5AV9B

Human nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9B00
1P3KD 5AV9C 5GSUD 4QLCB 1AOID 1A7WA 3WA9C 5B1LA 2IO5C 5GT0D 3W99A 3AZFC 3MGSA 3WAAA 3MVDA 4H9RB 5B31G 4J8WB 5DNNC 5CHLB 4LD9A 2PYOB 3UTBD 4J8UA 3X1TD 1P3IB 4H9QB 5B33D 4YM6B 4CAYB 1P3GA 5B0YB 5B31A 3B6GA 2CV5B 5CPJD 2F8NG 4KGCA 4E45A 3MGPD 4J8VC 4KGCB 4H9OB 5CPKA 4WNNA 1P3GB 4KUDA 4ZUXC 3AFAA 3KUYB 3AZLA 1N1JA 3AZMB 1P3PA 2PYOD 3W97A 3AZMA 3WTPA 3AV1D 1P3OD 2AROA 3KUYA 1P34C 4Z5TC 3VH5W 5B24C 3C1BB 3AZMD 5B24D 3AZFA 3NQJA 5B2JC 3AZIA 1M1AA 4H9PB 5CPJA 4KGCD 3AV1C 1P3OC 3B6GD 3AZEC 5GXQB 5B0ZB 1M18A 4WZSB 3V9RA 3A6NB 2HUEB 3NQUB 5B1MB 4M6BA 3WA9D 3AZKA 4HGAC 3KXBA 3UT9B 2HUEC 5B31B 3X1SB 3C1BD 3X1TA 2NQBD 3MGQA 4J8WC 1HTAA 5B1LD 5GT0A 3AZLC 4JJNB 4ZUXA 3AFAC 2F8NA 3UTAD 1ID3B 1P3KA 1S32B 3AZLB 1U35A 4QLCC 5AVCC 2BYMB 4KHAA 5B31C 1S32C 3A6ND 3REHC 3KSYA 4YS3C 2NZDB 1U35B 3B0CT 4CSRA 5C3IC 1F66C 5B32D 5B0YA 4AWLC 1KX3D 3RELC 2YFVA 5GSUC 1P3KC 3W97D 2YFVB 3WAAC 5AV8A 3MGSC 4WU9B 3WKJA 1F1EA 4LD9B 3AZLD 5B1LC 4R8PC 5AVBD 1ID3D 4J8WD 1JFIA 4DRBA 5GT3A 4Z66B 3C1BC 5CPIB 5CPKD 5CPIC 1KU5A 5BNVA 1P3FD 5GXQA 3AZNA 5BT1C 3MGRA 5B33A 5AV8C 5B32B 2L5AA 3MGPB 3C1CC 1BH8A 3UTBA 3MGQB 4NE6A 4ZBJB 5B2JD 3REHB 2BYKA 1EQZC 3W99D 3REHA 3RELD 4Z5TD 5AV5B 4XZQA 3LZ0D 1P3GC 4XUJC 3AZHB 3REKA 5F99A 1TAFA 4H9PA 1TZYD 3AZNB 3AV2C 2CV5C 1ZLAC 3REJD 3AZJA 4QLCD 5AV5D 4WU8D 5GT3C 4J8VD 4Z66A 5B2JB 3B6FB 3B0BA 3VH6A 2NQBC 5B33C 1P3PB 1WWIA 5AY8D 3LJAB 3RELA 3LZ1A 5BNXA 4WU8C 1WWSA 1HQ3A 3AZGC 3X1SA 1P3ID 3REID 1P3LD 1ZLAD 3REJB 4EO5C 4R8PA 5AVCA 1KX4C 3UTAB 2BYMA 1ZLAA 1AOIC 2HIOB 3X1SD 1P3IA 2F8NH 5CP6A 5AV6A 3LZ1C 2NQBB 3AZMC 4XUJA 4R8PB 1AOIB 5B0YC 3AYWD 5E5AC 5JRGD 4JJNA 5B40D 1P3AD 1P34D 1P3LA 4DRAA 1KX3B 3O62A 3C1CD 1R4VA 3WKJD 5E5AA 4J8VA 5AY8A 5BT1D 4WU8A 1P3FC 4QLCA 3LELC 3WTPE 1U35C 2RVQC 5CP6C 5AV6C 4J8XA 5B40C 3REKD 3AYWC 5BNVB 4NFTA 5AVBC 1M19D 2F8NK 3AZFB 5GT3B 5CPIA 5F99D 2CV5A 1KX4D 3UT9D 5KDMA 3REKB 5B32C 4XZQD 3LZ0A 5B40A 1BH8B 3AZHC 5AV9A 4YS3D 3REHD 3MGQD 3LJAD 3W96D 3A6NC 3W98C 3MGRD 5AY8C 5B2JA 3AZKD 4KUDB 3O62C 3B0CW 1KX4B 5GT3D 4G91C 3AZND 1ID3A 5F99B 2HIOD 3X1VA 1TZYB 5AV8B 4J8XC 4J8UC 5BS7C 5FUGB 4E44A 4G91B 3VH5A 5B2IB 3LZ0B 3AN2B 3AV2D 4J8WA 1KX3A 4WU9D 5BO0B 5B2IC 1P3BD 3KUYD 2BYKB 3WKJB 1HQ3C 3AZGA 3B0DB 5B32G 3B6GC 4H9SA 1P3PD 4WV4B 5B32A 3KWQB 4UUZA 5DNMB 2F8ND 1P3BC 5B2ID 2RVQD 2PYOC 5DNNB 3WKJC 5JA4B 4ZUXD 4J8UD 4X23D 5DNMD 3X1VC 2F8NB 1N1JB 1ID3C 3AZEB 4LD9D 3KWQC 5CP6B 5FUGA 5AV6B 3AN2A 2NQBA 3WA9B 3LELB 1P3MD 3MGSD 4H9NA 3X1VB 5CPJC 3KXBD 3WAAD 3AZKB 3R45A 3MNNA 3AZJB 1KX3C 5B24A 1P34B 3W98D 1B6WA 4H9NB 3UTBC 1P3MB 4H9QA 4YM6A 3MNNC 1BH9B 1Q9CA 3WTPB 3LZ1B 4J8UB 3AV1A 3AZID 1P3OA 1M1AD 3AZFD 4ZUXB 4NE5A 4Z2MG 3AV1B 1P3OB 4NE3A 3AFAD 2AROD 2FJ7B 3O62B 3WTPD 3REIB 3W98A 3WTPC 2JSSA 4Z5TB 3MGPA 3A6NA 3MNNB 1P3MC 3W97B 5C3IB 3KWQD 4KUDD 1KX5C 1U35D 4LD9C 1P3MA 1TZYC 4WNNB 3AZIC 1M1AC 5CPJB 3UTAA 3VH6W 3AZGB 3MNND 5JA4A 4WU8B 5JRGB 1P3AB 4J8VB 4KGCC 3C1BA 4JJNC 2FJ7A 2FJ7D 3AN2D 4X23B 3WA9A 1H3OB 2AROB 5B2IA 5DNMA 1AOIA 1M18D 5GSUA 1B67A 1KX4A 5DNMC 3W99B 1ZLAB 2YFWB 4H9OA 1P3LC 3TU4A 3AZGD 5B0ZD 3B0DC 3B6GB 4J8XD 4WU9A 1HQ3B 5AV9B 4G92C 1ULYA 3AYWB 1BFMA 5B40B 5BNXB 4XZQB 2CWEA 1KX5A 3X1TB 2PYOA 3MVDC 4H9RA 3X1TC 3O62D 4CSRB 5G49B 3NQUA 3AZKC 3REJC 4JJND 2FJ7C 3AV2A 5B1LB 3KUYC 2YFWA 5B31D 1P3KB 1P3GD 4XZQC 5GSUB 4UUZB 3W96A 3NQJB 4KUDC 5AV9D 4YS3A 3W98B 1EQZA 5AY8B 3X1UC 4X23A 4YM6C 5KDMB 3MVDD 3VH6T 3AZJC 5G49A 3KXBB 3UT9A 1M19C 3TU4C 2AROC 3V9RB 3REKC 3MGRC 1M18B 3UTBB 1BH9A 3AFAB 3LJAC 3MGQC 4Z66D 3AZHD 5CPKB 5AVBB 5AVCB 5CPID 3AZIB 1M1AB 5CPKC 2NZDA 3R45B 4HGAB 3REJA 3UT9C 5B1MD 1M19A 5E5AD 5JRGC 1P3AC 1M18C 1P3BA 3C1CA 3AZEA 4J8XB 3X1SC 5GXQC 1KX5B 4XUJB 1F66D 5B1MC 3B6FA 3VH5T 4Z2MH 5DNNA 5E5AB 1P3BB 3X1UB 3MGSB 5CP6D 2HIOA 5AV6D 3X1VD 3WAAB 3LELD 4H9SC 1S32D 5B24B 1P34A 3REIC 5JRGA 1P3AA 4Z66C 5AVCD 4CAYA 3LELA 1P3FA 3LJAA 3RELB 1F66A 3LZ1D 4AWLB 3MVDB 3X1UD 3REIA 1HQ3D 2CV5D 4G92B 3B6FD 5B1MA 3B6FC 1P3IC 3AZED 5BS7A 5B0ZA 1P3FB 3AZHA 3W99C 5AV5A 3AZNC 3AV2B 3KXBC 1M19B 4Z5TA 2IO5B 2LY8A 2NZDC 5BO0A 1TAFB 5AV5C 4X23C 3X1UA 5B0ZC 1EQZB 3AYWA 3W96C 4ZBJC 4XUJD 3MGRB 3LZ0C 3MGPC 3C1CB 5GXQD 3TU4B 4EO5B 4R8PD 1EQZD 5F99C 1JFIB 3W97C 1S32A 1P3PC 5AVBA 3AN2C 3KWQA 5DNND 5AV8D 5GT0B 1H3OA 4WU9C 5GT0C 1P3LB 1KX5D 3TU4D 1F66B 2HIOC 4KHAB 2NZDD 3AZJD 4YM6D 3UTAC 4YS3B 5B0YD 3W96B 1TZYA 5B33B
chains in the Genus database with same CATH superfamily
1P3KD 5AV9C 5GSUD 4QLCB 1AOID 1A7WA 3WA9C 5B1LA 2IO5C 5GT0D 2Y2IA 3W99A 3AZFC 3MGSA 3WAAA 3MVDA 4H9RB 5B31G 4J8WB 5DNNC 5CHLB 4LD9A 2PYOB 3UTBD 4J8UA 3X1TD 2UWXA 1P3IB 4H9QB 3A1KA 5B33D 4YM6B 4CAYB 1P3GA 5B0YB 5B31A 3B6GA 2CV5B 5CPJD 2F8NG 4KGCA 3EG5B 4E45A 3MGPD 4J8VC 4KGCB 4H9OB 5CPKA 4WNNA 1P3GB 4KUDA 4ZUXC 3AFAA 3KUYB 3AZLA 1N1JA 3AZMB 1P3PA 2PYOD 3W97A 3AZMA 3WTPA 3AV1D 1P3OD 2AROA 3KUYA 1P34C 4Z5TC 3VH5W 5B24C 3C1BB 3AZMD 5B24D 3AZFA 3NQJA 5B2JC 3IP4C 3AZIA 1M1AA 4H9PB 5CPJA 4KGCD 3AV1C 1P3OC 3B6GD 3AZEC 5GXQB 5B0ZB 1M18A 4WZSB 3V9RA 3A6NB 2HUEB 3NQUB 5B1MB 4M6BA 3WA9D 3AZKA 4HGAC 3KXBA 3UT9B 2HUEC 5B31B 3X1SB 3C1BD 3X1TA 2NQBD 3MGQA 4J8WC 1HTAA 5B1LD 5GT0A 3AZLC 4JJNB 4ZUXA 3AFAC 2F8NA 3UTAD 1ID3B 1P3KA 1S32B 3AZLB 1U35A 4QLCC 5AVCC 2BYMB 4KHAA 5B31C 1S32C 3A6ND 4WJ3C 3REHC 3KSYA 4YS3C 2NZDB 1U35B 3B0CT 4CSRA 5C3IC 1F66C 5B32D 5B0YA 3KFUG 4AWLC 1KX3D 3RELC 2YFVA 5GSUC 1P3KC 3W97D 2YFVB 3WAAC 5AV8A 3MGSC 4WU9B 3WKJA 1F1EA 4LD9B 3AZLD 5B1LC 4R8PC 5AVBD 1ID3D 4J8WD 1JFIA 4DRBA 5GT3A 4Z66B 3C1BC 5CPIB 5CPKD 5CPIC 1KU5A 2ZY2A 5BNVA 3H0MC 1P3FD 5GXQA 2J8PA 3AZNA 5BT1C 3MGRA 5B33A 5AV8C 5B32B 2L5AA 3MGPB 3C1CC 1BH8A 2Y2HA 3UTBA 3MGQB 4NE6A 4ZBJB 5B2JD 3FDDA 3REHB 2BYKA 1EQZC 3W99D 3REHA 3RELD 4Z5TD 5AV5B 4XZQA 3LZ0D 1P3GC 4XUJC 3AZHB 3REKA 5F99A 1TAFA 1TZYD 4H9PA 3AZNB 3AV2C 2CV5C 2JE5A 1ZLAC 3REJD 3AZJA 4QLCD 5AV5D 4WU8D 5GT3C 4J8VD 4Z66A 5B2JB 3B6FB 3B0BA 1T3UA 3VH6A 2NQBC 5B33C 1P3PB 1WWIA 5AY8D 3LJAB 3RELA 3LZ1A 5BNXA 4WU8C 1WWSA 1HQ3A 3AZGC 3X1SA 1P3ID 3REID 1P3LD 1ZLAD 3REJB 4EO5C 1PZRA 4R8PA 5AVCA 1KX4C 3UTAB 2BYMA 3EPLA 1ZLAA 1AOIC 2HIOB 3X1SD 1P3IA 2F8NH 5CP6A 5AV6A 3LZ1C 2NQBB 3AZMC 4XUJA 4R8PB 1AOIB 5B0YC 3AYWD 5E5AC 5JRGD 4JJNA 5B40D 1P3AD 1P34D 1P3LA 4DRAA 2Y2KA 3O62A 1KX3B 3C1CD 1R4VA 3WKJD 5E5AA 4J8VA 5AY8A 5BT1D 4WU8A 1P3FC 4QLCA 3LELC 3WTPE 1U35C 2RVQC 5CP6C 5AV6C 3H0RC 2ZM5A 4J8XA 5B40C 3REKD 4DQYB 5BNVB 4NFTA 3AYWC 5AVBC 1M19D 2F8NK 3AZFB 5GT3B 5CPIA 3P5JB 2F2AC 5F99D 2CV5A 3EPKA 1KX4D 3UT9D 5KDMA 3REKB 5B32C 4XZQD 3LZ0A 5B40A 1BH8B 3AZHC 5AV9A 4YS3D 3REHD 3MGQD 3LJAD 3W96D 3A6NC 2BG1A 3W98C 3MGRD 5AY8C 5B2JA 3AZKD 4KUDB 4UPKA 3O62C 3B0CW 1KX4B 5GT3D 4G91C 3AZND 1ID3A 5F99B 2HIOD 3X1VA 1TZYB 5AV8B 4J8XC 4J8UC 5BS7C 5FUGB 5B2IB 4G91B 3VH5A 4E44A 3LZ0B 3AN2B 3A1IA 3AV2D 4J8WA 1KX3A 4WU9D 5BO0B 5B2IC 1P3BD 3KUYD 2JCHA 2BYKB 2ZY5A 2Y2NA 3WKJB 1HQ3C 3AZGA 3B0DB 5B32G 3B6GC 2Y2JA 4H9SA 1P3PD 2XD5A 4WV4B 5B32A 3KWQB 2W8SA 2Y2QA 4UUZA 5DNMB 2F8ND 2Y2OA 1P3BC 5B2ID 2RVQD 2PYOC 5DNNB 3EPJA 3WKJC 5JA4B 4ZUXD 4J8UD 4X23D 5DNMD 3X1VC 2F8NB 1N1JB 1ID3C 3AZEB 4LD9D 3KWQC 5CP6B 5FUGA 5AV6B 3AN2A 2NQBA 3WA9B 3LELB 1P3MD 3MGSD 4H9NA 3X1VB 5CPJC 2FFFB 3KXBD 3WAAD 3AL0C 3AZKB 3R45A 3MNNA 3AZJB 2DF4C 1KX3C 5B24A 1P34B 3W98D 1B6WA 4H9NB 3UTBC 1P3MB 4H9QA 4YM6A 3EPHA 3MNNC 1BH9B 1Q9CA 3WTPB 3LZ1B 4J8UB 3AV1A 3AZID 1P3OA 1M1AD 3AZFD 4ZUXB 4NE5A 4Z2MG 3AV1B 1P3OB 4NE3A 3AFAD 2AROD 2FJ7B 3O62B 3WTPD 3REIB 3W98A 3WTPC 2JSSA 4Z5TB 3MGPA 3A6NA 3MNNB 2G5IC 1P3MC 3W97B 5C3IB 3KWQD 4KUDD 1KX5C 1U35D 4LD9C 1P3MA 1TZYC 4WNNB 3AZIC 1M1AC 5CPJB 3UTAA 3VH6W 3AZGB 3MNND 5JA4A 4WU8B 5JRGB 1P3AB 4J8VB 4KGCC 3C1BA 4JJNC 2FJ7A 1W2EA 2FJ7D 3AN2D 4X23B 3WA9A 1H3OB 2AROB 5B2IA 5DNMA 1AOIA 1M18D 5GSUA 1B67A 1KX4A 5DNMC 3W99B 1ZLAB 2YFWB 4H9OA 1P3LC 3TU4A 3AZGD 5B0ZD 3B0DC 3B6GB 4J8XD 4WU9A 2VQRA 1HQ3B 5AV9B 4G92C 1ULYA 3AYWB 1BFMA 5B40B 5BNXB 4XZQB 2CWEA 1KX5A 3X1TB 2PYOA 3MVDC 2RIQA 4H9RA 3X1TC 4CSRB 3O62D 5G49B 3NQUA 2Y2MA 3REJC 4JJND 3AZKC 2FJ7C 3AV2A 5B1LB 3KUYC 2YFWA 2Y2GA 2Y2PA 5B31D 1P3KB 1P3GD 4XZQC 5GSUB 4UUZB 3W96A 3NQJB 4KUDC 5AV9D 4YS3A 3W98B 1EQZA 5AY8B 3X1UC 4X23A 4YM6C 5KDMB 3MVDD 3VH6T 3AZJC 5G49A 3KXBB 3UT9A 1M19C 3TU4C 2AROC 3V9RB 3REKC 3MGRC 1M18B 3UTBB 1BH9A 3AFAB 3LJAC 3MGQC 4Z66D 3AZHD 5CPKB 5AVBB 5AVCB 5CPID 3AZIB 1M1AB 5CPKC 2NZDA 3R45B 4HGAB 3REJA 3UT9C 5B1MD 1M19A 5E5AD 5JRGC 1P3AC 1M18C 1P3BA 3C1CA 3AZEA 4J8XB 3X1SC 5GXQC 1KX5B 4XUJB 1F66D 5B1MC 3B6FA 3VH5T 4Z2MH 5DNNA 5E5AB 1P3BB 3X1UB 3MGSB 5CP6D 2HIOA 5AV6D 3X1VD 3WAAB 2ZY3A 4H9SC 3LELD 1S32D 3F6TA 5B24B 1P34A 3REIC 5JRGA 1P3AA 4Z66C 5AVCD 4CAYA 2ZY4A 3LELA 1P3FA 3LJAA 3RELB 2DQNC 1F66A 3LZ1D 2G5HC 4AWLB 3MVDB 3X1UD 3REIA 1HQ3D 2CV5D 4G92B 3B6FD 5B1MA 3B6FC 1P3IC 3AZED 5BS7A 5B0ZA 1P3FB 3AZHA 3W99C 5AV5A 3AZNC 3AV2B 3KXBC 1M19B 4Z5TA 2IO5B 2LY8A 2NZDC 5BO0A 1TAFB 5AV5C 4X23C 3X1UA 5B0ZC 1EQZB 3AYWA 3W96C 2XD1A 2Y2LA 4ZBJC 4XUJD 3MGRB 3LZ0C 3MGPC 3C1CB 5GXQD 3TU4B 4EO5B 4R8PD 1EQZD 5F99C 1JFIB 3W97C 1S32A 1P3PC 5AVBA 3AN2C 3KWQA 5DNND 5AV8D 5GT0B 1H3OA 4WU9C 5GT0C 1P3LB 1KX5D 3TU4D 1F66B 2HIOC 4KHAB 2NZDD 3AZJD 4YM6D 3UTAC 4YS3B 1Z2CB 3H0LC 5B0YD 3W96B 1TZYA 5B33B
chains in the Genus database with same CATH topology
1P3KD 5AV9C 5GSUD 4QLCB 1AOID 1A7WA 3WA9C 5B1LA 2IO5C 5GT0D 2Y2IA 3W99A 3AZFC 3MGSA 3WAAA 3MVDA 4H9RB 5B31G 4J8WB 5DNNC 5CHLB 4LD9A 2PYOB 3UTBD 4J8UA 3X1TD 2UWXA 1P3IB 4H9QB 3A1KA 5B33D 4YM6B 4CAYB 1P3GA 5B0YB 5B31A 3B6GA 2CV5B 5CPJD 2F8NG 4KGCA 3EG5B 4E45A 3MGPD 4J8VC 4KGCB 4H9OB 5CPKA 4WNNA 1P3GB 4KUDA 4ZUXC 3AFAA 3KUYB 3AZLA 1N1JA 3AZMB 1P3PA 2PYOD 3W97A 3AZMA 3WTPA 3AV1D 1P3OD 2AROA 3KUYA 1P34C 4Z5TC 3VH5W 5B24C 3C1BB 3AZMD 5B24D 3AZFA 3NQJA 5B2JC 3IP4C 3AZIA 1M1AA 4H9PB 5CPJA 4KGCD 3AV1C 1P3OC 3B6GD 3AZEC 5GXQB 5B0ZB 1M18A 4WZSB 3V9RA 3A6NB 2HUEB 3NQUB 5B1MB 4M6BA 3WA9D 3AZKA 4HGAC 3KXBA 3UT9B 2HUEC 5B31B 3X1SB 3C1BD 3X1TA 2NQBD 3MGQA 4J8WC 1HTAA 5B1LD 5GT0A 3AZLC 4JJNB 4ZUXA 3AFAC 2F8NA 3UTAD 1ID3B 1P3KA 1S32B 3AZLB 1U35A 4QLCC 5AVCC 2BYMB 4KHAA 5B31C 1S32C 3A6ND 4WJ3C 3REHC 3KSYA 4YS3C 2NZDB 1U35B 3B0CT 4CSRA 5C3IC 1F66C 5B32D 5B0YA 3KFUG 4AWLC 1KX3D 3RELC 2YFVA 5GSUC 1P3KC 3W97D 2YFVB 3WAAC 5AV8A 3MGSC 4WU9B 3WKJA 1F1EA 4LD9B 3AZLD 5B1LC 4R8PC 5AVBD 1ID3D 4J8WD 1JFIA 4DRBA 5GT3A 4Z66B 3C1BC 5CPIB 5CPKD 5CPIC 1KU5A 2ZY2A 5BNVA 3H0MC 1P3FD 5GXQA 2J8PA 3AZNA 5BT1C 3MGRA 5B33A 5AV8C 5B32B 2L5AA 3MGPB 3C1CC 1BH8A 2Y2HA 3UTBA 3MGQB 4NE6A 4ZBJB 5B2JD 3FDDA 3REHB 2BYKA 1EQZC 3W99D 3REHA 3RELD 4Z5TD 5AV5B 4XZQA 3LZ0D 1P3GC 4XUJC 3AZHB 3REKA 5F99A 1TAFA 1TZYD 4H9PA 3AZNB 3AV2C 2CV5C 2JE5A 1ZLAC 3REJD 3AZJA 4QLCD 5AV5D 4WU8D 5GT3C 4J8VD 4Z66A 5B2JB 3B6FB 3B0BA 1T3UA 3VH6A 2NQBC 5B33C 1P3PB 1WWIA 5AY8D 3LJAB 3RELA 3LZ1A 5BNXA 4WU8C 1WWSA 1HQ3A 3AZGC 3X1SA 1P3ID 3REID 1P3LD 1ZLAD 3REJB 4EO5C 1PZRA 4R8PA 5AVCA 1KX4C 3UTAB 2BYMA 3EPLA 1ZLAA 1AOIC 2HIOB 3X1SD 1P3IA 2F8NH 5CP6A 5AV6A 3LZ1C 2NQBB 3AZMC 4XUJA 4R8PB 1AOIB 5B0YC 3AYWD 5E5AC 5JRGD 4JJNA 5B40D 1P3AD 1P34D 1P3LA 4DRAA 2Y2KA 3O62A 1KX3B 3C1CD 1R4VA 3WKJD 5E5AA 4J8VA 5AY8A 5BT1D 4WU8A 1P3FC 4QLCA 3LELC 3WTPE 1U35C 2RVQC 5CP6C 5AV6C 3H0RC 2ZM5A 4J8XA 5B40C 3REKD 4DQYB 5BNVB 4NFTA 3AYWC 5AVBC 1M19D 2F8NK 3AZFB 5GT3B 5CPIA 3P5JB 2F2AC 5F99D 2CV5A 3EPKA 1KX4D 3UT9D 5KDMA 3REKB 5B32C 4XZQD 3LZ0A 5B40A 1BH8B 3AZHC 5AV9A 4YS3D 3REHD 3MGQD 3LJAD 3W96D 3A6NC 2BG1A 3W98C 3MGRD 5AY8C 5B2JA 3AZKD 4KUDB 4UPKA 3O62C 3B0CW 1KX4B 5GT3D 4G91C 3AZND 1ID3A 5F99B 2HIOD 3X1VA 1TZYB 5AV8B 4J8XC 4J8UC 5BS7C 5FUGB 5B2IB 4G91B 3VH5A 4E44A 3LZ0B 3AN2B 3A1IA 3AV2D 4J8WA 1KX3A 4WU9D 5BO0B 5B2IC 1P3BD 3KUYD 2JCHA 2BYKB 2ZY5A 2Y2NA 3WKJB 1HQ3C 3AZGA 3B0DB 5B32G 3B6GC 2Y2JA 4H9SA 1P3PD 2XD5A 4WV4B 5B32A 3KWQB 2W8SA 2Y2QA 4UUZA 5DNMB 2F8ND 2Y2OA 1P3BC 5B2ID 2RVQD 2PYOC 5DNNB 3EPJA 3WKJC 5JA4B 4ZUXD 4J8UD 4X23D 5DNMD 3X1VC 2F8NB 1N1JB 1ID3C 3AZEB 4LD9D 3KWQC 5CP6B 5FUGA 5AV6B 3AN2A 2NQBA 3WA9B 3LELB 1P3MD 3MGSD 4H9NA 3X1VB 5CPJC 2FFFB 3KXBD 3WAAD 3AL0C 3AZKB 3R45A 3MNNA 3AZJB 2DF4C 1KX3C 5B24A 1P34B 3W98D 1B6WA 4H9NB 3UTBC 1P3MB 4H9QA 4YM6A 3EPHA 3MNNC 1BH9B 1Q9CA 3WTPB 3LZ1B 4J8UB 3AV1A 3AZID 1P3OA 1M1AD 3AZFD 4ZUXB 4NE5A 4Z2MG 3AV1B 1P3OB 4NE3A 3AFAD 2AROD 2FJ7B 3O62B 3WTPD 3REIB 3W98A 3WTPC 2JSSA 4Z5TB 3MGPA 3A6NA 3MNNB 2G5IC 1P3MC 3W97B 5C3IB 3KWQD 4KUDD 1KX5C 1U35D 4LD9C 1P3MA 1TZYC 4WNNB 3AZIC 1M1AC 5CPJB 3UTAA 3VH6W 3AZGB 3MNND 5JA4A 4WU8B 5JRGB 1P3AB 4J8VB 4KGCC 3C1BA 4JJNC 2FJ7A 1W2EA 2FJ7D 3AN2D 4X23B 3WA9A 1H3OB 2AROB 5B2IA 5DNMA 1AOIA 1M18D 5GSUA 1B67A 1KX4A 5DNMC 3W99B 1ZLAB 2YFWB 4H9OA 1P3LC 3TU4A 3AZGD 5B0ZD 3B0DC 3B6GB 4J8XD 4WU9A 2VQRA 1HQ3B 5AV9B 4G92C 1ULYA 3AYWB 1BFMA 5B40B 5BNXB 4XZQB 2CWEA 1KX5A 3X1TB 2PYOA 3MVDC 2RIQA 4H9RA 3X1TC 4CSRB 3O62D 5G49B 3NQUA 2Y2MA 3REJC 4JJND 3AZKC 2FJ7C 3AV2A 5B1LB 3KUYC 2YFWA 2Y2GA 2Y2PA 5B31D 1P3KB 1P3GD 4XZQC 5GSUB 4UUZB 3W96A 3NQJB 4KUDC 5AV9D 4YS3A 3W98B 1EQZA 5AY8B 3X1UC 4X23A 4YM6C 5KDMB 3MVDD 3VH6T 3AZJC 5G49A 3KXBB 3UT9A 1M19C 3TU4C 2AROC 3V9RB 3REKC 3MGRC 1M18B 3UTBB 1BH9A 3AFAB 3LJAC 3MGQC 4Z66D 3AZHD 5CPKB 5AVBB 5AVCB 5CPID 3AZIB 1M1AB 5CPKC 2NZDA 3R45B 4HGAB 3REJA 3UT9C 5B1MD 1M19A 5E5AD 5JRGC 1P3AC 1M18C 1P3BA 3C1CA 3AZEA 4J8XB 3X1SC 5GXQC 1KX5B 4XUJB 1F66D 5B1MC 3B6FA 3VH5T 4Z2MH 5DNNA 5E5AB 1P3BB 3X1UB 3MGSB 5CP6D 2HIOA 5AV6D 3X1VD 3WAAB 2ZY3A 4H9SC 3LELD 1S32D 3F6TA 5B24B 1P34A 3REIC 5JRGA 1P3AA 4Z66C 5AVCD 4CAYA 2ZY4A 3LELA 1P3FA 3LJAA 3RELB 2DQNC 1F66A 3LZ1D 2G5HC 4AWLB 3MVDB 3X1UD 3REIA 1HQ3D 2CV5D 4G92B 3B6FD 5B1MA 3B6FC 1P3IC 3AZED 5BS7A 5B0ZA 1P3FB 3AZHA 3W99C 5AV5A 3AZNC 3AV2B 3KXBC 1M19B 4Z5TA 2IO5B 2LY8A 2NZDC 5BO0A 1TAFB 5AV5C 4X23C 3X1UA 5B0ZC 1EQZB 3AYWA 3W96C 2XD1A 2Y2LA 4ZBJC 4XUJD 3MGRB 3LZ0C 3MGPC 3C1CB 5GXQD 3TU4B 4EO5B 4R8PD 1EQZD 5F99C 1JFIB 3W97C 1S32A 1P3PC 5AVBA 3AN2C 3KWQA 5DNND 5AV8D 5GT0B 1H3OA 4WU9C 5GT0C 1P3LB 1KX5D 3TU4D 1F66B 2HIOC 4KHAB 2NZDD 3AZJD 4YM6D 3UTAC 4YS3B 1Z2CB 3H0LC 5B0YD 3W96B 1TZYA 5B33B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K D;  5AV9 C;  5GSU D;  4QLC B;  1AOI D;  1A7W A;  3WA9 C;  5B1L A;  2IO5 C;  5GT0 D;  3W99 A;  3AZF C;  3MGS A;  3WAA A;  3MVD A;  4H9R B;  5B31 G;  4J8W B;  5DNN C;  5CHL B;  4LD9 A;  2PYO B;  3UTB D;  4J8U A;  3X1T D;  1P3I B;  4H9Q B;  5B33 D;  4YM6 B;  4CAY B;  1P3G A;  5B0Y B;  5B31 A;  3B6G A;  2CV5 B;  5CPJ D;  2F8N G;  4KGC A;  4E45 A;  3MGP D;  4J8V C;  4KGC B;  4H9O B;  5CPK A;  4WNN A;  1P3G B;  4KUD A;  4ZUX C;  3AFA A;  3KUY B;  3AZL A;  1N1J A;  3AZM B;  1P3P A;  2PYO D;  3W97 A;  3AZM A;  3WTP A;  3AV1 D;  1P3O D;  2ARO A;  3KUY A;  1P34 C;  4Z5T C;  3VH5 W;  5B24 C;  3C1B B;  3AZM D;  5B24 D;  3AZF A;  3NQJ A;  5B2J C;  3AZI A;  1M1A A;  4H9P B;  5CPJ A;  4KGC D;  3AV1 C;  1P3O C;  3B6G D;  3AZE C;  5GXQ B;  5B0Z B;  1M18 A;  4WZS B;  3V9R A;  3A6N B;  2HUE B;  3NQU B;  5B1M B;  4M6B A;  3WA9 D;  3AZK A;  4HGA C;  3KXB A;  3UT9 B;  2HUE C;  5B31 B;  3X1S B;  3C1B D;  3X1T A;  2NQB D;  3MGQ A;  4J8W C;  1HTA A;  5B1L D;  5GT0 A;  3AZL C;  4JJN B;  4ZUX A;  3AFA C;  2F8N A;  3UTA D;  1ID3 B;  1P3K A;  1S32 B;  3AZL B;  1U35 A;  4QLC C;  5AVC C;  2BYM B;  4KHA A;  5B31 C;  1S32 C;  3A6N D;  3REH C;  3KSY A;  4YS3 C;  2NZD B;  1U35 B;  3B0C T;  4CSR A;  5C3I C;  1F66 C;  5B32 D;  5B0Y A;  4AWL C;  1KX3 D;  3REL C;  2YFV A;  5GSU C;  1P3K C;  3W97 D;  2YFV B;  3WAA C;  5AV8 A;  3MGS C;  4WU9 B;  3WKJ A;  1F1E A;  4LD9 B;  3AZL D;  5B1L C;  4R8P C;  5AVB D;  1ID3 D;  4J8W D;  1JFI A;  4DRB A;  5GT3 A;  4Z66 B;  3C1B C;  5CPI B;  5CPK D;  5CPI C;  1KU5 A;  5BNV A;  1P3F D;  5GXQ A;  3AZN A;  5BT1 C;  3MGR A;  5B33 A;  5AV8 C;  5B32 B;  2L5A A;  3MGP B;  3C1C C;  1BH8 A;  3UTB A;  3MGQ B;  4NE6 A;  4ZBJ B;  5B2J D;  3REH B;  2BYK A;  1EQZ C;  3W99 D;  3REH A;  3REL D;  4Z5T D;  5AV5 B;  4XZQ A;  3LZ0 D;  1P3G C;  4XUJ C;  3AZH B;  3REK A;  5F99 A;  1TAF A;  4H9P A;  1TZY D;  3AZN B;  3AV2 C;  2CV5 C;  1ZLA C;  3REJ D;  3AZJ A;  4QLC D;  5AV5 D;  4WU8 D;  5GT3 C;  4J8V D;  4Z66 A;  5B2J B;  3B6F B;  3B0B A;  3VH6 A;  2NQB C;  5B33 C;  1P3P B;  1WWI A;  5AY8 D;  3LJA B;  3REL A;  3LZ1 A;  5BNX A;  4WU8 C;  1WWS A;  1HQ3 A;  3AZG C;  3X1S A;  1P3I D;  3REI D;  1P3L D;  1ZLA D;  3REJ B;  4EO5 C;  4R8P A;  5AVC A;  1KX4 C;  3UTA B;  2BYM A;  1ZLA A;  1AOI C;  2HIO B;  3X1S D;  1P3I A;  2F8N H;  5CP6 A;  5AV6 A;  3LZ1 C;  2NQB B;  3AZM C;  4XUJ A;  4R8P B;  1AOI B;  5B0Y C;  3AYW D;  5E5A C;  5JRG D;  4JJN A;  5B40 D;  1P3A D;  1P34 D;  1P3L A;  4DRA A;  1KX3 B;  3O62 A;  3C1C D;  1R4V A;  3WKJ D;  5E5A A;  4J8V A;  5AY8 A;  5BT1 D;  4WU8 A;  1P3F C;  4QLC A;  3LEL C;  3WTP E;  1U35 C;  2RVQ C;  5CP6 C;  5AV6 C;  4J8X A;  5B40 C;  3REK D;  3AYW C;  5BNV B;  4NFT A;  5AVB C;  1M19 D;  2F8N K;  3AZF B;  5GT3 B;  5CPI A;  5F99 D;  2CV5 A;  1KX4 D;  3UT9 D;  5KDM A;  3REK B;  5B32 C;  4XZQ D;  3LZ0 A;  5B40 A;  1BH8 B;  3AZH C;  5AV9 A;  4YS3 D;  3REH D;  3MGQ D;  3LJA D;  3W96 D;  3A6N C;  3W98 C;  3MGR D;  5AY8 C;  5B2J A;  3AZK D;  4KUD B;  3O62 C;  3B0C W;  1KX4 B;  5GT3 D;  4G91 C;  3AZN D;  1ID3 A;  5F99 B;  2HIO D;  3X1V A;  1TZY B;  5AV8 B;  4J8X C;  4J8U C;  5BS7 C;  5FUG B;  4E44 A;  4G91 B;  3VH5 A;  5B2I B;  3LZ0 B;  3AN2 B;  3AV2 D;  4J8W A;  1KX3 A;  4WU9 D;  5BO0 B;  5B2I C;  1P3B D;  3KUY D;  2BYK B;  3WKJ B;  1HQ3 C;  3AZG A;  3B0D B;  5B32 G;  3B6G C;  4H9S A;  1P3P D;  4WV4 B;  5B32 A;  3KWQ B;  4UUZ A;  5DNM B;  2F8N D;  1P3B C;  5B2I D;  2RVQ D;  2PYO C;  5DNN B;  3WKJ C;  5JA4 B;  4ZUX D;  4J8U D;  4X23 D;  5DNM D;  3X1V C;  2F8N B;  1N1J B;  1ID3 C;  3AZE B;  4LD9 D;  3KWQ C;  5CP6 B;  5FUG A;  5AV6 B;  3AN2 A;  2NQB A;  3WA9 B;  3LEL B;  1P3M D;  3MGS D;  4H9N A;  3X1V B;  5CPJ C;  3KXB D;  3WAA D;  3AZK B;  3R45 A;  3MNN A;  3AZJ B;  1KX3 C;  5B24 A;  1P34 B;  3W98 D;  1B6W A;  4H9N B;  3UTB C;  1P3M B;  4H9Q A;  4YM6 A;  3MNN C;  1BH9 B;  1Q9C A;  3WTP B;  3LZ1 B;  4J8U B;  3AV1 A;  3AZI D;  1P3O A;  1M1A D;  3AZF D;  4ZUX B;  4NE5 A;  4Z2M G;  3AV1 B;  1P3O B;  4NE3 A;  3AFA D;  2ARO D;  2FJ7 B;  3O62 B;  3WTP D;  3REI B;  3W98 A;  3WTP C;  2JSS A;  4Z5T B;  3MGP A;  3A6N A;  3MNN B;  1P3M C;  3W97 B;  5C3I B;  3KWQ D;  4KUD D;  1KX5 C;  1U35 D;  4LD9 C;  1P3M A;  1TZY C;  4WNN B;  3AZI C;  1M1A C;  5CPJ B;  3UTA A;  3VH6 W;  3AZG B;  3MNN D;  5JA4 A;  4WU8 B;  5JRG B;  1P3A B;  4J8V B;  4KGC C;  3C1B A;  4JJN C;  2FJ7 A;  2FJ7 D;  3AN2 D;  4X23 B;  3WA9 A;  1H3O B;  2ARO B;  5B2I A;  5DNM A;  1AOI A;  1M18 D;  5GSU A;  1B67 A;  1KX4 A;  5DNM C;  3W99 B;  1ZLA B;  2YFW B;  4H9O A;  1P3L C;  3TU4 A;  3AZG D;  5B0Z D;  3B0D C;  3B6G B;  4J8X D;  4WU9 A;  1HQ3 B;  5AV9 B;  4G92 C;  1ULY A;  3AYW B;  1BFM A;  5B40 B;  5BNX B;  4XZQ B;  2CWE A;  1KX5 A;  3X1T B;  2PYO A;  3MVD C;  4H9R A;  3X1T C;  3O62 D;  4CSR B;  5G49 B;  3NQU A;  3AZK C;  3REJ C;  4JJN D;  2FJ7 C;  3AV2 A;  5B1L B;  3KUY C;  2YFW A;  5B31 D;  1P3K B;  1P3G D;  4XZQ C;  5GSU B;  4UUZ B;  3W96 A;  3NQJ B;  4KUD C;  5AV9 D;  4YS3 A;  3W98 B;  1EQZ A;  5AY8 B;  3X1U C;  4X23 A;  4YM6 C;  5KDM B;  3MVD D;  3VH6 T;  3AZJ C;  5G49 A;  3KXB B;  3UT9 A;  1M19 C;  3TU4 C;  2ARO C;  3V9R B;  3REK C;  3MGR C;  1M18 B;  3UTB B;  1BH9 A;  3AFA B;  3LJA C;  3MGQ C;  4Z66 D;  3AZH D;  5CPK B;  5AVB B;  5AVC B;  5CPI D;  3AZI B;  1M1A B;  5CPK C;  2NZD A;  3R45 B;  4HGA B;  3REJ A;  3UT9 C;  5B1M D;  1M19 A;  5E5A D;  5JRG C;  1P3A C;  1M18 C;  1P3B A;  3C1C A;  3AZE A;  4J8X B;  3X1S C;  5GXQ C;  1KX5 B;  4XUJ B;  1F66 D;  5B1M C;  3B6F A;  3VH5 T;  4Z2M H;  5DNN A;  5E5A B;  1P3B B;  3X1U B;  3MGS B;  5CP6 D;  2HIO A;  5AV6 D;  3X1V D;  3WAA B;  3LEL D;  4H9S C;  1S32 D;  5B24 B;  1P34 A;  3REI C;  5JRG A;  1P3A A;  4Z66 C;  5AVC D;  4CAY A;  3LEL A;  1P3F A;  3LJA A;  3REL B;  1F66 A;  3LZ1 D;  4AWL B;  3MVD B;  3X1U D;  3REI A;  1HQ3 D;  2CV5 D;  4G92 B;  3B6F D;  5B1M A;  3B6F C;  1P3I C;  3AZE D;  5BS7 A;  5B0Z A;  1P3F B;  3AZH A;  3W99 C;  5AV5 A;  3AZN C;  3AV2 B;  3KXB C;  1M19 B;  4Z5T A;  2IO5 B;  2LY8 A;  2NZD C;  5BO0 A;  1TAF B;  5AV5 C;  4X23 C;  3X1U A;  5B0Z C;  1EQZ B;  3AYW A;  3W96 C;  4ZBJ C;  4XUJ D;  3MGR B;  3LZ0 C;  3MGP C;  3C1C B;  5GXQ D;  3TU4 B;  4EO5 B;  4R8P D;  1EQZ D;  5F99 C;  1JFI B;  3W97 C;  1S32 A;  1P3P C;  5AVB A;  3AN2 C;  3KWQ A;  5DNN D;  5AV8 D;  5GT0 B;  1H3O A;  4WU9 C;  5GT0 C;  1P3L B;  1KX5 D;  3TU4 D;  1F66 B;  2HIO C;  4KHA B;  2NZD D;  3AZJ D;  4YM6 D;  3UTA C;  4YS3 B;  5B0Y D;  3W96 B;  1TZY A;  5B33 B; 
#chains in the Genus database with same CATH topology
 1P3K D;  5AV9 C;  5GSU D;  4QLC B;  1AOI D;  1A7W A;  3WA9 C;  5B1L A;  2IO5 C;  5GT0 D;  2Y2I A;  3W99 A;  3AZF C;  3MGS A;  3WAA A;  3MVD A;  4H9R B;  5B31 G;  4J8W B;  5DNN C;  5CHL B;  4LD9 A;  2PYO B;  3UTB D;  4J8U A;  3X1T D;  2UWX A;  1P3I B;  4H9Q B;  3A1K A;  5B33 D;  4YM6 B;  4CAY B;  1P3G A;  5B0Y B;  5B31 A;  3B6G A;  2CV5 B;  5CPJ D;  2F8N G;  4KGC A;  3EG5 B;  4E45 A;  3MGP D;  4J8V C;  4KGC B;  4H9O B;  5CPK A;  4WNN A;  1P3G B;  4KUD A;  4ZUX C;  3AFA A;  3KUY B;  3AZL A;  1N1J A;  3AZM B;  1P3P A;  2PYO D;  3W97 A;  3AZM A;  3WTP A;  3AV1 D;  1P3O D;  2ARO A;  3KUY A;  1P34 C;  4Z5T C;  3VH5 W;  5B24 C;  3C1B B;  3AZM D;  5B24 D;  3AZF A;  3NQJ A;  5B2J C;  3IP4 C;  3AZI A;  1M1A A;  4H9P B;  5CPJ A;  4KGC D;  3AV1 C;  1P3O C;  3B6G D;  3AZE C;  5GXQ B;  5B0Z B;  1M18 A;  4WZS B;  3V9R A;  3A6N B;  2HUE B;  3NQU B;  5B1M B;  4M6B A;  3WA9 D;  3AZK A;  4HGA C;  3KXB A;  3UT9 B;  2HUE C;  5B31 B;  3X1S B;  3C1B D;  3X1T A;  2NQB D;  3MGQ A;  4J8W C;  1HTA A;  5B1L D;  5GT0 A;  3AZL C;  4JJN B;  4ZUX A;  3AFA C;  2F8N A;  3UTA D;  1ID3 B;  1P3K A;  1S32 B;  3AZL B;  1U35 A;  4QLC C;  5AVC C;  2BYM B;  4KHA A;  5B31 C;  1S32 C;  3A6N D;  4WJ3 C;  3REH C;  3KSY A;  4YS3 C;  2NZD B;  1U35 B;  3B0C T;  4CSR A;  5C3I C;  1F66 C;  5B32 D;  5B0Y A;  3KFU G;  4AWL C;  1KX3 D;  3REL C;  2YFV A;  5GSU C;  1P3K C;  3W97 D;  2YFV B;  3WAA C;  5AV8 A;  3MGS C;  4WU9 B;  3WKJ A;  1F1E A;  4LD9 B;  3AZL D;  5B1L C;  4R8P C;  5AVB D;  1ID3 D;  4J8W D;  1JFI A;  4DRB A;  5GT3 A;  4Z66 B;  3C1B C;  5CPI B;  5CPK D;  5CPI C;  1KU5 A;  2ZY2 A;  5BNV A;  3H0M C;  1P3F D;  5GXQ A;  2J8P A;  3AZN A;  5BT1 C;  3MGR A;  5B33 A;  5AV8 C;  5B32 B;  2L5A A;  3MGP B;  3C1C C;  1BH8 A;  2Y2H A;  3UTB A;  3MGQ B;  4NE6 A;  4ZBJ B;  5B2J D;  3FDD A;  3REH B;  2BYK A;  1EQZ C;  3W99 D;  3REH A;  3REL D;  4Z5T D;  5AV5 B;  4XZQ A;  3LZ0 D;  1P3G C;  4XUJ C;  3AZH B;  3REK A;  5F99 A;  1TAF A;  1TZY D;  4H9P A;  3AZN B;  3AV2 C;  2CV5 C;  2JE5 A;  1ZLA C;  3REJ D;  3AZJ A;  4QLC D;  5AV5 D;  4WU8 D;  5GT3 C;  4J8V D;  4Z66 A;  5B2J B;  3B6F B;  3B0B A;  1T3U A;  3VH6 A;  2NQB C;  5B33 C;  1P3P B;  1WWI A;  5AY8 D;  3LJA B;  3REL A;  3LZ1 A;  5BNX A;  4WU8 C;  1WWS A;  1HQ3 A;  3AZG C;  3X1S A;  1P3I D;  3REI D;  1P3L D;  1ZLA D;  3REJ B;  4EO5 C;  1PZR A;  4R8P A;  5AVC A;  1KX4 C;  3UTA B;  2BYM A;  3EPL A;  1ZLA A;  1AOI C;  2HIO B;  3X1S D;  1P3I A;  2F8N H;  5CP6 A;  5AV6 A;  3LZ1 C;  2NQB B;  3AZM C;  4XUJ A;  4R8P B;  1AOI B;  5B0Y C;  3AYW D;  5E5A C;  5JRG D;  4JJN A;  5B40 D;  1P3A D;  1P34 D;  1P3L A;  4DRA A;  2Y2K A;  3O62 A;  1KX3 B;  3C1C D;  1R4V A;  3WKJ D;  5E5A A;  4J8V A;  5AY8 A;  5BT1 D;  4WU8 A;  1P3F C;  4QLC A;  3LEL C;  3WTP E;  1U35 C;  2RVQ C;  5CP6 C;  5AV6 C;  3H0R C;  2ZM5 A;  4J8X A;  5B40 C;  3REK D;  4DQY B;  5BNV B;  4NFT A;  3AYW C;  5AVB C;  1M19 D;  2F8N K;  3AZF B;  5GT3 B;  5CPI A;  3P5J B;  2F2A C;  5F99 D;  2CV5 A;  3EPK A;  1KX4 D;  3UT9 D;  5KDM A;  3REK B;  5B32 C;  4XZQ D;  3LZ0 A;  5B40 A;  1BH8 B;  3AZH C;  5AV9 A;  4YS3 D;  3REH D;  3MGQ D;  3LJA D;  3W96 D;  3A6N C;  2BG1 A;  3W98 C;  3MGR D;  5AY8 C;  5B2J A;  3AZK D;  4KUD B;  4UPK A;  3O62 C;  3B0C W;  1KX4 B;  5GT3 D;  4G91 C;  3AZN D;  1ID3 A;  5F99 B;  2HIO D;  3X1V A;  1TZY B;  5AV8 B;  4J8X C;  4J8U C;  5BS7 C;  5FUG B;  5B2I B;  4G91 B;  3VH5 A;  4E44 A;  3LZ0 B;  3AN2 B;  3A1I A;  3AV2 D;  4J8W A;  1KX3 A;  4WU9 D;  5BO0 B;  5B2I C;  1P3B D;  3KUY D;  2JCH A;  2BYK B;  2ZY5 A;  2Y2N A;  3WKJ B;  1HQ3 C;  3AZG A;  3B0D B;  5B32 G;  3B6G C;  2Y2J A;  4H9S A;  1P3P D;  2XD5 A;  4WV4 B;  5B32 A;  3KWQ B;  2W8S A;  2Y2Q A;  4UUZ A;  5DNM B;  2F8N D;  2Y2O A;  1P3B C;  5B2I D;  2RVQ D;  2PYO C;  5DNN B;  3EPJ A;  3WKJ C;  5JA4 B;  4ZUX D;  4J8U D;  4X23 D;  5DNM D;  3X1V C;  2F8N B;  1N1J B;  1ID3 C;  3AZE B;  4LD9 D;  3KWQ C;  5CP6 B;  5FUG A;  5AV6 B;  3AN2 A;  2NQB A;  3WA9 B;  3LEL B;  1P3M D;  3MGS D;  4H9N A;  3X1V B;  5CPJ C;  2FFF B;  3KXB D;  3WAA D;  3AL0 C;  3AZK B;  3R45 A;  3MNN A;  3AZJ B;  2DF4 C;  1KX3 C;  5B24 A;  1P34 B;  3W98 D;  1B6W A;  4H9N B;  3UTB C;  1P3M B;  4H9Q A;  4YM6 A;  3EPH A;  3MNN C;  1BH9 B;  1Q9C A;  3WTP B;  3LZ1 B;  4J8U B;  3AV1 A;  3AZI D;  1P3O A;  1M1A D;  3AZF D;  4ZUX B;  4NE5 A;  4Z2M G;  3AV1 B;  1P3O B;  4NE3 A;  3AFA D;  2ARO D;  2FJ7 B;  3O62 B;  3WTP D;  3REI B;  3W98 A;  3WTP C;  2JSS A;  4Z5T B;  3MGP A;  3A6N A;  3MNN B;  2G5I C;  1P3M C;  3W97 B;  5C3I B;  3KWQ D;  4KUD D;  1KX5 C;  1U35 D;  4LD9 C;  1P3M A;  1TZY C;  4WNN B;  3AZI C;  1M1A C;  5CPJ B;  3UTA A;  3VH6 W;  3AZG B;  3MNN D;  5JA4 A;  4WU8 B;  5JRG B;  1P3A B;  4J8V B;  4KGC C;  3C1B A;  4JJN C;  2FJ7 A;  1W2E A;  2FJ7 D;  3AN2 D;  4X23 B;  3WA9 A;  1H3O B;  2ARO B;  5B2I A;  5DNM A;  1AOI A;  1M18 D;  5GSU A;  1B67 A;  1KX4 A;  5DNM C;  3W99 B;  1ZLA B;  2YFW B;  4H9O A;  1P3L C;  3TU4 A;  3AZG D;  5B0Z D;  3B0D C;  3B6G B;  4J8X D;  4WU9 A;  2VQR A;  1HQ3 B;  5AV9 B;  4G92 C;  1ULY A;  3AYW B;  1BFM A;  5B40 B;  5BNX B;  4XZQ B;  2CWE A;  1KX5 A;  3X1T B;  2PYO A;  3MVD C;  2RIQ A;  4H9R A;  3X1T C;  4CSR B;  3O62 D;  5G49 B;  3NQU A;  2Y2M A;  3REJ C;  4JJN D;  3AZK C;  2FJ7 C;  3AV2 A;  5B1L B;  3KUY C;  2YFW A;  2Y2G A;  2Y2P A;  5B31 D;  1P3K B;  1P3G D;  4XZQ C;  5GSU B;  4UUZ B;  3W96 A;  3NQJ B;  4KUD C;  5AV9 D;  4YS3 A;  3W98 B;  1EQZ A;  5AY8 B;  3X1U C;  4X23 A;  4YM6 C;  5KDM B;  3MVD D;  3VH6 T;  3AZJ C;  5G49 A;  3KXB B;  3UT9 A;  1M19 C;  3TU4 C;  2ARO C;  3V9R B;  3REK C;  3MGR C;  1M18 B;  3UTB B;  1BH9 A;  3AFA B;  3LJA C;  3MGQ C;  4Z66 D;  3AZH D;  5CPK B;  5AVB B;  5AVC B;  5CPI D;  3AZI B;  1M1A B;  5CPK C;  2NZD A;  3R45 B;  4HGA B;  3REJ A;  3UT9 C;  5B1M D;  1M19 A;  5E5A D;  5JRG C;  1P3A C;  1M18 C;  1P3B A;  3C1C A;  3AZE A;  4J8X B;  3X1S C;  5GXQ C;  1KX5 B;  4XUJ B;  1F66 D;  5B1M C;  3B6F A;  3VH5 T;  4Z2M H;  5DNN A;  5E5A B;  1P3B B;  3X1U B;  3MGS B;  5CP6 D;  2HIO A;  5AV6 D;  3X1V D;  3WAA B;  2ZY3 A;  4H9S C;  3LEL D;  1S32 D;  3F6T A;  5B24 B;  1P34 A;  3REI C;  5JRG A;  1P3A A;  4Z66 C;  5AVC D;  4CAY A;  2ZY4 A;  3LEL A;  1P3F A;  3LJA A;  3REL B;  2DQN C;  1F66 A;  3LZ1 D;  2G5H C;  4AWL B;  3MVD B;  3X1U D;  3REI A;  1HQ3 D;  2CV5 D;  4G92 B;  3B6F D;  5B1M A;  3B6F C;  1P3I C;  3AZE D;  5BS7 A;  5B0Z A;  1P3F B;  3AZH A;  3W99 C;  5AV5 A;  3AZN C;  3AV2 B;  3KXB C;  1M19 B;  4Z5T A;  2IO5 B;  2LY8 A;  2NZD C;  5BO0 A;  1TAF B;  5AV5 C;  4X23 C;  3X1U A;  5B0Z C;  1EQZ B;  3AYW A;  3W96 C;  2XD1 A;  2Y2L A;  4ZBJ C;  4XUJ D;  3MGR B;  3LZ0 C;  3MGP C;  3C1C B;  5GXQ D;  3TU4 B;  4EO5 B;  4R8P D;  1EQZ D;  5F99 C;  1JFI B;  3W97 C;  1S32 A;  1P3P C;  5AVB A;  3AN2 C;  3KWQ A;  5DNN D;  5AV8 D;  5GT0 B;  1H3O A;  4WU9 C;  5GT0 C;  1P3L B;  1KX5 D;  3TU4 D;  1F66 B;  2HIO C;  4KHA B;  2NZD D;  3AZJ D;  4YM6 D;  3UTA C;  4YS3 B;  1Z2C B;  3H0L C;  5B0Y D;  3W96 B;  1TZY A;  5B33 B; 
#chains in the Genus database with same CATH homology
 1P3K D;  5AV9 C;  5GSU D;  4QLC B;  1AOI D;  1A7W A;  3WA9 C;  5B1L A;  2IO5 C;  5GT0 D;  2Y2I A;  3W99 A;  3AZF C;  3MGS A;  3WAA A;  3MVD A;  4H9R B;  5B31 G;  4J8W B;  5DNN C;  5CHL B;  4LD9 A;  2PYO B;  3UTB D;  4J8U A;  3X1T D;  2UWX A;  1P3I B;  4H9Q B;  3A1K A;  5B33 D;  4YM6 B;  4CAY B;  1P3G A;  5B0Y B;  5B31 A;  3B6G A;  2CV5 B;  5CPJ D;  2F8N G;  4KGC A;  3EG5 B;  4E45 A;  3MGP D;  4J8V C;  4KGC B;  4H9O B;  5CPK A;  4WNN A;  1P3G B;  4KUD A;  4ZUX C;  3AFA A;  3KUY B;  3AZL A;  1N1J A;  3AZM B;  1P3P A;  2PYO D;  3W97 A;  3AZM A;  3WTP A;  3AV1 D;  1P3O D;  2ARO A;  3KUY A;  1P34 C;  4Z5T C;  3VH5 W;  5B24 C;  3C1B B;  3AZM D;  5B24 D;  3AZF A;  3NQJ A;  5B2J C;  3IP4 C;  3AZI A;  1M1A A;  4H9P B;  5CPJ A;  4KGC D;  3AV1 C;  1P3O C;  3B6G D;  3AZE C;  5GXQ B;  5B0Z B;  1M18 A;  4WZS B;  3V9R A;  3A6N B;  2HUE B;  3NQU B;  5B1M B;  4M6B A;  3WA9 D;  3AZK A;  4HGA C;  3KXB A;  3UT9 B;  2HUE C;  5B31 B;  3X1S B;  3C1B D;  3X1T A;  2NQB D;  3MGQ A;  4J8W C;  1HTA A;  5B1L D;  5GT0 A;  3AZL C;  4JJN B;  4ZUX A;  3AFA C;  2F8N A;  3UTA D;  1ID3 B;  1P3K A;  1S32 B;  3AZL B;  1U35 A;  4QLC C;  5AVC C;  2BYM B;  4KHA A;  5B31 C;  1S32 C;  3A6N D;  4WJ3 C;  3REH C;  3KSY A;  4YS3 C;  2NZD B;  1U35 B;  3B0C T;  4CSR A;  5C3I C;  1F66 C;  5B32 D;  5B0Y A;  3KFU G;  4AWL C;  1KX3 D;  3REL C;  2YFV A;  5GSU C;  1P3K C;  3W97 D;  2YFV B;  3WAA C;  5AV8 A;  3MGS C;  4WU9 B;  3WKJ A;  1F1E A;  4LD9 B;  3AZL D;  5B1L C;  4R8P C;  5AVB D;  1ID3 D;  4J8W D;  1JFI A;  4DRB A;  5GT3 A;  4Z66 B;  3C1B C;  5CPI B;  5CPK D;  5CPI C;  1KU5 A;  2ZY2 A;  5BNV A;  3H0M C;  1P3F D;  5GXQ A;  2J8P A;  3AZN A;  5BT1 C;  3MGR A;  5B33 A;  5AV8 C;  5B32 B;  2L5A A;  3MGP B;  3C1C C;  1BH8 A;  2Y2H A;  3UTB A;  3MGQ B;  4NE6 A;  4ZBJ B;  5B2J D;  3FDD A;  3REH B;  2BYK A;  1EQZ C;  3W99 D;  3REH A;  3REL D;  4Z5T D;  5AV5 B;  4XZQ A;  3LZ0 D;  1P3G C;  4XUJ C;  3AZH B;  3REK A;  5F99 A;  1TAF A;  1TZY D;  4H9P A;  3AZN B;  3AV2 C;  2CV5 C;  2JE5 A;  1ZLA C;  3REJ D;  3AZJ A;  4QLC D;  5AV5 D;  4WU8 D;  5GT3 C;  4J8V D;  4Z66 A;  5B2J B;  3B6F B;  3B0B A;  1T3U A;  3VH6 A;  2NQB C;  5B33 C;  1P3P B;  1WWI A;  5AY8 D;  3LJA B;  3REL A;  3LZ1 A;  5BNX A;  4WU8 C;  1WWS A;  1HQ3 A;  3AZG C;  3X1S A;  1P3I D;  3REI D;  1P3L D;  1ZLA D;  3REJ B;  4EO5 C;  1PZR A;  4R8P A;  5AVC A;  1KX4 C;  3UTA B;  2BYM A;  3EPL A;  1ZLA A;  1AOI C;  2HIO B;  3X1S D;  1P3I A;  2F8N H;  5CP6 A;  5AV6 A;  3LZ1 C;  2NQB B;  3AZM C;  4XUJ A;  4R8P B;  1AOI B;  5B0Y C;  3AYW D;  5E5A C;  5JRG D;  4JJN A;  5B40 D;  1P3A D;  1P34 D;  1P3L A;  4DRA A;  2Y2K A;  3O62 A;  1KX3 B;  3C1C D;  1R4V A;  3WKJ D;  5E5A A;  4J8V A;  5AY8 A;  5BT1 D;  4WU8 A;  1P3F C;  4QLC A;  3LEL C;  3WTP E;  1U35 C;  2RVQ C;  5CP6 C;  5AV6 C;  3H0R C;  2ZM5 A;  4J8X A;  5B40 C;  3REK D;  4DQY B;  5BNV B;  4NFT A;  3AYW C;  5AVB C;  1M19 D;  2F8N K;  3AZF B;  5GT3 B;  5CPI A;  3P5J B;  2F2A C;  5F99 D;  2CV5 A;  3EPK A;  1KX4 D;  3UT9 D;  5KDM A;  3REK B;  5B32 C;  4XZQ D;  3LZ0 A;  5B40 A;  1BH8 B;  3AZH C;  5AV9 A;  4YS3 D;  3REH D;  3MGQ D;  3LJA D;  3W96 D;  3A6N C;  2BG1 A;  3W98 C;  3MGR D;  5AY8 C;  5B2J A;  3AZK D;  4KUD B;  4UPK A;  3O62 C;  3B0C W;  1KX4 B;  5GT3 D;  4G91 C;  3AZN D;  1ID3 A;  5F99 B;  2HIO D;  3X1V A;  1TZY B;  5AV8 B;  4J8X C;  4J8U C;  5BS7 C;  5FUG B;  5B2I B;  4G91 B;  3VH5 A;  4E44 A;  3LZ0 B;  3AN2 B;  3A1I A;  3AV2 D;  4J8W A;  1KX3 A;  4WU9 D;  5BO0 B;  5B2I C;  1P3B D;  3KUY D;  2JCH A;  2BYK B;  2ZY5 A;  2Y2N A;  3WKJ B;  1HQ3 C;  3AZG A;  3B0D B;  5B32 G;  3B6G C;  2Y2J A;  4H9S A;  1P3P D;  2XD5 A;  4WV4 B;  5B32 A;  3KWQ B;  2W8S A;  2Y2Q A;  4UUZ A;  5DNM B;  2F8N D;  2Y2O A;  1P3B C;  5B2I D;  2RVQ D;  2PYO C;  5DNN B;  3EPJ A;  3WKJ C;  5JA4 B;  4ZUX D;  4J8U D;  4X23 D;  5DNM D;  3X1V C;  2F8N B;  1N1J B;  1ID3 C;  3AZE B;  4LD9 D;  3KWQ C;  5CP6 B;  5FUG A;  5AV6 B;  3AN2 A;  2NQB A;  3WA9 B;  3LEL B;  1P3M D;  3MGS D;  4H9N A;  3X1V B;  5CPJ C;  2FFF B;  3KXB D;  3WAA D;  3AL0 C;  3AZK B;  3R45 A;  3MNN A;  3AZJ B;  2DF4 C;  1KX3 C;  5B24 A;  1P34 B;  3W98 D;  1B6W A;  4H9N B;  3UTB C;  1P3M B;  4H9Q A;  4YM6 A;  3EPH A;  3MNN C;  1BH9 B;  1Q9C A;  3WTP B;  3LZ1 B;  4J8U B;  3AV1 A;  3AZI D;  1P3O A;  1M1A D;  3AZF D;  4ZUX B;  4NE5 A;  4Z2M G;  3AV1 B;  1P3O B;  4NE3 A;  3AFA D;  2ARO D;  2FJ7 B;  3O62 B;  3WTP D;  3REI B;  3W98 A;  3WTP C;  2JSS A;  4Z5T B;  3MGP A;  3A6N A;  3MNN B;  2G5I C;  1P3M C;  3W97 B;  5C3I B;  3KWQ D;  4KUD D;  1KX5 C;  1U35 D;  4LD9 C;  1P3M A;  1TZY C;  4WNN B;  3AZI C;  1M1A C;  5CPJ B;  3UTA A;  3VH6 W;  3AZG B;  3MNN D;  5JA4 A;  4WU8 B;  5JRG B;  1P3A B;  4J8V B;  4KGC C;  3C1B A;  4JJN C;  2FJ7 A;  1W2E A;  2FJ7 D;  3AN2 D;  4X23 B;  3WA9 A;  1H3O B;  2ARO B;  5B2I A;  5DNM A;  1AOI A;  1M18 D;  5GSU A;  1B67 A;  1KX4 A;  5DNM C;  3W99 B;  1ZLA B;  2YFW B;  4H9O A;  1P3L C;  3TU4 A;  3AZG D;  5B0Z D;  3B0D C;  3B6G B;  4J8X D;  4WU9 A;  2VQR A;  1HQ3 B;  5AV9 B;  4G92 C;  1ULY A;  3AYW B;  1BFM A;  5B40 B;  5BNX B;  4XZQ B;  2CWE A;  1KX5 A;  3X1T B;  2PYO A;  3MVD C;  2RIQ A;  4H9R A;  3X1T C;  4CSR B;  3O62 D;  5G49 B;  3NQU A;  2Y2M A;  3REJ C;  4JJN D;  3AZK C;  2FJ7 C;  3AV2 A;  5B1L B;  3KUY C;  2YFW A;  2Y2G A;  2Y2P A;  5B31 D;  1P3K B;  1P3G D;  4XZQ C;  5GSU B;  4UUZ B;  3W96 A;  3NQJ B;  4KUD C;  5AV9 D;  4YS3 A;  3W98 B;  1EQZ A;  5AY8 B;  3X1U C;  4X23 A;  4YM6 C;  5KDM B;  3MVD D;  3VH6 T;  3AZJ C;  5G49 A;  3KXB B;  3UT9 A;  1M19 C;  3TU4 C;  2ARO C;  3V9R B;  3REK C;  3MGR C;  1M18 B;  3UTB B;  1BH9 A;  3AFA B;  3LJA C;  3MGQ C;  4Z66 D;  3AZH D;  5CPK B;  5AVB B;  5AVC B;  5CPI D;  3AZI B;  1M1A B;  5CPK C;  2NZD A;  3R45 B;  4HGA B;  3REJ A;  3UT9 C;  5B1M D;  1M19 A;  5E5A D;  5JRG C;  1P3A C;  1M18 C;  1P3B A;  3C1C A;  3AZE A;  4J8X B;  3X1S C;  5GXQ C;  1KX5 B;  4XUJ B;  1F66 D;  5B1M C;  3B6F A;  3VH5 T;  4Z2M H;  5DNN A;  5E5A B;  1P3B B;  3X1U B;  3MGS B;  5CP6 D;  2HIO A;  5AV6 D;  3X1V D;  3WAA B;  2ZY3 A;  4H9S C;  3LEL D;  1S32 D;  3F6T A;  5B24 B;  1P34 A;  3REI C;  5JRG A;  1P3A A;  4Z66 C;  5AVC D;  4CAY A;  2ZY4 A;  3LEL A;  1P3F A;  3LJA A;  3REL B;  2DQN C;  1F66 A;  3LZ1 D;  2G5H C;  4AWL B;  3MVD B;  3X1U D;  3REI A;  1HQ3 D;  2CV5 D;  4G92 B;  3B6F D;  5B1M A;  3B6F C;  1P3I C;  3AZE D;  5BS7 A;  5B0Z A;  1P3F B;  3AZH A;  3W99 C;  5AV5 A;  3AZN C;  3AV2 B;  3KXB C;  1M19 B;  4Z5T A;  2IO5 B;  2LY8 A;  2NZD C;  5BO0 A;  1TAF B;  5AV5 C;  4X23 C;  3X1U A;  5B0Z C;  1EQZ B;  3AYW A;  3W96 C;  2XD1 A;  2Y2L A;  4ZBJ C;  4XUJ D;  3MGR B;  3LZ0 C;  3MGP C;  3C1C B;  5GXQ D;  3TU4 B;  4EO5 B;  4R8P D;  1EQZ D;  5F99 C;  1JFI B;  3W97 C;  1S32 A;  1P3P C;  5AVB A;  3AN2 C;  3KWQ A;  5DNN D;  5AV8 D;  5GT0 B;  1H3O A;  4WU9 C;  5GT0 C;  1P3L B;  1KX5 D;  3TU4 D;  1F66 B;  2HIO C;  4KHA B;  2NZD D;  3AZJ D;  4YM6 D;  3UTA C;  4YS3 B;  1Z2C B;  3H0L C;  5B0Y D;  3W96 B;  1TZY A;  5B33 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...