3AZKB

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLQVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkB00
5JRGA 4J8VB 2F8NG 1M19B 3REJC 4QLCC 1TZYD 5CP6C 3MGSB 5AV6C 4KGCC 1EQZD 3X1UD 4WU8D 1P34D 1P3IA 3AZLD 1U35C 5B33D 3WA9A 5GSUA 5AV5D 5JRGB 1M1AC 4CAYB 4YS3A 3C1BA 4NE5A 3X1TC 1P3BD 4DRAA 2PYOB 5CPIC 2FJ7A 5E5AA 1P3IB 1ZLAC 5CPJA 5AVBD 5B1MD 1P3FA 3RELC 3WA9B 5GSUB 3LELC 1Q9CA 4R8PC 4AWLB 3C1BB 4YS3B 2F8NK 4YM6A 3W98C 5CP6D 4H9QA 5AV6D 4KGCD 5B0ZB 5E5AB 1HQ3D 5CPJB 3KWQD 3AZNC 5BO0A 1P3OA 5GT0A 3C1CA 1M1AD 3LZ0C 4YM6B 3UT9A 5GXQC 4Z66C 1P3LA 5B24C 5CPID 1ZLAD 5BO0B 1P3OB 4KUDC 4HGAC 5GT0B 5GT3A 3C1CB 1EQZA 4WU8A 2YFVA 5F99A 4R8PD 3AFAD 3UT9B 3AZHC 5DNNB 5AV8B 3UTBC 3NQJB 3MVDB 4XUJB 1P3LB 3MGPD 5B40D 1KX3C 1TAFB 3AZND 1ID3D 1F66C 4JJND 5GT3B 1AOIC 3REHB 5F99B 5JA4B 5AY8A 3B0CT 5GXQD 5C3IB 3AZGB 1KX5C 5B32G 3REJA 4QLCA 3VH5W 3REID 1S32C 5CP6A 4KUDD 5AV6A 4KGCA 4ZBJB 4E45A 5AY8B 2YFWA 5CPKC 3WAAD 1U35A 3KUYC 3AN2C 1M1AA 1KX4B 3REJB 5AV9B 2AROC 4QLCB 3X1TA 1F66D 5B2JC 5CP6B 3B6GD 4KGCB 1AOID 5CPIA 3WTPE 5KDMB 1U35B 3AZIA 3RELA 3LELA 5DNMC 3B0BA 4WU9A 4UUZA 3LJAC 4R8PA 1KX5D 3AYWC 3X1TB 3W98A 2BYKB 1S32D 3UTAC 3AZNA 5CPKD 2HIOC 3AZIB 3RELB 1P3MD 4Z5TD 3KUYD 3LELB 2L5AA 3W96D 1TZYC 4WU9B 4UUZB 5B0YC 3X1SD 3LZ0A 5BNVA 3W98B 3X1UC 5GXQA 3AZLC 4Z66A 5B33C 3KSYA 5B24A 5AV5C 1ULYA 4KUDA 3LZ0B 1P3BC 3AYWD 3AZHA 1M18B 3UTBA 1P3AC 4Z66B 5AVBC 5B1MC 3MNNA 5B24B 3UTAD 3WKJC 1KX3A 1F66A 2HIOD 3REKD 3VH6W 3NQUB 3LZ1C 1AOIA 2NZDD 3AZJD 3AV2C 5B0YD 1P3GB 3AZHB 3UTBB 1HQ3C 3KWQC 3MNNB 3MGRD 4X23D 4J8XC 1KX5A 1P3FB 1KX3B 1F66B 5AVCC 1S32A 4XZQA 5BS7C 3WTPD 1N1JA 5CPKA 3KUYA 4J8WA 1P3AD 3AN2A 5B31D 3WKJD 2AROA 3AZFD 3O62C 2IO5C 3VH5A 5B2JA 3AFAC 4XZQB 3B6FC 1B67A 3LZ1D 3AV2D 1N1JB 3W97D 4J8WB 2FJ7B 3MGPC 4H9OA 5B40C 3AZKC 5DNMA 3AN2B 1ID3C 3AZEA 3LJAA 4J8XD 4JJNC 2AROB 2RVQC 4H9PA 5B2JB 5AVCD 1HTAA 2F8ND 3UTAA 1WWSA 4H9QB 4LD9C 2HIOA 4EO5C 4H9OB 5DNMB 1TZYA 3AZEB 1H3OA 5B0YA 3LJAB 3REIC 3AZMD 3O62D 3X1UA 3TU4C 1P34A 1P3KD 3B6FD 3WAAC 3AZLA 3A6NC 3UTAB 5B33A 2HUEC 3B0DC 5AV5A 4G92C 4H9SA 3AZKD 1TZYB 1H3OB 5B0YB 3W99C 1P3BA 3B6GC 3X1VD 2RVQD 4ZUXC 1EQZB 4WU8B 2YFVB 3X1UB 1P34B 3AZLB 5AVBA 5B1MA 5B33B 5AV5B 3AV1C 3WKJA 3KXBD 4J8UC 4LD9D 4J8VC 1BH8A 3LZ1A 3AV2A 1P3BB 3TU4D 1HQ3A 2CV5D 3KWQA 5AVBB 5B1MB 1P3MC 4J8XA 2NQBD 4Z5TC 5CHLB 3A6ND 3W96C 3X1SC 5AVCA 1BH8B 3VH6A 5BS7A 5B32C 3W99D 5B2ID 5AV6B 4ZUXD 2PYOC 1HQ3B 3KWQB 4WNNA 2YFWB 5B1LD 1ZLAA 1KU5A 3AV1D 3O62A 1M1AB 4J8UD 2BYMA 3AFAA 4J8VD 1M19D 3MGSD 5B0ZC 5CPIB 3MGPA 3AZKA 4WNNB 5B40A 1ZLAB 1ID3A 4JJNA 3REKC 2NZDC 3AZJC 2IO5B 5JRGD 4R8PB 2BYMB 3AFAB 4YM6C 5B32D 3MGRC 4X23C 4LD9A 2PYOD 4WV4B 3MGPB 5B40B 1P3ID 3AZNB 1ID3B 4JJNB 3REIA 4KHAA 3WA9D 5GSUD 3WTPC 3TU4A 4YS3D 3C1BD 5BNVB 5DNNC 3WAAA 3A6NA 5AV8C 5GXQB 3V9RA 2CWEA 4XUJC 3MVDC 4EO5B 5B31C 5B0ZD 5E5AD 3AZFC 5CPJD 4NFTA 3W99A 4H9NA 1A7WA 3REIB 3B6GA 4KUDB 4HGAB 3REHC 4ZUXA 5BT1D 4DRBA 5F99C 4YM6D 5FUGA 3W97C 3WAAB 2HUEB 3B0DB 3V9RB 5C3IC 4G91C 4J8UA 3AZGC 3B0CW 4H9NB 3B6GB 1P3OD 1AOIB 5GT0D 3C1CD 3UT9D 5DNND 1P3MA 4Z5TA 5AV8D 3W96A 3VH5T 3X1SA 4XUJD 3MVDD 4J8UB 1P3LD 1KX4C 4CAYA 3AZMC 1KX5B 5AV9C 5B32A 1S32B 1P3KC 5GT3D 3REHD 2PYOA 5F99D 4Z2MH 5CPKB 1P3MB 4Z5TB 3KUYB 3W96B 4E44A 3X1SB 3AZGD 3X1VC 3AYWA 2JSSA 5B32B 5B0ZA 5AY8D 1P3PC 3KXBC 3MGQC 3AZIC 3REKA 4WU9C 2NZDA 3AZJA 1KX4D 3AYWB 4H9PB 3REJD 5AV9D 4QLCD 2F8NH 2CV5C 3MGRA 4X23A 2NQBC 2HIOB 3REKB 1U35D 4M6BA 2NZDB 3AZJB 5B2IC 3WTPA 3X1TD 5DNNA 1M18C 5AV8A 4H9RA 3NQJA 5B1LC 3MVDA 4XUJA 4X23B 3MGRB 1P3AA 5B31A 3AZFA 1TAFA 1BH9A 1P3PD 3MGQD 3AZID 3RELD 3LELD 1M19C 4WU9D 3REHA 3WTPB 1P3GC 5G49A 3W97A 3R45A 5JA4A 3MGSC 3W98D 4H9RB 3MNNC 1P3AB 5B31B 3AZGA 3VH6T 1P3FC 3WKJB 3AZFB 1BH9B 5JRGC 1R4VA 3LZ1B 3AV2B 2LY8A 2F8NA 3LZ0D 5G49B 3W97B 3R45B 4CSRA 1M18D 1P3IC 4G91B 4Z66D 4J8XB 1KX4A 1F1EA 5B24D 3AZMA 3WA9C 5GSUC 5AV9A 5AVCB 4AWLC 4YS3C 3C1BC 4XZQC 1P3KA 3B6FA 2F8NB 1P3GD 4CSRB 3AZHD 5KDMA 3UTBD 4J8WC 2FJ7C 5E5AC 5CPJC 3MNND 3AZMB 3X1VA 1P3FD 1KX3D 3O62B 5BT1C 2BYKA 1P3KB 3B6FB 1BFMA 4NE3A 1P3PA 3KXBA 3MGQA 3AZKB 4NE6A 3AZEC 3X1VB 1P3OC 5GT0C 3C1CC 2CV5A 3UT9C 4XZQD 2NQBA 1JFIA 5BNXA 1P3PB 3KXBB 3MGQB 1P3LC 4LD9B 4J8WD 2FJ7D 3AN2D 5B2IA 4KHAB 2AROD 5GT3C 4Z2MG 1EQZC 4WU8C 1M18A 1P34C 3TU4B 5B2JD 2CV5B 5B31G 5B1LA 2NQBB 3A6NB 1JFIB 5BNXB 3AV1A 4H9SC 4G92B 4WZSB 4J8VA 1M19A 3NQUA 5DNMD 3W99B 3AZED 1B6WA 5B2IB 3LJAD 1P3GA 4ZUXB 3MGSA 1WWIA 5B1LB 4ZBJC 5FUGB 5AY8C 3AV1B
chains in the Genus database with same CATH superfamily
5JRGA 4J8VB 2F8NG 1M19B 3REJC 4QLCC 1TZYD 5CP6C 3MGSB 2DQNC 5AV6C 4KGCC 1EQZD 3X1UD 4WU8D 1P34D 4UPKA 1P3IA 3AZLD 1U35C 5B33D 3WA9A 5GSUA 5AV5D 5JRGB 1M1AC 4CAYB 4YS3A 3C1BA 4NE5A 3X1TC 1P3BD 4DRAA 2PYOB 5CPIC 2FJ7A 5E5AA 1P3IB 1ZLAC 5CPJA 5AVBD 5B1MD 1P3FA 3RELC 3WA9B 5GSUB 3LELC 1Q9CA 4R8PC 4AWLB 3C1BB 4YS3B 2F8NK 4YM6A 3W98C 3EPKA 2XD5A 5CP6D 4H9QA 5AV6D 4KGCD 5B0ZB 5E5AB 1HQ3D 5CPJB 3KWQD 3AZNC 5BO0A 2Y2KA 1P3OA 5GT0A 3C1CA 1M1AD 3LZ0C 4YM6B 3UT9A 2Y2GA 5GXQC 4Z66C 1P3LA 5B24C 5CPID 1ZLAD 5BO0B 1P3OB 4KUDC 4HGAC 5GT3A 5GT0B 3C1CB 1EQZA 4WU8A 2YFVA 5F99A 4R8PD 3AFAD 3UT9B 3AZHC 5DNNB 5AV8B 3UTBC 3NQJB 3MVDB 4XUJB 1P3LB 3MGPD 5B40D 1KX3C 1TAFB 3AZND 1ID3D 1F66C 4JJND 5GT3B 1AOIC 3REHB 5F99B 5JA4B 5AY8A 3B0CT 5GXQD 5C3IB 3A1KA 3AZGB 1KX5C 5B32G 3REJA 4QLCA 3VH5W 3REID 1S32C 5CP6A 4KUDD 5AV6A 4KGCA 4ZBJB 4E45A 5AY8B 2YFWA 5CPKC 3WAAD 1U35A 3KUYC 4WJ3C 3AN2C 1M1AA 2Y2IA 1KX4B 3REJB 5AV9B 2AROC 4QLCB 3X1TA 1F66D 5B2JC 5CP6B 3B6GD 4DQYB 4KGCB 1AOID 5CPIA 2BG1A 3WTPE 5KDMB 1U35B 3AZIA 2G5HC 3RELA 3LELA 5DNMC 3B0BA 4WU9A 4UUZA 3LJAC 4R8PA 1KX5D 3AYWC 3X1TB 3W98A 2BYKB 3EG5B 1S32D 3UTAC 3AZNA 5CPKD 2HIOC 3AZIB 3RELB 1P3MD 4Z5TD 3KUYD 3LELB 2L5AA 3W96D 1TZYC 4WU9B 4UUZB 5B0YC 3X1SD 3LZ0A 5BNVA 3W98B 3X1UC 5GXQA 3AZLC 4Z66A 5B33C 3KSYA 5B24A 5AV5C 1ULYA 4KUDA 3LZ0B 1P3BC 3AYWD 3AZHA 1M18B 3UTBA 1P3AC 4Z66B 5AVBC 5B1MC 3MNNA 5B24B 3UTAD 3WKJC 1KX3A 1F66A 2HIOD 3REKD 3VH6W 3NQUB 3LZ1C 1AOIA 2NZDD 3AZJD 3AV2C 5B0YD 1P3GB 3AZHB 3UTBB 1HQ3C 3KWQC 3MNNB 3MGRD 4X23D 4J8XC 1KX5A 1P3FB 1KX3B 1F66B 5AVCC 1S32A 4XZQA 5BS7C 3WTPD 1N1JA 5CPKA 3KUYA 4J8WA 1P3AD 3AN2A 5B31D 3A1IA 1PZRA 3WKJD 2AROA 3AZFD 3O62C 2IO5C 2JCHA 3VH5A 5B2JA 3AFAC 4XZQB 3B6FC 1B67A 3LZ1D 3AV2D 1N1JB 3W97D 4J8WB 2FJ7B 3MGPC 4H9OA 5B40C 3AZKC 3EPJA 5DNMA 3AN2B 1ID3C 3AZEA 3LJAA 4J8XD 4JJNC 2AROB 2RVQC 4H9PA 5B2JB 5AVCD 1HTAA 2F8ND 3UTAA 1WWSA 4H9QB 4LD9C 2HIOA 4EO5C 3FDDA 4H9OB 5DNMB 1TZYA 3AZEB 1H3OA 5B0YA 3LJAB 3REIC 3AZMD 3F6TA 3O62D 3X1UA 3P5JB 3TU4C 1P34A 1P3KD 3B6FD 3WAAC 3AZLA 3A6NC 3UTAB 5B33A 2HUEC 3B0DC 5AV5A 4G92C 4H9SA 3AZKD 1TZYB 1H3OB 5B0YB 3W99C 1P3BA 3B6GC 3X1VD 2FFFB 2RVQD 4ZUXC 1EQZB 4WU8B 2YFVB 3X1UB 1P34B 3AZLB 5AVBA 5B1MA 5B33B 5AV5B 3AV1C 3WKJA 3EPLA 3KXBD 4J8UC 4LD9D 4J8VC 1BH8A 3LZ1A 3AV2A 2J8PA 1P3BB 2DF4C 1W2EA 3TU4D 1HQ3A 2CV5D 3KWQA 5AVBB 5B1MB 1P3MC 4J8XA 2NQBD 4Z5TC 5CHLB 3A6ND 3W96C 3X1SC 5AVCA 1BH8B 3VH6A 5BS7A 5B32C 3W99D 5B2ID 2VQRA 5AV6B 4ZUXD 2PYOC 1HQ3B 3KWQB 4WNNA 2YFWB 5B1LD 1ZLAA 1KU5A 2G5IC 3AV1D 2Y2HA 3O62A 1M1AB 4J8UD 2BYMA 3AFAA 4J8VD 1M19D 2XD1A 3MGSD 5B0ZC 5CPIB 3MGPA 3AZKA 4WNNB 5B40A 1ZLAB 1ID3A 4JJNA 3REKC 3H0LC 2NZDC 3AZJC 2IO5B 5JRGD 4R8PB 2BYMB 3AFAB 4YM6C 5B32D 3MGRC 4X23C 4LD9A 2PYOD 4WV4B 3MGPB 5B40B 1P3ID 3AZNB 2ZM5A 1ID3B 4JJNB 3EPHA 3REIA 4KHAA 3WA9D 5GSUD 3WTPC 3TU4A 2JE5A 4YS3D 3C1BD 5BNVB 5DNNC 3WAAA 3A6NA 5AV8C 5GXQB 3V9RA 2CWEA 4XUJC 3MVDC 2Y2JA 5B31C 4EO5B 5B0ZD 5E5AD 3AZFC 5CPJD 2Y2QA 4NFTA 3W99A 4H9NA 1A7WA 3REIB 3B6GA 4KUDB 4HGAB 3REHC 4ZUXA 5BT1D 4DRBA 5F99C 4YM6D 5FUGA 3W97C 3WAAB 2HUEB 2F2AC 3B0DB 3V9RB 5C3IC 4G91C 3H0RC 4J8UA 3AZGC 3B0CW 4H9NB 3B6GB 1P3OD 2Y2OA 1AOIB 5GT0D 3C1CD 3UT9D 5DNND 1P3MA 4Z5TA 5AV8D 3W96A 3VH5T 3X1SA 4XUJD 3MVDD 4J8UB 1P3LD 1KX4C 4CAYA 3AZMC 1KX5B 5AV9C 5B32A 1S32B 1P3KC 5GT3D 3REHD 2PYOA 5F99D 4Z2MH 5CPKB 1P3MB 4Z5TB 3KUYB 3W96B 4E44A 3X1SB 3AZGD 3X1VC 3AYWA 2JSSA 5B32B 5B0ZA 5AY8D 2Y2MA 3KXBC 3MGQC 3AZIC 3REKA 1P3PC 4WU9C 2NZDA 3AZJA 1KX4D 3AYWB 4H9PB 3REJD 5AV9D 4QLCD 2F8NH 2CV5C 3MGRA 4X23A 2NQBC 2HIOB 3REKB 1U35D 4M6BA 3AV1B 2NZDB 3AZJB 5B2IC 3WTPA 3X1TD 5DNNA 1M18C 2Y2PA 5AV8A 4H9RA 3NQJA 5B1LC 3MVDA 4XUJA 4X23B 3MGRB 1P3AA 5B31A 3AZFA 1TAFA 1BH9A 2UWXA 1P3PD 3MGQD 3AZID 2ZY3A 3RELD 3LELD 1M19C 4WU9D 3REHA 3WTPB 1P3GC 5G49A 3W97A 3R45A 5JA4A 3MGSC 3W98D 4H9RB 3MNNC 1P3AB 5B31B 3AZGA 3VH6T 1P3FC 3WKJB 3AZFB 1BH9B 5JRGC 1R4VA 3LZ1B 3AV2B 2LY8A 2F8NA 3LZ0D 5G49B 3W97B 3R45B 4CSRA 1M18D 1P3IC 3IP4C 4G91B 4Z66D 4J8XB 1KX4A 1F1EA 5B24D 3AZMA 3WA9C 5GSUC 5AV9A 5AVCB 4AWLC 4YS3C 3C1BC 4XZQC 1P3KA 3B6FA 3AL0C 2F8NB 1P3GD 4CSRB 3AZHD 5KDMA 3UTBD 4J8WC 2FJ7C 5E5AC 5CPJC 3MNND 3AZMB 2RIQA 3X1VA 1P3FD 1KX3D 2ZY5A 3O62B 5BT1C 2BYKA 1P3KB 3B6FB 1BFMA 4NE3A 1P3PA 3KXBA 3MGQA 3AZKB 4NE6A 3AZEC 3X1VB 1P3OC 1T3UA 5GT0C 3C1CC 2CV5A 3UT9C 4XZQD 2ZY4A 2NQBA 1JFIA 5BNXA 1P3PB 3KXBB 3MGQB 1P3LC 4LD9B 4J8WD 2FJ7D 3AN2D 5B2IA 4KHAB 2AROD 5GT3C 4Z2MG 1EQZC 4WU8C 1M18A 1P34C 3TU4B 5B2JD 2CV5B 5B31G 5B1LA 2NQBB 3H0MC 3A6NB 2W8SA 1JFIB 5BNXB 3AV1A 3KFUG 4H9SC 4G92B 2Y2NA 4WZSB 4J8VA 1M19A 3NQUA 5DNMD 3W99B 3AZED 1B6WA 5B2IB 3LJAD 1P3GA 2ZY2A 4ZUXB 3MGSA 2Y2LA 1WWIA 5B1LB 4ZBJC 5FUGB 5AY8C 1Z2CB
chains in the Genus database with same CATH topology
5JRGA 4J8VB 2F8NG 1M19B 3REJC 4QLCC 1TZYD 5CP6C 3MGSB 2DQNC 5AV6C 4KGCC 1EQZD 3X1UD 4WU8D 1P34D 4UPKA 1P3IA 3AZLD 1U35C 5B33D 3WA9A 5GSUA 5AV5D 5JRGB 1M1AC 4CAYB 4YS3A 3C1BA 4NE5A 3X1TC 1P3BD 4DRAA 2PYOB 5CPIC 2FJ7A 5E5AA 1P3IB 1ZLAC 5CPJA 5AVBD 5B1MD 1P3FA 3RELC 3WA9B 5GSUB 3LELC 1Q9CA 4R8PC 4AWLB 3C1BB 4YS3B 2F8NK 4YM6A 3W98C 3EPKA 2XD5A 5CP6D 4H9QA 5AV6D 4KGCD 5B0ZB 5E5AB 1HQ3D 5CPJB 3KWQD 3AZNC 5BO0A 2Y2KA 1P3OA 5GT0A 3C1CA 1M1AD 3LZ0C 4YM6B 3UT9A 2Y2GA 5GXQC 4Z66C 1P3LA 5B24C 5CPID 1ZLAD 5BO0B 1P3OB 4KUDC 4HGAC 5GT3A 5GT0B 3C1CB 1EQZA 4WU8A 2YFVA 5F99A 4R8PD 3AFAD 3UT9B 3AZHC 5DNNB 5AV8B 3UTBC 3NQJB 3MVDB 4XUJB 1P3LB 3MGPD 5B40D 1KX3C 1TAFB 3AZND 1ID3D 1F66C 4JJND 5GT3B 1AOIC 3REHB 5F99B 5JA4B 5AY8A 3B0CT 5GXQD 5C3IB 3A1KA 3AZGB 1KX5C 5B32G 3REJA 4QLCA 3VH5W 3REID 1S32C 5CP6A 4KUDD 5AV6A 4KGCA 4ZBJB 4E45A 5AY8B 2YFWA 5CPKC 3WAAD 1U35A 3KUYC 4WJ3C 3AN2C 1M1AA 2Y2IA 1KX4B 3REJB 5AV9B 2AROC 4QLCB 3X1TA 1F66D 5B2JC 5CP6B 3B6GD 4DQYB 4KGCB 1AOID 5CPIA 2BG1A 3WTPE 5KDMB 1U35B 3AZIA 2G5HC 3RELA 3LELA 5DNMC 3B0BA 4WU9A 4UUZA 3LJAC 4R8PA 1KX5D 3AYWC 3X1TB 3W98A 2BYKB 3EG5B 1S32D 3UTAC 3AZNA 5CPKD 2HIOC 3AZIB 3RELB 1P3MD 4Z5TD 3KUYD 3LELB 2L5AA 3W96D 1TZYC 4WU9B 4UUZB 5B0YC 3X1SD 3LZ0A 5BNVA 3W98B 3X1UC 5GXQA 3AZLC 4Z66A 5B33C 3KSYA 5B24A 5AV5C 1ULYA 4KUDA 3LZ0B 1P3BC 3AYWD 3AZHA 1M18B 3UTBA 1P3AC 4Z66B 5AVBC 5B1MC 3MNNA 5B24B 3UTAD 3WKJC 1KX3A 1F66A 2HIOD 3REKD 3VH6W 3NQUB 3LZ1C 1AOIA 2NZDD 3AZJD 3AV2C 5B0YD 1P3GB 3AZHB 3UTBB 1HQ3C 3KWQC 3MNNB 3MGRD 4X23D 4J8XC 1KX5A 1P3FB 1KX3B 1F66B 5AVCC 1S32A 4XZQA 5BS7C 3WTPD 1N1JA 5CPKA 3KUYA 4J8WA 1P3AD 3AN2A 5B31D 3A1IA 1PZRA 3WKJD 2AROA 3AZFD 3O62C 2IO5C 2JCHA 3VH5A 5B2JA 3AFAC 4XZQB 3B6FC 1B67A 3LZ1D 3AV2D 1N1JB 3W97D 4J8WB 2FJ7B 3MGPC 4H9OA 5B40C 3AZKC 3EPJA 5DNMA 3AN2B 1ID3C 3AZEA 3LJAA 4J8XD 4JJNC 2AROB 2RVQC 4H9PA 5B2JB 5AVCD 1HTAA 2F8ND 3UTAA 1WWSA 4H9QB 4LD9C 2HIOA 4EO5C 3FDDA 4H9OB 5DNMB 1TZYA 3AZEB 1H3OA 5B0YA 3LJAB 3REIC 3AZMD 3F6TA 3O62D 3X1UA 3P5JB 3TU4C 1P34A 1P3KD 3B6FD 3WAAC 3AZLA 3A6NC 3UTAB 5B33A 2HUEC 3B0DC 5AV5A 4G92C 4H9SA 3AZKD 1TZYB 1H3OB 5B0YB 3W99C 1P3BA 3B6GC 3X1VD 2FFFB 2RVQD 4ZUXC 1EQZB 4WU8B 2YFVB 3X1UB 1P34B 3AZLB 5AVBA 5B1MA 5B33B 5AV5B 3AV1C 3WKJA 3EPLA 3KXBD 4J8UC 4LD9D 4J8VC 1BH8A 3LZ1A 3AV2A 2J8PA 1P3BB 2DF4C 1W2EA 3TU4D 1HQ3A 2CV5D 3KWQA 5AVBB 5B1MB 1P3MC 4J8XA 2NQBD 4Z5TC 5CHLB 3A6ND 3W96C 3X1SC 5AVCA 1BH8B 3VH6A 5BS7A 5B32C 3W99D 5B2ID 2VQRA 5AV6B 4ZUXD 2PYOC 1HQ3B 3KWQB 4WNNA 2YFWB 5B1LD 1ZLAA 1KU5A 2G5IC 3AV1D 2Y2HA 3O62A 1M1AB 4J8UD 2BYMA 3AFAA 4J8VD 1M19D 2XD1A 3MGSD 5B0ZC 5CPIB 3MGPA 3AZKA 4WNNB 5B40A 1ZLAB 1ID3A 4JJNA 3REKC 3H0LC 2NZDC 3AZJC 2IO5B 5JRGD 4R8PB 2BYMB 3AFAB 4YM6C 5B32D 3MGRC 4X23C 4LD9A 2PYOD 4WV4B 3MGPB 5B40B 1P3ID 3AZNB 2ZM5A 1ID3B 4JJNB 3EPHA 3REIA 4KHAA 3WA9D 5GSUD 3WTPC 3TU4A 2JE5A 4YS3D 3C1BD 5BNVB 5DNNC 3WAAA 3A6NA 5AV8C 5GXQB 3V9RA 2CWEA 4XUJC 3MVDC 2Y2JA 5B31C 4EO5B 5B0ZD 5E5AD 3AZFC 5CPJD 2Y2QA 4NFTA 3W99A 4H9NA 1A7WA 3REIB 3B6GA 4KUDB 4HGAB 3REHC 4ZUXA 5BT1D 4DRBA 5F99C 4YM6D 5FUGA 3W97C 3WAAB 2HUEB 2F2AC 3B0DB 3V9RB 5C3IC 4G91C 3H0RC 4J8UA 3AZGC 3B0CW 4H9NB 3B6GB 1P3OD 2Y2OA 1AOIB 5GT0D 3C1CD 3UT9D 5DNND 1P3MA 4Z5TA 5AV8D 3W96A 3VH5T 3X1SA 4XUJD 3MVDD 4J8UB 1P3LD 1KX4C 4CAYA 3AZMC 1KX5B 5AV9C 5B32A 1S32B 1P3KC 5GT3D 3REHD 2PYOA 5F99D 4Z2MH 5CPKB 1P3MB 4Z5TB 3KUYB 3W96B 4E44A 3X1SB 3AZGD 3X1VC 3AYWA 2JSSA 5B32B 5B0ZA 5AY8D 2Y2MA 3KXBC 3MGQC 3AZIC 3REKA 1P3PC 4WU9C 2NZDA 3AZJA 1KX4D 3AYWB 4H9PB 3REJD 5AV9D 4QLCD 2F8NH 2CV5C 3MGRA 4X23A 2NQBC 2HIOB 3REKB 1U35D 4M6BA 3AV1B 2NZDB 3AZJB 5B2IC 3WTPA 3X1TD 5DNNA 1M18C 2Y2PA 5AV8A 4H9RA 3NQJA 5B1LC 3MVDA 4XUJA 4X23B 3MGRB 1P3AA 5B31A 3AZFA 1TAFA 1BH9A 2UWXA 1P3PD 3MGQD 3AZID 2ZY3A 3RELD 3LELD 1M19C 4WU9D 3REHA 3WTPB 1P3GC 5G49A 3W97A 3R45A 5JA4A 3MGSC 3W98D 4H9RB 3MNNC 1P3AB 5B31B 3AZGA 3VH6T 1P3FC 3WKJB 3AZFB 1BH9B 5JRGC 1R4VA 3LZ1B 3AV2B 2LY8A 2F8NA 3LZ0D 5G49B 3W97B 3R45B 4CSRA 1M18D 1P3IC 3IP4C 4G91B 4Z66D 4J8XB 1KX4A 1F1EA 5B24D 3AZMA 3WA9C 5GSUC 5AV9A 5AVCB 4AWLC 4YS3C 3C1BC 4XZQC 1P3KA 3B6FA 3AL0C 2F8NB 1P3GD 4CSRB 3AZHD 5KDMA 3UTBD 4J8WC 2FJ7C 5E5AC 5CPJC 3MNND 3AZMB 2RIQA 3X1VA 1P3FD 1KX3D 2ZY5A 3O62B 5BT1C 2BYKA 1P3KB 3B6FB 1BFMA 4NE3A 1P3PA 3KXBA 3MGQA 3AZKB 4NE6A 3AZEC 3X1VB 1P3OC 1T3UA 5GT0C 3C1CC 2CV5A 3UT9C 4XZQD 2ZY4A 2NQBA 1JFIA 5BNXA 1P3PB 3KXBB 3MGQB 1P3LC 4LD9B 4J8WD 2FJ7D 3AN2D 5B2IA 4KHAB 2AROD 5GT3C 4Z2MG 1EQZC 4WU8C 1M18A 1P34C 3TU4B 5B2JD 2CV5B 5B31G 5B1LA 2NQBB 3H0MC 3A6NB 2W8SA 1JFIB 5BNXB 3AV1A 3KFUG 4H9SC 4G92B 2Y2NA 4WZSB 4J8VA 1M19A 3NQUA 5DNMD 3W99B 3AZED 1B6WA 5B2IB 3LJAD 1P3GA 2ZY2A 4ZUXB 3MGSA 2Y2LA 1WWIA 5B1LB 4ZBJC 5FUGB 5AY8C 1Z2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG A;  4J8V B;  2F8N G;  1M19 B;  3REJ C;  4QLC C;  1TZY D;  5CP6 C;  3MGS B;  5AV6 C;  4KGC C;  1EQZ D;  3X1U D;  4WU8 D;  1P34 D;  1P3I A;  3AZL D;  1U35 C;  5B33 D;  3WA9 A;  5GSU A;  5AV5 D;  5JRG B;  1M1A C;  4CAY B;  4YS3 A;  3C1B A;  4NE5 A;  3X1T C;  1P3B D;  4DRA A;  2PYO B;  5CPI C;  2FJ7 A;  5E5A A;  1P3I B;  1ZLA C;  5CPJ A;  5AVB D;  5B1M D;  1P3F A;  3REL C;  3WA9 B;  5GSU B;  3LEL C;  1Q9C A;  4R8P C;  4AWL B;  3C1B B;  4YS3 B;  2F8N K;  4YM6 A;  3W98 C;  5CP6 D;  4H9Q A;  5AV6 D;  4KGC D;  5B0Z B;  5E5A B;  1HQ3 D;  5CPJ B;  3KWQ D;  3AZN C;  5BO0 A;  1P3O A;  5GT0 A;  3C1C A;  1M1A D;  3LZ0 C;  4YM6 B;  3UT9 A;  5GXQ C;  4Z66 C;  1P3L A;  5B24 C;  5CPI D;  1ZLA D;  5BO0 B;  1P3O B;  4KUD C;  4HGA C;  5GT0 B;  5GT3 A;  3C1C B;  1EQZ A;  4WU8 A;  2YFV A;  5F99 A;  4R8P D;  3AFA D;  3UT9 B;  3AZH C;  5DNN B;  5AV8 B;  3UTB C;  3NQJ B;  3MVD B;  4XUJ B;  1P3L B;  3MGP D;  5B40 D;  1KX3 C;  1TAF B;  3AZN D;  1ID3 D;  1F66 C;  4JJN D;  5GT3 B;  1AOI C;  3REH B;  5F99 B;  5JA4 B;  5AY8 A;  3B0C T;  5GXQ D;  5C3I B;  3AZG B;  1KX5 C;  5B32 G;  3REJ A;  4QLC A;  3VH5 W;  3REI D;  1S32 C;  5CP6 A;  4KUD D;  5AV6 A;  4KGC A;  4ZBJ B;  4E45 A;  5AY8 B;  2YFW A;  5CPK C;  3WAA D;  1U35 A;  3KUY C;  3AN2 C;  1M1A A;  1KX4 B;  3REJ B;  5AV9 B;  2ARO C;  4QLC B;  3X1T A;  1F66 D;  5B2J C;  5CP6 B;  3B6G D;  4KGC B;  1AOI D;  5CPI A;  3WTP E;  5KDM B;  1U35 B;  3AZI A;  3REL A;  3LEL A;  5DNM C;  3B0B A;  4WU9 A;  4UUZ A;  3LJA C;  4R8P A;  1KX5 D;  3AYW C;  3X1T B;  3W98 A;  2BYK B;  1S32 D;  3UTA C;  3AZN A;  5CPK D;  2HIO C;  3AZI B;  3REL B;  1P3M D;  4Z5T D;  3KUY D;  3LEL B;  2L5A A;  3W96 D;  1TZY C;  4WU9 B;  4UUZ B;  5B0Y C;  3X1S D;  3LZ0 A;  5BNV A;  3W98 B;  3X1U C;  5GXQ A;  3AZL C;  4Z66 A;  5B33 C;  3KSY A;  5B24 A;  5AV5 C;  1ULY A;  4KUD A;  3LZ0 B;  1P3B C;  3AYW D;  3AZH A;  1M18 B;  3UTB A;  1P3A C;  4Z66 B;  5AVB C;  5B1M C;  3MNN A;  5B24 B;  3UTA D;  3WKJ C;  1KX3 A;  1F66 A;  2HIO D;  3REK D;  3VH6 W;  3NQU B;  3LZ1 C;  1AOI A;  2NZD D;  3AZJ D;  3AV2 C;  5B0Y D;  1P3G B;  3AZH B;  3UTB B;  1HQ3 C;  3KWQ C;  3MNN B;  3MGR D;  4X23 D;  4J8X C;  1KX5 A;  1P3F B;  1KX3 B;  1F66 B;  5AVC C;  1S32 A;  4XZQ A;  5BS7 C;  3WTP D;  1N1J A;  5CPK A;  3KUY A;  4J8W A;  1P3A D;  3AN2 A;  5B31 D;  3WKJ D;  2ARO A;  3AZF D;  3O62 C;  2IO5 C;  3VH5 A;  5B2J A;  3AFA C;  4XZQ B;  3B6F C;  1B67 A;  3LZ1 D;  3AV2 D;  1N1J B;  3W97 D;  4J8W B;  2FJ7 B;  3MGP C;  4H9O A;  5B40 C;  3AZK C;  5DNM A;  3AN2 B;  1ID3 C;  3AZE A;  3LJA A;  4J8X D;  4JJN C;  2ARO B;  2RVQ C;  4H9P A;  5B2J B;  5AVC D;  1HTA A;  2F8N D;  3UTA A;  1WWS A;  4H9Q B;  4LD9 C;  2HIO A;  4EO5 C;  4H9O B;  5DNM B;  1TZY A;  3AZE B;  1H3O A;  5B0Y A;  3LJA B;  3REI C;  3AZM D;  3O62 D;  3X1U A;  3TU4 C;  1P34 A;  1P3K D;  3B6F D;  3WAA C;  3AZL A;  3A6N C;  3UTA B;  5B33 A;  2HUE C;  3B0D C;  5AV5 A;  4G92 C;  4H9S A;  3AZK D;  1TZY B;  1H3O B;  5B0Y B;  3W99 C;  1P3B A;  3B6G C;  3X1V D;  2RVQ D;  4ZUX C;  1EQZ B;  4WU8 B;  2YFV B;  3X1U B;  1P34 B;  3AZL B;  5AVB A;  5B1M A;  5B33 B;  5AV5 B;  3AV1 C;  3WKJ A;  3KXB D;  4J8U C;  4LD9 D;  4J8V C;  1BH8 A;  3LZ1 A;  3AV2 A;  1P3B B;  3TU4 D;  1HQ3 A;  2CV5 D;  3KWQ A;  5AVB B;  5B1M B;  1P3M C;  4J8X A;  2NQB D;  4Z5T C;  5CHL B;  3A6N D;  3W96 C;  3X1S C;  5AVC A;  1BH8 B;  3VH6 A;  5BS7 A;  5B32 C;  3W99 D;  5B2I D;  5AV6 B;  4ZUX D;  2PYO C;  1HQ3 B;  3KWQ B;  4WNN A;  2YFW B;  5B1L D;  1ZLA A;  1KU5 A;  3AV1 D;  3O62 A;  1M1A B;  4J8U D;  2BYM A;  3AFA A;  4J8V D;  1M19 D;  3MGS D;  5B0Z C;  5CPI B;  3MGP A;  3AZK A;  4WNN B;  5B40 A;  1ZLA B;  1ID3 A;  4JJN A;  3REK C;  2NZD C;  3AZJ C;  2IO5 B;  5JRG D;  4R8P B;  2BYM B;  3AFA B;  4YM6 C;  5B32 D;  3MGR C;  4X23 C;  4LD9 A;  2PYO D;  4WV4 B;  3MGP B;  5B40 B;  1P3I D;  3AZN B;  1ID3 B;  4JJN B;  3REI A;  4KHA A;  3WA9 D;  5GSU D;  3WTP C;  3TU4 A;  4YS3 D;  3C1B D;  5BNV B;  5DNN C;  3WAA A;  3A6N A;  5AV8 C;  5GXQ B;  3V9R A;  2CWE A;  4XUJ C;  3MVD C;  4EO5 B;  5B31 C;  5B0Z D;  5E5A D;  3AZF C;  5CPJ D;  4NFT A;  3W99 A;  4H9N A;  1A7W A;  3REI B;  3B6G A;  4KUD B;  4HGA B;  3REH C;  4ZUX A;  5BT1 D;  4DRB A;  5F99 C;  4YM6 D;  5FUG A;  3W97 C;  3WAA B;  2HUE B;  3B0D B;  3V9R B;  5C3I C;  4G91 C;  4J8U A;  3AZG C;  3B0C W;  4H9N B;  3B6G B;  1P3O D;  1AOI B;  5GT0 D;  3C1C D;  3UT9 D;  5DNN D;  1P3M A;  4Z5T A;  5AV8 D;  3W96 A;  3VH5 T;  3X1S A;  4XUJ D;  3MVD D;  4J8U B;  1P3L D;  1KX4 C;  4CAY A;  3AZM C;  1KX5 B;  5AV9 C;  5B32 A;  1S32 B;  1P3K C;  5GT3 D;  3REH D;  2PYO A;  5F99 D;  4Z2M H;  5CPK B;  1P3M B;  4Z5T B;  3KUY B;  3W96 B;  4E44 A;  3X1S B;  3AZG D;  3X1V C;  3AYW A;  2JSS A;  5B32 B;  5B0Z A;  5AY8 D;  1P3P C;  3KXB C;  3MGQ C;  3AZI C;  3REK A;  4WU9 C;  2NZD A;  3AZJ A;  1KX4 D;  3AYW B;  4H9P B;  3REJ D;  5AV9 D;  4QLC D;  2F8N H;  2CV5 C;  3MGR A;  4X23 A;  2NQB C;  2HIO B;  3REK B;  1U35 D;  4M6B A;  2NZD B;  3AZJ B;  5B2I C;  3WTP A;  3X1T D;  5DNN A;  1M18 C;  5AV8 A;  4H9R A;  3NQJ A;  5B1L C;  3MVD A;  4XUJ A;  4X23 B;  3MGR B;  1P3A A;  5B31 A;  3AZF A;  1TAF A;  1BH9 A;  1P3P D;  3MGQ D;  3AZI D;  3REL D;  3LEL D;  1M19 C;  4WU9 D;  3REH A;  3WTP B;  1P3G C;  5G49 A;  3W97 A;  3R45 A;  5JA4 A;  3MGS C;  3W98 D;  4H9R B;  3MNN C;  1P3A B;  5B31 B;  3AZG A;  3VH6 T;  1P3F C;  3WKJ B;  3AZF B;  1BH9 B;  5JRG C;  1R4V A;  3LZ1 B;  3AV2 B;  2LY8 A;  2F8N A;  3LZ0 D;  5G49 B;  3W97 B;  3R45 B;  4CSR A;  1M18 D;  1P3I C;  4G91 B;  4Z66 D;  4J8X B;  1KX4 A;  1F1E A;  5B24 D;  3AZM A;  3WA9 C;  5GSU C;  5AV9 A;  5AVC B;  4AWL C;  4YS3 C;  3C1B C;  4XZQ C;  1P3K A;  3B6F A;  2F8N B;  1P3G D;  4CSR B;  3AZH D;  5KDM A;  3UTB D;  4J8W C;  2FJ7 C;  5E5A C;  5CPJ C;  3MNN D;  3AZM B;  3X1V A;  1P3F D;  1KX3 D;  3O62 B;  5BT1 C;  2BYK A;  1P3K B;  3B6F B;  1BFM A;  4NE3 A;  1P3P A;  3KXB A;  3MGQ A;  3AZK B;  4NE6 A;  3AZE C;  3X1V B;  1P3O C;  5GT0 C;  3C1C C;  2CV5 A;  3UT9 C;  4XZQ D;  2NQB A;  1JFI A;  5BNX A;  1P3P B;  3KXB B;  3MGQ B;  1P3L C;  4LD9 B;  4J8W D;  2FJ7 D;  3AN2 D;  5B2I A;  4KHA B;  2ARO D;  5GT3 C;  4Z2M G;  1EQZ C;  4WU8 C;  1M18 A;  1P34 C;  3TU4 B;  5B2J D;  2CV5 B;  5B31 G;  5B1L A;  2NQB B;  3A6N B;  1JFI B;  5BNX B;  3AV1 A;  4H9S C;  4G92 B;  4WZS B;  4J8V A;  1M19 A;  3NQU A;  5DNM D;  3W99 B;  3AZE D;  1B6W A;  5B2I B;  3LJA D;  1P3G A;  4ZUX B;  3MGS A;  1WWI A;  5B1L B;  4ZBJ C;  5FUG B;  5AY8 C;  3AV1 B; 
#chains in the Genus database with same CATH topology
 5JRG A;  4J8V B;  2F8N G;  1M19 B;  3REJ C;  4QLC C;  1TZY D;  5CP6 C;  3MGS B;  2DQN C;  5AV6 C;  4KGC C;  1EQZ D;  3X1U D;  4WU8 D;  1P34 D;  4UPK A;  1P3I A;  3AZL D;  1U35 C;  5B33 D;  3WA9 A;  5GSU A;  5AV5 D;  5JRG B;  1M1A C;  4CAY B;  4YS3 A;  3C1B A;  4NE5 A;  3X1T C;  1P3B D;  4DRA A;  2PYO B;  5CPI C;  2FJ7 A;  5E5A A;  1P3I B;  1ZLA C;  5CPJ A;  5AVB D;  5B1M D;  1P3F A;  3REL C;  3WA9 B;  5GSU B;  3LEL C;  1Q9C A;  4R8P C;  4AWL B;  3C1B B;  4YS3 B;  2F8N K;  4YM6 A;  3W98 C;  3EPK A;  2XD5 A;  5CP6 D;  4H9Q A;  5AV6 D;  4KGC D;  5B0Z B;  5E5A B;  1HQ3 D;  5CPJ B;  3KWQ D;  3AZN C;  5BO0 A;  2Y2K A;  1P3O A;  5GT0 A;  3C1C A;  1M1A D;  3LZ0 C;  4YM6 B;  3UT9 A;  2Y2G A;  5GXQ C;  4Z66 C;  1P3L A;  5B24 C;  5CPI D;  1ZLA D;  5BO0 B;  1P3O B;  4KUD C;  4HGA C;  5GT3 A;  5GT0 B;  3C1C B;  1EQZ A;  4WU8 A;  2YFV A;  5F99 A;  4R8P D;  3AFA D;  3UT9 B;  3AZH C;  5DNN B;  5AV8 B;  3UTB C;  3NQJ B;  3MVD B;  4XUJ B;  1P3L B;  3MGP D;  5B40 D;  1KX3 C;  1TAF B;  3AZN D;  1ID3 D;  1F66 C;  4JJN D;  5GT3 B;  1AOI C;  3REH B;  5F99 B;  5JA4 B;  5AY8 A;  3B0C T;  5GXQ D;  5C3I B;  3A1K A;  3AZG B;  1KX5 C;  5B32 G;  3REJ A;  4QLC A;  3VH5 W;  3REI D;  1S32 C;  5CP6 A;  4KUD D;  5AV6 A;  4KGC A;  4ZBJ B;  4E45 A;  5AY8 B;  2YFW A;  5CPK C;  3WAA D;  1U35 A;  3KUY C;  4WJ3 C;  3AN2 C;  1M1A A;  2Y2I A;  1KX4 B;  3REJ B;  5AV9 B;  2ARO C;  4QLC B;  3X1T A;  1F66 D;  5B2J C;  5CP6 B;  3B6G D;  4DQY B;  4KGC B;  1AOI D;  5CPI A;  2BG1 A;  3WTP E;  5KDM B;  1U35 B;  3AZI A;  2G5H C;  3REL A;  3LEL A;  5DNM C;  3B0B A;  4WU9 A;  4UUZ A;  3LJA C;  4R8P A;  1KX5 D;  3AYW C;  3X1T B;  3W98 A;  2BYK B;  3EG5 B;  1S32 D;  3UTA C;  3AZN A;  5CPK D;  2HIO C;  3AZI B;  3REL B;  1P3M D;  4Z5T D;  3KUY D;  3LEL B;  2L5A A;  3W96 D;  1TZY C;  4WU9 B;  4UUZ B;  5B0Y C;  3X1S D;  3LZ0 A;  5BNV A;  3W98 B;  3X1U C;  5GXQ A;  3AZL C;  4Z66 A;  5B33 C;  3KSY A;  5B24 A;  5AV5 C;  1ULY A;  4KUD A;  3LZ0 B;  1P3B C;  3AYW D;  3AZH A;  1M18 B;  3UTB A;  1P3A C;  4Z66 B;  5AVB C;  5B1M C;  3MNN A;  5B24 B;  3UTA D;  3WKJ C;  1KX3 A;  1F66 A;  2HIO D;  3REK D;  3VH6 W;  3NQU B;  3LZ1 C;  1AOI A;  2NZD D;  3AZJ D;  3AV2 C;  5B0Y D;  1P3G B;  3AZH B;  3UTB B;  1HQ3 C;  3KWQ C;  3MNN B;  3MGR D;  4X23 D;  4J8X C;  1KX5 A;  1P3F B;  1KX3 B;  1F66 B;  5AVC C;  1S32 A;  4XZQ A;  5BS7 C;  3WTP D;  1N1J A;  5CPK A;  3KUY A;  4J8W A;  1P3A D;  3AN2 A;  5B31 D;  3A1I A;  1PZR A;  3WKJ D;  2ARO A;  3AZF D;  3O62 C;  2IO5 C;  2JCH A;  3VH5 A;  5B2J A;  3AFA C;  4XZQ B;  3B6F C;  1B67 A;  3LZ1 D;  3AV2 D;  1N1J B;  3W97 D;  4J8W B;  2FJ7 B;  3MGP C;  4H9O A;  5B40 C;  3AZK C;  3EPJ A;  5DNM A;  3AN2 B;  1ID3 C;  3AZE A;  3LJA A;  4J8X D;  4JJN C;  2ARO B;  2RVQ C;  4H9P A;  5B2J B;  5AVC D;  1HTA A;  2F8N D;  3UTA A;  1WWS A;  4H9Q B;  4LD9 C;  2HIO A;  4EO5 C;  3FDD A;  4H9O B;  5DNM B;  1TZY A;  3AZE B;  1H3O A;  5B0Y A;  3LJA B;  3REI C;  3AZM D;  3F6T A;  3O62 D;  3X1U A;  3P5J B;  3TU4 C;  1P34 A;  1P3K D;  3B6F D;  3WAA C;  3AZL A;  3A6N C;  3UTA B;  5B33 A;  2HUE C;  3B0D C;  5AV5 A;  4G92 C;  4H9S A;  3AZK D;  1TZY B;  1H3O B;  5B0Y B;  3W99 C;  1P3B A;  3B6G C;  3X1V D;  2FFF B;  2RVQ D;  4ZUX C;  1EQZ B;  4WU8 B;  2YFV B;  3X1U B;  1P34 B;  3AZL B;  5AVB A;  5B1M A;  5B33 B;  5AV5 B;  3AV1 C;  3WKJ A;  3EPL A;  3KXB D;  4J8U C;  4LD9 D;  4J8V C;  1BH8 A;  3LZ1 A;  3AV2 A;  2J8P A;  1P3B B;  2DF4 C;  1W2E A;  3TU4 D;  1HQ3 A;  2CV5 D;  3KWQ A;  5AVB B;  5B1M B;  1P3M C;  4J8X A;  2NQB D;  4Z5T C;  5CHL B;  3A6N D;  3W96 C;  3X1S C;  5AVC A;  1BH8 B;  3VH6 A;  5BS7 A;  5B32 C;  3W99 D;  5B2I D;  2VQR A;  5AV6 B;  4ZUX D;  2PYO C;  1HQ3 B;  3KWQ B;  4WNN A;  2YFW B;  5B1L D;  1ZLA A;  1KU5 A;  2G5I C;  3AV1 D;  2Y2H A;  3O62 A;  1M1A B;  4J8U D;  2BYM A;  3AFA A;  4J8V D;  1M19 D;  2XD1 A;  3MGS D;  5B0Z C;  5CPI B;  3MGP A;  3AZK A;  4WNN B;  5B40 A;  1ZLA B;  1ID3 A;  4JJN A;  3REK C;  3H0L C;  2NZD C;  3AZJ C;  2IO5 B;  5JRG D;  4R8P B;  2BYM B;  3AFA B;  4YM6 C;  5B32 D;  3MGR C;  4X23 C;  4LD9 A;  2PYO D;  4WV4 B;  3MGP B;  5B40 B;  1P3I D;  3AZN B;  2ZM5 A;  1ID3 B;  4JJN B;  3EPH A;  3REI A;  4KHA A;  3WA9 D;  5GSU D;  3WTP C;  3TU4 A;  2JE5 A;  4YS3 D;  3C1B D;  5BNV B;  5DNN C;  3WAA A;  3A6N A;  5AV8 C;  5GXQ B;  3V9R A;  2CWE A;  4XUJ C;  3MVD C;  2Y2J A;  5B31 C;  4EO5 B;  5B0Z D;  5E5A D;  3AZF C;  5CPJ D;  2Y2Q A;  4NFT A;  3W99 A;  4H9N A;  1A7W A;  3REI B;  3B6G A;  4KUD B;  4HGA B;  3REH C;  4ZUX A;  5BT1 D;  4DRB A;  5F99 C;  4YM6 D;  5FUG A;  3W97 C;  3WAA B;  2HUE B;  2F2A C;  3B0D B;  3V9R B;  5C3I C;  4G91 C;  3H0R C;  4J8U A;  3AZG C;  3B0C W;  4H9N B;  3B6G B;  1P3O D;  2Y2O A;  1AOI B;  5GT0 D;  3C1C D;  3UT9 D;  5DNN D;  1P3M A;  4Z5T A;  5AV8 D;  3W96 A;  3VH5 T;  3X1S A;  4XUJ D;  3MVD D;  4J8U B;  1P3L D;  1KX4 C;  4CAY A;  3AZM C;  1KX5 B;  5AV9 C;  5B32 A;  1S32 B;  1P3K C;  5GT3 D;  3REH D;  2PYO A;  5F99 D;  4Z2M H;  5CPK B;  1P3M B;  4Z5T B;  3KUY B;  3W96 B;  4E44 A;  3X1S B;  3AZG D;  3X1V C;  3AYW A;  2JSS A;  5B32 B;  5B0Z A;  5AY8 D;  2Y2M A;  3KXB C;  3MGQ C;  3AZI C;  3REK A;  1P3P C;  4WU9 C;  2NZD A;  3AZJ A;  1KX4 D;  3AYW B;  4H9P B;  3REJ D;  5AV9 D;  4QLC D;  2F8N H;  2CV5 C;  3MGR A;  4X23 A;  2NQB C;  2HIO B;  3REK B;  1U35 D;  4M6B A;  3AV1 B;  2NZD B;  3AZJ B;  5B2I C;  3WTP A;  3X1T D;  5DNN A;  1M18 C;  2Y2P A;  5AV8 A;  4H9R A;  3NQJ A;  5B1L C;  3MVD A;  4XUJ A;  4X23 B;  3MGR B;  1P3A A;  5B31 A;  3AZF A;  1TAF A;  1BH9 A;  2UWX A;  1P3P D;  3MGQ D;  3AZI D;  2ZY3 A;  3REL D;  3LEL D;  1M19 C;  4WU9 D;  3REH A;  3WTP B;  1P3G C;  5G49 A;  3W97 A;  3R45 A;  5JA4 A;  3MGS C;  3W98 D;  4H9R B;  3MNN C;  1P3A B;  5B31 B;  3AZG A;  3VH6 T;  1P3F C;  3WKJ B;  3AZF B;  1BH9 B;  5JRG C;  1R4V A;  3LZ1 B;  3AV2 B;  2LY8 A;  2F8N A;  3LZ0 D;  5G49 B;  3W97 B;  3R45 B;  4CSR A;  1M18 D;  1P3I C;  3IP4 C;  4G91 B;  4Z66 D;  4J8X B;  1KX4 A;  1F1E A;  5B24 D;  3AZM A;  3WA9 C;  5GSU C;  5AV9 A;  5AVC B;  4AWL C;  4YS3 C;  3C1B C;  4XZQ C;  1P3K A;  3B6F A;  3AL0 C;  2F8N B;  1P3G D;  4CSR B;  3AZH D;  5KDM A;  3UTB D;  4J8W C;  2FJ7 C;  5E5A C;  5CPJ C;  3MNN D;  3AZM B;  2RIQ A;  3X1V A;  1P3F D;  1KX3 D;  2ZY5 A;  3O62 B;  5BT1 C;  2BYK A;  1P3K B;  3B6F B;  1BFM A;  4NE3 A;  1P3P A;  3KXB A;  3MGQ A;  3AZK B;  4NE6 A;  3AZE C;  3X1V B;  1P3O C;  1T3U A;  5GT0 C;  3C1C C;  2CV5 A;  3UT9 C;  4XZQ D;  2ZY4 A;  2NQB A;  1JFI A;  5BNX A;  1P3P B;  3KXB B;  3MGQ B;  1P3L C;  4LD9 B;  4J8W D;  2FJ7 D;  3AN2 D;  5B2I A;  4KHA B;  2ARO D;  5GT3 C;  4Z2M G;  1EQZ C;  4WU8 C;  1M18 A;  1P34 C;  3TU4 B;  5B2J D;  2CV5 B;  5B31 G;  5B1L A;  2NQB B;  3H0M C;  3A6N B;  2W8S A;  1JFI B;  5BNX B;  3AV1 A;  3KFU G;  4H9S C;  4G92 B;  2Y2N A;  4WZS B;  4J8V A;  1M19 A;  3NQU A;  5DNM D;  3W99 B;  3AZE D;  1B6W A;  5B2I B;  3LJA D;  1P3G A;  2ZY2 A;  4ZUX B;  3MGS A;  2Y2L A;  1WWI A;  5B1L B;  4ZBJ C;  5FUG B;  5AY8 C;  1Z2C B; 
#chains in the Genus database with same CATH homology
 5JRG A;  4J8V B;  2F8N G;  1M19 B;  3REJ C;  4QLC C;  1TZY D;  5CP6 C;  3MGS B;  2DQN C;  5AV6 C;  4KGC C;  1EQZ D;  3X1U D;  4WU8 D;  1P34 D;  4UPK A;  1P3I A;  3AZL D;  1U35 C;  5B33 D;  3WA9 A;  5GSU A;  5AV5 D;  5JRG B;  1M1A C;  4CAY B;  4YS3 A;  3C1B A;  4NE5 A;  3X1T C;  1P3B D;  4DRA A;  2PYO B;  5CPI C;  2FJ7 A;  5E5A A;  1P3I B;  1ZLA C;  5CPJ A;  5AVB D;  5B1M D;  1P3F A;  3REL C;  3WA9 B;  5GSU B;  3LEL C;  1Q9C A;  4R8P C;  4AWL B;  3C1B B;  4YS3 B;  2F8N K;  4YM6 A;  3W98 C;  3EPK A;  2XD5 A;  5CP6 D;  4H9Q A;  5AV6 D;  4KGC D;  5B0Z B;  5E5A B;  1HQ3 D;  5CPJ B;  3KWQ D;  3AZN C;  5BO0 A;  2Y2K A;  1P3O A;  5GT0 A;  3C1C A;  1M1A D;  3LZ0 C;  4YM6 B;  3UT9 A;  2Y2G A;  5GXQ C;  4Z66 C;  1P3L A;  5B24 C;  5CPI D;  1ZLA D;  5BO0 B;  1P3O B;  4KUD C;  4HGA C;  5GT3 A;  5GT0 B;  3C1C B;  1EQZ A;  4WU8 A;  2YFV A;  5F99 A;  4R8P D;  3AFA D;  3UT9 B;  3AZH C;  5DNN B;  5AV8 B;  3UTB C;  3NQJ B;  3MVD B;  4XUJ B;  1P3L B;  3MGP D;  5B40 D;  1KX3 C;  1TAF B;  3AZN D;  1ID3 D;  1F66 C;  4JJN D;  5GT3 B;  1AOI C;  3REH B;  5F99 B;  5JA4 B;  5AY8 A;  3B0C T;  5GXQ D;  5C3I B;  3A1K A;  3AZG B;  1KX5 C;  5B32 G;  3REJ A;  4QLC A;  3VH5 W;  3REI D;  1S32 C;  5CP6 A;  4KUD D;  5AV6 A;  4KGC A;  4ZBJ B;  4E45 A;  5AY8 B;  2YFW A;  5CPK C;  3WAA D;  1U35 A;  3KUY C;  4WJ3 C;  3AN2 C;  1M1A A;  2Y2I A;  1KX4 B;  3REJ B;  5AV9 B;  2ARO C;  4QLC B;  3X1T A;  1F66 D;  5B2J C;  5CP6 B;  3B6G D;  4DQY B;  4KGC B;  1AOI D;  5CPI A;  2BG1 A;  3WTP E;  5KDM B;  1U35 B;  3AZI A;  2G5H C;  3REL A;  3LEL A;  5DNM C;  3B0B A;  4WU9 A;  4UUZ A;  3LJA C;  4R8P A;  1KX5 D;  3AYW C;  3X1T B;  3W98 A;  2BYK B;  3EG5 B;  1S32 D;  3UTA C;  3AZN A;  5CPK D;  2HIO C;  3AZI B;  3REL B;  1P3M D;  4Z5T D;  3KUY D;  3LEL B;  2L5A A;  3W96 D;  1TZY C;  4WU9 B;  4UUZ B;  5B0Y C;  3X1S D;  3LZ0 A;  5BNV A;  3W98 B;  3X1U C;  5GXQ A;  3AZL C;  4Z66 A;  5B33 C;  3KSY A;  5B24 A;  5AV5 C;  1ULY A;  4KUD A;  3LZ0 B;  1P3B C;  3AYW D;  3AZH A;  1M18 B;  3UTB A;  1P3A C;  4Z66 B;  5AVB C;  5B1M C;  3MNN A;  5B24 B;  3UTA D;  3WKJ C;  1KX3 A;  1F66 A;  2HIO D;  3REK D;  3VH6 W;  3NQU B;  3LZ1 C;  1AOI A;  2NZD D;  3AZJ D;  3AV2 C;  5B0Y D;  1P3G B;  3AZH B;  3UTB B;  1HQ3 C;  3KWQ C;  3MNN B;  3MGR D;  4X23 D;  4J8X C;  1KX5 A;  1P3F B;  1KX3 B;  1F66 B;  5AVC C;  1S32 A;  4XZQ A;  5BS7 C;  3WTP D;  1N1J A;  5CPK A;  3KUY A;  4J8W A;  1P3A D;  3AN2 A;  5B31 D;  3A1I A;  1PZR A;  3WKJ D;  2ARO A;  3AZF D;  3O62 C;  2IO5 C;  2JCH A;  3VH5 A;  5B2J A;  3AFA C;  4XZQ B;  3B6F C;  1B67 A;  3LZ1 D;  3AV2 D;  1N1J B;  3W97 D;  4J8W B;  2FJ7 B;  3MGP C;  4H9O A;  5B40 C;  3AZK C;  3EPJ A;  5DNM A;  3AN2 B;  1ID3 C;  3AZE A;  3LJA A;  4J8X D;  4JJN C;  2ARO B;  2RVQ C;  4H9P A;  5B2J B;  5AVC D;  1HTA A;  2F8N D;  3UTA A;  1WWS A;  4H9Q B;  4LD9 C;  2HIO A;  4EO5 C;  3FDD A;  4H9O B;  5DNM B;  1TZY A;  3AZE B;  1H3O A;  5B0Y A;  3LJA B;  3REI C;  3AZM D;  3F6T A;  3O62 D;  3X1U A;  3P5J B;  3TU4 C;  1P34 A;  1P3K D;  3B6F D;  3WAA C;  3AZL A;  3A6N C;  3UTA B;  5B33 A;  2HUE C;  3B0D C;  5AV5 A;  4G92 C;  4H9S A;  3AZK D;  1TZY B;  1H3O B;  5B0Y B;  3W99 C;  1P3B A;  3B6G C;  3X1V D;  2FFF B;  2RVQ D;  4ZUX C;  1EQZ B;  4WU8 B;  2YFV B;  3X1U B;  1P34 B;  3AZL B;  5AVB A;  5B1M A;  5B33 B;  5AV5 B;  3AV1 C;  3WKJ A;  3EPL A;  3KXB D;  4J8U C;  4LD9 D;  4J8V C;  1BH8 A;  3LZ1 A;  3AV2 A;  2J8P A;  1P3B B;  2DF4 C;  1W2E A;  3TU4 D;  1HQ3 A;  2CV5 D;  3KWQ A;  5AVB B;  5B1M B;  1P3M C;  4J8X A;  2NQB D;  4Z5T C;  5CHL B;  3A6N D;  3W96 C;  3X1S C;  5AVC A;  1BH8 B;  3VH6 A;  5BS7 A;  5B32 C;  3W99 D;  5B2I D;  2VQR A;  5AV6 B;  4ZUX D;  2PYO C;  1HQ3 B;  3KWQ B;  4WNN A;  2YFW B;  5B1L D;  1ZLA A;  1KU5 A;  2G5I C;  3AV1 D;  2Y2H A;  3O62 A;  1M1A B;  4J8U D;  2BYM A;  3AFA A;  4J8V D;  1M19 D;  2XD1 A;  3MGS D;  5B0Z C;  5CPI B;  3MGP A;  3AZK A;  4WNN B;  5B40 A;  1ZLA B;  1ID3 A;  4JJN A;  3REK C;  3H0L C;  2NZD C;  3AZJ C;  2IO5 B;  5JRG D;  4R8P B;  2BYM B;  3AFA B;  4YM6 C;  5B32 D;  3MGR C;  4X23 C;  4LD9 A;  2PYO D;  4WV4 B;  3MGP B;  5B40 B;  1P3I D;  3AZN B;  2ZM5 A;  1ID3 B;  4JJN B;  3EPH A;  3REI A;  4KHA A;  3WA9 D;  5GSU D;  3WTP C;  3TU4 A;  2JE5 A;  4YS3 D;  3C1B D;  5BNV B;  5DNN C;  3WAA A;  3A6N A;  5AV8 C;  5GXQ B;  3V9R A;  2CWE A;  4XUJ C;  3MVD C;  2Y2J A;  5B31 C;  4EO5 B;  5B0Z D;  5E5A D;  3AZF C;  5CPJ D;  2Y2Q A;  4NFT A;  3W99 A;  4H9N A;  1A7W A;  3REI B;  3B6G A;  4KUD B;  4HGA B;  3REH C;  4ZUX A;  5BT1 D;  4DRB A;  5F99 C;  4YM6 D;  5FUG A;  3W97 C;  3WAA B;  2HUE B;  2F2A C;  3B0D B;  3V9R B;  5C3I C;  4G91 C;  3H0R C;  4J8U A;  3AZG C;  3B0C W;  4H9N B;  3B6G B;  1P3O D;  2Y2O A;  1AOI B;  5GT0 D;  3C1C D;  3UT9 D;  5DNN D;  1P3M A;  4Z5T A;  5AV8 D;  3W96 A;  3VH5 T;  3X1S A;  4XUJ D;  3MVD D;  4J8U B;  1P3L D;  1KX4 C;  4CAY A;  3AZM C;  1KX5 B;  5AV9 C;  5B32 A;  1S32 B;  1P3K C;  5GT3 D;  3REH D;  2PYO A;  5F99 D;  4Z2M H;  5CPK B;  1P3M B;  4Z5T B;  3KUY B;  3W96 B;  4E44 A;  3X1S B;  3AZG D;  3X1V C;  3AYW A;  2JSS A;  5B32 B;  5B0Z A;  5AY8 D;  2Y2M A;  3KXB C;  3MGQ C;  3AZI C;  3REK A;  1P3P C;  4WU9 C;  2NZD A;  3AZJ A;  1KX4 D;  3AYW B;  4H9P B;  3REJ D;  5AV9 D;  4QLC D;  2F8N H;  2CV5 C;  3MGR A;  4X23 A;  2NQB C;  2HIO B;  3REK B;  1U35 D;  4M6B A;  3AV1 B;  2NZD B;  3AZJ B;  5B2I C;  3WTP A;  3X1T D;  5DNN A;  1M18 C;  2Y2P A;  5AV8 A;  4H9R A;  3NQJ A;  5B1L C;  3MVD A;  4XUJ A;  4X23 B;  3MGR B;  1P3A A;  5B31 A;  3AZF A;  1TAF A;  1BH9 A;  2UWX A;  1P3P D;  3MGQ D;  3AZI D;  2ZY3 A;  3REL D;  3LEL D;  1M19 C;  4WU9 D;  3REH A;  3WTP B;  1P3G C;  5G49 A;  3W97 A;  3R45 A;  5JA4 A;  3MGS C;  3W98 D;  4H9R B;  3MNN C;  1P3A B;  5B31 B;  3AZG A;  3VH6 T;  1P3F C;  3WKJ B;  3AZF B;  1BH9 B;  5JRG C;  1R4V A;  3LZ1 B;  3AV2 B;  2LY8 A;  2F8N A;  3LZ0 D;  5G49 B;  3W97 B;  3R45 B;  4CSR A;  1M18 D;  1P3I C;  3IP4 C;  4G91 B;  4Z66 D;  4J8X B;  1KX4 A;  1F1E A;  5B24 D;  3AZM A;  3WA9 C;  5GSU C;  5AV9 A;  5AVC B;  4AWL C;  4YS3 C;  3C1B C;  4XZQ C;  1P3K A;  3B6F A;  3AL0 C;  2F8N B;  1P3G D;  4CSR B;  3AZH D;  5KDM A;  3UTB D;  4J8W C;  2FJ7 C;  5E5A C;  5CPJ C;  3MNN D;  3AZM B;  2RIQ A;  3X1V A;  1P3F D;  1KX3 D;  2ZY5 A;  3O62 B;  5BT1 C;  2BYK A;  1P3K B;  3B6F B;  1BFM A;  4NE3 A;  1P3P A;  3KXB A;  3MGQ A;  3AZK B;  4NE6 A;  3AZE C;  3X1V B;  1P3O C;  1T3U A;  5GT0 C;  3C1C C;  2CV5 A;  3UT9 C;  4XZQ D;  2ZY4 A;  2NQB A;  1JFI A;  5BNX A;  1P3P B;  3KXB B;  3MGQ B;  1P3L C;  4LD9 B;  4J8W D;  2FJ7 D;  3AN2 D;  5B2I A;  4KHA B;  2ARO D;  5GT3 C;  4Z2M G;  1EQZ C;  4WU8 C;  1M18 A;  1P34 C;  3TU4 B;  5B2J D;  2CV5 B;  5B31 G;  5B1L A;  2NQB B;  3H0M C;  3A6N B;  2W8S A;  1JFI B;  5BNX B;  3AV1 A;  3KFU G;  4H9S C;  4G92 B;  2Y2N A;  4WZS B;  4J8V A;  1M19 A;  3NQU A;  5DNM D;  3W99 B;  3AZE D;  1B6W A;  5B2I B;  3LJA D;  1P3G A;  2ZY2 A;  4ZUX B;  3MGS A;  2Y2L A;  1WWI A;  5B1L B;  4ZBJ C;  5FUG B;  5AY8 C;  1Z2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...