1P34 D;  1P3B C;  4G92 C;  5B31 C;  3UT9 D;  5G49 B;  3WAA D;  4EO5 C;  3AZL B;  4YS3 C;  1W2E A;  2Y2H A;  3MNN C;  3R45 B;  3MGS C;  3UTA A;  3REH B;  2DQN C;  3WTP A;  2L5A A;  3X1V A;  5B33 A;  3W98 B;  5BT1 D;  3TU4 A;  2HIO C;  5B1L B;  4CAY B;  4Z2M G;  3X1T A;  3MGQ A;  4R8P D;  3AZL A;  3AFA B;  4DRB A;  3AV1 B;  3AZF A;  5DNN A;  1M19 B;  3AZH A;  2CWE A;  5B40 D;  5KDM A;  4J8X C;  2ZY2 A;  1P3P C;  1KX5 D;  3W98 A;  2XD5 A;  4KUD C;  5E5A B;  3P5J B;  1JFI A;  1P3K B;  1AOI A;  2JCH A;  3W96 A;  5AV6 A;  1ID3 D;  3C1B D;  4J8U A;  1T3U A;  3WKJ A;  1WWI A;  1P3B D;  5B31 D;  1HQ3 B;  3X1V C;  4J8W B;  3WTP C;  1P3L B;  4YS3 D;  4E45 A;  3MNN D;  2ARO B;  5B2I A;  3TU4 C;  1P3I B;  4UUZ B;  3X1T C;  3MGQ C;  3AZL C;  3LZ1 B;  5F99 A;  2HIO D;  3AZF C;  5AVB B;  4Z2M H;  1N1J A;  3AZH C;  4H9N A;  4AWL C;  2PYO B;  4ZUX A;  3W98 C;  3W99 B;  5B1L C;  4J8X D;  1P3P D;  3REI A;  3LZ1 A;  1AOI C;  4KUD D;  2NZD B;  2CV5 A;  3W96 C;  5AV6 C;  2Y2O A;  4J8U C;  3WKJ C;  1B6W A;  4H9O B;  5E5A C;  5B24 A;  4Z66 B;  1P34 B;  2NZD A;  3UTA D;  2YFV A;  3X1V D;  3WTP D;  3WAA B;  5B2J A;  5DNM A;  1P3F A;  5F99 C;  3TU4 D;  3X1T D;  3MGQ D;  3AZL D;  1S32 D;  2W8S A;  3B0C T;  3AZF D;  4ZUX C;  5DNN D;  3AN2 A;  2ARO C;  1BH9 A;  4R8P B;  3AZH D;  1P3I C;  3REI C;  3W98 D;  3X1S A;  3LZ1 C;  2CV5 C;  3X1U A;  4CSR A;  1KX5 B;  1AOI D;  1KX4 A;  3W96 D;  5AV6 D;  5JRG A;  4J8U D;  3WKJ D;  5B24 C;  2NZD C;  2Y2P A;  1ID3 B;  3C1B B;  5B2J C;  3REJ A;  1P3B B;  4NE5 A;  1P3F C;  5B2I D;  4EO5 B;  3NQU B;  3KWQ A;  3MNN B;  5F99 D;  1P3A B;  4H9S A;  3AN2 C;  5GXQ B;  3KUY B;  2HIO B;  4ZUX D;  3X1S C;  3C1C A;  3V9R A;  1WWS A;  5BNX A;  3REI D;  3LZ1 D;  2IO5 C;  4QLC A;  3AZK B;  2Y2J A;  2CV5 D;  4XZQ A;  1P3A A;  1KX4 C;  4J8X B;  5JRG C;  5GXQ A;  3KUY A;  1P3P B;  4KUD B;  4KHA B;  3VH6 W;  5B24 D;  3AZM A;  1HTA A;  3REJ C;  2NZD D;  2DF4 C;  3AZK A;  5B0Z A;  4NE6 A;  2JSS A;  5B2J D;  5DNM D;  3KWQ C;  1P3F D;  3UTA B;  3B0D C;  4KHA A;  5GSU A;  3KFU G;  3X1V B;  3WTP B;  4H9S C;  5B33 B;  3TU4 B;  1KU5 A;  3VH5 W;  4WZS B;  3C1C C;  4J8V A;  3MGQ B;  1R4V A;  3AZN A;  3AN2 D;  3X1T B;  5C3I C;  5BNV A;  3X1S D;  3AZF B;  3MGR A;  5CHL B;  5DNN B;  4QLC C;  3EPL A;  1P3A C;  3AZH B;  3X1U D;  5KDM B;  5GXQ C;  3KUY C;  4AWL B;  3REK A;  2NQB A;  1KX4 D;  5AVC A;  1JFI B;  5JRG D;  4M6B A;  2Y2L A;  1A7W A;  3EG5 B;  1AOI B;  3AZM C;  3W96 B;  5AV6 B;  3AZK C;  4J8U B;  3WKJ B;  3AZG A;  3LJA A;  3REJ D;  4WU8 B;  5CPI B;  5B1M A;  1EQZ A;  3REL A;  3KWQ D;  4LD9 B;  5B2I B;  3O62 A;  4J8V C;  3AZN C;  5F99 B;  4WU8 A;  3C1C D;  5CPI A;  3MGR C;  1N1J B;  2ZY4 A;  3UTA C;  2ZY5 A;  4H9N B;  3WA9 A;  5CP6 B;  5AV8 A;  5B33 C;  3F6T A;  3MGP B;  4ZUX B;  1P3A D;  4QLC D;  4LD9 A;  4XZQ D;  5AVC C;  5GXQ D;  3KUY D;  3REI B;  2CV5 B;  5DNN C;  3AZM D;  5CP6 A;  3AZG C;  3AZK D;  5B1M C;  5B0Z D;  5B24 B;  5GT3 A;  4WU9 A;  1EQZ C;  3REL C;  5GSU D;  1Q9C A;  2YFV B;  3O62 C;  5B2J B;  5DNM B;  1P3F B;  4X23 A;  4WU8 C;  5BO0 B;  5CPI C;  4J8V D;  3AZN D;  3WA9 C;  4XUJ B;  3MGP A;  4KGC B;  5AV8 C;  1P3G A;  3MGR D;  3AN2 B;  4LD9 C;  1BH9 B;  5B2I C;  2BYK B;  5B33 D;  2Y2K A;  3REK D;  3X1S B;  1ZLA A;  3VH6 T;  5AVC D;  2Y2Q A;  5BO0 A;  2YFW A;  5AY8 A;  4CSR B;  3X1U B;  1P3O A;  4XUJ A;  4KGC A;  2IO5 B;  5CP6 C;  1KX4 B;  3AV2 A;  4Z5T B;  5JRG B;  2BYK A;  3AZG D;  5GT3 C;  4WU9 C;  3LJA D;  5B1M D;  1EQZ D;  3REL D;  3FDD A;  3REJ B;  2F2A C;  3A6N A;  4H9P A;  4X23 C;  4Z5T A;  2HUE C;  3O62 D;  2Y2N A;  4H9Q A;  3KWQ B;  3B0D B;  4WU8 D;  5CPI D;  3B6F A;  3WA9 D;  5AV8 D;  5DNM C;  4UPK A;  3C1C B;  4LD9 D;  3V9R B;  2Y2I A;  5C3I B;  3A1K A;  1M18 A;  5BNX B;  5CPK A;  4ZBJ B;  1P3O C;  4XUJ C;  4KGC C;  3AL0 C;  4QLC B;  1U35 A;  4XZQ B;  4E44 A;  3KSY A;  3AV2 C;  5CP6 D;  5BS7 A;  1M1A A;  5JA4 A;  3AZM B;  3IP4 C;  5GT3 D;  3X1U C;  2RIQ A;  4WU9 D;  4WNN B;  2BG1 A;  3A6N C;  3A1I A;  5B0Z B;  4Z5T C;  4X23 D;  2J8P A;  5GSU B;  2FJ7 A;  1TZY A;  3B6F C;  3MGP D;  3AYW A;  4WNN A;  5B32 A;  1P3G D;  4J8V B;  3AZN B;  1S32 A;  2G5H C;  5BNV B;  1M18 C;  3H0M C;  5CPK C;  1ZLA D;  3MGR B;  1U35 C;  3AZJ A;  5AY8 D;  1P3O D;  3KXB A;  4XUJ D;  3REK B;  4KGC D;  2NQB B;  5BS7 C;  1KX3 A;  5AVC B;  4JJN A;  3MGS A;  3AV2 D;  1M1A C;  3EPJ A;  2BYM A;  3NQJ A;  4HGA C;  4ZBJ C;  2LY8 A;  3AZE A;  4XZQ C;  2F8N A;  1P3M A;  3LEL B;  3AZG B;  3MVD B;  3LJA B;  3A6N D;  5B1M B;  5AV5 A;  4Z5T D;  4H9R B;  4G91 B;  1BH8 A;  5GT0 A;  1EQZ B;  3REL B;  2FJ7 C;  3AYW C;  4DQY B;  3O62 B;  3B6F D;  5B0Z C;  3LEL A;  5FUG A;  3MVD A;  4DRA A;  1H3O B;  3LZ0 A;  2RVQ C;  1PZR A;  2JE5 A;  5GSU C;  4H9R A;  3WA9 B;  1M18 D;  3AZJ C;  3W97 A;  5AV8 B;  5CPK D;  3AZI A;  3KXB C;  3B6G A;  1U35 D;  1KX3 C;  5AV9 A;  4JJN C;  2G5I C;  4NFT A;  1H3O A;  1TAF A;  2Y2G A;  3AZE C;  1M1A D;  5G49 A;  1P3M C;  3REK C;  2NQB C;  3R45 A;  5AV5 C;  5GT0 C;  2XD1 A;  5GT3 B;  3REH A;  4WU9 B;  2FJ7 D;  5B1L A;  1TZY D;  4CAY A;  3WTP E;  3LEL C;  3AFA A;  3AYW D;  5B32 D;  4X23 B;  3MVD C;  3LJA C;  3AV1 A;  2HUE B;  3LZ0 C;  2Y2M A;  1M19 A;  5CPJ B;  4G91 C;  3H0L C; 
#chains in the Genus database with same CATH homology
 3W97 C;  1P3G B;  3AZI C;  3B6G C;  2RVQ D;  4YM6 B;  5B32 G;  5E5A A;  5AV9 C;  3EPK A;  3AZJ D;  3KXB D;  1P3K A;  1ZLA B;  1KX3 D;  4JJN D;  3MGS D;  2YFW B;  5AY8 B;  5CPJ A;  1P3O B;  5B31 G;  1F66 B;  1B67 A;  3AZE D;  4YM6 A;  3AV2 B;  5B0Y B;  2F8N D;  1HQ3 A;  1P3M D;  4J8W A;  3REH C;  1P3L A;  2NQB D;  2ARO A;  5AV5 D;  5GT0 D;  3UTB B;  1P3I A;  1F66 A;  4UUZ A;  2F8N G;  3AFA C;  3A6N B;  4H9P B;  5B0Y A;  3AV1 C;  5AVB A;  4H9Q B;  1M19 C;  3LEL D;  3MVD D;  3LZ0 D;  3B0B A;  2PYO A;  3B6F B;  3UTB A;  3W99 A;  3W97 D;  3AZI D;  3B6G D;  3VH5 T;  1P3K C;  2ZY3 A;  2F8N K;  5AV9 D;  3UT9 B;  1M18 B;  4NE3 A;  5CPK B;  5CPJ C;  3MGP C;  1P3G C;  1U35 B;  4YM6 C;  4H9O A;  1BFM A;  4WV4 B;  1HQ3 C;  4J8W C;  1P3L C;  1M1A B;  1ZLA C;  4Z66 A;  1P34 A;  1ULY A;  5JA4 B;  3UT9 A;  4HGA B;  5AY8 C;  3REH D;  1F66 C;  3WAA A;  1F1E A;  5B1L D;  5B0Y C;  5AVB C;  3VH6 A;  2UWX A;  5B40 B;  3AFA D;  2F8N H;  3AV1 D;  2FJ7 B;  2PYO C;  1TZY B;  1M19 D;  3UTB C;  4R8P A;  3W99 C;  3AYW B;  5B32 B;  1S32 B;  5E5A D;  1KX5 A;  5B40 A;  1P3K D;  4G92 B;  5B31 B;  3AZJ B;  3VH5 A;  5CPJ D;  3KXB B;  2VQR A;  4YS3 B;  1KX3 B;  4YM6 D;  3MGS B;  4JJN B;  4Z66 C;  1P34 C;  1HQ3 D;  1ID3 A;  3C1B A;  3UT9 C;  2BYM B;  3NQJ B;  3WAA C;  4J8W D;  1P3L D;  3AZE B;  4WJ3 C;  1P3B A;  5B31 A;  2ARO D;  2F8N B;  1P3M B;  1P3I D;  1F66 D;  3EPH A;  3NQU A;  4YS3 A;  5BT1 C;  3MNN A;  5AV5 B;  5GT0 B;  5B0Y D;  1BH8 B;  5AVB D;  4R8P C;  2FFF B;  2PYO D;  2HIO A;  3UTB D;  3W99 D;  5FUG B;  2ZM5 A;  3H0R C;  1KX5 C;  3LZ0 B;  5B40 C;  3B0C W;  3W97 B;  1TZY C;  4J8X A;  3AZI B;  3B6G B;  1P3P A;  5B32 C;  4KUD A;  5AV9 B;  1S32 C;  1ID3 C;  3C1B C;  1Z2C B;  1TAF B;  4Z66 D;  1P34 D;  1P3B C;  4G92 C;  5B31 C;  3UT9 D;  5G49 B;  3WAA D;  4EO5 C;  3AZL B;  4YS3 C;  1W2E A;  2Y2H A;  3MNN C;  3R45 B;  3MGS C;  3UTA A;  3REH B;  2DQN C;  3WTP A;  2L5A A;  3X1V A;  5B33 A;  3W98 B;  5BT1 D;  3TU4 A;  2HIO C;  5B1L B;  4CAY B;  4Z2M G;  3X1T A;  3MGQ A;  4R8P D;  3AZL A;  3AFA B;  4DRB A;  3AV1 B;  3AZF A;  5DNN A;  1M19 B;  3AZH A;  2CWE A;  5B40 D;  5KDM A;  4J8X C;  2ZY2 A;  1P3P C;  1KX5 D;  3W98 A;  2XD5 A;  4KUD C;  5E5A B;  3P5J B;  1JFI A;  1P3K B;  1AOI A;  2JCH A;  3W96 A;  5AV6 A;  1ID3 D;  3C1B D;  4J8U A;  1T3U A;  3WKJ A;  1WWI A;  1P3B D;  5B31 D;  1HQ3 B;  3X1V C;  4J8W B;  3WTP C;  1P3L B;  4YS3 D;  4E45 A;  3MNN D;  2ARO B;  5B2I A;  3TU4 C;  1P3I B;  4UUZ B;  3X1T C;  3MGQ C;  3AZL C;  3LZ1 B;  5F99 A;  2HIO D;  3AZF C;  5AVB B;  4Z2M H;  1N1J A;  3AZH C;  4H9N A;  4AWL C;  2PYO B;  4ZUX A;  3W98 C;  3W99 B;  5B1L C;  4J8X D;  1P3P D;  3REI A;  3LZ1 A;  1AOI C;  4KUD D;  2NZD B;  2CV5 A;  3W96 C;  5AV6 C;  2Y2O A;  4J8U C;  3WKJ C;  1B6W A;  4H9O B;  5E5A C;  5B24 A;  4Z66 B;  1P34 B;  2NZD A;  3UTA D;  2YFV A;  3X1V D;  3WTP D;  3WAA B;  5B2J A;  5DNM A;  1P3F A;  5F99 C;  3TU4 D;  3X1T D;  3MGQ D;  3AZL D;  1S32 D;  2W8S A;  3B0C T;  3AZF D;  4ZUX C;  5DNN D;  3AN2 A;  2ARO C;  1BH9 A;  4R8P B;  3AZH D;  1P3I C;  3REI C;  3W98 D;  3X1S A;  3LZ1 C;  2CV5 C;  3X1U A;  4CSR A;  1KX5 B;  1AOI D;  1KX4 A;  3W96 D;  5AV6 D;  5JRG A;  4J8U D;  3WKJ D;  5B24 C;  2NZD C;  2Y2P A;  1ID3 B;  3C1B B;  5B2J C;  3REJ A;  1P3B B;  4NE5 A;  1P3F C;  5B2I D;  4EO5 B;  3NQU B;  3KWQ A;  3MNN B;  5F99 D;  1P3A B;  4H9S A;  3AN2 C;  5GXQ B;  3KUY B;  2HIO B;  4ZUX D;  3X1S C;  3C1C A;  3V9R A;  1WWS A;  5BNX A;  3REI D;  3LZ1 D;  2IO5 C;  4QLC A;  3AZK B;  2Y2J A;  2CV5 D;  4XZQ A;  1P3A A;  1KX4 C;  4J8X B;  5JRG C;  5GXQ A;  3KUY A;  1P3P B;  4KUD B;  4KHA B;  3VH6 W;  5B24 D;  3AZM A;  1HTA A;  3REJ C;  2NZD D;  2DF4 C;  3AZK A;  5B0Z A;  4NE6 A;  2JSS A;  5B2J D;  5DNM D;  3KWQ C;  1P3F D;  3UTA B;  3B0D C;  4KHA A;  5GSU A;  3KFU G;  3X1V B;  3WTP B;  4H9S C;  5B33 B;  3TU4 B;  1KU5 A;  3VH5 W;  4WZS B;  3C1C C;  4J8V A;  3MGQ B;  1R4V A;  3AZN A;  3AN2 D;  3X1T B;  5C3I C;  5BNV A;  3X1S D;  3AZF B;  3MGR A;  5CHL B;  5DNN B;  4QLC C;  3EPL A;  1P3A C;  3AZH B;  3X1U D;  5KDM B;  5GXQ C;  3KUY C;  4AWL B;  3REK A;  2NQB A;  1KX4 D;  5AVC A;  1JFI B;  5JRG D;  4M6B A;  2Y2L A;  1A7W A;  3EG5 B;  1AOI B;  3AZM C;  3W96 B;  5AV6 B;  3AZK C;  4J8U B;  3WKJ B;  3AZG A;  3LJA A;  3REJ D;  4WU8 B;  5CPI B;  5B1M A;  1EQZ A;  3REL A;  3KWQ D;  4LD9 B;  5B2I B;  3O62 A;  4J8V C;  3AZN C;  5F99 B;  4WU8 A;  3C1C D;  5CPI A;  3MGR C;  1N1J B;  2ZY4 A;  3UTA C;  2ZY5 A;  4H9N B;  3WA9 A;  5CP6 B;  5AV8 A;  5B33 C;  3F6T A;  3MGP B;  4ZUX B;  1P3A D;  4QLC D;  4LD9 A;  4XZQ D;  5AVC C;  5GXQ D;  3KUY D;  3REI B;  2CV5 B;  5DNN C;  3AZM D;  5CP6 A;  3AZG C;  3AZK D;  5B1M C;  5B0Z D;  5B24 B;  5GT3 A;  4WU9 A;  1EQZ C;  3REL C;  5GSU D;  1Q9C A;  2YFV B;  3O62 C;  5B2J B;  5DNM B;  1P3F B;  4X23 A;  4WU8 C;  5BO0 B;  5CPI C;  4J8V D;  3AZN D;  3WA9 C;  4XUJ B;  3MGP A;  4KGC B;  5AV8 C;  1P3G A;  3MGR D;  3AN2 B;  4LD9 C;  1BH9 B;  5B2I C;  2BYK B;  5B33 D;  2Y2K A;  3REK D;  3X1S B;  1ZLA A;  3VH6 T;  5AVC D;  2Y2Q A;  5BO0 A;  2YFW A;  5AY8 A;  4CSR B;  3X1U B;  1P3O A;  4XUJ A;  4KGC A;  2IO5 B;  5CP6 C;  1KX4 B;  3AV2 A;  4Z5T B;  5JRG B;  2BYK A;  3AZG D;  5GT3 C;  4WU9 C;  3LJA D;  5B1M D;  1EQZ D;  3REL D;  3FDD A;  3REJ B;  2F2A C;  3A6N A;  4H9P A;  4X23 C;  4Z5T A;  2HUE C;  3O62 D;  2Y2N A;  4H9Q A;  3KWQ B;  3B0D B;  4WU8 D;  5CPI D;  3B6F A;  3WA9 D;  5AV8 D;  5DNM C;  4UPK A;  3C1C B;  4LD9 D;  3V9R B;  2Y2I A;  5C3I B;  3A1K A;  1M18 A;  5BNX B;  5CPK A;  4ZBJ B;  1P3O C;  4XUJ C;  4KGC C;  3AL0 C;  4QLC B;  1U35 A;  4XZQ B;  4E44 A;  3KSY A;  3AV2 C;  5CP6 D;  5BS7 A;  1M1A A;  5JA4 A;  3AZM B;  3IP4 C;  5GT3 D;  3X1U C;  2RIQ A;  4WU9 D;  4WNN B;  2BG1 A;  3A6N C;  3A1I A;  5B0Z B;  4Z5T C;  4X23 D;  2J8P A;  5GSU B;  2FJ7 A;  1TZY A;  3B6F C;  3MGP D;  3AYW A;  4WNN A;  5B32 A;  1P3G D;  4J8V B;  3AZN B;  1S32 A;  2G5H C;  5BNV B;  1M18 C;  3H0M C;  5CPK C;  1ZLA D;  3MGR B;  1U35 C;  3AZJ A;  5AY8 D;  1P3O D;  3KXB A;  4XUJ D;  3REK B;  4KGC D;  2NQB B;  5BS7 C;  1KX3 A;  5AVC B;  4JJN A;  3MGS A;  3AV2 D;  1M1A C;  3EPJ A;  2BYM A;  3NQJ A;  4HGA C;  4ZBJ C;  2LY8 A;  3AZE A;  4XZQ C;  2F8N A;  1P3M A;  3LEL B;  3AZG B;  3MVD B;  3LJA B;  3A6N D;  5B1M B;  5AV5 A;  4Z5T D;  4H9R B;  4G91 B;  1BH8 A;  5GT0 A;  1EQZ B;  3REL B;  2FJ7 C;  3AYW C;  4DQY B;  3O62 B;  3B6F D;  5B0Z C;  3LEL A;  5FUG A;  3MVD A;  4DRA A;  1H3O B;  3LZ0 A;  2RVQ C;  1PZR A;  2JE5 A;  5GSU C;  4H9R A;  3WA9 B;  1M18 D;  3AZJ C;  3W97 A;  5AV8 B;  5CPK D;  3AZI A;  3KXB C;  3B6G A;  1U35 D;  1KX3 C;  5AV9 A;  4JJN C;  2G5I C;  4NFT A;  1H3O A;  1TAF A;  2Y2G A;  3AZE C;  1M1A D;  5G49 A;  1P3M C;  3REK C;  2NQB C;  3R45 A;  5AV5 C;  5GT0 C;  2XD1 A;  5GT3 B;  3REH A;  4WU9 B;  2FJ7 D;  5B1L A;  1TZY D;  4CAY A;  3WTP E;  3LEL C;  3AFA A;  3AYW D;  5B32 D;  4X23 B;  3MVD C;  3LJA C;  3AV1 A;  2HUE B;  3LZ0 C;  2Y2M A;  1M19 A;  5CPJ B;  4G91 C;  3H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...