5AV9B

Human nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9B00
5F99A 1ZLAD 3X1TD 4R8PD 1P3FC 3MGQA 4QLCD 1P3OA 3UT9D 4H9NA 1P3GD 5CP6B 3AZGD 3A6ND 3W99C 5B2JA 3AZEA 3W98D 4ZBJC 4E45A 3B0CT 3AZKA 4DRBA 3KWQB 1P3FD 5F99B 3MGQB 1P3OB 1P3BA 5AV5C 4H9NB 3W96B 5AY8A 3W99D 5B24C 3TU4A 3AV1C 5B2JB 3AZEB 2F8NA 5AV6C 3X1SC 1ID3B 4H9SA 2IO5C 3REIA 4LD9B 3MVDC 4J8WA 5AV5D 1HQ3A 5B24D 4DRAA 3AV1D 3MGPC 3AYWC 5AV6D 3X1SD 5BO0B 1N1JA 3KUYC 3UTAA 3REIB 3MVDD 4WZSB 4J8WB 2HUEB 3B0CW 3LZ1A 3C1BC 1P3MB 4CAYA 3UTBA 5B0YA 3AYWD 1Q9CA 1TZYA 3KUYD 2NZDA 5DNNA 4AWLB 1N1JB 1KX5C 3V9RB 5B2IA 3AZFA 3B6GB 3C1BD 3LZ1B 1M18A 3W97C 4CAYB 3UTBB 3REHC 5B1MA 5C3IC 5AV9A 3KXBC 5E5AA 1TZYB 1KX5D 2NZDB 5DNNB 1R4VA 5CP6D 5B2IB 5BS7C 3MNNA 5B33A 3LELA 2AROC 4J8VC 3AZHC 3AZFB 5AV8A 1M1AA 4WU9C 5B32C 3W97D 2HIOA 2BYKA 3RELA 1M18B 2LY8A 3REHD 3KXBD 1P3KC 4LD9C 5AV9B 5E5AB 5GT3A 1P3IB 3AN2A 3W96D 5B33B 3LELB 3AZHD 3LZ0A 5AV8B 5B32D 4WU9D 4M6BA 1F66A 5GXQC 3X1VA 3RELB 1KX3B 4J8XC 3NQUB 1P3KD 4LD9D 3AZLB 5GT3B 3AN2B 4XZQB 3C1CC 5B32G 3W99A 3LJAC 1TAFA 3LZ0B 4X23C 5GXQD 3B0DC 4J8UB 3AZJA 4J8XD 3WAAC 3X1VB 2FJ7C 5GSUA 5B1LC 4Z66C 4WV4B 3WTPC 3VH6A 1P3MD 3MGRB 1M19A 5JRGC 5KDMA 4ZUXA 3LJAD 4X23D 1TAFB 1P3PB 5B40C 4H9QA 3WAAD 3AZJB 5B0ZB 2FJ7D 1AOIB 1P3LC 3AZNA 5B1LD 2CV5C 5GSUB 3WTPD 3REJC 3KSYA 5JRGD 1P3GC 1M19B 5KDMB 4ZUXB 3AZGC 3MGPA 3MGSC 5B40D 2NQBA 1KX4A 3KUYA 1P3IC 5GT0C 4EO5B 1P3LD 1EQZC 2CV5D 3AZNB 3AZMC 5CPIC 2RVQC 4CSRA 2L5AA 3REJD 1U35A 2PYOA 5B31C 3REKA 1KX3C 3MGSD 5CPJC 2NQBB 1P3ID 5GT0D 5CHLB 1KX4B 4Z5TB 4HGAC 1EQZD 5AVBA 4XZQC 3AZMD 5CPID 2RVQD 4G92B 3WA9C 4CSRB 5B31D 1U35B 5FUGA 4J8UC 2PYOB 1KX3D 3W97A 3AZIA 1B6WA 2JSSA 5CPJD 3WKJC 3REHA 5DNMA 4YM6A 4WNNA 3AZLD 3AZKB 4NFTA 4XZQD 5AVBB 5B31G 5AVCC 2AROA 4J8VA 4JJNA 3B6FC 3WA9D 1P3PC 1P3BB 4J8UD 3AV2C 5FUGB 5AY8B 3TU4B 5B0ZC 3AZIB 3WKJD 3X1UA 4XUJA 2F8NB 2YFVA 5DNMB 3MGRD 5CPKC 5AVCD 4WU8C 4KGCC 3B6FD 2YFWA 1P3PD 1S32A 3AV2D 4KUDC 2CWEA 1HQ3B 5GXQA 5B0ZD 4EO5C 1AOID 4J8XA 3X1UB 4XUJB 2YFVB 5CPKD 4WU8D 3UTAB 5CP6C 4KGCD 1P3AA 3C1CA 4E44A 2YFWB 4KUDD 4X23A 3VH6T 5JA4A 4YS3A 3O62A 1F1EA 3KWQC 5F99C 5B0YB 1P34A 3MGQC 1P3OC 1BFMA 4Z66A 4H9OA 3W96C 1P3AB 5B2JC 3AZEC 1ID3C 5B40A 4Z5TD 1BH8A 3KWQD 5F99D 3AFAA 3VH5T 3MGQD 3NQJA 1ZLAA 4R8PA 3X1TA 1P34B 1P3OD 4QLCA 2CV5A 5B1MB 3UT9A 1P3GA 4H9OB 3TU4C 5B2JD 3AZED 3MNNB 3AZGA 3A6NA 1ID3D 3W98A 3MGSA 1BH8B 1M1AB 5GT0A 2HIOB 2BYKB 4NE6A 1P3FA 3REIC 3NQJB 4R8PB 1P3BD 4J8WC 2HUEC 4G91B 3TU4D 1P3MC 3VH6W 3A6NB 4AWLC 1F66B 3REID 4H9PA 1P3FB 4J8WD 3WA9A 1WWSA 5BNVA 3B6GC 5AV5A 3LZ1C 5B24A 3UTBC 3AV1A 5B0YC 3W99B 3VH5W 5AV6A 3X1SA 1TZYC 2NZDC 5DNNC 3UTAD 5B2IC 4H9PB 3AZFC 1ULYA 3MVDA 3B6GD 3LZ1D 5AV5B 3UTBD 5B0YD 5B24B 1M18C 3AV1B 3AYWA 1TZYD 2NZDD 5AV9C 5DNND 5E5AC 5AV6B 3X1SB 5CPKA 4H9QB 5B2ID 2IO5B 3MNNC 5B33C 3LELC 3AFAD 3AZFD 5BNXA 5AV8C 3MVDB 1M18D 2HIOC 3C1BA 3RELC 1A7WA 3MGPB 5B1MD 5AV9D 5E5AD 1BH9A 3AZLC 1KX5A 3KUYB 5GT3C 5G49A 3AN2C 5CP6A 5B33D 3MNND 3LELD 4KHAA 5AV8D 3LZ0C 5BNXB 2HIOD 3KWQA 3RELD 3REKB 3C1BB 3X1VC 3KXBA 1BH9B 2BYMA 5GT3D 3AN2D 1KX5B 3MGRC 3W96A 5G49B 5BS7A 3LZ0D 3AZHA 4KHAB 1ID3A 4WU9A 5B32A 1F66D 3X1VD 3AZJC 3W97B 1AOIC 1P3KA 5GSUC 3REHB 4LD9A 5C3IB 4WNNB 4YM6B 3KXBB 2BYMB 1M19C 4ZUXC 2AROB 4J8VB 4JJNB 3AZHB 5BO0A 3AZJD 4WU9B 5B32B 1H3OA 5GSUD 4H9RA 3AZNC 1P3KB 1M19D 4ZUXD 1P3MA 3LJAA 2F8NK 4NE3A 4UUZA 2NQBC 1S32B 1KX4C 4Z5TC 3V9RA 1KU5A 5GXQB 1H3OB 3WAAA 4J8XB 3AZND 2FJ7A 4H9RB 4G92C 4NE5A 5B1LA 1U35C 3WTPA 2PYOC 3B6GA 5JRGA 3REKC 3MGPD 3C1CB 3LJAB 2NQBD 4UUZB 1KX4D 3AZKC 4X23B 5JA4B 4YS3B 3O62B 3B0DB 1WWIA 5AVBC 3WAAB 1P3LA 1HTAA 2FJ7B 1U35D 1P3BC 5B1LB 4Z66B 2PYOD 3REJA 3WTPB 3REKD 5AY8C 5JRGB 3AZIC 3AZKD 5DNMC 4YM6C 5B40B 1P3IA 4H9SC 3AFAB 5AVBD 1EQZA 4Z2MH 1P3LB 3X1TB 1ZLAB 4JJNC 4QLCB 3AZMA 5CPIA 2CV5B 5BT1C 3UT9B 1HQ3C 3REJB 5AY8D 5B31A 3AZID 1P3GB 1KX3A 2F8ND 3NQUA 3AZGB 3X1UC 5DNMD 4YM6D 4Z2MG 4XUJC 3MGSB 5CPJA 2F8NH 3R45A 3W98B 3AZLA 3B0BA 5GT0B 3UTAC 4XZQA 1EQZB 2AROD 4J8VD 4JJND 5BT1D 3AZMB 5CPIB 1HQ3D 1S32C 2F8NG 4J8UA 5B31B 3X1UD 4XUJD 3WKJA 4ZBJB 5CPJB 3R45B 3MGRA 4HGAB 5AVCA 1P3AC 3B6FA 1S32D 1P3PA 3WA9B 5BNVB 4YS3C 3AV2A 3O62C 1JFIA 5B0ZA 1AOIA 1P34C 3WKJB 5B1MC 1P3AD 3C1CD 4WU8A 4KGCA 5AVCB 3WTPE 3B6FB 4YS3D 3O62D 4KUDA 1M1AC 3AV2B 3AFAC 1JFIB 1P34D 1B67A 1ZLAC 4R8PC 3AYWB 3X1TC 4Z66D 4QLCC 4G91C 3UT9C 5CPKB 3VH5A 4WU8B 4KGCB 3A6NC 3W98C 1M1AD 4KUDB 4Z5TA 1F66C
chains in the Genus database with same CATH superfamily
5F99A 3A1IA 3X1TD 4R8PD 1P3FC 1ZLAD 3MGQA 4QLCD 1P3OA 3UT9D 4H9NA 1P3GD 5CP6B 3AZGD 3A6ND 3W99C 5B2JA 3AZEA 2Y2JA 3W98D 4ZBJC 4E45A 3B0CT 3AZKA 4DRBA 2Y2KA 3KWQB 1P3FD 5F99B 3MGQB 1P3OB 1P3BA 5AV5C 4H9NB 3W96B 5AY8A 3W99D 5B24C 3TU4A 3AV1C 5B2JB 3AZEB 2F8NA 5AV6C 3X1SC 1ID3B 4H9SA 2IO5C 3REIA 4LD9B 3MVDC 4J8WA 5AV5D 1HQ3A 5B24D 4DRAA 3AV1D 3MGPC 3AYWC 5AV6D 3X1SD 5BO0B 1N1JA 3KUYC 3EPJA 3UTAA 3EPLA 2XD5A 3REIB 3MVDD 4WZSB 4J8WB 2HUEB 3B0CW 3LZ1A 3C1BC 1P3MB 4CAYA 3UTBA 5B0YA 3AYWD 1Q9CA 1TZYA 3KUYD 2NZDA 5DNNA 4AWLB 1N1JB 1KX5C 3V9RB 5B2IA 3AZFA 3B6GB 3C1BD 3LZ1B 1M18A 3W97C 4CAYB 3UTBB 3REHC 5B1MA 5C3IC 5AV9A 3KXBC 5E5AA 1TZYB 1KX5D 2NZDB 5DNNB 1R4VA 5CP6D 5B2IB 5BS7C 3MNNA 5B33A 4UPKA 2AROC 3LELA 4J8VC 3AZHC 3AZFB 5AV8A 1M1AA 4WU9C 5B32C 3W97D 2HIOA 2BYKA 3RELA 1M18B 2LY8A 3REHD 3KXBD 1P3KC 4LD9C 5AV9B 5E5AB 5GT3A 1P3IB 2JE5A 3AN2A 3W96D 5B33B 3LELB 3AZHD 3LZ0A 5AV8B 5B32D 4WU9D 4M6BA 1F66A 5GXQC 3X1VA 3RELB 1KX3B 4J8XC 3NQUB 1P3KD 2UWXA 4LD9D 3AZLB 5GT3B 3AN2B 4XZQB 3C1CC 5B32G 3W99A 3LJAC 3P5JB 1TAFA 3LZ0B 4X23C 5GXQD 3B0DC 4J8UB 3AZJA 4J8XD 3WAAC 3X1VB 2ZY5A 2FJ7C 5GSUA 5B1LC 4Z66C 4WV4B 3WTPC 3VH6A 1P3MD 3MGRB 1M19A 3EG5B 5JRGC 5KDMA 4ZUXA 3LJAD 4X23D 1TAFB 1P3PB 5B40C 4H9QA 3WAAD 3AZJB 5B0ZB 2FJ7D 1AOIB 1P3LC 2DF4C 3AZNA 5B1LD 2CV5C 5GSUB 3WTPD 3REJC 3KSYA 5JRGD 1P3GC 1M19B 5KDMB 4ZUXB 2Y2IA 2VQRA 3MGPA 3AZGC 3MGSC 5B40D 2NQBA 1KX4A 3KUYA 1P3IC 5GT0C 4EO5B 1P3LD 1EQZC 2CV5D 3AZNB 3AZMC 5CPIC 2RVQC 4CSRA 2L5AA 3REJD 1U35A 2PYOA 5B31C 3REKA 1KX3C 3MGSD 5CPJC 2NQBB 1P3ID 1W2EA 5CHLB 5GT0D 4Z5TB 4HGAC 1KX4B 1EQZD 5AVBA 4XZQC 4WJ3C 3AZMD 5CPID 1T3UA 2RVQD 2G5HC 4G92B 3WA9C 4CSRB 5B31D 1U35B 5FUGA 4J8UC 2PYOB 1KX3D 3W97A 3AZIA 1B6WA 2FFFB 2JSSA 5CPJD 3WKJC 3REHA 2JCHA 5DNMA 4WNNA 4YM6A 3AZLD 3AZKB 2XD1A 3H0MC 4NFTA 4XZQD 5AVBB 5B31G 5AVCC 2AROA 2W8SA 4J8VA 4JJNA 3B6FC 3WA9D 1P3PC 1P3BB 4J8UD 3AV2C 5FUGB 5AY8B 3TU4B 5B0ZC 3AZIB 3WKJD 3X1UA 4XUJA 2F8NB 2YFVA 5DNMB 3MGRD 5CPKC 2G5IC 2DQNC 5AVCD 4WU8C 4KGCC 2Y2MA 3B6FD 2YFWA 1P3PD 1S32A 3AV2D 4KUDC 2CWEA 1HQ3B 5GXQA 5B0ZD 4EO5C 1AOID 4J8XA 3X1UB 4XUJB 2YFVB 5CPKD 3A1KA 4WU8D 3UTAB 5CP6C 4KGCD 1P3AA 3C1CA 4E44A 2YFWB 4KUDD 4X23A 3VH6T 5JA4A 2BG1A 4YS3A 3O62A 1F1EA 3KWQC 5F99C 5B0YB 1P34A 3MGQC 1P3OC 1BFMA 4Z66A 4H9OA 3W96C 1P3AB 5B2JC 3AZEC 1ID3C 5B40A 4Z5TD 1BH8A 3KWQD 5F99D 3AFAA 3VH5T 3MGQD 3NQJA 1ZLAA 4R8PA 3X1TA 1P34B 1P3OD 4QLCA 2CV5A 5B1MB 3UT9A 1P3GA 4H9OB 3TU4C 5B2JD 3AZED 3MNNB 3AZGA 3A6NA 1ID3D 2Y2HA 3MGSA 3W98A 3EPKA 1BH8B 1M1AB 5GT0A 2HIOB 2BYKB 4NE6A 1P3FA 3REIC 3NQJB 4R8PB 1P3BD 3KFUG 4J8WC 2HUEC 4G91B 3TU4D 1P3MC 3VH6W 3IP4C 3A6NB 2ZY2A 4AWLC 1F66B 3REID 4H9PA 1P3FB 4J8WD 3WA9A 1WWSA 5BNVA 3B6GC 5AV5A 3LZ1C 5B24A 2Y2NA 3UTBC 3AV1A 5B0YC 3W99B 3VH5W 5AV6A 3X1SA 1TZYC 2NZDC 5DNNC 3UTAD 5B2IC 3AL0C 4H9PB 3AZFC 1ULYA 2Y2LA 3MVDA 3B6GD 3LZ1D 5AV5B 3UTBD 5B0YD 5B24B 1M18C 3AV1B 3AYWA 1TZYD 2NZDD 5AV9C 5DNND 5E5AC 5AV6B 3X1SB 5CPKA 4H9QB 5B2ID 2IO5B 3MNNC 5B33C 3LELC 3AFAD 3AZFD 5BNXA 5AV8C 3MVDB 1M18D 2HIOC 3C1BA 3RELC 1A7WA 3MGPB 5B1MD 5AV9D 5E5AD 1BH9A 3AZLC 1KX5A 2Y2OA 3KUYB 5GT3C 5G49A 3AN2C 5CP6A 5B33D 3MNND 3LELD 4KHAA 5AV8D 3LZ0C 5BNXB 2HIOD 3F6TA 3KWQA 3RELD 3REKB 3C1BB 3X1VC 3KXBA 1BH9B 2BYMA 5GT3D 3AN2D 1KX5B 3MGRC 3W96A 5G49B 5BS7A 2F2AC 3LZ0D 3AZHA 4KHAB 1ID3A 4WU9A 5B32A 1F66D 3X1VD 3AZJC 3W97B 1AOIC 1P3KA 5GSUC 3REHB 4LD9A 5C3IB 4WNNB 4YM6B 3KXBB 2BYMB 1M19C 4ZUXC 2ZM5A 2AROB 4J8VB 4JJNB 3AZHB 5BO0A 3AZJD 4WU9B 5B32B 1H3OA 2RIQA 4H9RA 5GSUD 3AZNC 1P3KB 2J8PA 1M19D 4ZUXD 1P3MA 3LJAA 2F8NK 4NE3A 4UUZA 2NQBC 1S32B 1KX4C 4Z5TC 3V9RA 1KU5A 5GXQB 1H3OB 3WAAA 4J8XB 3AZND 2FJ7A 4H9RB 4G92C 2Y2QA 4NE5A 5B1LA 1U35C 3WTPA 2PYOC 3B6GA 5JRGA 3REKC 3MGPD 3C1CB 3LJAB 2NQBD 4UUZB 1KX4D 3AZKC 4X23B 5JA4B 4YS3B 3O62B 3B0DB 1WWIA 5AVBC 3WAAB 1P3LA 1HTAA 2FJ7B 1U35D 1P3BC 5B1LB 4Z66B 2PYOD 3REJA 3WTPB 3REKD 5AY8C 1PZRA 5JRGB 3AZIC 3AZKD 5DNMC 4YM6C 5B40B 1P3IA 4H9SC 3AFAB 5AVBD 1EQZA 4DQYB 4Z2MH 1P3LB 3X1TB 1ZLAB 4JJNC 4QLCB 3AZMA 5CPIA 2CV5B 5BT1C 3UT9B 1HQ3C 3REJB 5AY8D 5B31A 3AZID 1P3GB 1KX3A 2F8ND 3NQUA 3AZGB 3X1UC 5DNMD 4Z2MG 4XUJC 4YM6D 3MGSB 5CPJA 2F8NH 3R45A 3W98B 3AZLA 2ZY3A 3B0BA 5GT0B 3UTAC 4XZQA 1EQZB 2AROD 4J8VD 4JJND 5BT1D 3AZMB 5CPIB 1HQ3D 1S32C 2F8NG 4J8UA 5B31B 2ZY4A 3X1UD 4XUJD 3WKJA 4ZBJB 5CPJB 3R45B 1Z2CB 3H0RC 3MGRA 4HGAB 5AVCA 1P3AC 3B6FA 1S32D 1P3PA 3WA9B 5BNVB 4YS3C 3AV2A 3O62C 1JFIA 5B0ZA 1AOIA 2Y2PA 1P34C 3WKJB 5B1MC 3H0LC 3EPHA 1P3AD 3C1CD 4WU8A 4KGCA 5AVCB 3FDDA 3WTPE 3B6FB 4YS3D 3O62D 4KUDA 1M1AC 3AV2B 3AFAC 1JFIB 1P34D 1B67A 1ZLAC 4R8PC 3AYWB 3X1TC 4Z66D 4QLCC 4G91C 3UT9C 5CPKB 3VH5A 4WU8B 4KGCB 3A6NC 3W98C 1M1AD 4KUDB 4Z5TA 1F66C 2Y2GA
chains in the Genus database with same CATH topology
5F99A 3A1IA 3X1TD 4R8PD 1P3FC 1ZLAD 3MGQA 4QLCD 1P3OA 3UT9D 4H9NA 1P3GD 5CP6B 3AZGD 3A6ND 3W99C 5B2JA 3AZEA 2Y2JA 3W98D 4ZBJC 4E45A 3B0CT 3AZKA 4DRBA 2Y2KA 3KWQB 1P3FD 5F99B 3MGQB 1P3OB 1P3BA 5AV5C 4H9NB 3W96B 5AY8A 3W99D 5B24C 3TU4A 3AV1C 5B2JB 3AZEB 2F8NA 5AV6C 3X1SC 1ID3B 4H9SA 2IO5C 3REIA 4LD9B 3MVDC 4J8WA 5AV5D 1HQ3A 5B24D 4DRAA 3AV1D 3MGPC 3AYWC 5AV6D 3X1SD 5BO0B 1N1JA 3KUYC 3EPJA 3UTAA 3EPLA 2XD5A 3REIB 3MVDD 4WZSB 4J8WB 2HUEB 3B0CW 3LZ1A 3C1BC 1P3MB 4CAYA 3UTBA 5B0YA 3AYWD 1Q9CA 1TZYA 3KUYD 2NZDA 5DNNA 4AWLB 1N1JB 1KX5C 3V9RB 5B2IA 3AZFA 3B6GB 3C1BD 3LZ1B 1M18A 3W97C 4CAYB 3UTBB 3REHC 5B1MA 5C3IC 5AV9A 3KXBC 5E5AA 1TZYB 1KX5D 2NZDB 5DNNB 1R4VA 5CP6D 5B2IB 5BS7C 3MNNA 5B33A 4UPKA 2AROC 3LELA 4J8VC 3AZHC 3AZFB 5AV8A 1M1AA 4WU9C 5B32C 3W97D 2HIOA 2BYKA 3RELA 1M18B 2LY8A 3REHD 3KXBD 1P3KC 4LD9C 5AV9B 5E5AB 5GT3A 1P3IB 2JE5A 3AN2A 3W96D 5B33B 3LELB 3AZHD 3LZ0A 5AV8B 5B32D 4WU9D 4M6BA 1F66A 5GXQC 3X1VA 3RELB 1KX3B 4J8XC 3NQUB 1P3KD 2UWXA 4LD9D 3AZLB 5GT3B 3AN2B 4XZQB 3C1CC 5B32G 3W99A 3LJAC 3P5JB 1TAFA 3LZ0B 4X23C 5GXQD 3B0DC 4J8UB 3AZJA 4J8XD 3WAAC 3X1VB 2ZY5A 2FJ7C 5GSUA 5B1LC 4Z66C 4WV4B 3WTPC 3VH6A 1P3MD 3MGRB 1M19A 3EG5B 5JRGC 5KDMA 4ZUXA 3LJAD 4X23D 1TAFB 1P3PB 5B40C 4H9QA 3WAAD 3AZJB 5B0ZB 2FJ7D 1AOIB 1P3LC 2DF4C 3AZNA 5B1LD 2CV5C 5GSUB 3WTPD 3REJC 3KSYA 5JRGD 1P3GC 1M19B 5KDMB 4ZUXB 2Y2IA 2VQRA 3MGPA 3AZGC 3MGSC 5B40D 2NQBA 1KX4A 3KUYA 1P3IC 5GT0C 4EO5B 1P3LD 1EQZC 2CV5D 3AZNB 3AZMC 5CPIC 2RVQC 4CSRA 2L5AA 3REJD 1U35A 2PYOA 5B31C 3REKA 1KX3C 3MGSD 5CPJC 2NQBB 1P3ID 1W2EA 5CHLB 5GT0D 4Z5TB 4HGAC 1KX4B 1EQZD 5AVBA 4XZQC 4WJ3C 3AZMD 5CPID 1T3UA 2RVQD 2G5HC 4G92B 3WA9C 4CSRB 5B31D 1U35B 5FUGA 4J8UC 2PYOB 1KX3D 3W97A 3AZIA 1B6WA 2FFFB 2JSSA 5CPJD 3WKJC 3REHA 2JCHA 5DNMA 4WNNA 4YM6A 3AZLD 3AZKB 2XD1A 3H0MC 4NFTA 4XZQD 5AVBB 5B31G 5AVCC 2AROA 2W8SA 4J8VA 4JJNA 3B6FC 3WA9D 1P3PC 1P3BB 4J8UD 3AV2C 5FUGB 5AY8B 3TU4B 5B0ZC 3AZIB 3WKJD 3X1UA 4XUJA 2F8NB 2YFVA 5DNMB 3MGRD 5CPKC 2G5IC 2DQNC 5AVCD 4WU8C 4KGCC 2Y2MA 3B6FD 2YFWA 1P3PD 1S32A 3AV2D 4KUDC 2CWEA 1HQ3B 5GXQA 5B0ZD 4EO5C 1AOID 4J8XA 3X1UB 4XUJB 2YFVB 5CPKD 3A1KA 4WU8D 3UTAB 5CP6C 4KGCD 1P3AA 3C1CA 4E44A 2YFWB 4KUDD 4X23A 3VH6T 5JA4A 2BG1A 4YS3A 3O62A 1F1EA 3KWQC 5F99C 5B0YB 1P34A 3MGQC 1P3OC 1BFMA 4Z66A 4H9OA 3W96C 1P3AB 5B2JC 3AZEC 1ID3C 5B40A 4Z5TD 1BH8A 3KWQD 5F99D 3AFAA 3VH5T 3MGQD 3NQJA 1ZLAA 4R8PA 3X1TA 1P34B 1P3OD 4QLCA 2CV5A 5B1MB 3UT9A 1P3GA 4H9OB 3TU4C 5B2JD 3AZED 3MNNB 3AZGA 3A6NA 1ID3D 2Y2HA 3MGSA 3W98A 3EPKA 1BH8B 1M1AB 5GT0A 2HIOB 2BYKB 4NE6A 1P3FA 3REIC 3NQJB 4R8PB 1P3BD 3KFUG 4J8WC 2HUEC 4G91B 3TU4D 1P3MC 3VH6W 3IP4C 3A6NB 2ZY2A 4AWLC 1F66B 3REID 4H9PA 1P3FB 4J8WD 3WA9A 1WWSA 5BNVA 3B6GC 5AV5A 3LZ1C 5B24A 2Y2NA 3UTBC 3AV1A 5B0YC 3W99B 3VH5W 5AV6A 3X1SA 1TZYC 2NZDC 5DNNC 3UTAD 5B2IC 3AL0C 4H9PB 3AZFC 1ULYA 2Y2LA 3MVDA 3B6GD 3LZ1D 5AV5B 3UTBD 5B0YD 5B24B 1M18C 3AV1B 3AYWA 1TZYD 2NZDD 5AV9C 5DNND 5E5AC 5AV6B 3X1SB 5CPKA 4H9QB 5B2ID 2IO5B 3MNNC 5B33C 3LELC 3AFAD 3AZFD 5BNXA 5AV8C 3MVDB 1M18D 2HIOC 3C1BA 3RELC 1A7WA 3MGPB 5B1MD 5AV9D 5E5AD 1BH9A 3AZLC 1KX5A 2Y2OA 3KUYB 5GT3C 5G49A 3AN2C 5CP6A 5B33D 3MNND 3LELD 4KHAA 5AV8D 3LZ0C 5BNXB 2HIOD 3F6TA 3KWQA 3RELD 3REKB 3C1BB 3X1VC 3KXBA 1BH9B 2BYMA 5GT3D 3AN2D 1KX5B 3MGRC 3W96A 5G49B 5BS7A 2F2AC 3LZ0D 3AZHA 4KHAB 1ID3A 4WU9A 5B32A 1F66D 3X1VD 3AZJC 3W97B 1AOIC 1P3KA 5GSUC 3REHB 4LD9A 5C3IB 4WNNB 4YM6B 3KXBB 2BYMB 1M19C 4ZUXC 2ZM5A 2AROB 4J8VB 4JJNB 3AZHB 5BO0A 3AZJD 4WU9B 5B32B 1H3OA 2RIQA 4H9RA 5GSUD 3AZNC 1P3KB 2J8PA 1M19D 4ZUXD 1P3MA 3LJAA 2F8NK 4NE3A 4UUZA 2NQBC 1S32B 1KX4C 4Z5TC 3V9RA 1KU5A 5GXQB 1H3OB 3WAAA 4J8XB 3AZND 2FJ7A 4H9RB 4G92C 2Y2QA 4NE5A 5B1LA 1U35C 3WTPA 2PYOC 3B6GA 5JRGA 3REKC 3MGPD 3C1CB 3LJAB 2NQBD 4UUZB 1KX4D 3AZKC 4X23B 5JA4B 4YS3B 3O62B 3B0DB 1WWIA 5AVBC 3WAAB 1P3LA 1HTAA 2FJ7B 1U35D 1P3BC 5B1LB 4Z66B 2PYOD 3REJA 3WTPB 3REKD 5AY8C 1PZRA 5JRGB 3AZIC 3AZKD 5DNMC 4YM6C 5B40B 1P3IA 4H9SC 3AFAB 5AVBD 1EQZA 4DQYB 4Z2MH 1P3LB 3X1TB 1ZLAB 4JJNC 4QLCB 3AZMA 5CPIA 2CV5B 5BT1C 3UT9B 1HQ3C 3REJB 5AY8D 5B31A 3AZID 1P3GB 1KX3A 2F8ND 3NQUA 3AZGB 3X1UC 5DNMD 4Z2MG 4XUJC 4YM6D 3MGSB 5CPJA 2F8NH 3R45A 3W98B 3AZLA 2ZY3A 3B0BA 5GT0B 3UTAC 4XZQA 1EQZB 2AROD 4J8VD 4JJND 5BT1D 3AZMB 5CPIB 1HQ3D 1S32C 2F8NG 4J8UA 5B31B 2ZY4A 3X1UD 4XUJD 3WKJA 4ZBJB 5CPJB 3R45B 1Z2CB 3H0RC 3MGRA 4HGAB 5AVCA 1P3AC 3B6FA 1S32D 1P3PA 3WA9B 5BNVB 4YS3C 3AV2A 3O62C 1JFIA 5B0ZA 1AOIA 2Y2PA 1P34C 3WKJB 5B1MC 3H0LC 3EPHA 1P3AD 3C1CD 4WU8A 4KGCA 5AVCB 3FDDA 3WTPE 3B6FB 4YS3D 3O62D 4KUDA 1M1AC 3AV2B 3AFAC 1JFIB 1P34D 1B67A 1ZLAC 4R8PC 3AYWB 3X1TC 4Z66D 4QLCC 4G91C 3UT9C 5CPKB 3VH5A 4WU8B 4KGCB 3A6NC 3W98C 1M1AD 4KUDB 4Z5TA 1F66C 2Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 A;  1ZLA D;  3X1T D;  4R8P D;  1P3F C;  3MGQ A;  4QLC D;  1P3O A;  3UT9 D;  4H9N A;  1P3G D;  5CP6 B;  3AZG D;  3A6N D;  3W99 C;  5B2J A;  3AZE A;  3W98 D;  4ZBJ C;  4E45 A;  3B0C T;  3AZK A;  4DRB A;  3KWQ B;  1P3F D;  5F99 B;  3MGQ B;  1P3O B;  1P3B A;  5AV5 C;  4H9N B;  3W96 B;  5AY8 A;  3W99 D;  5B24 C;  3TU4 A;  3AV1 C;  5B2J B;  3AZE B;  2F8N A;  5AV6 C;  3X1S C;  1ID3 B;  4H9S A;  2IO5 C;  3REI A;  4LD9 B;  3MVD C;  4J8W A;  5AV5 D;  1HQ3 A;  5B24 D;  4DRA A;  3AV1 D;  3MGP C;  3AYW C;  5AV6 D;  3X1S D;  5BO0 B;  1N1J A;  3KUY C;  3UTA A;  3REI B;  3MVD D;  4WZS B;  4J8W B;  2HUE B;  3B0C W;  3LZ1 A;  3C1B C;  1P3M B;  4CAY A;  3UTB A;  5B0Y A;  3AYW D;  1Q9C A;  1TZY A;  3KUY D;  2NZD A;  5DNN A;  4AWL B;  1N1J B;  1KX5 C;  3V9R B;  5B2I A;  3AZF A;  3B6G B;  3C1B D;  3LZ1 B;  1M18 A;  3W97 C;  4CAY B;  3UTB B;  3REH C;  5B1M A;  5C3I C;  5AV9 A;  3KXB C;  5E5A A;  1TZY B;  1KX5 D;  2NZD B;  5DNN B;  1R4V A;  5CP6 D;  5B2I B;  5BS7 C;  3MNN A;  5B33 A;  3LEL A;  2ARO C;  4J8V C;  3AZH C;  3AZF B;  5AV8 A;  1M1A A;  4WU9 C;  5B32 C;  3W97 D;  2HIO A;  2BYK A;  3REL A;  1M18 B;  2LY8 A;  3REH D;  3KXB D;  1P3K C;  4LD9 C;  5AV9 B;  5E5A B;  5GT3 A;  1P3I B;  3AN2 A;  3W96 D;  5B33 B;  3LEL B;  3AZH D;  3LZ0 A;  5AV8 B;  5B32 D;  4WU9 D;  4M6B A;  1F66 A;  5GXQ C;  3X1V A;  3REL B;  1KX3 B;  4J8X C;  3NQU B;  1P3K D;  4LD9 D;  3AZL B;  5GT3 B;  3AN2 B;  4XZQ B;  3C1C C;  5B32 G;  3W99 A;  3LJA C;  1TAF A;  3LZ0 B;  4X23 C;  5GXQ D;  3B0D C;  4J8U B;  3AZJ A;  4J8X D;  3WAA C;  3X1V B;  2FJ7 C;  5GSU A;  5B1L C;  4Z66 C;  4WV4 B;  3WTP C;  3VH6 A;  1P3M D;  3MGR B;  1M19 A;  5JRG C;  5KDM A;  4ZUX A;  3LJA D;  4X23 D;  1TAF B;  1P3P B;  5B40 C;  4H9Q A;  3WAA D;  3AZJ B;  5B0Z B;  2FJ7 D;  1AOI B;  1P3L C;  3AZN A;  5B1L D;  2CV5 C;  5GSU B;  3WTP D;  3REJ C;  3KSY A;  5JRG D;  1P3G C;  1M19 B;  5KDM B;  4ZUX B;  3AZG C;  3MGP A;  3MGS C;  5B40 D;  2NQB A;  1KX4 A;  3KUY A;  1P3I C;  5GT0 C;  4EO5 B;  1P3L D;  1EQZ C;  2CV5 D;  3AZN B;  3AZM C;  5CPI C;  2RVQ C;  4CSR A;  2L5A A;  3REJ D;  1U35 A;  2PYO A;  5B31 C;  3REK A;  1KX3 C;  3MGS D;  5CPJ C;  2NQB B;  1P3I D;  5GT0 D;  5CHL B;  1KX4 B;  4Z5T B;  4HGA C;  1EQZ D;  5AVB A;  4XZQ C;  3AZM D;  5CPI D;  2RVQ D;  4G92 B;  3WA9 C;  4CSR B;  5B31 D;  1U35 B;  5FUG A;  4J8U C;  2PYO B;  1KX3 D;  3W97 A;  3AZI A;  1B6W A;  2JSS A;  5CPJ D;  3WKJ C;  3REH A;  5DNM A;  4YM6 A;  4WNN A;  3AZL D;  3AZK B;  4NFT A;  4XZQ D;  5AVB B;  5B31 G;  5AVC C;  2ARO A;  4J8V A;  4JJN A;  3B6F C;  3WA9 D;  1P3P C;  1P3B B;  4J8U D;  3AV2 C;  5FUG B;  5AY8 B;  3TU4 B;  5B0Z C;  3AZI B;  3WKJ D;  3X1U A;  4XUJ A;  2F8N B;  2YFV A;  5DNM B;  3MGR D;  5CPK C;  5AVC D;  4WU8 C;  4KGC C;  3B6F D;  2YFW A;  1P3P D;  1S32 A;  3AV2 D;  4KUD C;  2CWE A;  1HQ3 B;  5GXQ A;  5B0Z D;  4EO5 C;  1AOI D;  4J8X A;  3X1U B;  4XUJ B;  2YFV B;  5CPK D;  4WU8 D;  3UTA B;  5CP6 C;  4KGC D;  1P3A A;  3C1C A;  4E44 A;  2YFW B;  4KUD D;  4X23 A;  3VH6 T;  5JA4 A;  4YS3 A;  3O62 A;  1F1E A;  3KWQ C;  5F99 C;  5B0Y B;  1P34 A;  3MGQ C;  1P3O C;  1BFM A;  4Z66 A;  4H9O A;  3W96 C;  1P3A B;  5B2J C;  3AZE C;  1ID3 C;  5B40 A;  4Z5T D;  1BH8 A;  3KWQ D;  5F99 D;  3AFA A;  3VH5 T;  3MGQ D;  3NQJ A;  1ZLA A;  4R8P A;  3X1T A;  1P34 B;  1P3O D;  4QLC A;  2CV5 A;  5B1M B;  3UT9 A;  1P3G A;  4H9O B;  3TU4 C;  5B2J D;  3AZE D;  3MNN B;  3AZG A;  3A6N A;  1ID3 D;  3W98 A;  3MGS A;  1BH8 B;  1M1A B;  5GT0 A;  2HIO B;  2BYK B;  4NE6 A;  1P3F A;  3REI C;  3NQJ B;  4R8P B;  1P3B D;  4J8W C;  2HUE C;  4G91 B;  3TU4 D;  1P3M C;  3VH6 W;  3A6N B;  4AWL C;  1F66 B;  3REI D;  4H9P A;  1P3F B;  4J8W D;  3WA9 A;  1WWS A;  5BNV A;  3B6G C;  5AV5 A;  3LZ1 C;  5B24 A;  3UTB C;  3AV1 A;  5B0Y C;  3W99 B;  3VH5 W;  5AV6 A;  3X1S A;  1TZY C;  2NZD C;  5DNN C;  3UTA D;  5B2I C;  4H9P B;  3AZF C;  1ULY A;  3MVD A;  3B6G D;  3LZ1 D;  5AV5 B;  3UTB D;  5B0Y D;  5B24 B;  1M18 C;  3AV1 B;  3AYW A;  1TZY D;  2NZD D;  5AV9 C;  5DNN D;  5E5A C;  5AV6 B;  3X1S B;  5CPK A;  4H9Q B;  5B2I D;  2IO5 B;  3MNN C;  5B33 C;  3LEL C;  3AFA D;  3AZF D;  5BNX A;  5AV8 C;  3MVD B;  1M18 D;  2HIO C;  3C1B A;  3REL C;  1A7W A;  3MGP B;  5B1M D;  5AV9 D;  5E5A D;  1BH9 A;  3AZL C;  1KX5 A;  3KUY B;  5GT3 C;  5G49 A;  3AN2 C;  5CP6 A;  5B33 D;  3MNN D;  3LEL D;  4KHA A;  5AV8 D;  3LZ0 C;  5BNX B;  2HIO D;  3KWQ A;  3REL D;  3REK B;  3C1B B;  3X1V C;  3KXB A;  1BH9 B;  2BYM A;  5GT3 D;  3AN2 D;  1KX5 B;  3MGR C;  3W96 A;  5G49 B;  5BS7 A;  3LZ0 D;  3AZH A;  4KHA B;  1ID3 A;  4WU9 A;  5B32 A;  1F66 D;  3X1V D;  3AZJ C;  3W97 B;  1AOI C;  1P3K A;  5GSU C;  3REH B;  4LD9 A;  5C3I B;  4WNN B;  4YM6 B;  3KXB B;  2BYM B;  1M19 C;  4ZUX C;  2ARO B;  4J8V B;  4JJN B;  3AZH B;  5BO0 A;  3AZJ D;  4WU9 B;  5B32 B;  1H3O A;  5GSU D;  4H9R A;  3AZN C;  1P3K B;  1M19 D;  4ZUX D;  1P3M A;  3LJA A;  2F8N K;  4NE3 A;  4UUZ A;  2NQB C;  1S32 B;  1KX4 C;  4Z5T C;  3V9R A;  1KU5 A;  5GXQ B;  1H3O B;  3WAA A;  4J8X B;  3AZN D;  2FJ7 A;  4H9R B;  4G92 C;  4NE5 A;  5B1L A;  1U35 C;  3WTP A;  2PYO C;  3B6G A;  5JRG A;  3REK C;  3MGP D;  3C1C B;  3LJA B;  2NQB D;  4UUZ B;  1KX4 D;  3AZK C;  4X23 B;  5JA4 B;  4YS3 B;  3O62 B;  3B0D B;  1WWI A;  5AVB C;  3WAA B;  1P3L A;  1HTA A;  2FJ7 B;  1U35 D;  1P3B C;  5B1L B;  4Z66 B;  2PYO D;  3REJ A;  3WTP B;  3REK D;  5AY8 C;  5JRG B;  3AZI C;  3AZK D;  5DNM C;  4YM6 C;  5B40 B;  1P3I A;  4H9S C;  3AFA B;  5AVB D;  1EQZ A;  4Z2M H;  1P3L B;  3X1T B;  1ZLA B;  4JJN C;  4QLC B;  3AZM A;  5CPI A;  2CV5 B;  5BT1 C;  3UT9 B;  1HQ3 C;  3REJ B;  5AY8 D;  5B31 A;  3AZI D;  1P3G B;  1KX3 A;  2F8N D;  3NQU A;  3AZG B;  3X1U C;  5DNM D;  4YM6 D;  4Z2M G;  4XUJ C;  3MGS B;  5CPJ A;  2F8N H;  3R45 A;  3W98 B;  3AZL A;  3B0B A;  5GT0 B;  3UTA C;  4XZQ A;  1EQZ B;  2ARO D;  4J8V D;  4JJN D;  5BT1 D;  3AZM B;  5CPI B;  1HQ3 D;  1S32 C;  2F8N G;  4J8U A;  5B31 B;  3X1U D;  4XUJ D;  3WKJ A;  4ZBJ B;  5CPJ B;  3R45 B;  3MGR A;  4HGA B;  5AVC A;  1P3A C;  3B6F A;  1S32 D;  1P3P A;  3WA9 B;  5BNV B;  4YS3 C;  3AV2 A;  3O62 C;  1JFI A;  5B0Z A;  1AOI A;  1P34 C;  3WKJ B;  5B1M C;  1P3A D;  3C1C D;  4WU8 A;  4KGC A;  5AVC B;  3WTP E;  3B6F B;  4YS3 D;  3O62 D;  4KUD A;  1M1A C;  3AV2 B;  3AFA C;  1JFI B;  1P34 D;  1B67 A;  1ZLA C;  4R8P C;  3AYW B;  3X1T C;  4Z66 D;  4QLC C;  4G91 C;  3UT9 C;  5CPK B;  3VH5 A;  4WU8 B;  4KGC B;  3A6N C;  3W98 C;  1M1A D;  4KUD B;  4Z5T A;  1F66 C; 
#chains in the Genus database with same CATH topology
 5F99 A;  3A1I A;  3X1T D;  4R8P D;  1P3F C;  1ZLA D;  3MGQ A;  4QLC D;  1P3O A;  3UT9 D;  4H9N A;  1P3G D;  5CP6 B;  3AZG D;  3A6N D;  3W99 C;  5B2J A;  3AZE A;  2Y2J A;  3W98 D;  4ZBJ C;  4E45 A;  3B0C T;  3AZK A;  4DRB A;  2Y2K A;  3KWQ B;  1P3F D;  5F99 B;  3MGQ B;  1P3O B;  1P3B A;  5AV5 C;  4H9N B;  3W96 B;  5AY8 A;  3W99 D;  5B24 C;  3TU4 A;  3AV1 C;  5B2J B;  3AZE B;  2F8N A;  5AV6 C;  3X1S C;  1ID3 B;  4H9S A;  2IO5 C;  3REI A;  4LD9 B;  3MVD C;  4J8W A;  5AV5 D;  1HQ3 A;  5B24 D;  4DRA A;  3AV1 D;  3MGP C;  3AYW C;  5AV6 D;  3X1S D;  5BO0 B;  1N1J A;  3KUY C;  3EPJ A;  3UTA A;  3EPL A;  2XD5 A;  3REI B;  3MVD D;  4WZS B;  4J8W B;  2HUE B;  3B0C W;  3LZ1 A;  3C1B C;  1P3M B;  4CAY A;  3UTB A;  5B0Y A;  3AYW D;  1Q9C A;  1TZY A;  3KUY D;  2NZD A;  5DNN A;  4AWL B;  1N1J B;  1KX5 C;  3V9R B;  5B2I A;  3AZF A;  3B6G B;  3C1B D;  3LZ1 B;  1M18 A;  3W97 C;  4CAY B;  3UTB B;  3REH C;  5B1M A;  5C3I C;  5AV9 A;  3KXB C;  5E5A A;  1TZY B;  1KX5 D;  2NZD B;  5DNN B;  1R4V A;  5CP6 D;  5B2I B;  5BS7 C;  3MNN A;  5B33 A;  4UPK A;  2ARO C;  3LEL A;  4J8V C;  3AZH C;  3AZF B;  5AV8 A;  1M1A A;  4WU9 C;  5B32 C;  3W97 D;  2HIO A;  2BYK A;  3REL A;  1M18 B;  2LY8 A;  3REH D;  3KXB D;  1P3K C;  4LD9 C;  5AV9 B;  5E5A B;  5GT3 A;  1P3I B;  2JE5 A;  3AN2 A;  3W96 D;  5B33 B;  3LEL B;  3AZH D;  3LZ0 A;  5AV8 B;  5B32 D;  4WU9 D;  4M6B A;  1F66 A;  5GXQ C;  3X1V A;  3REL B;  1KX3 B;  4J8X C;  3NQU B;  1P3K D;  2UWX A;  4LD9 D;  3AZL B;  5GT3 B;  3AN2 B;  4XZQ B;  3C1C C;  5B32 G;  3W99 A;  3LJA C;  3P5J B;  1TAF A;  3LZ0 B;  4X23 C;  5GXQ D;  3B0D C;  4J8U B;  3AZJ A;  4J8X D;  3WAA C;  3X1V B;  2ZY5 A;  2FJ7 C;  5GSU A;  5B1L C;  4Z66 C;  4WV4 B;  3WTP C;  3VH6 A;  1P3M D;  3MGR B;  1M19 A;  3EG5 B;  5JRG C;  5KDM A;  4ZUX A;  3LJA D;  4X23 D;  1TAF B;  1P3P B;  5B40 C;  4H9Q A;  3WAA D;  3AZJ B;  5B0Z B;  2FJ7 D;  1AOI B;  1P3L C;  2DF4 C;  3AZN A;  5B1L D;  2CV5 C;  5GSU B;  3WTP D;  3REJ C;  3KSY A;  5JRG D;  1P3G C;  1M19 B;  5KDM B;  4ZUX B;  2Y2I A;  2VQR A;  3MGP A;  3AZG C;  3MGS C;  5B40 D;  2NQB A;  1KX4 A;  3KUY A;  1P3I C;  5GT0 C;  4EO5 B;  1P3L D;  1EQZ C;  2CV5 D;  3AZN B;  3AZM C;  5CPI C;  2RVQ C;  4CSR A;  2L5A A;  3REJ D;  1U35 A;  2PYO A;  5B31 C;  3REK A;  1KX3 C;  3MGS D;  5CPJ C;  2NQB B;  1P3I D;  1W2E A;  5CHL B;  5GT0 D;  4Z5T B;  4HGA C;  1KX4 B;  1EQZ D;  5AVB A;  4XZQ C;  4WJ3 C;  3AZM D;  5CPI D;  1T3U A;  2RVQ D;  2G5H C;  4G92 B;  3WA9 C;  4CSR B;  5B31 D;  1U35 B;  5FUG A;  4J8U C;  2PYO B;  1KX3 D;  3W97 A;  3AZI A;  1B6W A;  2FFF B;  2JSS A;  5CPJ D;  3WKJ C;  3REH A;  2JCH A;  5DNM A;  4WNN A;  4YM6 A;  3AZL D;  3AZK B;  2XD1 A;  3H0M C;  4NFT A;  4XZQ D;  5AVB B;  5B31 G;  5AVC C;  2ARO A;  2W8S A;  4J8V A;  4JJN A;  3B6F C;  3WA9 D;  1P3P C;  1P3B B;  4J8U D;  3AV2 C;  5FUG B;  5AY8 B;  3TU4 B;  5B0Z C;  3AZI B;  3WKJ D;  3X1U A;  4XUJ A;  2F8N B;  2YFV A;  5DNM B;  3MGR D;  5CPK C;  2G5I C;  2DQN C;  5AVC D;  4WU8 C;  4KGC C;  2Y2M A;  3B6F D;  2YFW A;  1P3P D;  1S32 A;  3AV2 D;  4KUD C;  2CWE A;  1HQ3 B;  5GXQ A;  5B0Z D;  4EO5 C;  1AOI D;  4J8X A;  3X1U B;  4XUJ B;  2YFV B;  5CPK D;  3A1K A;  4WU8 D;  3UTA B;  5CP6 C;  4KGC D;  1P3A A;  3C1C A;  4E44 A;  2YFW B;  4KUD D;  4X23 A;  3VH6 T;  5JA4 A;  2BG1 A;  4YS3 A;  3O62 A;  1F1E A;  3KWQ C;  5F99 C;  5B0Y B;  1P34 A;  3MGQ C;  1P3O C;  1BFM A;  4Z66 A;  4H9O A;  3W96 C;  1P3A B;  5B2J C;  3AZE C;  1ID3 C;  5B40 A;  4Z5T D;  1BH8 A;  3KWQ D;  5F99 D;  3AFA A;  3VH5 T;  3MGQ D;  3NQJ A;  1ZLA A;  4R8P A;  3X1T A;  1P34 B;  1P3O D;  4QLC A;  2CV5 A;  5B1M B;  3UT9 A;  1P3G A;  4H9O B;  3TU4 C;  5B2J D;  3AZE D;  3MNN B;  3AZG A;  3A6N A;  1ID3 D;  2Y2H A;  3MGS A;  3W98 A;  3EPK A;  1BH8 B;  1M1A B;  5GT0 A;  2HIO B;  2BYK B;  4NE6 A;  1P3F A;  3REI C;  3NQJ B;  4R8P B;  1P3B D;  3KFU G;  4J8W C;  2HUE C;  4G91 B;  3TU4 D;  1P3M C;  3VH6 W;  3IP4 C;  3A6N B;  2ZY2 A;  4AWL C;  1F66 B;  3REI D;  4H9P A;  1P3F B;  4J8W D;  3WA9 A;  1WWS A;  5BNV A;  3B6G C;  5AV5 A;  3LZ1 C;  5B24 A;  2Y2N A;  3UTB C;  3AV1 A;  5B0Y C;  3W99 B;  3VH5 W;  5AV6 A;  3X1S A;  1TZY C;  2NZD C;  5DNN C;  3UTA D;  5B2I C;  3AL0 C;  4H9P B;  3AZF C;  1ULY A;  2Y2L A;  3MVD A;  3B6G D;  3LZ1 D;  5AV5 B;  3UTB D;  5B0Y D;  5B24 B;  1M18 C;  3AV1 B;  3AYW A;  1TZY D;  2NZD D;  5AV9 C;  5DNN D;  5E5A C;  5AV6 B;  3X1S B;  5CPK A;  4H9Q B;  5B2I D;  2IO5 B;  3MNN C;  5B33 C;  3LEL C;  3AFA D;  3AZF D;  5BNX A;  5AV8 C;  3MVD B;  1M18 D;  2HIO C;  3C1B A;  3REL C;  1A7W A;  3MGP B;  5B1M D;  5AV9 D;  5E5A D;  1BH9 A;  3AZL C;  1KX5 A;  2Y2O A;  3KUY B;  5GT3 C;  5G49 A;  3AN2 C;  5CP6 A;  5B33 D;  3MNN D;  3LEL D;  4KHA A;  5AV8 D;  3LZ0 C;  5BNX B;  2HIO D;  3F6T A;  3KWQ A;  3REL D;  3REK B;  3C1B B;  3X1V C;  3KXB A;  1BH9 B;  2BYM A;  5GT3 D;  3AN2 D;  1KX5 B;  3MGR C;  3W96 A;  5G49 B;  5BS7 A;  2F2A C;  3LZ0 D;  3AZH A;  4KHA B;  1ID3 A;  4WU9 A;  5B32 A;  1F66 D;  3X1V D;  3AZJ C;  3W97 B;  1AOI C;  1P3K A;  5GSU C;  3REH B;  4LD9 A;  5C3I B;  4WNN B;  4YM6 B;  3KXB B;  2BYM B;  1M19 C;  4ZUX C;  2ZM5 A;  2ARO B;  4J8V B;  4JJN B;  3AZH B;  5BO0 A;  3AZJ D;  4WU9 B;  5B32 B;  1H3O A;  2RIQ A;  4H9R A;  5GSU D;  3AZN C;  1P3K B;  2J8P A;  1M19 D;  4ZUX D;  1P3M A;  3LJA A;  2F8N K;  4NE3 A;  4UUZ A;  2NQB C;  1S32 B;  1KX4 C;  4Z5T C;  3V9R A;  1KU5 A;  5GXQ B;  1H3O B;  3WAA A;  4J8X B;  3AZN D;  2FJ7 A;  4H9R B;  4G92 C;  2Y2Q A;  4NE5 A;  5B1L A;  1U35 C;  3WTP A;  2PYO C;  3B6G A;  5JRG A;  3REK C;  3MGP D;  3C1C B;  3LJA B;  2NQB D;  4UUZ B;  1KX4 D;  3AZK C;  4X23 B;  5JA4 B;  4YS3 B;  3O62 B;  3B0D B;  1WWI A;  5AVB C;  3WAA B;  1P3L A;  1HTA A;  2FJ7 B;  1U35 D;  1P3B C;  5B1L B;  4Z66 B;  2PYO D;  3REJ A;  3WTP B;  3REK D;  5AY8 C;  1PZR A;  5JRG B;  3AZI C;  3AZK D;  5DNM C;  4YM6 C;  5B40 B;  1P3I A;  4H9S C;  3AFA B;  5AVB D;  1EQZ A;  4DQY B;  4Z2M H;  1P3L B;  3X1T B;  1ZLA B;  4JJN C;  4QLC B;  3AZM A;  5CPI A;  2CV5 B;  5BT1 C;  3UT9 B;  1HQ3 C;  3REJ B;  5AY8 D;  5B31 A;  3AZI D;  1P3G B;  1KX3 A;  2F8N D;  3NQU A;  3AZG B;  3X1U C;  5DNM D;  4Z2M G;  4XUJ C;  4YM6 D;  3MGS B;  5CPJ A;  2F8N H;  3R45 A;  3W98 B;  3AZL A;  2ZY3 A;  3B0B A;  5GT0 B;  3UTA C;  4XZQ A;  1EQZ B;  2ARO D;  4J8V D;  4JJN D;  5BT1 D;  3AZM B;  5CPI B;  1HQ3 D;  1S32 C;  2F8N G;  4J8U A;  5B31 B;  2ZY4 A;  3X1U D;  4XUJ D;  3WKJ A;  4ZBJ B;  5CPJ B;  3R45 B;  1Z2C B;  3H0R C;  3MGR A;  4HGA B;  5AVC A;  1P3A C;  3B6F A;  1S32 D;  1P3P A;  3WA9 B;  5BNV B;  4YS3 C;  3AV2 A;  3O62 C;  1JFI A;  5B0Z A;  1AOI A;  2Y2P A;  1P34 C;  3WKJ B;  5B1M C;  3H0L C;  3EPH A;  1P3A D;  3C1C D;  4WU8 A;  4KGC A;  5AVC B;  3FDD A;  3WTP E;  3B6F B;  4YS3 D;  3O62 D;  4KUD A;  1M1A C;  3AV2 B;  3AFA C;  1JFI B;  1P34 D;  1B67 A;  1ZLA C;  4R8P C;  3AYW B;  3X1T C;  4Z66 D;  4QLC C;  4G91 C;  3UT9 C;  5CPK B;  3VH5 A;  4WU8 B;  4KGC B;  3A6N C;  3W98 C;  1M1A D;  4KUD B;  4Z5T A;  1F66 C;  2Y2G A; 
#chains in the Genus database with same CATH homology
 5F99 A;  3A1I A;  3X1T D;  4R8P D;  1P3F C;  1ZLA D;  3MGQ A;  4QLC D;  1P3O A;  3UT9 D;  4H9N A;  1P3G D;  5CP6 B;  3AZG D;  3A6N D;  3W99 C;  5B2J A;  3AZE A;  2Y2J A;  3W98 D;  4ZBJ C;  4E45 A;  3B0C T;  3AZK A;  4DRB A;  2Y2K A;  3KWQ B;  1P3F D;  5F99 B;  3MGQ B;  1P3O B;  1P3B A;  5AV5 C;  4H9N B;  3W96 B;  5AY8 A;  3W99 D;  5B24 C;  3TU4 A;  3AV1 C;  5B2J B;  3AZE B;  2F8N A;  5AV6 C;  3X1S C;  1ID3 B;  4H9S A;  2IO5 C;  3REI A;  4LD9 B;  3MVD C;  4J8W A;  5AV5 D;  1HQ3 A;  5B24 D;  4DRA A;  3AV1 D;  3MGP C;  3AYW C;  5AV6 D;  3X1S D;  5BO0 B;  1N1J A;  3KUY C;  3EPJ A;  3UTA A;  3EPL A;  2XD5 A;  3REI B;  3MVD D;  4WZS B;  4J8W B;  2HUE B;  3B0C W;  3LZ1 A;  3C1B C;  1P3M B;  4CAY A;  3UTB A;  5B0Y A;  3AYW D;  1Q9C A;  1TZY A;  3KUY D;  2NZD A;  5DNN A;  4AWL B;  1N1J B;  1KX5 C;  3V9R B;  5B2I A;  3AZF A;  3B6G B;  3C1B D;  3LZ1 B;  1M18 A;  3W97 C;  4CAY B;  3UTB B;  3REH C;  5B1M A;  5C3I C;  5AV9 A;  3KXB C;  5E5A A;  1TZY B;  1KX5 D;  2NZD B;  5DNN B;  1R4V A;  5CP6 D;  5B2I B;  5BS7 C;  3MNN A;  5B33 A;  4UPK A;  2ARO C;  3LEL A;  4J8V C;  3AZH C;  3AZF B;  5AV8 A;  1M1A A;  4WU9 C;  5B32 C;  3W97 D;  2HIO A;  2BYK A;  3REL A;  1M18 B;  2LY8 A;  3REH D;  3KXB D;  1P3K C;  4LD9 C;  5AV9 B;  5E5A B;  5GT3 A;  1P3I B;  2JE5 A;  3AN2 A;  3W96 D;  5B33 B;  3LEL B;  3AZH D;  3LZ0 A;  5AV8 B;  5B32 D;  4WU9 D;  4M6B A;  1F66 A;  5GXQ C;  3X1V A;  3REL B;  1KX3 B;  4J8X C;  3NQU B;  1P3K D;  2UWX A;  4LD9 D;  3AZL B;  5GT3 B;  3AN2 B;  4XZQ B;  3C1C C;  5B32 G;  3W99 A;  3LJA C;  3P5J B;  1TAF A;  3LZ0 B;  4X23 C;  5GXQ D;  3B0D C;  4J8U B;  3AZJ A;  4J8X D;  3WAA C;  3X1V B;  2ZY5 A;  2FJ7 C;  5GSU A;  5B1L C;  4Z66 C;  4WV4 B;  3WTP C;  3VH6 A;  1P3M D;  3MGR B;  1M19 A;  3EG5 B;  5JRG C;  5KDM A;  4ZUX A;  3LJA D;  4X23 D;  1TAF B;  1P3P B;  5B40 C;  4H9Q A;  3WAA D;  3AZJ B;  5B0Z B;  2FJ7 D;  1AOI B;  1P3L C;  2DF4 C;  3AZN A;  5B1L D;  2CV5 C;  5GSU B;  3WTP D;  3REJ C;  3KSY A;  5JRG D;  1P3G C;  1M19 B;  5KDM B;  4ZUX B;  2Y2I A;  2VQR A;  3MGP A;  3AZG C;  3MGS C;  5B40 D;  2NQB A;  1KX4 A;  3KUY A;  1P3I C;  5GT0 C;  4EO5 B;  1P3L D;  1EQZ C;  2CV5 D;  3AZN B;  3AZM C;  5CPI C;  2RVQ C;  4CSR A;  2L5A A;  3REJ D;  1U35 A;  2PYO A;  5B31 C;  3REK A;  1KX3 C;  3MGS D;  5CPJ C;  2NQB B;  1P3I D;  1W2E A;  5CHL B;  5GT0 D;  4Z5T B;  4HGA C;  1KX4 B;  1EQZ D;  5AVB A;  4XZQ C;  4WJ3 C;  3AZM D;  5CPI D;  1T3U A;  2RVQ D;  2G5H C;  4G92 B;  3WA9 C;  4CSR B;  5B31 D;  1U35 B;  5FUG A;  4J8U C;  2PYO B;  1KX3 D;  3W97 A;  3AZI A;  1B6W A;  2FFF B;  2JSS A;  5CPJ D;  3WKJ C;  3REH A;  2JCH A;  5DNM A;  4WNN A;  4YM6 A;  3AZL D;  3AZK B;  2XD1 A;  3H0M C;  4NFT A;  4XZQ D;  5AVB B;  5B31 G;  5AVC C;  2ARO A;  2W8S A;  4J8V A;  4JJN A;  3B6F C;  3WA9 D;  1P3P C;  1P3B B;  4J8U D;  3AV2 C;  5FUG B;  5AY8 B;  3TU4 B;  5B0Z C;  3AZI B;  3WKJ D;  3X1U A;  4XUJ A;  2F8N B;  2YFV A;  5DNM B;  3MGR D;  5CPK C;  2G5I C;  2DQN C;  5AVC D;  4WU8 C;  4KGC C;  2Y2M A;  3B6F D;  2YFW A;  1P3P D;  1S32 A;  3AV2 D;  4KUD C;  2CWE A;  1HQ3 B;  5GXQ A;  5B0Z D;  4EO5 C;  1AOI D;  4J8X A;  3X1U B;  4XUJ B;  2YFV B;  5CPK D;  3A1K A;  4WU8 D;  3UTA B;  5CP6 C;  4KGC D;  1P3A A;  3C1C A;  4E44 A;  2YFW B;  4KUD D;  4X23 A;  3VH6 T;  5JA4 A;  2BG1 A;  4YS3 A;  3O62 A;  1F1E A;  3KWQ C;  5F99 C;  5B0Y B;  1P34 A;  3MGQ C;  1P3O C;  1BFM A;  4Z66 A;  4H9O A;  3W96 C;  1P3A B;  5B2J C;  3AZE C;  1ID3 C;  5B40 A;  4Z5T D;  1BH8 A;  3KWQ D;  5F99 D;  3AFA A;  3VH5 T;  3MGQ D;  3NQJ A;  1ZLA A;  4R8P A;  3X1T A;  1P34 B;  1P3O D;  4QLC A;  2CV5 A;  5B1M B;  3UT9 A;  1P3G A;  4H9O B;  3TU4 C;  5B2J D;  3AZE D;  3MNN B;  3AZG A;  3A6N A;  1ID3 D;  2Y2H A;  3MGS A;  3W98 A;  3EPK A;  1BH8 B;  1M1A B;  5GT0 A;  2HIO B;  2BYK B;  4NE6 A;  1P3F A;  3REI C;  3NQJ B;  4R8P B;  1P3B D;  3KFU G;  4J8W C;  2HUE C;  4G91 B;  3TU4 D;  1P3M C;  3VH6 W;  3IP4 C;  3A6N B;  2ZY2 A;  4AWL C;  1F66 B;  3REI D;  4H9P A;  1P3F B;  4J8W D;  3WA9 A;  1WWS A;  5BNV A;  3B6G C;  5AV5 A;  3LZ1 C;  5B24 A;  2Y2N A;  3UTB C;  3AV1 A;  5B0Y C;  3W99 B;  3VH5 W;  5AV6 A;  3X1S A;  1TZY C;  2NZD C;  5DNN C;  3UTA D;  5B2I C;  3AL0 C;  4H9P B;  3AZF C;  1ULY A;  2Y2L A;  3MVD A;  3B6G D;  3LZ1 D;  5AV5 B;  3UTB D;  5B0Y D;  5B24 B;  1M18 C;  3AV1 B;  3AYW A;  1TZY D;  2NZD D;  5AV9 C;  5DNN D;  5E5A C;  5AV6 B;  3X1S B;  5CPK A;  4H9Q B;  5B2I D;  2IO5 B;  3MNN C;  5B33 C;  3LEL C;  3AFA D;  3AZF D;  5BNX A;  5AV8 C;  3MVD B;  1M18 D;  2HIO C;  3C1B A;  3REL C;  1A7W A;  3MGP B;  5B1M D;  5AV9 D;  5E5A D;  1BH9 A;  3AZL C;  1KX5 A;  2Y2O A;  3KUY B;  5GT3 C;  5G49 A;  3AN2 C;  5CP6 A;  5B33 D;  3MNN D;  3LEL D;  4KHA A;  5AV8 D;  3LZ0 C;  5BNX B;  2HIO D;  3F6T A;  3KWQ A;  3REL D;  3REK B;  3C1B B;  3X1V C;  3KXB A;  1BH9 B;  2BYM A;  5GT3 D;  3AN2 D;  1KX5 B;  3MGR C;  3W96 A;  5G49 B;  5BS7 A;  2F2A C;  3LZ0 D;  3AZH A;  4KHA B;  1ID3 A;  4WU9 A;  5B32 A;  1F66 D;  3X1V D;  3AZJ C;  3W97 B;  1AOI C;  1P3K A;  5GSU C;  3REH B;  4LD9 A;  5C3I B;  4WNN B;  4YM6 B;  3KXB B;  2BYM B;  1M19 C;  4ZUX C;  2ZM5 A;  2ARO B;  4J8V B;  4JJN B;  3AZH B;  5BO0 A;  3AZJ D;  4WU9 B;  5B32 B;  1H3O A;  2RIQ A;  4H9R A;  5GSU D;  3AZN C;  1P3K B;  2J8P A;  1M19 D;  4ZUX D;  1P3M A;  3LJA A;  2F8N K;  4NE3 A;  4UUZ A;  2NQB C;  1S32 B;  1KX4 C;  4Z5T C;  3V9R A;  1KU5 A;  5GXQ B;  1H3O B;  3WAA A;  4J8X B;  3AZN D;  2FJ7 A;  4H9R B;  4G92 C;  2Y2Q A;  4NE5 A;  5B1L A;  1U35 C;  3WTP A;  2PYO C;  3B6G A;  5JRG A;  3REK C;  3MGP D;  3C1C B;  3LJA B;  2NQB D;  4UUZ B;  1KX4 D;  3AZK C;  4X23 B;  5JA4 B;  4YS3 B;  3O62 B;  3B0D B;  1WWI A;  5AVB C;  3WAA B;  1P3L A;  1HTA A;  2FJ7 B;  1U35 D;  1P3B C;  5B1L B;  4Z66 B;  2PYO D;  3REJ A;  3WTP B;  3REK D;  5AY8 C;  1PZR A;  5JRG B;  3AZI C;  3AZK D;  5DNM C;  4YM6 C;  5B40 B;  1P3I A;  4H9S C;  3AFA B;  5AVB D;  1EQZ A;  4DQY B;  4Z2M H;  1P3L B;  3X1T B;  1ZLA B;  4JJN C;  4QLC B;  3AZM A;  5CPI A;  2CV5 B;  5BT1 C;  3UT9 B;  1HQ3 C;  3REJ B;  5AY8 D;  5B31 A;  3AZI D;  1P3G B;  1KX3 A;  2F8N D;  3NQU A;  3AZG B;  3X1U C;  5DNM D;  4Z2M G;  4XUJ C;  4YM6 D;  3MGS B;  5CPJ A;  2F8N H;  3R45 A;  3W98 B;  3AZL A;  2ZY3 A;  3B0B A;  5GT0 B;  3UTA C;  4XZQ A;  1EQZ B;  2ARO D;  4J8V D;  4JJN D;  5BT1 D;  3AZM B;  5CPI B;  1HQ3 D;  1S32 C;  2F8N G;  4J8U A;  5B31 B;  2ZY4 A;  3X1U D;  4XUJ D;  3WKJ A;  4ZBJ B;  5CPJ B;  3R45 B;  1Z2C B;  3H0R C;  3MGR A;  4HGA B;  5AVC A;  1P3A C;  3B6F A;  1S32 D;  1P3P A;  3WA9 B;  5BNV B;  4YS3 C;  3AV2 A;  3O62 C;  1JFI A;  5B0Z A;  1AOI A;  2Y2P A;  1P34 C;  3WKJ B;  5B1M C;  3H0L C;  3EPH A;  1P3A D;  3C1C D;  4WU8 A;  4KGC A;  5AVC B;  3FDD A;  3WTP E;  3B6F B;  4YS3 D;  3O62 D;  4KUD A;  1M1A C;  3AV2 B;  3AFA C;  1JFI B;  1P34 D;  1B67 A;  1ZLA C;  4R8P C;  3AYW B;  3X1T C;  4Z66 D;  4QLC C;  4G91 C;  3UT9 C;  5CPK B;  3VH5 A;  4WU8 B;  4KGC B;  3A6N C;  3W98 C;  1M1A D;  4KUD B;  4Z5T A;  1F66 C;  2Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...