3AZKB

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLQVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkB00
5AV6D 4J8UC 4G91B 3TU4D 5AV8B 2NZDD 2PYOB 3AZID 3KWQC 3MGQC 3R45B 3WTPC 1P3GB 4XZQB 3REKA 4YS3B 3X1TA 3KWQA 4G92C 2NQBC 3WAAC 3X1VC 3AYWB 2F8NB 2AROC 3X1UA 1P3BA 1F66B 4J8WB 3AZHB 1A7WA 5BNVA 3AZGA 3NQJA 4H9RA 4H9SC 4Z2MG 1WWIA 4JJNC 5DNMC 5AV9A 5AV5C 5JA4B 1S32A 3W98B 4WU8B 1H3OA 5AVBC 4KUDA 2BYKB 3X1TD 5C3IC 3KWQD 5GT3C 3UTBA 5B0YB 3MGRA 3UTAB 1M19B 3X1UD 1P3BD 5B1MB 3B6FC 3NQUA 3MGSB 3AZGD 1U35C 5CPKA 4J8VB 5CPJA 5AV9D 5BT1C 5GT3A 1KX5C 1S32D 2BYMA 1TZYA 1ZLAB 4H9PA 5B32B 3MGPC 4KUDD 3MVDC 5CPIC 4LD9B 4YM6C 3WKJC 1N1JA 3UTBD 3MGRD 4WZSB 4H9OB 2HUEB 1P3LB 3AZMC 1HQ3C 4Z66B 3LZ0B 5CPKD 2HIOC 5GSUB 3REIA 3WA9B 3B6GA 4HGAB 4ZUXC 2JSSA 3W97A 3VH6A 5CPJD 5GT3D 1EQZB 1M1AC 1TZYD 1P3KA 3REJB 5B40C 3A6NC 2BYKA 3AV1A 1JFIA 5E5AC 3AZMA 1P3FB 1AOIC 3LZ1A 3C1BC 3RELA 3UT9A 3AZNB 2FJ7B 5BS7A 5AV6B 3A6NA 3TU4B 2NZDB 3REID 2IO5C 3AZIB 3B6GD 4CAYA 3C1BA 3W97D 5DNNC 3LJAC 5B31G 1P3KD 2YFVB 3AV1D 3REHC 3AZMD 5GXQC 5FUGB 3LZ1D 3RELD 3UT9D 4H9OA 4CSRA 1KX4C 5CP6A 3AZFA 1KU5A 4J8XC 5F99C 3A6ND 3C1CA 4ZBJC 3AZEA 2RVQC 3C1BD 1P3PC 1M18C 4X23A 5BO0A 3O62A 5B31C 3KUYC 5B24A 3X1TB 3KWQB 3AV2C 5CP6D 5AVCA 4XUJC 3AZFD 3C1CD 3KXBA 3X1UB 1P3BB 5B33C 3AZED 4H9QA 5BNVB 3AZGB 3NQJB 4H9RB 3MNNA 4WU9C 4X23D 5AV9B 1S32B 3O62D 2L5AA 5B24D 3AZKA 2F8NH 1H3OB 5GT0A 4KUDB 3VH5A 3AZJC 3X1SC 5AVCD 3UTBB 2F8NK 3MGRB 5JRGA 1P3MA 3KXBD 3NQUB 5B1LC 4Z5TC 3MNND 4M6BA 5CPKB 5CPJB 3LELC 5GT3B 4J8UA 2BYMB 1TZYB 3AZKD 4H9PB 4QLCC 3KSYA 5GT0D 3MGQA 5B1LA 1ULYA 3WTPA 1N1JB 1F1EA 5JRGD 1P3MD 1ID3C 3W99C 3WTPE 4EO5C 4KHAA 2NQBA 3W96C 3WAAA 3AFAC 3REIB 5B0ZC 3X1VA 2CV5C 3B6GB 3B0CW 1KX3C 3AN2C 1P34C 3W97B 4KGCC 4J8UD 2AROA 4H9NA 5AY8C 1BFMA 1P3KB 3AV1B 1JFIB 3AZMB 3MGQD 4H9SA 5B1LD 3LZ1B 4JJNA 5DNMA 3RELB 5AV5A 3WTPD 4DRAA 4AWLC 3LELD 3UT9B 1P3OC 4KGCA 5AY8A 5AVBA 4UUZA 3A6NB 2NQBD 1P3AC 2F8NG 3WAAD 3X1VD 4CAYB 3B0DB 4R8PC 3C1BB 4G91C 2AROD 3B6FA 5AV8C 2PYOC 3W99D 1U35A 4JJND 5DNMD 5AV5D 1KX5A 1KX3D 1HTAA 4CSRB 4KGCD 5CP6B 3AZFB 1P3GC 5AY8D 4XZQC 5AVBD 3MGPA 3C1CB 3MVDA 3AZEB 5CPIA 4YM6A 3WKJA 1P3IC 1F66C 4X23B 4J8WC 3B6FD 1HQ3A 5BO0B 3O62B 5B24B 1U35D 2HIOA 4ZUXA 5BT1D 1KX5D 5B32G 1M1AA 3W98C 1BH8A 5BNXA 5AVCB 5B40A 5E5AA 3MGPD 4WNNA 3VH6W 3KXBB 3MVDD 1AOIA 5G49A 4H9QB 5CPID 4YM6D 3WKJD 5B0YC 3MNNB 3UTAC 1M19C 5B1MC 3MGSC 1HQ3D 1B6WA 3AZKB 2HIOD 5GT0B 4J8VC 4ZUXD 5DNNA 3LJAA 1M1AD 1ZLAC 1P3ID 5B40D 3REHA 5B32C 5E5AD 5JRGB 1P3MB 4E45A 5GXQA 1AOID 2YFWA 4WV4B 4LD9C 1KX4A 2HUEC 1P3LC 4J8XA 3AZLC 5F99A 4Z66C 4J8UB 3LZ0C 3WA9C 5GSUC 4HGAC 1P3PA 3VH6T 3MGQB 5DNND 3LJAD 1M18A 1EQZC 5B1LB 5B2IC 3REJC 3WTPB 3LELB 3REHD 5B31A 3KUYA 3AZLA 1P3FC 5GXQD 4KHAB 4G92B 2NQBB 4E44A 3WAAB 3AV2A 3AZNC 1KX4D 3X1VB 2FJ7C 4XUJA 4J8XD 5AV6C 5F99D 2AROB 4H9NB 3TU4C 5B33A 2NZDC 2RVQD 3AZIC 3W99B 2LY8A 4Z2MH 1P3PD 4WU9A 1M18D 4JJNB 5DNMB 5AV5B 1KX3B 5B31D 3KUYD 3AZLD 4KGCB 4NE5A 5AY8B 5AVBB 4UUZB 5C3IB 3AZJA 1BH9A 3AV2D 3X1SA 4XUJD 5B2ID 3VH5W 3B6FB 5B33D 1U35B 4Z5TA 4WU9D 1WWSA 3LELA 1KX5B 4QLCA 3REKC 3MGPB 3X1TC 3MVDB 3AZJD 5KDMA 3X1SD 5CPIB 4YM6B 3WKJB 1ID3A 3X1UC 1P3BC 5B2JC 3W99A 1HQ3B 3AZGC 1TAFB 3W96A 3V9RA 3AFAA 2HIOB 4Z5TD 5B0ZA 2CV5A 4ZUXB 5AV9C 3AN2A 1P34A 1KX3A 1S32C 1M1AB 1BH8B 1P3IB 5BNXB 4QLCD 5B40B 5B2JA 5E5AB 4KUDC 4WNNB 3VH5T 1AOIB 5G49B 3UTBC 3MGRC 1P3OA 1ID3D 3REKD 1P3AA 3W96D 5CPKC 3AFAD 5B0ZD 2CV5D 2IO5B 5CPJC 4R8PA 3AN2D 1P34D 5DNNB 3LJAB 3B0CT 1TZYC 5AV8A 4YS3C 2PYOA 5B2JD 3REHB 5GXQB 3R45A 2YFWB 3AYWC 1Q9CA 1P3OD 1KX4B 3AZHC 4DRBA 1P3GA 4XZQA 4J8XB 1TAFA 5F99B 4YS3A 1P3AD 4ZBJB 3REIC 3B6GC 3W97C 4R8PD 3AYWA 1P3PB 2F8NA 4WU8C 1M18B 1P3IA 1F66A 4J8WA 1P3KC 5AV8D 3AZHA 3AV1C 2PYOD 5B31B 3KUYB 3AZLB 3LZ1C 3RELC 1R4VA 5JA4A 3UT9C 3AV2B 3W98A 4WU8A 4XUJB 5B2IB 1P3GD 4XZQD 5BS7C 4YS3D 5B33B 3B0DC 3AYWD 2F8ND 5B0YA 4WU9B 3UTAA 1M19A 1F66D 5B1MA 4J8WD 3MGSA 3AZHD 4J8VA 4NE6A 3AZJB 1BH9B 3W98D 3X1SB 5CP6C 4WU8D 1ZLAA 3AZFC 5B32A 3C1CC 3AZEC 1B67A 4LD9A 5B0YD 4Z5TB 3UTAD 4X23C 1P3LA 5CHLB 5B1MD 1M19D 3MGSD 4Z66A 3O62C 3LZ0A 5B24C 4QLCB 5GSUA 3WA9A 4J8VD 1EQZA 5KDMB 5B2IA 1ZLAD 5AVCC 3REJA 5B32D 4NFTA 1P3FA 3KXBC 1ID3B 4EO5B 4LD9D 3REKB 3W96B 3MNNC 3V9RB 3AFAB 3AZNA 5B0ZB 2CWEA 2CV5B 2FJ7A 1P3LD 3AN2B 1P34B 5AV6A 4Z66D 3LZ0D 3TU4A 3AZKC 2NZDA 3WA9D 5GSUD 5GT0C 5B2JB 3AZIA 1EQZD 4NE3A 3B0BA 2YFVA 3REJD 4AWLB 1P3OB 5JRGC 1P3MC 1P3FD 5FUGA 1P3AB 3AZND 2FJ7D 4R8PB
chains in the Genus database with same CATH superfamily
5AV6D 4J8UC 4G91B 3TU4D 2Y2OA 5AV8B 2NZDD 2PYOB 3AZID 3KWQC 3MGQC 3R45B 3WTPC 1P3GB 4XZQB 2G5IC 3REKA 4YS3B 3X1TA 3KWQA 4G92C 2NQBC 3WAAC 3X1VC 3AYWB 2F8NB 2AROC 3X1UA 1P3BA 1F66B 4J8WB 3AZHB 1A7WA 5BNVA 3AZGA 3NQJA 4H9RA 4H9SC 4Z2MG 1WWIA 4JJNC 5DNMC 5AV9A 5AV5C 5JA4B 1S32A 3W98B 4WU8B 1H3OA 5AVBC 4KUDA 2BYKB 3X1TD 5C3IC 3KWQD 2VQRA 5GT3C 3UTBA 5B0YB 3MGRA 3UTAB 1M19B 3X1UD 1P3BD 5B1MB 3B6FC 3NQUA 2F2AC 3MGSB 3AZGD 1U35C 5CPKA 4J8VB 5CPJA 5AV9D 5BT1C 5GT3A 1KX5C 1S32D 2BYMA 1TZYA 1ZLAB 4H9PA 5B32B 3MGPC 4KUDD 3MVDC 1PZRA 5CPIC 4LD9B 4YM6C 3WKJC 2DQNC 1N1JA 3UTBD 3MGRD 4WZSB 4H9OB 2HUEB 1P3LB 3AZMC 1HQ3C 4Z66B 3LZ0B 5CPKD 2HIOC 5GSUB 3REIA 3WA9B 3B6GA 4HGAB 4ZUXC 2JSSA 3W97A 3VH6A 5CPJD 5GT3D 3IP4C 1M1AC 1EQZB 1TZYD 1P3KA 3REJB 5B40C 3A6NC 2BYKA 3AV1A 1JFIA 5E5AC 3AZMA 1P3FB 1AOIC 3LZ1A 3C1BC 3RELA 3EPJA 3UT9A 3AZNB 2FJ7B 1Z2CB 5BS7A 5AV6B 3A6NA 2XD1A 3TU4B 2NZDB 3REID 2IO5C 3AZIB 3B6GD 4CAYA 3C1BA 3W97D 5DNNC 3LJAC 5B31G 2G5HC 1P3KD 2YFVB 3AV1D 3REHC 3AZMD 5GXQC 5FUGB 2Y2IA 3LZ1D 3H0RC 3RELD 3UT9D 4H9OA 4CSRA 1KX4C 5CP6A 3AZFA 1KU5A 4J8XC 5F99C 3A6ND 3C1CA 4ZBJC 3AZEA 2RVQC 3KFUG 3C1BD 1P3PC 1M18C 4X23A 5BO0A 3O62A 5B31C 3KUYC 3H0MC 5B24A 2Y2GA 3X1TB 3KWQB 2BG1A 3AV2C 5CP6D 5AVCA 4XUJC 3AZFD 3C1CD 3KXBA 3X1UB 1P3BB 2ZY4A 5B33C 3AZED 4H9QA 5BNVB 3AZGB 3NQJB 4H9RB 3MNNA 4WU9C 4X23D 5AV9B 2DF4C 4WJ3C 1S32B 3O62D 2L5AA 5B24D 3AZKA 2F8NH 1H3OB 5GT0A 4KUDB 3VH5A 3AZJC 3X1SC 2W8SA 5AVCD 3UTBB 2F8NK 3MGRB 5JRGA 1P3MA 3KXBD 2RIQA 3NQUB 5B1LC 4Z5TC 3MNND 4M6BA 5CPKB 5CPJB 3LELC 2J8PA 5GT3B 4J8UA 2BYMB 1TZYB 3AZKD 4H9PB 4QLCC 3KSYA 5GT0D 3MGQA 2XD5A 5B1LA 1ULYA 3WTPA 1N1JB 1F1EA 5JRGD 1P3MD 1ID3C 3W99C 3WTPE 4EO5C 4KHAA 2NQBA 3W96C 3WAAA 3AFAC 3REIB 2JCHA 5B0ZC 3X1VA 2CV5C 3B6GB 3B0CW 1KX3C 3AN2C 1P34C 3W97B 4KGCC 4J8UD 2AROA 4H9NA 5AY8C 1BFMA 3A1IA 3AV1B 1P3KB 1JFIB 3AZMB 3MGQD 4H9SA 5B1LD 3LZ1B 4JJNA 5DNMA 3RELB 5AV5A 3WTPD 4DRAA 4AWLC 3LELD 3UT9B 1P3OC 4KGCA 5AY8A 5AVBA 4UUZA 3A6NB 2NQBD 1P3AC 2F8NG 3WAAD 3X1VD 4CAYB 3B0DB 4R8PC 3C1BB 3A1KA 2AROD 4G91C 2Y2MA 3B6FA 5AV8C 2PYOC 3W99D 4DQYB 1U35A 2ZY5A 4JJND 5DNMD 5AV5D 1KX5A 1KX3D 2Y2NA 1HTAA 4CSRB 4KGCD 5CP6B 3AZFB 1P3GC 5AY8D 4XZQC 5AVBD 3MGPA 3C1CB 3MVDA 3AZEB 5CPIA 4YM6A 3WKJA 1P3IC 1F66C 4X23B 4J8WC 3B6FD 1HQ3A 5BO0B 3O62B 5B24B 1U35D 2HIOA 4ZUXA 5BT1D 1KX5D 5B32G 1M1AA 3W98C 1BH8A 5BNXA 5AVCB 5B40A 5E5AA 3MGPD 4WNNA 3VH6W 3KXBB 3MVDD 1AOIA 2Y2JA 5G49A 4H9QB 5CPID 4YM6D 3WKJD 5B0YC 3MNNB 3UTAC 1M19C 5B1MC 3MGSC 1HQ3D 2Y2QA 1B6WA 3AZKB 2HIOD 5GT0B 3FDDA 4J8VC 4ZUXD 5DNNA 3LJAA 2Y2HA 1M1AD 1ZLAC 1P3ID 5B40D 3REHA 5B32C 5E5AD 5JRGB 1P3MB 4E45A 2ZY2A 5GXQA 1AOID 2YFWA 4WV4B 4LD9C 1KX4A 2HUEC 1P3LC 4J8XA 3AZLC 5F99A 4Z66C 2ZY3A 4J8UB 3LZ0C 3WA9C 5GSUC 4HGAC 1P3PA 3VH6T 3MGQB 5DNND 3LJAD 1M18A 1EQZC 5B1LB 3EPLA 5B2IC 3H0LC 3REJC 3WTPB 3LELB 3REHD 5B31A 3KUYA 3AZLA 1P3FC 5GXQD 4KHAB 4G92B 2NQBB 4E44A 3WAAB 3AV2A 3AZNC 1KX4D 3X1VB 2FJ7C 4XUJA 4J8XD 5AV6C 5F99D 2AROB 4H9NB 3TU4C 5B33A 2NZDC 2RVQD 3AZIC 3W99B 2LY8A 4Z2MH 1P3PD 4WU9A 1M18D 4JJNB 5DNMB 5AV5B 1KX3B 5B31D 3KUYD 3AZLD 4KGCB 4NE5A 5AY8B 5AVBB 4UUZB 5C3IB 3AZJA 1BH9A 3AV2D 3X1SA 4XUJD 5B2ID 3VH5W 3B6FB 5B33D 1U35B 4Z5TA 4WU9D 2JE5A 1WWSA 3LELA 1KX5B 2Y2KA 3EG5B 4QLCA 3REKC 3MGPB 3X1TC 3MVDB 3AZJD 5KDMA 3X1SD 5CPIB 4UPKA 4YM6B 3WKJB 1ID3A 3X1UC 1P3BC 5B2JC 3EPKA 3W99A 1HQ3B 3AZGC 1TAFB 3W96A 3V9RA 3AFAA 2HIOB 4Z5TD 5B0ZA 2CV5A 3EPHA 4ZUXB 5AV9C 3AN2A 1P34A 1KX3A 1S32C 1M1AB 1BH8B 1P3IB 5BNXB 4QLCD 5B40B 5B2JA 5E5AB 4KUDC 4WNNB 3VH5T 1AOIB 1W2EA 5G49B 3UTBC 3MGRC 1P3OA 1ID3D 3REKD 1P3AA 3W96D 2ZM5A 3AFAD 5CPKC 5B0ZD 2CV5D 2IO5B 5CPJC 4R8PA 3AN2D 1P34D 5DNNB 3LJAB 3B0CT 1TZYC 5AV8A 4YS3C 2PYOA 5B2JD 3REHB 5GXQB 3R45A 2YFWB 1T3UA 3AYWC 1Q9CA 1P3OD 1KX4B 3AZHC 4DRBA 1P3GA 4XZQA 4J8XB 1TAFA 5F99B 4YS3A 3AL0C 1P3AD 4ZBJB 3REIC 3B6GC 3W97C 4R8PD 3AYWA 1P3PB 2F8NA 4WU8C 1M18B 1P3IA 1F66A 4J8WA 1P3KC 5AV8D 3AZHA 3AV1C 2PYOD 5B31B 3KUYB 3AZLB 3LZ1C 3RELC 1R4VA 5JA4A 3UT9C 3AV2B 3W98A 4WU8A 4XUJB 5B2IB 1P3GD 3F6TA 5BS7C 4XZQD 4YS3D 5B33B 3B0DC 3AYWD 2F8ND 5B0YA 4WU9B 3UTAA 1M19A 1F66D 5B1MA 4J8WD 3MGSA 3AZHD 4J8VA 4NE6A 3AZJB 1BH9B 2FFFB 3W98D 3X1SB 5CP6C 4WU8D 1ZLAA 3AZFC 5B32A 3C1CC 3AZEC 1B67A 4LD9A 5B0YD 4Z5TB 3UTAD 4X23C 1P3LA 5CHLB 5B1MD 1M19D 3MGSD 4Z66A 3O62C 3LZ0A 5B24C 4QLCB 5GSUA 3WA9A 2Y2LA 4J8VD 1EQZA 5KDMB 5B2IA 1ZLAD 5AVCC 3REJA 5B32D 4NFTA 1P3FA 2Y2PA 3KXBC 1ID3B 4EO5B 4LD9D 3REKB 3W96B 3MNNC 3V9RB 3AFAB 3AZNA 5B0ZB 2CWEA 2CV5B 2FJ7A 1P3LD 3AN2B 1P34B 5AV6A 4Z66D 3LZ0D 3TU4A 3AZKC 2NZDA 3WA9D 5GSUD 5GT0C 5B2JB 3AZIA 2UWXA 1EQZD 4NE3A 3B0BA 2YFVA 3REJD 4AWLB 1P3OB 5JRGC 1P3MC 1P3FD 5FUGA 1P3AB 3AZND 2FJ7D 4R8PB 3P5JB
chains in the Genus database with same CATH topology
5AV6D 4J8UC 4G91B 3TU4D 2Y2OA 5AV8B 2NZDD 2PYOB 3AZID 3KWQC 3MGQC 3R45B 3WTPC 1P3GB 4XZQB 2G5IC 3REKA 4YS3B 3X1TA 3KWQA 4G92C 2NQBC 3WAAC 3X1VC 3AYWB 2F8NB 2AROC 3X1UA 1P3BA 1F66B 4J8WB 3AZHB 1A7WA 5BNVA 3AZGA 3NQJA 4H9RA 4H9SC 4Z2MG 1WWIA 4JJNC 5DNMC 5AV9A 5AV5C 5JA4B 1S32A 3W98B 4WU8B 1H3OA 5AVBC 4KUDA 2BYKB 3X1TD 5C3IC 3KWQD 2VQRA 5GT3C 3UTBA 5B0YB 3MGRA 3UTAB 1M19B 3X1UD 1P3BD 5B1MB 3B6FC 3NQUA 2F2AC 3MGSB 3AZGD 1U35C 5CPKA 4J8VB 5CPJA 5AV9D 5BT1C 5GT3A 1KX5C 1S32D 2BYMA 1TZYA 1ZLAB 4H9PA 5B32B 3MGPC 4KUDD 3MVDC 1PZRA 5CPIC 4LD9B 4YM6C 3WKJC 2DQNC 1N1JA 3UTBD 3MGRD 4WZSB 4H9OB 2HUEB 1P3LB 3AZMC 1HQ3C 4Z66B 3LZ0B 5CPKD 2HIOC 5GSUB 3REIA 3WA9B 3B6GA 4HGAB 4ZUXC 2JSSA 3W97A 3VH6A 5CPJD 5GT3D 3IP4C 1M1AC 1EQZB 1TZYD 1P3KA 3REJB 5B40C 3A6NC 2BYKA 3AV1A 1JFIA 5E5AC 3AZMA 1P3FB 1AOIC 3LZ1A 3C1BC 3RELA 3EPJA 3UT9A 3AZNB 2FJ7B 1Z2CB 5BS7A 5AV6B 3A6NA 2XD1A 3TU4B 2NZDB 3REID 2IO5C 3AZIB 3B6GD 4CAYA 3C1BA 3W97D 5DNNC 3LJAC 5B31G 2G5HC 1P3KD 2YFVB 3AV1D 3REHC 3AZMD 5GXQC 5FUGB 2Y2IA 3LZ1D 3H0RC 3RELD 3UT9D 4H9OA 4CSRA 1KX4C 5CP6A 3AZFA 1KU5A 4J8XC 5F99C 3A6ND 3C1CA 4ZBJC 3AZEA 2RVQC 3KFUG 3C1BD 1P3PC 1M18C 4X23A 5BO0A 3O62A 5B31C 3KUYC 3H0MC 5B24A 2Y2GA 3X1TB 3KWQB 2BG1A 3AV2C 5CP6D 5AVCA 4XUJC 3AZFD 3C1CD 3KXBA 3X1UB 1P3BB 2ZY4A 5B33C 3AZED 4H9QA 5BNVB 3AZGB 3NQJB 4H9RB 3MNNA 4WU9C 4X23D 5AV9B 2DF4C 4WJ3C 1S32B 3O62D 2L5AA 5B24D 3AZKA 2F8NH 1H3OB 5GT0A 4KUDB 3VH5A 3AZJC 3X1SC 2W8SA 5AVCD 3UTBB 2F8NK 3MGRB 5JRGA 1P3MA 3KXBD 2RIQA 3NQUB 5B1LC 4Z5TC 3MNND 4M6BA 5CPKB 5CPJB 3LELC 2J8PA 5GT3B 4J8UA 2BYMB 1TZYB 3AZKD 4H9PB 4QLCC 3KSYA 5GT0D 3MGQA 2XD5A 5B1LA 1ULYA 3WTPA 1N1JB 1F1EA 5JRGD 1P3MD 1ID3C 3W99C 3WTPE 4EO5C 4KHAA 2NQBA 3W96C 3WAAA 3AFAC 3REIB 2JCHA 5B0ZC 3X1VA 2CV5C 3B6GB 3B0CW 1KX3C 3AN2C 1P34C 3W97B 4KGCC 4J8UD 2AROA 4H9NA 5AY8C 1BFMA 3A1IA 3AV1B 1P3KB 1JFIB 3AZMB 3MGQD 4H9SA 5B1LD 3LZ1B 4JJNA 5DNMA 3RELB 5AV5A 3WTPD 4DRAA 4AWLC 3LELD 3UT9B 1P3OC 4KGCA 5AY8A 5AVBA 4UUZA 3A6NB 2NQBD 1P3AC 2F8NG 3WAAD 3X1VD 4CAYB 3B0DB 4R8PC 3C1BB 3A1KA 2AROD 4G91C 2Y2MA 3B6FA 5AV8C 2PYOC 3W99D 4DQYB 1U35A 2ZY5A 4JJND 5DNMD 5AV5D 1KX5A 1KX3D 2Y2NA 1HTAA 4CSRB 4KGCD 5CP6B 3AZFB 1P3GC 5AY8D 4XZQC 5AVBD 3MGPA 3C1CB 3MVDA 3AZEB 5CPIA 4YM6A 3WKJA 1P3IC 1F66C 4X23B 4J8WC 3B6FD 1HQ3A 5BO0B 3O62B 5B24B 1U35D 2HIOA 4ZUXA 5BT1D 1KX5D 5B32G 1M1AA 3W98C 1BH8A 5BNXA 5AVCB 5B40A 5E5AA 3MGPD 4WNNA 3VH6W 3KXBB 3MVDD 1AOIA 2Y2JA 5G49A 4H9QB 5CPID 4YM6D 3WKJD 5B0YC 3MNNB 3UTAC 1M19C 5B1MC 3MGSC 1HQ3D 2Y2QA 1B6WA 3AZKB 2HIOD 5GT0B 3FDDA 4J8VC 4ZUXD 5DNNA 3LJAA 2Y2HA 1M1AD 1ZLAC 1P3ID 5B40D 3REHA 5B32C 5E5AD 5JRGB 1P3MB 4E45A 2ZY2A 5GXQA 1AOID 2YFWA 4WV4B 4LD9C 1KX4A 2HUEC 1P3LC 4J8XA 3AZLC 5F99A 4Z66C 2ZY3A 4J8UB 3LZ0C 3WA9C 5GSUC 4HGAC 1P3PA 3VH6T 3MGQB 5DNND 3LJAD 1M18A 1EQZC 5B1LB 3EPLA 5B2IC 3H0LC 3REJC 3WTPB 3LELB 3REHD 5B31A 3KUYA 3AZLA 1P3FC 5GXQD 4KHAB 4G92B 2NQBB 4E44A 3WAAB 3AV2A 3AZNC 1KX4D 3X1VB 2FJ7C 4XUJA 4J8XD 5AV6C 5F99D 2AROB 4H9NB 3TU4C 5B33A 2NZDC 2RVQD 3AZIC 3W99B 2LY8A 4Z2MH 1P3PD 4WU9A 1M18D 4JJNB 5DNMB 5AV5B 1KX3B 5B31D 3KUYD 3AZLD 4KGCB 4NE5A 5AY8B 5AVBB 4UUZB 5C3IB 3AZJA 1BH9A 3AV2D 3X1SA 4XUJD 5B2ID 3VH5W 3B6FB 5B33D 1U35B 4Z5TA 4WU9D 2JE5A 1WWSA 3LELA 1KX5B 2Y2KA 3EG5B 4QLCA 3REKC 3MGPB 3X1TC 3MVDB 3AZJD 5KDMA 3X1SD 5CPIB 4UPKA 4YM6B 3WKJB 1ID3A 3X1UC 1P3BC 5B2JC 3EPKA 3W99A 1HQ3B 3AZGC 1TAFB 3W96A 3V9RA 3AFAA 2HIOB 4Z5TD 5B0ZA 2CV5A 3EPHA 4ZUXB 5AV9C 3AN2A 1P34A 1KX3A 1S32C 1M1AB 1BH8B 1P3IB 5BNXB 4QLCD 5B40B 5B2JA 5E5AB 4KUDC 4WNNB 3VH5T 1AOIB 1W2EA 5G49B 3UTBC 3MGRC 1P3OA 1ID3D 3REKD 1P3AA 3W96D 2ZM5A 3AFAD 5CPKC 5B0ZD 2CV5D 2IO5B 5CPJC 4R8PA 3AN2D 1P34D 5DNNB 3LJAB 3B0CT 1TZYC 5AV8A 4YS3C 2PYOA 5B2JD 3REHB 5GXQB 3R45A 2YFWB 1T3UA 3AYWC 1Q9CA 1P3OD 1KX4B 3AZHC 4DRBA 1P3GA 4XZQA 4J8XB 1TAFA 5F99B 4YS3A 3AL0C 1P3AD 4ZBJB 3REIC 3B6GC 3W97C 4R8PD 3AYWA 1P3PB 2F8NA 4WU8C 1M18B 1P3IA 1F66A 4J8WA 1P3KC 5AV8D 3AZHA 3AV1C 2PYOD 5B31B 3KUYB 3AZLB 3LZ1C 3RELC 1R4VA 5JA4A 3UT9C 3AV2B 3W98A 4WU8A 4XUJB 5B2IB 1P3GD 3F6TA 5BS7C 4XZQD 4YS3D 5B33B 3B0DC 3AYWD 2F8ND 5B0YA 4WU9B 3UTAA 1M19A 1F66D 5B1MA 4J8WD 3MGSA 3AZHD 4J8VA 4NE6A 3AZJB 1BH9B 2FFFB 3W98D 3X1SB 5CP6C 4WU8D 1ZLAA 3AZFC 5B32A 3C1CC 3AZEC 1B67A 4LD9A 5B0YD 4Z5TB 3UTAD 4X23C 1P3LA 5CHLB 5B1MD 1M19D 3MGSD 4Z66A 3O62C 3LZ0A 5B24C 4QLCB 5GSUA 3WA9A 2Y2LA 4J8VD 1EQZA 5KDMB 5B2IA 1ZLAD 5AVCC 3REJA 5B32D 4NFTA 1P3FA 2Y2PA 3KXBC 1ID3B 4EO5B 4LD9D 3REKB 3W96B 3MNNC 3V9RB 3AFAB 3AZNA 5B0ZB 2CWEA 2CV5B 2FJ7A 1P3LD 3AN2B 1P34B 5AV6A 4Z66D 3LZ0D 3TU4A 3AZKC 2NZDA 3WA9D 5GSUD 5GT0C 5B2JB 3AZIA 2UWXA 1EQZD 4NE3A 3B0BA 2YFVA 3REJD 4AWLB 1P3OB 5JRGC 1P3MC 1P3FD 5FUGA 1P3AB 3AZND 2FJ7D 4R8PB 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 D;  4J8U C;  4G91 B;  3TU4 D;  5AV8 B;  2NZD D;  2PYO B;  3AZI D;  3KWQ C;  3MGQ C;  3R45 B;  3WTP C;  1P3G B;  4XZQ B;  3REK A;  4YS3 B;  3X1T A;  3KWQ A;  4G92 C;  2NQB C;  3WAA C;  3X1V C;  3AYW B;  2F8N B;  2ARO C;  3X1U A;  1P3B A;  1F66 B;  4J8W B;  3AZH B;  1A7W A;  5BNV A;  3AZG A;  3NQJ A;  4H9R A;  4H9S C;  4Z2M G;  1WWI A;  4JJN C;  5DNM C;  5AV9 A;  5AV5 C;  5JA4 B;  1S32 A;  3W98 B;  4WU8 B;  1H3O A;  5AVB C;  4KUD A;  2BYK B;  3X1T D;  5C3I C;  3KWQ D;  5GT3 C;  3UTB A;  5B0Y B;  3MGR A;  3UTA B;  1M19 B;  3X1U D;  1P3B D;  5B1M B;  3B6F C;  3NQU A;  3MGS B;  3AZG D;  1U35 C;  5CPK A;  4J8V B;  5CPJ A;  5AV9 D;  5BT1 C;  5GT3 A;  1KX5 C;  1S32 D;  2BYM A;  1TZY A;  1ZLA B;  4H9P A;  5B32 B;  3MGP C;  4KUD D;  3MVD C;  5CPI C;  4LD9 B;  4YM6 C;  3WKJ C;  1N1J A;  3UTB D;  3MGR D;  4WZS B;  4H9O B;  2HUE B;  1P3L B;  3AZM C;  1HQ3 C;  4Z66 B;  3LZ0 B;  5CPK D;  2HIO C;  5GSU B;  3REI A;  3WA9 B;  3B6G A;  4HGA B;  4ZUX C;  2JSS A;  3W97 A;  3VH6 A;  5CPJ D;  5GT3 D;  1EQZ B;  1M1A C;  1TZY D;  1P3K A;  3REJ B;  5B40 C;  3A6N C;  2BYK A;  3AV1 A;  1JFI A;  5E5A C;  3AZM A;  1P3F B;  1AOI C;  3LZ1 A;  3C1B C;  3REL A;  3UT9 A;  3AZN B;  2FJ7 B;  5BS7 A;  5AV6 B;  3A6N A;  3TU4 B;  2NZD B;  3REI D;  2IO5 C;  3AZI B;  3B6G D;  4CAY A;  3C1B A;  3W97 D;  5DNN C;  3LJA C;  5B31 G;  1P3K D;  2YFV B;  3AV1 D;  3REH C;  3AZM D;  5GXQ C;  5FUG B;  3LZ1 D;  3REL D;  3UT9 D;  4H9O A;  4CSR A;  1KX4 C;  5CP6 A;  3AZF A;  1KU5 A;  4J8X C;  5F99 C;  3A6N D;  3C1C A;  4ZBJ C;  3AZE A;  2RVQ C;  3C1B D;  1P3P C;  1M18 C;  4X23 A;  5BO0 A;  3O62 A;  5B31 C;  3KUY C;  5B24 A;  3X1T B;  3KWQ B;  3AV2 C;  5CP6 D;  5AVC A;  4XUJ C;  3AZF D;  3C1C D;  3KXB A;  3X1U B;  1P3B B;  5B33 C;  3AZE D;  4H9Q A;  5BNV B;  3AZG B;  3NQJ B;  4H9R B;  3MNN A;  4WU9 C;  4X23 D;  5AV9 B;  1S32 B;  3O62 D;  2L5A A;  5B24 D;  3AZK A;  2F8N H;  1H3O B;  5GT0 A;  4KUD B;  3VH5 A;  3AZJ C;  3X1S C;  5AVC D;  3UTB B;  2F8N K;  3MGR B;  5JRG A;  1P3M A;  3KXB D;  3NQU B;  5B1L C;  4Z5T C;  3MNN D;  4M6B A;  5CPK B;  5CPJ B;  3LEL C;  5GT3 B;  4J8U A;  2BYM B;  1TZY B;  3AZK D;  4H9P B;  4QLC C;  3KSY A;  5GT0 D;  3MGQ A;  5B1L A;  1ULY A;  3WTP A;  1N1J B;  1F1E A;  5JRG D;  1P3M D;  1ID3 C;  3W99 C;  3WTP E;  4EO5 C;  4KHA A;  2NQB A;  3W96 C;  3WAA A;  3AFA C;  3REI B;  5B0Z C;  3X1V A;  2CV5 C;  3B6G B;  3B0C W;  1KX3 C;  3AN2 C;  1P34 C;  3W97 B;  4KGC C;  4J8U D;  2ARO A;  4H9N A;  5AY8 C;  1BFM A;  1P3K B;  3AV1 B;  1JFI B;  3AZM B;  3MGQ D;  4H9S A;  5B1L D;  3LZ1 B;  4JJN A;  5DNM A;  3REL B;  5AV5 A;  3WTP D;  4DRA A;  4AWL C;  3LEL D;  3UT9 B;  1P3O C;  4KGC A;  5AY8 A;  5AVB A;  4UUZ A;  3A6N B;  2NQB D;  1P3A C;  2F8N G;  3WAA D;  3X1V D;  4CAY B;  3B0D B;  4R8P C;  3C1B B;  4G91 C;  2ARO D;  3B6F A;  5AV8 C;  2PYO C;  3W99 D;  1U35 A;  4JJN D;  5DNM D;  5AV5 D;  1KX5 A;  1KX3 D;  1HTA A;  4CSR B;  4KGC D;  5CP6 B;  3AZF B;  1P3G C;  5AY8 D;  4XZQ C;  5AVB D;  3MGP A;  3C1C B;  3MVD A;  3AZE B;  5CPI A;  4YM6 A;  3WKJ A;  1P3I C;  1F66 C;  4X23 B;  4J8W C;  3B6F D;  1HQ3 A;  5BO0 B;  3O62 B;  5B24 B;  1U35 D;  2HIO A;  4ZUX A;  5BT1 D;  1KX5 D;  5B32 G;  1M1A A;  3W98 C;  1BH8 A;  5BNX A;  5AVC B;  5B40 A;  5E5A A;  3MGP D;  4WNN A;  3VH6 W;  3KXB B;  3MVD D;  1AOI A;  5G49 A;  4H9Q B;  5CPI D;  4YM6 D;  3WKJ D;  5B0Y C;  3MNN B;  3UTA C;  1M19 C;  5B1M C;  3MGS C;  1HQ3 D;  1B6W A;  3AZK B;  2HIO D;  5GT0 B;  4J8V C;  4ZUX D;  5DNN A;  3LJA A;  1M1A D;  1ZLA C;  1P3I D;  5B40 D;  3REH A;  5B32 C;  5E5A D;  5JRG B;  1P3M B;  4E45 A;  5GXQ A;  1AOI D;  2YFW A;  4WV4 B;  4LD9 C;  1KX4 A;  2HUE C;  1P3L C;  4J8X A;  3AZL C;  5F99 A;  4Z66 C;  4J8U B;  3LZ0 C;  3WA9 C;  5GSU C;  4HGA C;  1P3P A;  3VH6 T;  3MGQ B;  5DNN D;  3LJA D;  1M18 A;  1EQZ C;  5B1L B;  5B2I C;  3REJ C;  3WTP B;  3LEL B;  3REH D;  5B31 A;  3KUY A;  3AZL A;  1P3F C;  5GXQ D;  4KHA B;  4G92 B;  2NQB B;  4E44 A;  3WAA B;  3AV2 A;  3AZN C;  1KX4 D;  3X1V B;  2FJ7 C;  4XUJ A;  4J8X D;  5AV6 C;  5F99 D;  2ARO B;  4H9N B;  3TU4 C;  5B33 A;  2NZD C;  2RVQ D;  3AZI C;  3W99 B;  2LY8 A;  4Z2M H;  1P3P D;  4WU9 A;  1M18 D;  4JJN B;  5DNM B;  5AV5 B;  1KX3 B;  5B31 D;  3KUY D;  3AZL D;  4KGC B;  4NE5 A;  5AY8 B;  5AVB B;  4UUZ B;  5C3I B;  3AZJ A;  1BH9 A;  3AV2 D;  3X1S A;  4XUJ D;  5B2I D;  3VH5 W;  3B6F B;  5B33 D;  1U35 B;  4Z5T A;  4WU9 D;  1WWS A;  3LEL A;  1KX5 B;  4QLC A;  3REK C;  3MGP B;  3X1T C;  3MVD B;  3AZJ D;  5KDM A;  3X1S D;  5CPI B;  4YM6 B;  3WKJ B;  1ID3 A;  3X1U C;  1P3B C;  5B2J C;  3W99 A;  1HQ3 B;  3AZG C;  1TAF B;  3W96 A;  3V9R A;  3AFA A;  2HIO B;  4Z5T D;  5B0Z A;  2CV5 A;  4ZUX B;  5AV9 C;  3AN2 A;  1P34 A;  1KX3 A;  1S32 C;  1M1A B;  1BH8 B;  1P3I B;  5BNX B;  4QLC D;  5B40 B;  5B2J A;  5E5A B;  4KUD C;  4WNN B;  3VH5 T;  1AOI B;  5G49 B;  3UTB C;  3MGR C;  1P3O A;  1ID3 D;  3REK D;  1P3A A;  3W96 D;  5CPK C;  3AFA D;  5B0Z D;  2CV5 D;  2IO5 B;  5CPJ C;  4R8P A;  3AN2 D;  1P34 D;  5DNN B;  3LJA B;  3B0C T;  1TZY C;  5AV8 A;  4YS3 C;  2PYO A;  5B2J D;  3REH B;  5GXQ B;  3R45 A;  2YFW B;  3AYW C;  1Q9C A;  1P3O D;  1KX4 B;  3AZH C;  4DRB A;  1P3G A;  4XZQ A;  4J8X B;  1TAF A;  5F99 B;  4YS3 A;  1P3A D;  4ZBJ B;  3REI C;  3B6G C;  3W97 C;  4R8P D;  3AYW A;  1P3P B;  2F8N A;  4WU8 C;  1M18 B;  1P3I A;  1F66 A;  4J8W A;  1P3K C;  5AV8 D;  3AZH A;  3AV1 C;  2PYO D;  5B31 B;  3KUY B;  3AZL B;  3LZ1 C;  3REL C;  1R4V A;  5JA4 A;  3UT9 C;  3AV2 B;  3W98 A;  4WU8 A;  4XUJ B;  5B2I B;  1P3G D;  4XZQ D;  5BS7 C;  4YS3 D;  5B33 B;  3B0D C;  3AYW D;  2F8N D;  5B0Y A;  4WU9 B;  3UTA A;  1M19 A;  1F66 D;  5B1M A;  4J8W D;  3MGS A;  3AZH D;  4J8V A;  4NE6 A;  3AZJ B;  1BH9 B;  3W98 D;  3X1S B;  5CP6 C;  4WU8 D;  1ZLA A;  3AZF C;  5B32 A;  3C1C C;  3AZE C;  1B67 A;  4LD9 A;  5B0Y D;  4Z5T B;  3UTA D;  4X23 C;  1P3L A;  5CHL B;  5B1M D;  1M19 D;  3MGS D;  4Z66 A;  3O62 C;  3LZ0 A;  5B24 C;  4QLC B;  5GSU A;  3WA9 A;  4J8V D;  1EQZ A;  5KDM B;  5B2I A;  1ZLA D;  5AVC C;  3REJ A;  5B32 D;  4NFT A;  1P3F A;  3KXB C;  1ID3 B;  4EO5 B;  4LD9 D;  3REK B;  3W96 B;  3MNN C;  3V9R B;  3AFA B;  3AZN A;  5B0Z B;  2CWE A;  2CV5 B;  2FJ7 A;  1P3L D;  3AN2 B;  1P34 B;  5AV6 A;  4Z66 D;  3LZ0 D;  3TU4 A;  3AZK C;  2NZD A;  3WA9 D;  5GSU D;  5GT0 C;  5B2J B;  3AZI A;  1EQZ D;  4NE3 A;  3B0B A;  2YFV A;  3REJ D;  4AWL B;  1P3O B;  5JRG C;  1P3M C;  1P3F D;  5FUG A;  1P3A B;  3AZN D;  2FJ7 D;  4R8P B; 
#chains in the Genus database with same CATH topology
 5AV6 D;  4J8U C;  4G91 B;  3TU4 D;  2Y2O A;  5AV8 B;  2NZD D;  2PYO B;  3AZI D;  3KWQ C;  3MGQ C;  3R45 B;  3WTP C;  1P3G B;  4XZQ B;  2G5I C;  3REK A;  4YS3 B;  3X1T A;  3KWQ A;  4G92 C;  2NQB C;  3WAA C;  3X1V C;  3AYW B;  2F8N B;  2ARO C;  3X1U A;  1P3B A;  1F66 B;  4J8W B;  3AZH B;  1A7W A;  5BNV A;  3AZG A;  3NQJ A;  4H9R A;  4H9S C;  4Z2M G;  1WWI A;  4JJN C;  5DNM C;  5AV9 A;  5AV5 C;  5JA4 B;  1S32 A;  3W98 B;  4WU8 B;  1H3O A;  5AVB C;  4KUD A;  2BYK B;  3X1T D;  5C3I C;  3KWQ D;  2VQR A;  5GT3 C;  3UTB A;  5B0Y B;  3MGR A;  3UTA B;  1M19 B;  3X1U D;  1P3B D;  5B1M B;  3B6F C;  3NQU A;  2F2A C;  3MGS B;  3AZG D;  1U35 C;  5CPK A;  4J8V B;  5CPJ A;  5AV9 D;  5BT1 C;  5GT3 A;  1KX5 C;  1S32 D;  2BYM A;  1TZY A;  1ZLA B;  4H9P A;  5B32 B;  3MGP C;  4KUD D;  3MVD C;  1PZR A;  5CPI C;  4LD9 B;  4YM6 C;  3WKJ C;  2DQN C;  1N1J A;  3UTB D;  3MGR D;  4WZS B;  4H9O B;  2HUE B;  1P3L B;  3AZM C;  1HQ3 C;  4Z66 B;  3LZ0 B;  5CPK D;  2HIO C;  5GSU B;  3REI A;  3WA9 B;  3B6G A;  4HGA B;  4ZUX C;  2JSS A;  3W97 A;  3VH6 A;  5CPJ D;  5GT3 D;  3IP4 C;  1M1A C;  1EQZ B;  1TZY D;  1P3K A;  3REJ B;  5B40 C;  3A6N C;  2BYK A;  3AV1 A;  1JFI A;  5E5A C;  3AZM A;  1P3F B;  1AOI C;  3LZ1 A;  3C1B C;  3REL A;  3EPJ A;  3UT9 A;  3AZN B;  2FJ7 B;  1Z2C B;  5BS7 A;  5AV6 B;  3A6N A;  2XD1 A;  3TU4 B;  2NZD B;  3REI D;  2IO5 C;  3AZI B;  3B6G D;  4CAY A;  3C1B A;  3W97 D;  5DNN C;  3LJA C;  5B31 G;  2G5H C;  1P3K D;  2YFV B;  3AV1 D;  3REH C;  3AZM D;  5GXQ C;  5FUG B;  2Y2I A;  3LZ1 D;  3H0R C;  3REL D;  3UT9 D;  4H9O A;  4CSR A;  1KX4 C;  5CP6 A;  3AZF A;  1KU5 A;  4J8X C;  5F99 C;  3A6N D;  3C1C A;  4ZBJ C;  3AZE A;  2RVQ C;  3KFU G;  3C1B D;  1P3P C;  1M18 C;  4X23 A;  5BO0 A;  3O62 A;  5B31 C;  3KUY C;  3H0M C;  5B24 A;  2Y2G A;  3X1T B;  3KWQ B;  2BG1 A;  3AV2 C;  5CP6 D;  5AVC A;  4XUJ C;  3AZF D;  3C1C D;  3KXB A;  3X1U B;  1P3B B;  2ZY4 A;  5B33 C;  3AZE D;  4H9Q A;  5BNV B;  3AZG B;  3NQJ B;  4H9R B;  3MNN A;  4WU9 C;  4X23 D;  5AV9 B;  2DF4 C;  4WJ3 C;  1S32 B;  3O62 D;  2L5A A;  5B24 D;  3AZK A;  2F8N H;  1H3O B;  5GT0 A;  4KUD B;  3VH5 A;  3AZJ C;  3X1S C;  2W8S A;  5AVC D;  3UTB B;  2F8N K;  3MGR B;  5JRG A;  1P3M A;  3KXB D;  2RIQ A;  3NQU B;  5B1L C;  4Z5T C;  3MNN D;  4M6B A;  5CPK B;  5CPJ B;  3LEL C;  2J8P A;  5GT3 B;  4J8U A;  2BYM B;  1TZY B;  3AZK D;  4H9P B;  4QLC C;  3KSY A;  5GT0 D;  3MGQ A;  2XD5 A;  5B1L A;  1ULY A;  3WTP A;  1N1J B;  1F1E A;  5JRG D;  1P3M D;  1ID3 C;  3W99 C;  3WTP E;  4EO5 C;  4KHA A;  2NQB A;  3W96 C;  3WAA A;  3AFA C;  3REI B;  2JCH A;  5B0Z C;  3X1V A;  2CV5 C;  3B6G B;  3B0C W;  1KX3 C;  3AN2 C;  1P34 C;  3W97 B;  4KGC C;  4J8U D;  2ARO A;  4H9N A;  5AY8 C;  1BFM A;  3A1I A;  3AV1 B;  1P3K B;  1JFI B;  3AZM B;  3MGQ D;  4H9S A;  5B1L D;  3LZ1 B;  4JJN A;  5DNM A;  3REL B;  5AV5 A;  3WTP D;  4DRA A;  4AWL C;  3LEL D;  3UT9 B;  1P3O C;  4KGC A;  5AY8 A;  5AVB A;  4UUZ A;  3A6N B;  2NQB D;  1P3A C;  2F8N G;  3WAA D;  3X1V D;  4CAY B;  3B0D B;  4R8P C;  3C1B B;  3A1K A;  2ARO D;  4G91 C;  2Y2M A;  3B6F A;  5AV8 C;  2PYO C;  3W99 D;  4DQY B;  1U35 A;  2ZY5 A;  4JJN D;  5DNM D;  5AV5 D;  1KX5 A;  1KX3 D;  2Y2N A;  1HTA A;  4CSR B;  4KGC D;  5CP6 B;  3AZF B;  1P3G C;  5AY8 D;  4XZQ C;  5AVB D;  3MGP A;  3C1C B;  3MVD A;  3AZE B;  5CPI A;  4YM6 A;  3WKJ A;  1P3I C;  1F66 C;  4X23 B;  4J8W C;  3B6F D;  1HQ3 A;  5BO0 B;  3O62 B;  5B24 B;  1U35 D;  2HIO A;  4ZUX A;  5BT1 D;  1KX5 D;  5B32 G;  1M1A A;  3W98 C;  1BH8 A;  5BNX A;  5AVC B;  5B40 A;  5E5A A;  3MGP D;  4WNN A;  3VH6 W;  3KXB B;  3MVD D;  1AOI A;  2Y2J A;  5G49 A;  4H9Q B;  5CPI D;  4YM6 D;  3WKJ D;  5B0Y C;  3MNN B;  3UTA C;  1M19 C;  5B1M C;  3MGS C;  1HQ3 D;  2Y2Q A;  1B6W A;  3AZK B;  2HIO D;  5GT0 B;  3FDD A;  4J8V C;  4ZUX D;  5DNN A;  3LJA A;  2Y2H A;  1M1A D;  1ZLA C;  1P3I D;  5B40 D;  3REH A;  5B32 C;  5E5A D;  5JRG B;  1P3M B;  4E45 A;  2ZY2 A;  5GXQ A;  1AOI D;  2YFW A;  4WV4 B;  4LD9 C;  1KX4 A;  2HUE C;  1P3L C;  4J8X A;  3AZL C;  5F99 A;  4Z66 C;  2ZY3 A;  4J8U B;  3LZ0 C;  3WA9 C;  5GSU C;  4HGA C;  1P3P A;  3VH6 T;  3MGQ B;  5DNN D;  3LJA D;  1M18 A;  1EQZ C;  5B1L B;  3EPL A;  5B2I C;  3H0L C;  3REJ C;  3WTP B;  3LEL B;  3REH D;  5B31 A;  3KUY A;  3AZL A;  1P3F C;  5GXQ D;  4KHA B;  4G92 B;  2NQB B;  4E44 A;  3WAA B;  3AV2 A;  3AZN C;  1KX4 D;  3X1V B;  2FJ7 C;  4XUJ A;  4J8X D;  5AV6 C;  5F99 D;  2ARO B;  4H9N B;  3TU4 C;  5B33 A;  2NZD C;  2RVQ D;  3AZI C;  3W99 B;  2LY8 A;  4Z2M H;  1P3P D;  4WU9 A;  1M18 D;  4JJN B;  5DNM B;  5AV5 B;  1KX3 B;  5B31 D;  3KUY D;  3AZL D;  4KGC B;  4NE5 A;  5AY8 B;  5AVB B;  4UUZ B;  5C3I B;  3AZJ A;  1BH9 A;  3AV2 D;  3X1S A;  4XUJ D;  5B2I D;  3VH5 W;  3B6F B;  5B33 D;  1U35 B;  4Z5T A;  4WU9 D;  2JE5 A;  1WWS A;  3LEL A;  1KX5 B;  2Y2K A;  3EG5 B;  4QLC A;  3REK C;  3MGP B;  3X1T C;  3MVD B;  3AZJ D;  5KDM A;  3X1S D;  5CPI B;  4UPK A;  4YM6 B;  3WKJ B;  1ID3 A;  3X1U C;  1P3B C;  5B2J C;  3EPK A;  3W99 A;  1HQ3 B;  3AZG C;  1TAF B;  3W96 A;  3V9R A;  3AFA A;  2HIO B;  4Z5T D;  5B0Z A;  2CV5 A;  3EPH A;  4ZUX B;  5AV9 C;  3AN2 A;  1P34 A;  1KX3 A;  1S32 C;  1M1A B;  1BH8 B;  1P3I B;  5BNX B;  4QLC D;  5B40 B;  5B2J A;  5E5A B;  4KUD C;  4WNN B;  3VH5 T;  1AOI B;  1W2E A;  5G49 B;  3UTB C;  3MGR C;  1P3O A;  1ID3 D;  3REK D;  1P3A A;  3W96 D;  2ZM5 A;  3AFA D;  5CPK C;  5B0Z D;  2CV5 D;  2IO5 B;  5CPJ C;  4R8P A;  3AN2 D;  1P34 D;  5DNN B;  3LJA B;  3B0C T;  1TZY C;  5AV8 A;  4YS3 C;  2PYO A;  5B2J D;  3REH B;  5GXQ B;  3R45 A;  2YFW B;  1T3U A;  3AYW C;  1Q9C A;  1P3O D;  1KX4 B;  3AZH C;  4DRB A;  1P3G A;  4XZQ A;  4J8X B;  1TAF A;  5F99 B;  4YS3 A;  3AL0 C;  1P3A D;  4ZBJ B;  3REI C;  3B6G C;  3W97 C;  4R8P D;  3AYW A;  1P3P B;  2F8N A;  4WU8 C;  1M18 B;  1P3I A;  1F66 A;  4J8W A;  1P3K C;  5AV8 D;  3AZH A;  3AV1 C;  2PYO D;  5B31 B;  3KUY B;  3AZL B;  3LZ1 C;  3REL C;  1R4V A;  5JA4 A;  3UT9 C;  3AV2 B;  3W98 A;  4WU8 A;  4XUJ B;  5B2I B;  1P3G D;  3F6T A;  5BS7 C;  4XZQ D;  4YS3 D;  5B33 B;  3B0D C;  3AYW D;  2F8N D;  5B0Y A;  4WU9 B;  3UTA A;  1M19 A;  1F66 D;  5B1M A;  4J8W D;  3MGS A;  3AZH D;  4J8V A;  4NE6 A;  3AZJ B;  1BH9 B;  2FFF B;  3W98 D;  3X1S B;  5CP6 C;  4WU8 D;  1ZLA A;  3AZF C;  5B32 A;  3C1C C;  3AZE C;  1B67 A;  4LD9 A;  5B0Y D;  4Z5T B;  3UTA D;  4X23 C;  1P3L A;  5CHL B;  5B1M D;  1M19 D;  3MGS D;  4Z66 A;  3O62 C;  3LZ0 A;  5B24 C;  4QLC B;  5GSU A;  3WA9 A;  2Y2L A;  4J8V D;  1EQZ A;  5KDM B;  5B2I A;  1ZLA D;  5AVC C;  3REJ A;  5B32 D;  4NFT A;  1P3F A;  2Y2P A;  3KXB C;  1ID3 B;  4EO5 B;  4LD9 D;  3REK B;  3W96 B;  3MNN C;  3V9R B;  3AFA B;  3AZN A;  5B0Z B;  2CWE A;  2CV5 B;  2FJ7 A;  1P3L D;  3AN2 B;  1P34 B;  5AV6 A;  4Z66 D;  3LZ0 D;  3TU4 A;  3AZK C;  2NZD A;  3WA9 D;  5GSU D;  5GT0 C;  5B2J B;  3AZI A;  2UWX A;  1EQZ D;  4NE3 A;  3B0B A;  2YFV A;  3REJ D;  4AWL B;  1P3O B;  5JRG C;  1P3M C;  1P3F D;  5FUG A;  1P3A B;  3AZN D;  2FJ7 D;  4R8P B;  3P5J B; 
#chains in the Genus database with same CATH homology
 5AV6 D;  4J8U C;  4G91 B;  3TU4 D;  2Y2O A;  5AV8 B;  2NZD D;  2PYO B;  3AZI D;  3KWQ C;  3MGQ C;  3R45 B;  3WTP C;  1P3G B;  4XZQ B;  2G5I C;  3REK A;  4YS3 B;  3X1T A;  3KWQ A;  4G92 C;  2NQB C;  3WAA C;  3X1V C;  3AYW B;  2F8N B;  2ARO C;  3X1U A;  1P3B A;  1F66 B;  4J8W B;  3AZH B;  1A7W A;  5BNV A;  3AZG A;  3NQJ A;  4H9R A;  4H9S C;  4Z2M G;  1WWI A;  4JJN C;  5DNM C;  5AV9 A;  5AV5 C;  5JA4 B;  1S32 A;  3W98 B;  4WU8 B;  1H3O A;  5AVB C;  4KUD A;  2BYK B;  3X1T D;  5C3I C;  3KWQ D;  2VQR A;  5GT3 C;  3UTB A;  5B0Y B;  3MGR A;  3UTA B;  1M19 B;  3X1U D;  1P3B D;  5B1M B;  3B6F C;  3NQU A;  2F2A C;  3MGS B;  3AZG D;  1U35 C;  5CPK A;  4J8V B;  5CPJ A;  5AV9 D;  5BT1 C;  5GT3 A;  1KX5 C;  1S32 D;  2BYM A;  1TZY A;  1ZLA B;  4H9P A;  5B32 B;  3MGP C;  4KUD D;  3MVD C;  1PZR A;  5CPI C;  4LD9 B;  4YM6 C;  3WKJ C;  2DQN C;  1N1J A;  3UTB D;  3MGR D;  4WZS B;  4H9O B;  2HUE B;  1P3L B;  3AZM C;  1HQ3 C;  4Z66 B;  3LZ0 B;  5CPK D;  2HIO C;  5GSU B;  3REI A;  3WA9 B;  3B6G A;  4HGA B;  4ZUX C;  2JSS A;  3W97 A;  3VH6 A;  5CPJ D;  5GT3 D;  3IP4 C;  1M1A C;  1EQZ B;  1TZY D;  1P3K A;  3REJ B;  5B40 C;  3A6N C;  2BYK A;  3AV1 A;  1JFI A;  5E5A C;  3AZM A;  1P3F B;  1AOI C;  3LZ1 A;  3C1B C;  3REL A;  3EPJ A;  3UT9 A;  3AZN B;  2FJ7 B;  1Z2C B;  5BS7 A;  5AV6 B;  3A6N A;  2XD1 A;  3TU4 B;  2NZD B;  3REI D;  2IO5 C;  3AZI B;  3B6G D;  4CAY A;  3C1B A;  3W97 D;  5DNN C;  3LJA C;  5B31 G;  2G5H C;  1P3K D;  2YFV B;  3AV1 D;  3REH C;  3AZM D;  5GXQ C;  5FUG B;  2Y2I A;  3LZ1 D;  3H0R C;  3REL D;  3UT9 D;  4H9O A;  4CSR A;  1KX4 C;  5CP6 A;  3AZF A;  1KU5 A;  4J8X C;  5F99 C;  3A6N D;  3C1C A;  4ZBJ C;  3AZE A;  2RVQ C;  3KFU G;  3C1B D;  1P3P C;  1M18 C;  4X23 A;  5BO0 A;  3O62 A;  5B31 C;  3KUY C;  3H0M C;  5B24 A;  2Y2G A;  3X1T B;  3KWQ B;  2BG1 A;  3AV2 C;  5CP6 D;  5AVC A;  4XUJ C;  3AZF D;  3C1C D;  3KXB A;  3X1U B;  1P3B B;  2ZY4 A;  5B33 C;  3AZE D;  4H9Q A;  5BNV B;  3AZG B;  3NQJ B;  4H9R B;  3MNN A;  4WU9 C;  4X23 D;  5AV9 B;  2DF4 C;  4WJ3 C;  1S32 B;  3O62 D;  2L5A A;  5B24 D;  3AZK A;  2F8N H;  1H3O B;  5GT0 A;  4KUD B;  3VH5 A;  3AZJ C;  3X1S C;  2W8S A;  5AVC D;  3UTB B;  2F8N K;  3MGR B;  5JRG A;  1P3M A;  3KXB D;  2RIQ A;  3NQU B;  5B1L C;  4Z5T C;  3MNN D;  4M6B A;  5CPK B;  5CPJ B;  3LEL C;  2J8P A;  5GT3 B;  4J8U A;  2BYM B;  1TZY B;  3AZK D;  4H9P B;  4QLC C;  3KSY A;  5GT0 D;  3MGQ A;  2XD5 A;  5B1L A;  1ULY A;  3WTP A;  1N1J B;  1F1E A;  5JRG D;  1P3M D;  1ID3 C;  3W99 C;  3WTP E;  4EO5 C;  4KHA A;  2NQB A;  3W96 C;  3WAA A;  3AFA C;  3REI B;  2JCH A;  5B0Z C;  3X1V A;  2CV5 C;  3B6G B;  3B0C W;  1KX3 C;  3AN2 C;  1P34 C;  3W97 B;  4KGC C;  4J8U D;  2ARO A;  4H9N A;  5AY8 C;  1BFM A;  3A1I A;  3AV1 B;  1P3K B;  1JFI B;  3AZM B;  3MGQ D;  4H9S A;  5B1L D;  3LZ1 B;  4JJN A;  5DNM A;  3REL B;  5AV5 A;  3WTP D;  4DRA A;  4AWL C;  3LEL D;  3UT9 B;  1P3O C;  4KGC A;  5AY8 A;  5AVB A;  4UUZ A;  3A6N B;  2NQB D;  1P3A C;  2F8N G;  3WAA D;  3X1V D;  4CAY B;  3B0D B;  4R8P C;  3C1B B;  3A1K A;  2ARO D;  4G91 C;  2Y2M A;  3B6F A;  5AV8 C;  2PYO C;  3W99 D;  4DQY B;  1U35 A;  2ZY5 A;  4JJN D;  5DNM D;  5AV5 D;  1KX5 A;  1KX3 D;  2Y2N A;  1HTA A;  4CSR B;  4KGC D;  5CP6 B;  3AZF B;  1P3G C;  5AY8 D;  4XZQ C;  5AVB D;  3MGP A;  3C1C B;  3MVD A;  3AZE B;  5CPI A;  4YM6 A;  3WKJ A;  1P3I C;  1F66 C;  4X23 B;  4J8W C;  3B6F D;  1HQ3 A;  5BO0 B;  3O62 B;  5B24 B;  1U35 D;  2HIO A;  4ZUX A;  5BT1 D;  1KX5 D;  5B32 G;  1M1A A;  3W98 C;  1BH8 A;  5BNX A;  5AVC B;  5B40 A;  5E5A A;  3MGP D;  4WNN A;  3VH6 W;  3KXB B;  3MVD D;  1AOI A;  2Y2J A;  5G49 A;  4H9Q B;  5CPI D;  4YM6 D;  3WKJ D;  5B0Y C;  3MNN B;  3UTA C;  1M19 C;  5B1M C;  3MGS C;  1HQ3 D;  2Y2Q A;  1B6W A;  3AZK B;  2HIO D;  5GT0 B;  3FDD A;  4J8V C;  4ZUX D;  5DNN A;  3LJA A;  2Y2H A;  1M1A D;  1ZLA C;  1P3I D;  5B40 D;  3REH A;  5B32 C;  5E5A D;  5JRG B;  1P3M B;  4E45 A;  2ZY2 A;  5GXQ A;  1AOI D;  2YFW A;  4WV4 B;  4LD9 C;  1KX4 A;  2HUE C;  1P3L C;  4J8X A;  3AZL C;  5F99 A;  4Z66 C;  2ZY3 A;  4J8U B;  3LZ0 C;  3WA9 C;  5GSU C;  4HGA C;  1P3P A;  3VH6 T;  3MGQ B;  5DNN D;  3LJA D;  1M18 A;  1EQZ C;  5B1L B;  3EPL A;  5B2I C;  3H0L C;  3REJ C;  3WTP B;  3LEL B;  3REH D;  5B31 A;  3KUY A;  3AZL A;  1P3F C;  5GXQ D;  4KHA B;  4G92 B;  2NQB B;  4E44 A;  3WAA B;  3AV2 A;  3AZN C;  1KX4 D;  3X1V B;  2FJ7 C;  4XUJ A;  4J8X D;  5AV6 C;  5F99 D;  2ARO B;  4H9N B;  3TU4 C;  5B33 A;  2NZD C;  2RVQ D;  3AZI C;  3W99 B;  2LY8 A;  4Z2M H;  1P3P D;  4WU9 A;  1M18 D;  4JJN B;  5DNM B;  5AV5 B;  1KX3 B;  5B31 D;  3KUY D;  3AZL D;  4KGC B;  4NE5 A;  5AY8 B;  5AVB B;  4UUZ B;  5C3I B;  3AZJ A;  1BH9 A;  3AV2 D;  3X1S A;  4XUJ D;  5B2I D;  3VH5 W;  3B6F B;  5B33 D;  1U35 B;  4Z5T A;  4WU9 D;  2JE5 A;  1WWS A;  3LEL A;  1KX5 B;  2Y2K A;  3EG5 B;  4QLC A;  3REK C;  3MGP B;  3X1T C;  3MVD B;  3AZJ D;  5KDM A;  3X1S D;  5CPI B;  4UPK A;  4YM6 B;  3WKJ B;  1ID3 A;  3X1U C;  1P3B C;  5B2J C;  3EPK A;  3W99 A;  1HQ3 B;  3AZG C;  1TAF B;  3W96 A;  3V9R A;  3AFA A;  2HIO B;  4Z5T D;  5B0Z A;  2CV5 A;  3EPH A;  4ZUX B;  5AV9 C;  3AN2 A;  1P34 A;  1KX3 A;  1S32 C;  1M1A B;  1BH8 B;  1P3I B;  5BNX B;  4QLC D;  5B40 B;  5B2J A;  5E5A B;  4KUD C;  4WNN B;  3VH5 T;  1AOI B;  1W2E A;  5G49 B;  3UTB C;  3MGR C;  1P3O A;  1ID3 D;  3REK D;  1P3A A;  3W96 D;  2ZM5 A;  3AFA D;  5CPK C;  5B0Z D;  2CV5 D;  2IO5 B;  5CPJ C;  4R8P A;  3AN2 D;  1P34 D;  5DNN B;  3LJA B;  3B0C T;  1TZY C;  5AV8 A;  4YS3 C;  2PYO A;  5B2J D;  3REH B;  5GXQ B;  3R45 A;  2YFW B;  1T3U A;  3AYW C;  1Q9C A;  1P3O D;  1KX4 B;  3AZH C;  4DRB A;  1P3G A;  4XZQ A;  4J8X B;  1TAF A;  5F99 B;  4YS3 A;  3AL0 C;  1P3A D;  4ZBJ B;  3REI C;  3B6G C;  3W97 C;  4R8P D;  3AYW A;  1P3P B;  2F8N A;  4WU8 C;  1M18 B;  1P3I A;  1F66 A;  4J8W A;  1P3K C;  5AV8 D;  3AZH A;  3AV1 C;  2PYO D;  5B31 B;  3KUY B;  3AZL B;  3LZ1 C;  3REL C;  1R4V A;  5JA4 A;  3UT9 C;  3AV2 B;  3W98 A;  4WU8 A;  4XUJ B;  5B2I B;  1P3G D;  3F6T A;  5BS7 C;  4XZQ D;  4YS3 D;  5B33 B;  3B0D C;  3AYW D;  2F8N D;  5B0Y A;  4WU9 B;  3UTA A;  1M19 A;  1F66 D;  5B1M A;  4J8W D;  3MGS A;  3AZH D;  4J8V A;  4NE6 A;  3AZJ B;  1BH9 B;  2FFF B;  3W98 D;  3X1S B;  5CP6 C;  4WU8 D;  1ZLA A;  3AZF C;  5B32 A;  3C1C C;  3AZE C;  1B67 A;  4LD9 A;  5B0Y D;  4Z5T B;  3UTA D;  4X23 C;  1P3L A;  5CHL B;  5B1M D;  1M19 D;  3MGS D;  4Z66 A;  3O62 C;  3LZ0 A;  5B24 C;  4QLC B;  5GSU A;  3WA9 A;  2Y2L A;  4J8V D;  1EQZ A;  5KDM B;  5B2I A;  1ZLA D;  5AVC C;  3REJ A;  5B32 D;  4NFT A;  1P3F A;  2Y2P A;  3KXB C;  1ID3 B;  4EO5 B;  4LD9 D;  3REK B;  3W96 B;  3MNN C;  3V9R B;  3AFA B;  3AZN A;  5B0Z B;  2CWE A;  2CV5 B;  2FJ7 A;  1P3L D;  3AN2 B;  1P34 B;  5AV6 A;  4Z66 D;  3LZ0 D;  3TU4 A;  3AZK C;  2NZD A;  3WA9 D;  5GSU D;  5GT0 C;  5B2J B;  3AZI A;  2UWX A;  1EQZ D;  4NE3 A;  3B0B A;  2YFV A;  3REJ D;  4AWL B;  1P3O B;  5JRG C;  1P3M C;  1P3F D;  5FUG A;  1P3A B;  3AZN D;  2FJ7 D;  4R8P B;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...