3AZKB

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLQVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkB00
4JJNA 4NFTA 3A6NC 3AV1B 3AV2C 1P34C 3AZKA 3AZJC 5B32G 4Z5TA 5AV5C 5GSUB 3LZ1A 5CP6A 2CV5B 4ZUXB 5CPIC 4KGCA 3AYWC 3A6ND 3UTAB 3AV2D 5AVBD 4YM6C 3AZEA 1P34D 1P3IC 5DNMC 3REHB 3W97A 3UT9A 1H3OB 1P3GA 5CPID 3RELC 4WV4B 3X1UA 3AYWD 1HQ3D 4WNNB 4YM6D 3WTPD 1KX4D 5DNMD 4LD9C 4WU8A 3W96C 3RELD 3AN2B 3TU4B 5B0YC 5AVCD 4J8VB 2PYOA 1KX3D 1F66B 4LD9D 5BNXB 3AZFC 4YS3C 3W96D 5CPJB 1P3KD 5G49B 3AFAB 1KX5C 5B0YD 1M19B 1P3BC 4KUDC 1P3FA 2RVQD 3LELB 4WU9B 3X1VA 3KUYA 2HIOA 3LZ1D 5CP6D 2NZDA 5GT0B 4KGCD 1KX5D 1AOIC 2YFWA 1P3BD 5B1LA 5B31B 4NE6A 5B0ZB 3C1BC 5AV6A 5B1MA 3VH6T 5B32C 3MGRA 1M18A 3AV1A 3O62C 5BNVB 3KSYA 3AV2B 2FJ7A 1P34B 3AZJB 1P3OB 5AV5B 2CV5A 4ZUXA 4J8WC 4WU8D 5B32D 1P3LC 5CPIB 4DRAA 3AZMC 3O62D 4YM6B 3REHA 1P3IB 5E5AC 3VH5A 3AZMD 4H9PA 4WNNA 5BS7A 5AV9C 5BO0B 4J8UC 5AV8C 1P3FD 4UUZB 3W96B 5E5AD 3W99B 1B6WA 3TU4A 5JA4B 4EO5C 5B31G 3X1SB 1F66A 5AV9D 3REKB 5BNXA 5GSUC 5AY8B 3AZFB 5CPJA 2L5AA 4YS3B 5G49A 4X23A 1M19A 3UTAC 3AV1D 1P3BB 3LELA 3MNNA 4KUDB 5GSUD 4G92B 2F8NB 3REIB 2CV5D 5CPKC 3VH5W 3UTAD 3W98C 1AOIB 4E45A 5B31A 3C1BB 2BYMA 3AN2C 1S32C 1R4VA 5BNVA 3A6NA 3O62B 3AV2A 1P34A 3AZJA 5GXQB 1ID3B 5AV5A 3WKJB 4XUJC 4J8WB 5CPIA 3LJAC 1P3LB 3AN2D 3AYWA 3AFAC 3AZMB 1S32D 3R45B 4YM6A 1P3IA 1N1JB 5DNMA 4J8VD 2F8NK 4H9SC 1F66D 4WU9C 4HGAC 5E5AB 5CPJD 3RELA 1P3MC 3B6GC 3AFAD 5AVCA 5BO0A 1KX3A 2F8NG 3X1TB 5AV9B 4J8UB 4LD9A 5AV8B 3LELD 3W96A 4WU9D 1P3KA 5GT0D 5B0YA 4EO5B 5B0ZD 5B31D 5B2JC 3AZFA 1P3OC 4YS3A 2BYKA 1BH9B 3AZGB 1KX5A 3REJC 1P3BA 4KUDA 3AZJD 5B2JD 1P3OD 5AV5D 2YFVB 5CPKB 1M1AB 4NE5A 4H9OB 3KWQC 3C1CC 1AOIA 3W98B 3REJD 3C1BA 1P3ID 2AROB 5B32A 3AZIB 5DNNC 3W99C 5B2IC 4CAYB 3O62A 1S32B 3KXBC 1HTAA 3X1SC 5GT3B 3REKC 5KDMA 5AY8C 4J8WA 4XUJB 1P3LA 4XZQC 3LJAB 3W99D 3AZMA 3R45A 3X1SD 3WTPE 4J8XC 3REKD 3MGPB 4G92C 5AY8D 5E5AA 5B24B 3REIC 3AZFD 4HGAB 5F99B 4YS3D 3B6FB 1P3MB 3B6GB 5AV9A 3VH6A 4J8UA 1EQZC 3WA9B 5AV8A 4KUDD 2F8ND 3REID 1A7WA 1ULYA 4QLCC 5GXQC 1AOID 3AZHC 1EQZD 1ID3C 5GSUA 5B2JB 3C1BD 3AZLB 3WKJC 3WAAC 3AZNC 1BH9A 5B33C 4KHAB 1Q9CA 3UTAA 4QLCD 1B67A 3REJB 5GXQD 3AZHD 1ID3D 3LZ0C 3WKJD 1H3OA 2YFVA 3WAAD 4J8WD 4WZSB 3AZND 5B33D 5CPKA 4H9OA 1P3LD 3KWQB 3C1CB 3W98A 3X1TC 4Z2MG 3VH6W 3UTBC 4G91B 4R8PB 3NQUB 5JRGC 4CAYA 5DNNB 3AN2A 5B2IB 1S32A 5C3IC 3KXBB 4J8VA 4AWLB 1P3AB 3X1TD 1P3PC 4J8UD 5AV8D 5JRGD 3MGQB 4XZQB 3AZGC 3AFAA 2NQBC 4J8XB 4H9SA 4WU9A 1WWIA 4M6BA 5GT0A 3B6GA 1ZLAC 3AZGD 1U35B 1M1AC 2JSSA 5B0ZA 1EQZB 4JJNB 2AROC 3AZIC 1F1EA 5CPKD 1ZLAD 1M1AD 3B0DC 5B40C 4Z5TB 4QLCB 3W98D 5GT3C 3AZHB 5B2JA 1P3OA 2AROD 3AZID 3WAAB 3AZNB 5B33B 3MGSC 3AZEB 4H9NB 4H9QB 3REJA 3W97B 3UT9B 5GT3D 4H9RB 1P3GB 3LZ0B 3NQJB 3MGPC 5B24C 4XUJD 5F99C 3X1UB 3B6FC 3LJAD 3MGSD 3KWQA 2IO5C 4Z66C 3NQUA 3WA9C 3UTBB 5CHLB 4DRBA 3MGPD 4UUZA 5B24D 5JRGB 5DNNA 3W99A 5F99D 5B2IA 3B6FD 5JA4A 1TZYC 1P3MD 2PYOB 3B6GD 3KXBA 3X1SA 5C3IB 4Z66D 3REKA 1P3PB 3WA9D 5AY8A 3MVDC 3AZLC 4XZQA 2NQBB 3X1VB 3KUYB 2HIOB 2F8NH 2F8NA 2NZDB 3MVDD 3REIA 3AZLD 1ZLAB 2YFWB 5B1LB 1EQZA 5B1MB 4G91C 3MGRB 1M18B 4ZBJC 4R8PC 5AVBC 2FJ7B 4QLCA 3B0DB 5B40B 3KWQD 3C1CD 4AWLC 5GXQA 1P3AC 3AZHA 1ID3A 4R8PD 3WKJA 3WAAA 3AZNA 5B33A 3MGQC 1HQ3C 3WTPC 1KX4C 3MGSB 5DNND 4H9NA 5B2ID 4H9QA 3KXBD 1N1JA 3B0CT 1P3AD 4H9RA 3LZ0A 3NQJA 5AVCC 3MGQD 1KX3C 4H9PB 4XZQD 1U35C 2IO5B 3X1TA 3UTBA 4Z66B 4J8XD 4JJNC 1P3KC 5FUGB 5JRGA 1TZYB 2RVQC 3AZKC 1U35D 4Z5TC 1P3PA 3V9RB 5CP6C 3LZ1C 2HUEC 4JJND 3MVDB 4X23B 4KGCC 1BH8B 3AZGA 3AZEC 3B0CW 3AZKD 4Z5TD 3MNNB 3W97C 3B0BA 2NQBA 3UT9C 1P3GC 4E44A 3X1UC 1ZLAA 1M1AA 3AZED 1KU5A 3W97D 4WU8C 2AROA 3UT9D 1BFMA 4ZBJB 3AZIA 2BYMB 1P3GD 3LZ0D 3A6NB 1JFIB 4NE3A 5AVBB 3X1UD 2PYOC 5B40A 5GT3A 3UTBD 4XUJA 4CSRB 3AYWB 3LJAA 3MGSA 1HQ3B 3WTPB 1KX4B 2PYOD 5DNMB 1P3FC 3X1VC 3KUYC 2HIOC 1P3PD 3MGPA 4Z2MH 3RELB 5B24A 2NZDC 5F99A 3B6FA 5AVCB 1P3MA 1KX3B 3VH5T 4LD9B 5B1LC 5AV6C 4Z66A 5B1MC 3WA9A 2NQBD 1TAFB 3MGRC 3KUYD 3X1VD 2HIOD 5FUGA 1P3KB 1M18C 2NZDD 3AV1C 5B0YB 1TZYA 2FJ7C 3AZKB 5B1LD 3V9RA 2CV5C 5AV6D 5B1MD 4ZUXC 3LZ1B 5CP6B 2HUEB 3MVDA 3MGRD 3AZLA 2BYKB 1M18D 1BH8A 4KGCB 1KX5B 4KHAA 3REHC 2FJ7D 5B40D 4ZUXD 5BS7C 3C1CA 3REHD 4WU8B 5B32B 4R8PA 3TU4C 1JFIA 5AVBA 4J8VC 2CWEA 1F66C 1P3AA 5KDMB 5CPJC 5BT1C 4CSRA 4X23C 2LY8A 3MGQA 3TU4D 1HQ3A 3WTPA 1M19C 1KX4A 1TZYD 3LELC 3MNNC 1P3FB 1WWSA 4J8XA 5GT0C 5BT1D 4X23D 1M19D 1U35A 5B0ZC 5B31C 3MNND 5AV6B 1TAFA
chains in the Genus database with same CATH superfamily
4JJNA 4NFTA 3A6NC 3AV1B 3AV2C 1P34C 3AZKA 3AZJC 5B32G 2ZY3A 4Z5TA 5AV5C 5GSUB 3LZ1A 5CP6A 2CV5B 4ZUXB 5CPIC 4KGCA 3AYWC 3A6ND 3UTAB 3AV2D 5AVBD 4YM6C 3AZEA 1P34D 1P3IC 5DNMC 3REHB 3W97A 3UT9A 1H3OB 1P3GA 5CPID 3H0LC 2BG1A 3RELC 4WV4B 3X1UA 3AYWD 3F6TA 1HQ3D 4WNNB 4YM6D 3WTPD 1KX4D 5DNMD 4LD9C 4WU8A 3W96C 3RELD 3AN2B 3TU4B 5B0YC 5AVCD 4J8VB 2PYOA 1KX3D 1F66B 4LD9D 5BNXB 3AZFC 4YS3C 3W96D 5CPJB 2DF4C 1P3KD 5G49B 3AFAB 1KX5C 5B0YD 1M19B 1P3BC 4KUDC 1P3FA 2RVQD 3LELB 4WU9B 3X1VA 3KUYA 2HIOA 3LZ1D 5CP6D 2NZDA 5GT0B 4KGCD 1KX5D 1AOIC 2YFWA 1P3BD 5B1LA 5B31B 4NE6A 5B0ZB 3C1BC 5AV6A 5B1MA 3VH6T 5B32C 3MGRA 1M18A 3EG5B 3P5JB 3AV1A 3O62C 5BNVB 3KSYA 3AV2B 2FJ7A 2G5IC 1P34B 3AZJB 1P3OB 5AV5B 2CV5A 4ZUXA 4J8WC 4WU8D 5B32D 1P3LC 5CPIB 4DRAA 3AZMC 3O62D 2Y2HA 4YM6B 3REHA 1P3IB 5E5AC 3VH5A 3AZMD 4H9PA 4WNNA 5BS7A 5AV9C 5BO0B 4J8UC 3EPHA 5AV8C 1P3FD 4UUZB 3W96B 5E5AD 3W99B 1B6WA 3TU4A 5JA4B 3EPKA 4EO5C 5B31G 3X1SB 1F66A 5AV9D 3REKB 5BNXA 5GSUC 5AY8B 3AZFB 5CPJA 2L5AA 2XD5A 4YS3B 5G49A 4X23A 1M19A 3UTAC 3AV1D 1P3BB 3LELA 3MNNA 4KUDB 5GSUD 4G92B 2F8NB 3REIB 2CV5D 5CPKC 3VH5W 3UTAD 3W98C 1AOIB 4E45A 5B31A 3C1BB 2BYMA 3AN2C 1S32C 1R4VA 5BNVA 3A6NA 3O62B 3AV2A 1P34A 3AZJA 5GXQB 1ID3B 5AV5A 3WKJB 2ZY2A 4XUJC 4J8WB 5CPIA 3LJAC 2F2AC 1P3LB 2J8PA 3AN2D 3AYWA 3AFAC 3AZMB 3H0RC 1S32D 3R45B 4YM6A 1P3IA 1N1JB 5DNMA 4J8VD 2F8NK 4H9SC 1F66D 4WU9C 4HGAC 5E5AB 5CPJD 3RELA 1P3MC 3B6GC 3AFAD 5AVCA 5BO0A 1KX3A 2F8NG 3X1TB 5AV9B 4J8UB 4LD9A 5AV8B 3LELD 3W96A 4WU9D 2Y2LA 1P3KA 5GT0D 5B0YA 4EO5B 5B0ZD 5B31D 5B2JC 3AZFA 1P3OC 4YS3A 2BYKA 1BH9B 3AZGB 2ZY5A 1KX5A 3REJC 1P3BA 4KUDA 3AZJD 2DQNC 5B2JD 5AV5D 1P3OD 2YFVB 5CPKB 1M1AB 2Y2JA 4NE5A 4H9OB 3KWQC 3C1CC 1AOIA 3W98B 3REJD 3C1BA 1P3ID 2AROB 5B32A 3AZIB 5DNNC 3W99C 5B2IC 4CAYB 3O62A 1S32B 3KXBC 1HTAA 3X1SC 5GT3B 3REKC 4WJ3C 5KDMA 5AY8C 4J8WA 4XUJB 1P3LA 4XZQC 3LJAB 3W99D 3AZMA 3R45A 3EPLA 3X1SD 3WTPE 4J8XC 3REKD 2XD1A 3MGPB 4G92C 5AY8D 5E5AA 5B24B 3REIC 3FDDA 4HGAB 5F99B 4YS3D 3AZFD 3B6FB 1P3MB 3B6GB 5AV9A 3VH6A 4J8UA 1EQZC 3WA9B 5AV8A 4KUDD 2F8ND 3REID 1A7WA 1ULYA 4QLCC 2G5HC 2JE5A 5GXQC 4DQYB 3AZHC 1AOID 1ID3C 1EQZD 5GSUA 5B2JB 3C1BD 3AZLB 3WKJC 3WAAC 3AZNC 1BH9A 5B33C 4KHAB 1Q9CA 3UTAA 4QLCD 1B67A 3REJB 5GXQD 3AZHD 1ID3D 3LZ0C 3WKJD 1H3OA 2JCHA 2YFVA 3WAAD 4J8WD 4WZSB 3AZND 5B33D 5CPKA 4H9OA 4UPKA 1P3LD 3KWQB 3C1CB 3W98A 3X1TC 4Z2MG 3VH6W 3UTBC 4G91B 3NQUB 4R8PB 5JRGC 4CAYA 5DNNB 3AN2A 5B2IB 1S32A 3H0MC 5C3IC 3KXBB 4J8VA 4AWLB 3EPJA 1P3AB 3X1TD 1P3PC 4J8UD 5AV8D 5JRGD 3MGQB 4XZQB 3AZGC 3AFAA 2NQBC 4J8XB 4H9SA 4WU9A 1WWIA 4M6BA 5GT0A 2Y2MA 3B6GA 1ZLAC 3AZGD 1U35B 1M1AC 2JSSA 5B0ZA 1EQZB 4JJNB 2AROC 2UWXA 3AZIC 1F1EA 5CPKD 1T3UA 1M1AD 1ZLAD 3B0DC 5B40C 4Z5TB 4QLCB 3W98D 5GT3C 3AZHB 5B2JA 1P3OA 2AROD 3AZID 3WAAB 3AZNB 3A1KA 5B33B 3MGSC 3AZEB 4H9NB 4H9QB 3REJA 3W97B 3UT9B 3AL0C 5GT3D 4H9RB 1P3GB 3LZ0B 3NQJB 3MGPC 5B24C 4XUJD 5F99C 3X1UB 3B6FC 3LJAD 3MGSD 3KWQA 2IO5C 4Z66C 1PZRA 3NQUA 3WA9C 3UTBB 5CHLB 4DRBA 3MGPD 4UUZA 5B24D 5JRGB 5DNNA 3W99A 5F99D 5B2IA 3B6FD 5JA4A 1TZYC 1P3MD 2PYOB 3B6GD 3KXBA 3X1SA 5C3IB 2VQRA 4Z66D 3REKA 1P3PB 3WA9D 5AY8A 3MVDC 3AZLC 2Y2IA 4XZQA 2NQBB 3A1IA 3X1VB 3KUYB 2HIOB 2F8NH 2F8NA 2NZDB 3MVDD 2FFFB 3REIA 3AZLD 1ZLAB 2YFWB 5B1LB 1EQZA 5B1MB 2RIQA 4G91C 3MGRB 1M18B 4ZBJC 4R8PC 5AVBC 2FJ7B 4QLCA 3B0DB 5B40B 3KWQD 3C1CD 4AWLC 5GXQA 1P3AC 3AZHA 1ID3A 4R8PD 3WKJA 3WAAA 3AZNA 5B33A 2Y2GA 3MGQC 1HQ3C 3WTPC 1KX4C 3MGSB 5DNND 4H9NA 5B2ID 4H9QA 3KXBD 1N1JA 3B0CT 1P3AD 4H9RA 3LZ0A 3NQJA 3KFUG 5AVCC 3MGQD 1KX3C 4H9PB 4XZQD 1U35C 2IO5B 3X1TA 3UTBA 4Z66B 4J8XD 4JJNC 1P3KC 2ZM5A 5FUGB 5JRGA 1TZYB 2RVQC 3AZKC 1U35D 4Z5TC 1P3PA 3V9RB 5CP6C 3LZ1C 2HUEC 4JJND 3MVDB 4X23B 4KGCC 1BH8B 1W2EA 3AZGA 3AZEC 3B0CW 3AZKD 2Y2PA 4Z5TD 3MNNB 3W97C 3B0BA 1Z2CB 2NQBA 2Y2NA 3UT9C 1P3GC 4E44A 2ZY4A 3X1UC 1ZLAA 1M1AA 3AZED 1KU5A 3W97D 4WU8C 2W8SA 2AROA 3UT9D 1BFMA 4ZBJB 3AZIA 2BYMB 1P3GD 3LZ0D 3A6NB 1JFIB 4NE3A 5AVBB 3X1UD 2PYOC 5B40A 5GT3A 3IP4C 3UTBD 4XUJA 4CSRB 3AYWB 3LJAA 3MGSA 1HQ3B 3WTPB 1KX4B 2PYOD 5DNMB 1P3FC 3X1VC 3KUYC 2HIOC 1P3PD 3MGPA 4Z2MH 3RELB 5B24A 2Y2OA 2NZDC 5F99A 3B6FA 5AVCB 1P3MA 1KX3B 3VH5T 4LD9B 5B1LC 5AV6C 5B1MC 4Z66A 3WA9A 2NQBD 1TAFB 3MGRC 3KUYD 3X1VD 2HIOD 5FUGA 1P3KB 1M18C 2NZDD 3AV1C 5B0YB 1TZYA 2FJ7C 3AZKB 5B1LD 3V9RA 2CV5C 5AV6D 5B1MD 4ZUXC 3LZ1B 5CP6B 2HUEB 3MVDA 3MGRD 3AZLA 2BYKB 1M18D 1BH8A 4KGCB 1KX5B 4KHAA 3REHC 2FJ7D 5B40D 2Y2KA 2Y2QA 4ZUXD 5BS7C 3C1CA 3REHD 4WU8B 5B32B 4R8PA 3TU4C 1JFIA 5AVBA 4J8VC 2CWEA 1F66C 1P3AA 5KDMB 5CPJC 5BT1C 4CSRA 4X23C 2LY8A 3MGQA 3TU4D 1HQ3A 3WTPA 1M19C 1KX4A 1TZYD 3LELC 3MNNC 1P3FB 1WWSA 4J8XA 5GT0C 5BT1D 4X23D 1M19D 1U35A 5B0ZC 5B31C 3MNND 5AV6B 1TAFA
chains in the Genus database with same CATH topology
4JJNA 4NFTA 3A6NC 3AV1B 3AV2C 1P34C 3AZKA 3AZJC 5B32G 2ZY3A 4Z5TA 5AV5C 5GSUB 3LZ1A 5CP6A 2CV5B 4ZUXB 5CPIC 4KGCA 3AYWC 3A6ND 3UTAB 3AV2D 5AVBD 4YM6C 3AZEA 1P34D 1P3IC 5DNMC 3REHB 3W97A 3UT9A 1H3OB 1P3GA 5CPID 3H0LC 2BG1A 3RELC 4WV4B 3X1UA 3AYWD 3F6TA 1HQ3D 4WNNB 4YM6D 3WTPD 1KX4D 5DNMD 4LD9C 4WU8A 3W96C 3RELD 3AN2B 3TU4B 5B0YC 5AVCD 4J8VB 2PYOA 1KX3D 1F66B 4LD9D 5BNXB 3AZFC 4YS3C 3W96D 5CPJB 2DF4C 1P3KD 5G49B 3AFAB 1KX5C 5B0YD 1M19B 1P3BC 4KUDC 1P3FA 2RVQD 3LELB 4WU9B 3X1VA 3KUYA 2HIOA 3LZ1D 5CP6D 2NZDA 5GT0B 4KGCD 1KX5D 1AOIC 2YFWA 1P3BD 5B1LA 5B31B 4NE6A 5B0ZB 3C1BC 5AV6A 5B1MA 3VH6T 5B32C 3MGRA 1M18A 3EG5B 3P5JB 3AV1A 3O62C 5BNVB 3KSYA 3AV2B 2FJ7A 2G5IC 1P34B 3AZJB 1P3OB 5AV5B 2CV5A 4ZUXA 4J8WC 4WU8D 5B32D 1P3LC 5CPIB 4DRAA 3AZMC 3O62D 2Y2HA 4YM6B 3REHA 1P3IB 5E5AC 3VH5A 3AZMD 4H9PA 4WNNA 5BS7A 5AV9C 5BO0B 4J8UC 3EPHA 5AV8C 1P3FD 4UUZB 3W96B 5E5AD 3W99B 1B6WA 3TU4A 5JA4B 3EPKA 4EO5C 5B31G 3X1SB 1F66A 5AV9D 3REKB 5BNXA 5GSUC 5AY8B 3AZFB 5CPJA 2L5AA 2XD5A 4YS3B 5G49A 4X23A 1M19A 3UTAC 3AV1D 1P3BB 3LELA 3MNNA 4KUDB 5GSUD 4G92B 2F8NB 3REIB 2CV5D 5CPKC 3VH5W 3UTAD 3W98C 1AOIB 4E45A 5B31A 3C1BB 2BYMA 3AN2C 1S32C 1R4VA 5BNVA 3A6NA 3O62B 3AV2A 1P34A 3AZJA 5GXQB 1ID3B 5AV5A 3WKJB 2ZY2A 4XUJC 4J8WB 5CPIA 3LJAC 2F2AC 1P3LB 2J8PA 3AN2D 3AYWA 3AFAC 3AZMB 3H0RC 1S32D 3R45B 4YM6A 1P3IA 1N1JB 5DNMA 4J8VD 2F8NK 4H9SC 1F66D 4WU9C 4HGAC 5E5AB 5CPJD 3RELA 1P3MC 3B6GC 3AFAD 5AVCA 5BO0A 1KX3A 2F8NG 3X1TB 5AV9B 4J8UB 4LD9A 5AV8B 3LELD 3W96A 4WU9D 2Y2LA 1P3KA 5GT0D 5B0YA 4EO5B 5B0ZD 5B31D 5B2JC 3AZFA 1P3OC 4YS3A 2BYKA 1BH9B 3AZGB 2ZY5A 1KX5A 3REJC 1P3BA 4KUDA 3AZJD 2DQNC 5B2JD 5AV5D 1P3OD 2YFVB 5CPKB 1M1AB 2Y2JA 4NE5A 4H9OB 3KWQC 3C1CC 1AOIA 3W98B 3REJD 3C1BA 1P3ID 2AROB 5B32A 3AZIB 5DNNC 3W99C 5B2IC 4CAYB 3O62A 1S32B 3KXBC 1HTAA 3X1SC 5GT3B 3REKC 4WJ3C 5KDMA 5AY8C 4J8WA 4XUJB 1P3LA 4XZQC 3LJAB 3W99D 3AZMA 3R45A 3EPLA 3X1SD 3WTPE 4J8XC 3REKD 2XD1A 3MGPB 4G92C 5AY8D 5E5AA 5B24B 3REIC 3FDDA 4HGAB 5F99B 4YS3D 3AZFD 3B6FB 1P3MB 3B6GB 5AV9A 3VH6A 4J8UA 1EQZC 3WA9B 5AV8A 4KUDD 2F8ND 3REID 1A7WA 1ULYA 4QLCC 2G5HC 2JE5A 5GXQC 4DQYB 3AZHC 1AOID 1ID3C 1EQZD 5GSUA 5B2JB 3C1BD 3AZLB 3WKJC 3WAAC 3AZNC 1BH9A 5B33C 4KHAB 1Q9CA 3UTAA 4QLCD 1B67A 3REJB 5GXQD 3AZHD 1ID3D 3LZ0C 3WKJD 1H3OA 2JCHA 2YFVA 3WAAD 4J8WD 4WZSB 3AZND 5B33D 5CPKA 4H9OA 4UPKA 1P3LD 3KWQB 3C1CB 3W98A 3X1TC 4Z2MG 3VH6W 3UTBC 4G91B 3NQUB 4R8PB 5JRGC 4CAYA 5DNNB 3AN2A 5B2IB 1S32A 3H0MC 5C3IC 3KXBB 4J8VA 4AWLB 3EPJA 1P3AB 3X1TD 1P3PC 4J8UD 5AV8D 5JRGD 3MGQB 4XZQB 3AZGC 3AFAA 2NQBC 4J8XB 4H9SA 4WU9A 1WWIA 4M6BA 5GT0A 2Y2MA 3B6GA 1ZLAC 3AZGD 1U35B 1M1AC 2JSSA 5B0ZA 1EQZB 4JJNB 2AROC 2UWXA 3AZIC 1F1EA 5CPKD 1T3UA 1M1AD 1ZLAD 3B0DC 5B40C 4Z5TB 4QLCB 3W98D 5GT3C 3AZHB 5B2JA 1P3OA 2AROD 3AZID 3WAAB 3AZNB 3A1KA 5B33B 3MGSC 3AZEB 4H9NB 4H9QB 3REJA 3W97B 3UT9B 3AL0C 5GT3D 4H9RB 1P3GB 3LZ0B 3NQJB 3MGPC 5B24C 4XUJD 5F99C 3X1UB 3B6FC 3LJAD 3MGSD 3KWQA 2IO5C 4Z66C 1PZRA 3NQUA 3WA9C 3UTBB 5CHLB 4DRBA 3MGPD 4UUZA 5B24D 5JRGB 5DNNA 3W99A 5F99D 5B2IA 3B6FD 5JA4A 1TZYC 1P3MD 2PYOB 3B6GD 3KXBA 3X1SA 5C3IB 2VQRA 4Z66D 3REKA 1P3PB 3WA9D 5AY8A 3MVDC 3AZLC 2Y2IA 4XZQA 2NQBB 3A1IA 3X1VB 3KUYB 2HIOB 2F8NH 2F8NA 2NZDB 3MVDD 2FFFB 3REIA 3AZLD 1ZLAB 2YFWB 5B1LB 1EQZA 5B1MB 2RIQA 4G91C 3MGRB 1M18B 4ZBJC 4R8PC 5AVBC 2FJ7B 4QLCA 3B0DB 5B40B 3KWQD 3C1CD 4AWLC 5GXQA 1P3AC 3AZHA 1ID3A 4R8PD 3WKJA 3WAAA 3AZNA 5B33A 2Y2GA 3MGQC 1HQ3C 3WTPC 1KX4C 3MGSB 5DNND 4H9NA 5B2ID 4H9QA 3KXBD 1N1JA 3B0CT 1P3AD 4H9RA 3LZ0A 3NQJA 3KFUG 5AVCC 3MGQD 1KX3C 4H9PB 4XZQD 1U35C 2IO5B 3X1TA 3UTBA 4Z66B 4J8XD 4JJNC 1P3KC 2ZM5A 5FUGB 5JRGA 1TZYB 2RVQC 3AZKC 1U35D 4Z5TC 1P3PA 3V9RB 5CP6C 3LZ1C 2HUEC 4JJND 3MVDB 4X23B 4KGCC 1BH8B 1W2EA 3AZGA 3AZEC 3B0CW 3AZKD 2Y2PA 4Z5TD 3MNNB 3W97C 3B0BA 1Z2CB 2NQBA 2Y2NA 3UT9C 1P3GC 4E44A 2ZY4A 3X1UC 1ZLAA 1M1AA 3AZED 1KU5A 3W97D 4WU8C 2W8SA 2AROA 3UT9D 1BFMA 4ZBJB 3AZIA 2BYMB 1P3GD 3LZ0D 3A6NB 1JFIB 4NE3A 5AVBB 3X1UD 2PYOC 5B40A 5GT3A 3IP4C 3UTBD 4XUJA 4CSRB 3AYWB 3LJAA 3MGSA 1HQ3B 3WTPB 1KX4B 2PYOD 5DNMB 1P3FC 3X1VC 3KUYC 2HIOC 1P3PD 3MGPA 4Z2MH 3RELB 5B24A 2Y2OA 2NZDC 5F99A 3B6FA 5AVCB 1P3MA 1KX3B 3VH5T 4LD9B 5B1LC 5AV6C 5B1MC 4Z66A 3WA9A 2NQBD 1TAFB 3MGRC 3KUYD 3X1VD 2HIOD 5FUGA 1P3KB 1M18C 2NZDD 3AV1C 5B0YB 1TZYA 2FJ7C 3AZKB 5B1LD 3V9RA 2CV5C 5AV6D 5B1MD 4ZUXC 3LZ1B 5CP6B 2HUEB 3MVDA 3MGRD 3AZLA 2BYKB 1M18D 1BH8A 4KGCB 1KX5B 4KHAA 3REHC 2FJ7D 5B40D 2Y2KA 2Y2QA 4ZUXD 5BS7C 3C1CA 3REHD 4WU8B 5B32B 4R8PA 3TU4C 1JFIA 5AVBA 4J8VC 2CWEA 1F66C 1P3AA 5KDMB 5CPJC 5BT1C 4CSRA 4X23C 2LY8A 3MGQA 3TU4D 1HQ3A 3WTPA 1M19C 1KX4A 1TZYD 3LELC 3MNNC 1P3FB 1WWSA 4J8XA 5GT0C 5BT1D 4X23D 1M19D 1U35A 5B0ZC 5B31C 3MNND 5AV6B 1TAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN A;  4NFT A;  3A6N C;  3AV1 B;  3AV2 C;  1P34 C;  3AZK A;  3AZJ C;  5B32 G;  4Z5T A;  5AV5 C;  5GSU B;  3LZ1 A;  5CP6 A;  2CV5 B;  4ZUX B;  5CPI C;  4KGC A;  3AYW C;  3A6N D;  3UTA B;  3AV2 D;  5AVB D;  4YM6 C;  3AZE A;  1P34 D;  1P3I C;  5DNM C;  3REH B;  3W97 A;  3UT9 A;  1H3O B;  1P3G A;  5CPI D;  3REL C;  4WV4 B;  3X1U A;  3AYW D;  1HQ3 D;  4WNN B;  4YM6 D;  3WTP D;  1KX4 D;  5DNM D;  4LD9 C;  4WU8 A;  3W96 C;  3REL D;  3AN2 B;  3TU4 B;  5B0Y C;  5AVC D;  4J8V B;  2PYO A;  1KX3 D;  1F66 B;  4LD9 D;  5BNX B;  3AZF C;  4YS3 C;  3W96 D;  5CPJ B;  1P3K D;  5G49 B;  3AFA B;  1KX5 C;  5B0Y D;  1M19 B;  1P3B C;  4KUD C;  1P3F A;  2RVQ D;  3LEL B;  4WU9 B;  3X1V A;  3KUY A;  2HIO A;  3LZ1 D;  5CP6 D;  2NZD A;  5GT0 B;  4KGC D;  1KX5 D;  1AOI C;  2YFW A;  1P3B D;  5B1L A;  5B31 B;  4NE6 A;  5B0Z B;  3C1B C;  5AV6 A;  5B1M A;  3VH6 T;  5B32 C;  3MGR A;  1M18 A;  3AV1 A;  3O62 C;  5BNV B;  3KSY A;  3AV2 B;  2FJ7 A;  1P34 B;  3AZJ B;  1P3O B;  5AV5 B;  2CV5 A;  4ZUX A;  4J8W C;  4WU8 D;  5B32 D;  1P3L C;  5CPI B;  4DRA A;  3AZM C;  3O62 D;  4YM6 B;  3REH A;  1P3I B;  5E5A C;  3VH5 A;  3AZM D;  4H9P A;  4WNN A;  5BS7 A;  5AV9 C;  5BO0 B;  4J8U C;  5AV8 C;  1P3F D;  4UUZ B;  3W96 B;  5E5A D;  3W99 B;  1B6W A;  3TU4 A;  5JA4 B;  4EO5 C;  5B31 G;  3X1S B;  1F66 A;  5AV9 D;  3REK B;  5BNX A;  5GSU C;  5AY8 B;  3AZF B;  5CPJ A;  2L5A A;  4YS3 B;  5G49 A;  4X23 A;  1M19 A;  3UTA C;  3AV1 D;  1P3B B;  3LEL A;  3MNN A;  4KUD B;  5GSU D;  4G92 B;  2F8N B;  3REI B;  2CV5 D;  5CPK C;  3VH5 W;  3UTA D;  3W98 C;  1AOI B;  4E45 A;  5B31 A;  3C1B B;  2BYM A;  3AN2 C;  1S32 C;  1R4V A;  5BNV A;  3A6N A;  3O62 B;  3AV2 A;  1P34 A;  3AZJ A;  5GXQ B;  1ID3 B;  5AV5 A;  3WKJ B;  4XUJ C;  4J8W B;  5CPI A;  3LJA C;  1P3L B;  3AN2 D;  3AYW A;  3AFA C;  3AZM B;  1S32 D;  3R45 B;  4YM6 A;  1P3I A;  1N1J B;  5DNM A;  4J8V D;  2F8N K;  4H9S C;  1F66 D;  4WU9 C;  4HGA C;  5E5A B;  5CPJ D;  3REL A;  1P3M C;  3B6G C;  3AFA D;  5AVC A;  5BO0 A;  1KX3 A;  2F8N G;  3X1T B;  5AV9 B;  4J8U B;  4LD9 A;  5AV8 B;  3LEL D;  3W96 A;  4WU9 D;  1P3K A;  5GT0 D;  5B0Y A;  4EO5 B;  5B0Z D;  5B31 D;  5B2J C;  3AZF A;  1P3O C;  4YS3 A;  2BYK A;  1BH9 B;  3AZG B;  1KX5 A;  3REJ C;  1P3B A;  4KUD A;  3AZJ D;  5B2J D;  1P3O D;  5AV5 D;  2YFV B;  5CPK B;  1M1A B;  4NE5 A;  4H9O B;  3KWQ C;  3C1C C;  1AOI A;  3W98 B;  3REJ D;  3C1B A;  1P3I D;  2ARO B;  5B32 A;  3AZI B;  5DNN C;  3W99 C;  5B2I C;  4CAY B;  3O62 A;  1S32 B;  3KXB C;  1HTA A;  3X1S C;  5GT3 B;  3REK C;  5KDM A;  5AY8 C;  4J8W A;  4XUJ B;  1P3L A;  4XZQ C;  3LJA B;  3W99 D;  3AZM A;  3R45 A;  3X1S D;  3WTP E;  4J8X C;  3REK D;  3MGP B;  4G92 C;  5AY8 D;  5E5A A;  5B24 B;  3REI C;  3AZF D;  4HGA B;  5F99 B;  4YS3 D;  3B6F B;  1P3M B;  3B6G B;  5AV9 A;  3VH6 A;  4J8U A;  1EQZ C;  3WA9 B;  5AV8 A;  4KUD D;  2F8N D;  3REI D;  1A7W A;  1ULY A;  4QLC C;  5GXQ C;  1AOI D;  3AZH C;  1EQZ D;  1ID3 C;  5GSU A;  5B2J B;  3C1B D;  3AZL B;  3WKJ C;  3WAA C;  3AZN C;  1BH9 A;  5B33 C;  4KHA B;  1Q9C A;  3UTA A;  4QLC D;  1B67 A;  3REJ B;  5GXQ D;  3AZH D;  1ID3 D;  3LZ0 C;  3WKJ D;  1H3O A;  2YFV A;  3WAA D;  4J8W D;  4WZS B;  3AZN D;  5B33 D;  5CPK A;  4H9O A;  1P3L D;  3KWQ B;  3C1C B;  3W98 A;  3X1T C;  4Z2M G;  3VH6 W;  3UTB C;  4G91 B;  4R8P B;  3NQU B;  5JRG C;  4CAY A;  5DNN B;  3AN2 A;  5B2I B;  1S32 A;  5C3I C;  3KXB B;  4J8V A;  4AWL B;  1P3A B;  3X1T D;  1P3P C;  4J8U D;  5AV8 D;  5JRG D;  3MGQ B;  4XZQ B;  3AZG C;  3AFA A;  2NQB C;  4J8X B;  4H9S A;  4WU9 A;  1WWI A;  4M6B A;  5GT0 A;  3B6G A;  1ZLA C;  3AZG D;  1U35 B;  1M1A C;  2JSS A;  5B0Z A;  1EQZ B;  4JJN B;  2ARO C;  3AZI C;  1F1E A;  5CPK D;  1ZLA D;  1M1A D;  3B0D C;  5B40 C;  4Z5T B;  4QLC B;  3W98 D;  5GT3 C;  3AZH B;  5B2J A;  1P3O A;  2ARO D;  3AZI D;  3WAA B;  3AZN B;  5B33 B;  3MGS C;  3AZE B;  4H9N B;  4H9Q B;  3REJ A;  3W97 B;  3UT9 B;  5GT3 D;  4H9R B;  1P3G B;  3LZ0 B;  3NQJ B;  3MGP C;  5B24 C;  4XUJ D;  5F99 C;  3X1U B;  3B6F C;  3LJA D;  3MGS D;  3KWQ A;  2IO5 C;  4Z66 C;  3NQU A;  3WA9 C;  3UTB B;  5CHL B;  4DRB A;  3MGP D;  4UUZ A;  5B24 D;  5JRG B;  5DNN A;  3W99 A;  5F99 D;  5B2I A;  3B6F D;  5JA4 A;  1TZY C;  1P3M D;  2PYO B;  3B6G D;  3KXB A;  3X1S A;  5C3I B;  4Z66 D;  3REK A;  1P3P B;  3WA9 D;  5AY8 A;  3MVD C;  3AZL C;  4XZQ A;  2NQB B;  3X1V B;  3KUY B;  2HIO B;  2F8N H;  2F8N A;  2NZD B;  3MVD D;  3REI A;  3AZL D;  1ZLA B;  2YFW B;  5B1L B;  1EQZ A;  5B1M B;  4G91 C;  3MGR B;  1M18 B;  4ZBJ C;  4R8P C;  5AVB C;  2FJ7 B;  4QLC A;  3B0D B;  5B40 B;  3KWQ D;  3C1C D;  4AWL C;  5GXQ A;  1P3A C;  3AZH A;  1ID3 A;  4R8P D;  3WKJ A;  3WAA A;  3AZN A;  5B33 A;  3MGQ C;  1HQ3 C;  3WTP C;  1KX4 C;  3MGS B;  5DNN D;  4H9N A;  5B2I D;  4H9Q A;  3KXB D;  1N1J A;  3B0C T;  1P3A D;  4H9R A;  3LZ0 A;  3NQJ A;  5AVC C;  3MGQ D;  1KX3 C;  4H9P B;  4XZQ D;  1U35 C;  2IO5 B;  3X1T A;  3UTB A;  4Z66 B;  4J8X D;  4JJN C;  1P3K C;  5FUG B;  5JRG A;  1TZY B;  2RVQ C;  3AZK C;  1U35 D;  4Z5T C;  1P3P A;  3V9R B;  5CP6 C;  3LZ1 C;  2HUE C;  4JJN D;  3MVD B;  4X23 B;  4KGC C;  1BH8 B;  3AZG A;  3AZE C;  3B0C W;  3AZK D;  4Z5T D;  3MNN B;  3W97 C;  3B0B A;  2NQB A;  3UT9 C;  1P3G C;  4E44 A;  3X1U C;  1ZLA A;  1M1A A;  3AZE D;  1KU5 A;  3W97 D;  4WU8 C;  2ARO A;  3UT9 D;  1BFM A;  4ZBJ B;  3AZI A;  2BYM B;  1P3G D;  3LZ0 D;  3A6N B;  1JFI B;  4NE3 A;  5AVB B;  3X1U D;  2PYO C;  5B40 A;  5GT3 A;  3UTB D;  4XUJ A;  4CSR B;  3AYW B;  3LJA A;  3MGS A;  1HQ3 B;  3WTP B;  1KX4 B;  2PYO D;  5DNM B;  1P3F C;  3X1V C;  3KUY C;  2HIO C;  1P3P D;  3MGP A;  4Z2M H;  3REL B;  5B24 A;  2NZD C;  5F99 A;  3B6F A;  5AVC B;  1P3M A;  1KX3 B;  3VH5 T;  4LD9 B;  5B1L C;  5AV6 C;  4Z66 A;  5B1M C;  3WA9 A;  2NQB D;  1TAF B;  3MGR C;  3KUY D;  3X1V D;  2HIO D;  5FUG A;  1P3K B;  1M18 C;  2NZD D;  3AV1 C;  5B0Y B;  1TZY A;  2FJ7 C;  3AZK B;  5B1L D;  3V9R A;  2CV5 C;  5AV6 D;  5B1M D;  4ZUX C;  3LZ1 B;  5CP6 B;  2HUE B;  3MVD A;  3MGR D;  3AZL A;  2BYK B;  1M18 D;  1BH8 A;  4KGC B;  1KX5 B;  4KHA A;  3REH C;  2FJ7 D;  5B40 D;  4ZUX D;  5BS7 C;  3C1C A;  3REH D;  4WU8 B;  5B32 B;  4R8P A;  3TU4 C;  1JFI A;  5AVB A;  4J8V C;  2CWE A;  1F66 C;  1P3A A;  5KDM B;  5CPJ C;  5BT1 C;  4CSR A;  4X23 C;  2LY8 A;  3MGQ A;  3TU4 D;  1HQ3 A;  3WTP A;  1M19 C;  1KX4 A;  1TZY D;  3LEL C;  3MNN C;  1P3F B;  1WWS A;  4J8X A;  5GT0 C;  5BT1 D;  4X23 D;  1M19 D;  1U35 A;  5B0Z C;  5B31 C;  3MNN D;  5AV6 B;  1TAF A; 
#chains in the Genus database with same CATH topology
 4JJN A;  4NFT A;  3A6N C;  3AV1 B;  3AV2 C;  1P34 C;  3AZK A;  3AZJ C;  5B32 G;  2ZY3 A;  4Z5T A;  5AV5 C;  5GSU B;  3LZ1 A;  5CP6 A;  2CV5 B;  4ZUX B;  5CPI C;  4KGC A;  3AYW C;  3A6N D;  3UTA B;  3AV2 D;  5AVB D;  4YM6 C;  3AZE A;  1P34 D;  1P3I C;  5DNM C;  3REH B;  3W97 A;  3UT9 A;  1H3O B;  1P3G A;  5CPI D;  3H0L C;  2BG1 A;  3REL C;  4WV4 B;  3X1U A;  3AYW D;  3F6T A;  1HQ3 D;  4WNN B;  4YM6 D;  3WTP D;  1KX4 D;  5DNM D;  4LD9 C;  4WU8 A;  3W96 C;  3REL D;  3AN2 B;  3TU4 B;  5B0Y C;  5AVC D;  4J8V B;  2PYO A;  1KX3 D;  1F66 B;  4LD9 D;  5BNX B;  3AZF C;  4YS3 C;  3W96 D;  5CPJ B;  2DF4 C;  1P3K D;  5G49 B;  3AFA B;  1KX5 C;  5B0Y D;  1M19 B;  1P3B C;  4KUD C;  1P3F A;  2RVQ D;  3LEL B;  4WU9 B;  3X1V A;  3KUY A;  2HIO A;  3LZ1 D;  5CP6 D;  2NZD A;  5GT0 B;  4KGC D;  1KX5 D;  1AOI C;  2YFW A;  1P3B D;  5B1L A;  5B31 B;  4NE6 A;  5B0Z B;  3C1B C;  5AV6 A;  5B1M A;  3VH6 T;  5B32 C;  3MGR A;  1M18 A;  3EG5 B;  3P5J B;  3AV1 A;  3O62 C;  5BNV B;  3KSY A;  3AV2 B;  2FJ7 A;  2G5I C;  1P34 B;  3AZJ B;  1P3O B;  5AV5 B;  2CV5 A;  4ZUX A;  4J8W C;  4WU8 D;  5B32 D;  1P3L C;  5CPI B;  4DRA A;  3AZM C;  3O62 D;  2Y2H A;  4YM6 B;  3REH A;  1P3I B;  5E5A C;  3VH5 A;  3AZM D;  4H9P A;  4WNN A;  5BS7 A;  5AV9 C;  5BO0 B;  4J8U C;  3EPH A;  5AV8 C;  1P3F D;  4UUZ B;  3W96 B;  5E5A D;  3W99 B;  1B6W A;  3TU4 A;  5JA4 B;  3EPK A;  4EO5 C;  5B31 G;  3X1S B;  1F66 A;  5AV9 D;  3REK B;  5BNX A;  5GSU C;  5AY8 B;  3AZF B;  5CPJ A;  2L5A A;  2XD5 A;  4YS3 B;  5G49 A;  4X23 A;  1M19 A;  3UTA C;  3AV1 D;  1P3B B;  3LEL A;  3MNN A;  4KUD B;  5GSU D;  4G92 B;  2F8N B;  3REI B;  2CV5 D;  5CPK C;  3VH5 W;  3UTA D;  3W98 C;  1AOI B;  4E45 A;  5B31 A;  3C1B B;  2BYM A;  3AN2 C;  1S32 C;  1R4V A;  5BNV A;  3A6N A;  3O62 B;  3AV2 A;  1P34 A;  3AZJ A;  5GXQ B;  1ID3 B;  5AV5 A;  3WKJ B;  2ZY2 A;  4XUJ C;  4J8W B;  5CPI A;  3LJA C;  2F2A C;  1P3L B;  2J8P A;  3AN2 D;  3AYW A;  3AFA C;  3AZM B;  3H0R C;  1S32 D;  3R45 B;  4YM6 A;  1P3I A;  1N1J B;  5DNM A;  4J8V D;  2F8N K;  4H9S C;  1F66 D;  4WU9 C;  4HGA C;  5E5A B;  5CPJ D;  3REL A;  1P3M C;  3B6G C;  3AFA D;  5AVC A;  5BO0 A;  1KX3 A;  2F8N G;  3X1T B;  5AV9 B;  4J8U B;  4LD9 A;  5AV8 B;  3LEL D;  3W96 A;  4WU9 D;  2Y2L A;  1P3K A;  5GT0 D;  5B0Y A;  4EO5 B;  5B0Z D;  5B31 D;  5B2J C;  3AZF A;  1P3O C;  4YS3 A;  2BYK A;  1BH9 B;  3AZG B;  2ZY5 A;  1KX5 A;  3REJ C;  1P3B A;  4KUD A;  3AZJ D;  2DQN C;  5B2J D;  5AV5 D;  1P3O D;  2YFV B;  5CPK B;  1M1A B;  2Y2J A;  4NE5 A;  4H9O B;  3KWQ C;  3C1C C;  1AOI A;  3W98 B;  3REJ D;  3C1B A;  1P3I D;  2ARO B;  5B32 A;  3AZI B;  5DNN C;  3W99 C;  5B2I C;  4CAY B;  3O62 A;  1S32 B;  3KXB C;  1HTA A;  3X1S C;  5GT3 B;  3REK C;  4WJ3 C;  5KDM A;  5AY8 C;  4J8W A;  4XUJ B;  1P3L A;  4XZQ C;  3LJA B;  3W99 D;  3AZM A;  3R45 A;  3EPL A;  3X1S D;  3WTP E;  4J8X C;  3REK D;  2XD1 A;  3MGP B;  4G92 C;  5AY8 D;  5E5A A;  5B24 B;  3REI C;  3FDD A;  4HGA B;  5F99 B;  4YS3 D;  3AZF D;  3B6F B;  1P3M B;  3B6G B;  5AV9 A;  3VH6 A;  4J8U A;  1EQZ C;  3WA9 B;  5AV8 A;  4KUD D;  2F8N D;  3REI D;  1A7W A;  1ULY A;  4QLC C;  2G5H C;  2JE5 A;  5GXQ C;  4DQY B;  3AZH C;  1AOI D;  1ID3 C;  1EQZ D;  5GSU A;  5B2J B;  3C1B D;  3AZL B;  3WKJ C;  3WAA C;  3AZN C;  1BH9 A;  5B33 C;  4KHA B;  1Q9C A;  3UTA A;  4QLC D;  1B67 A;  3REJ B;  5GXQ D;  3AZH D;  1ID3 D;  3LZ0 C;  3WKJ D;  1H3O A;  2JCH A;  2YFV A;  3WAA D;  4J8W D;  4WZS B;  3AZN D;  5B33 D;  5CPK A;  4H9O A;  4UPK A;  1P3L D;  3KWQ B;  3C1C B;  3W98 A;  3X1T C;  4Z2M G;  3VH6 W;  3UTB C;  4G91 B;  3NQU B;  4R8P B;  5JRG C;  4CAY A;  5DNN B;  3AN2 A;  5B2I B;  1S32 A;  3H0M C;  5C3I C;  3KXB B;  4J8V A;  4AWL B;  3EPJ A;  1P3A B;  3X1T D;  1P3P C;  4J8U D;  5AV8 D;  5JRG D;  3MGQ B;  4XZQ B;  3AZG C;  3AFA A;  2NQB C;  4J8X B;  4H9S A;  4WU9 A;  1WWI A;  4M6B A;  5GT0 A;  2Y2M A;  3B6G A;  1ZLA C;  3AZG D;  1U35 B;  1M1A C;  2JSS A;  5B0Z A;  1EQZ B;  4JJN B;  2ARO C;  2UWX A;  3AZI C;  1F1E A;  5CPK D;  1T3U A;  1M1A D;  1ZLA D;  3B0D C;  5B40 C;  4Z5T B;  4QLC B;  3W98 D;  5GT3 C;  3AZH B;  5B2J A;  1P3O A;  2ARO D;  3AZI D;  3WAA B;  3AZN B;  3A1K A;  5B33 B;  3MGS C;  3AZE B;  4H9N B;  4H9Q B;  3REJ A;  3W97 B;  3UT9 B;  3AL0 C;  5GT3 D;  4H9R B;  1P3G B;  3LZ0 B;  3NQJ B;  3MGP C;  5B24 C;  4XUJ D;  5F99 C;  3X1U B;  3B6F C;  3LJA D;  3MGS D;  3KWQ A;  2IO5 C;  4Z66 C;  1PZR A;  3NQU A;  3WA9 C;  3UTB B;  5CHL B;  4DRB A;  3MGP D;  4UUZ A;  5B24 D;  5JRG B;  5DNN A;  3W99 A;  5F99 D;  5B2I A;  3B6F D;  5JA4 A;  1TZY C;  1P3M D;  2PYO B;  3B6G D;  3KXB A;  3X1S A;  5C3I B;  2VQR A;  4Z66 D;  3REK A;  1P3P B;  3WA9 D;  5AY8 A;  3MVD C;  3AZL C;  2Y2I A;  4XZQ A;  2NQB B;  3A1I A;  3X1V B;  3KUY B;  2HIO B;  2F8N H;  2F8N A;  2NZD B;  3MVD D;  2FFF B;  3REI A;  3AZL D;  1ZLA B;  2YFW B;  5B1L B;  1EQZ A;  5B1M B;  2RIQ A;  4G91 C;  3MGR B;  1M18 B;  4ZBJ C;  4R8P C;  5AVB C;  2FJ7 B;  4QLC A;  3B0D B;  5B40 B;  3KWQ D;  3C1C D;  4AWL C;  5GXQ A;  1P3A C;  3AZH A;  1ID3 A;  4R8P D;  3WKJ A;  3WAA A;  3AZN A;  5B33 A;  2Y2G A;  3MGQ C;  1HQ3 C;  3WTP C;  1KX4 C;  3MGS B;  5DNN D;  4H9N A;  5B2I D;  4H9Q A;  3KXB D;  1N1J A;  3B0C T;  1P3A D;  4H9R A;  3LZ0 A;  3NQJ A;  3KFU G;  5AVC C;  3MGQ D;  1KX3 C;  4H9P B;  4XZQ D;  1U35 C;  2IO5 B;  3X1T A;  3UTB A;  4Z66 B;  4J8X D;  4JJN C;  1P3K C;  2ZM5 A;  5FUG B;  5JRG A;  1TZY B;  2RVQ C;  3AZK C;  1U35 D;  4Z5T C;  1P3P A;  3V9R B;  5CP6 C;  3LZ1 C;  2HUE C;  4JJN D;  3MVD B;  4X23 B;  4KGC C;  1BH8 B;  1W2E A;  3AZG A;  3AZE C;  3B0C W;  3AZK D;  2Y2P A;  4Z5T D;  3MNN B;  3W97 C;  3B0B A;  1Z2C B;  2NQB A;  2Y2N A;  3UT9 C;  1P3G C;  4E44 A;  2ZY4 A;  3X1U C;  1ZLA A;  1M1A A;  3AZE D;  1KU5 A;  3W97 D;  4WU8 C;  2W8S A;  2ARO A;  3UT9 D;  1BFM A;  4ZBJ B;  3AZI A;  2BYM B;  1P3G D;  3LZ0 D;  3A6N B;  1JFI B;  4NE3 A;  5AVB B;  3X1U D;  2PYO C;  5B40 A;  5GT3 A;  3IP4 C;  3UTB D;  4XUJ A;  4CSR B;  3AYW B;  3LJA A;  3MGS A;  1HQ3 B;  3WTP B;  1KX4 B;  2PYO D;  5DNM B;  1P3F C;  3X1V C;  3KUY C;  2HIO C;  1P3P D;  3MGP A;  4Z2M H;  3REL B;  5B24 A;  2Y2O A;  2NZD C;  5F99 A;  3B6F A;  5AVC B;  1P3M A;  1KX3 B;  3VH5 T;  4LD9 B;  5B1L C;  5AV6 C;  5B1M C;  4Z66 A;  3WA9 A;  2NQB D;  1TAF B;  3MGR C;  3KUY D;  3X1V D;  2HIO D;  5FUG A;  1P3K B;  1M18 C;  2NZD D;  3AV1 C;  5B0Y B;  1TZY A;  2FJ7 C;  3AZK B;  5B1L D;  3V9R A;  2CV5 C;  5AV6 D;  5B1M D;  4ZUX C;  3LZ1 B;  5CP6 B;  2HUE B;  3MVD A;  3MGR D;  3AZL A;  2BYK B;  1M18 D;  1BH8 A;  4KGC B;  1KX5 B;  4KHA A;  3REH C;  2FJ7 D;  5B40 D;  2Y2K A;  2Y2Q A;  4ZUX D;  5BS7 C;  3C1C A;  3REH D;  4WU8 B;  5B32 B;  4R8P A;  3TU4 C;  1JFI A;  5AVB A;  4J8V C;  2CWE A;  1F66 C;  1P3A A;  5KDM B;  5CPJ C;  5BT1 C;  4CSR A;  4X23 C;  2LY8 A;  3MGQ A;  3TU4 D;  1HQ3 A;  3WTP A;  1M19 C;  1KX4 A;  1TZY D;  3LEL C;  3MNN C;  1P3F B;  1WWS A;  4J8X A;  5GT0 C;  5BT1 D;  4X23 D;  1M19 D;  1U35 A;  5B0Z C;  5B31 C;  3MNN D;  5AV6 B;  1TAF A; 
#chains in the Genus database with same CATH homology
 4JJN A;  4NFT A;  3A6N C;  3AV1 B;  3AV2 C;  1P34 C;  3AZK A;  3AZJ C;  5B32 G;  2ZY3 A;  4Z5T A;  5AV5 C;  5GSU B;  3LZ1 A;  5CP6 A;  2CV5 B;  4ZUX B;  5CPI C;  4KGC A;  3AYW C;  3A6N D;  3UTA B;  3AV2 D;  5AVB D;  4YM6 C;  3AZE A;  1P34 D;  1P3I C;  5DNM C;  3REH B;  3W97 A;  3UT9 A;  1H3O B;  1P3G A;  5CPI D;  3H0L C;  2BG1 A;  3REL C;  4WV4 B;  3X1U A;  3AYW D;  3F6T A;  1HQ3 D;  4WNN B;  4YM6 D;  3WTP D;  1KX4 D;  5DNM D;  4LD9 C;  4WU8 A;  3W96 C;  3REL D;  3AN2 B;  3TU4 B;  5B0Y C;  5AVC D;  4J8V B;  2PYO A;  1KX3 D;  1F66 B;  4LD9 D;  5BNX B;  3AZF C;  4YS3 C;  3W96 D;  5CPJ B;  2DF4 C;  1P3K D;  5G49 B;  3AFA B;  1KX5 C;  5B0Y D;  1M19 B;  1P3B C;  4KUD C;  1P3F A;  2RVQ D;  3LEL B;  4WU9 B;  3X1V A;  3KUY A;  2HIO A;  3LZ1 D;  5CP6 D;  2NZD A;  5GT0 B;  4KGC D;  1KX5 D;  1AOI C;  2YFW A;  1P3B D;  5B1L A;  5B31 B;  4NE6 A;  5B0Z B;  3C1B C;  5AV6 A;  5B1M A;  3VH6 T;  5B32 C;  3MGR A;  1M18 A;  3EG5 B;  3P5J B;  3AV1 A;  3O62 C;  5BNV B;  3KSY A;  3AV2 B;  2FJ7 A;  2G5I C;  1P34 B;  3AZJ B;  1P3O B;  5AV5 B;  2CV5 A;  4ZUX A;  4J8W C;  4WU8 D;  5B32 D;  1P3L C;  5CPI B;  4DRA A;  3AZM C;  3O62 D;  2Y2H A;  4YM6 B;  3REH A;  1P3I B;  5E5A C;  3VH5 A;  3AZM D;  4H9P A;  4WNN A;  5BS7 A;  5AV9 C;  5BO0 B;  4J8U C;  3EPH A;  5AV8 C;  1P3F D;  4UUZ B;  3W96 B;  5E5A D;  3W99 B;  1B6W A;  3TU4 A;  5JA4 B;  3EPK A;  4EO5 C;  5B31 G;  3X1S B;  1F66 A;  5AV9 D;  3REK B;  5BNX A;  5GSU C;  5AY8 B;  3AZF B;  5CPJ A;  2L5A A;  2XD5 A;  4YS3 B;  5G49 A;  4X23 A;  1M19 A;  3UTA C;  3AV1 D;  1P3B B;  3LEL A;  3MNN A;  4KUD B;  5GSU D;  4G92 B;  2F8N B;  3REI B;  2CV5 D;  5CPK C;  3VH5 W;  3UTA D;  3W98 C;  1AOI B;  4E45 A;  5B31 A;  3C1B B;  2BYM A;  3AN2 C;  1S32 C;  1R4V A;  5BNV A;  3A6N A;  3O62 B;  3AV2 A;  1P34 A;  3AZJ A;  5GXQ B;  1ID3 B;  5AV5 A;  3WKJ B;  2ZY2 A;  4XUJ C;  4J8W B;  5CPI A;  3LJA C;  2F2A C;  1P3L B;  2J8P A;  3AN2 D;  3AYW A;  3AFA C;  3AZM B;  3H0R C;  1S32 D;  3R45 B;  4YM6 A;  1P3I A;  1N1J B;  5DNM A;  4J8V D;  2F8N K;  4H9S C;  1F66 D;  4WU9 C;  4HGA C;  5E5A B;  5CPJ D;  3REL A;  1P3M C;  3B6G C;  3AFA D;  5AVC A;  5BO0 A;  1KX3 A;  2F8N G;  3X1T B;  5AV9 B;  4J8U B;  4LD9 A;  5AV8 B;  3LEL D;  3W96 A;  4WU9 D;  2Y2L A;  1P3K A;  5GT0 D;  5B0Y A;  4EO5 B;  5B0Z D;  5B31 D;  5B2J C;  3AZF A;  1P3O C;  4YS3 A;  2BYK A;  1BH9 B;  3AZG B;  2ZY5 A;  1KX5 A;  3REJ C;  1P3B A;  4KUD A;  3AZJ D;  2DQN C;  5B2J D;  5AV5 D;  1P3O D;  2YFV B;  5CPK B;  1M1A B;  2Y2J A;  4NE5 A;  4H9O B;  3KWQ C;  3C1C C;  1AOI A;  3W98 B;  3REJ D;  3C1B A;  1P3I D;  2ARO B;  5B32 A;  3AZI B;  5DNN C;  3W99 C;  5B2I C;  4CAY B;  3O62 A;  1S32 B;  3KXB C;  1HTA A;  3X1S C;  5GT3 B;  3REK C;  4WJ3 C;  5KDM A;  5AY8 C;  4J8W A;  4XUJ B;  1P3L A;  4XZQ C;  3LJA B;  3W99 D;  3AZM A;  3R45 A;  3EPL A;  3X1S D;  3WTP E;  4J8X C;  3REK D;  2XD1 A;  3MGP B;  4G92 C;  5AY8 D;  5E5A A;  5B24 B;  3REI C;  3FDD A;  4HGA B;  5F99 B;  4YS3 D;  3AZF D;  3B6F B;  1P3M B;  3B6G B;  5AV9 A;  3VH6 A;  4J8U A;  1EQZ C;  3WA9 B;  5AV8 A;  4KUD D;  2F8N D;  3REI D;  1A7W A;  1ULY A;  4QLC C;  2G5H C;  2JE5 A;  5GXQ C;  4DQY B;  3AZH C;  1AOI D;  1ID3 C;  1EQZ D;  5GSU A;  5B2J B;  3C1B D;  3AZL B;  3WKJ C;  3WAA C;  3AZN C;  1BH9 A;  5B33 C;  4KHA B;  1Q9C A;  3UTA A;  4QLC D;  1B67 A;  3REJ B;  5GXQ D;  3AZH D;  1ID3 D;  3LZ0 C;  3WKJ D;  1H3O A;  2JCH A;  2YFV A;  3WAA D;  4J8W D;  4WZS B;  3AZN D;  5B33 D;  5CPK A;  4H9O A;  4UPK A;  1P3L D;  3KWQ B;  3C1C B;  3W98 A;  3X1T C;  4Z2M G;  3VH6 W;  3UTB C;  4G91 B;  3NQU B;  4R8P B;  5JRG C;  4CAY A;  5DNN B;  3AN2 A;  5B2I B;  1S32 A;  3H0M C;  5C3I C;  3KXB B;  4J8V A;  4AWL B;  3EPJ A;  1P3A B;  3X1T D;  1P3P C;  4J8U D;  5AV8 D;  5JRG D;  3MGQ B;  4XZQ B;  3AZG C;  3AFA A;  2NQB C;  4J8X B;  4H9S A;  4WU9 A;  1WWI A;  4M6B A;  5GT0 A;  2Y2M A;  3B6G A;  1ZLA C;  3AZG D;  1U35 B;  1M1A C;  2JSS A;  5B0Z A;  1EQZ B;  4JJN B;  2ARO C;  2UWX A;  3AZI C;  1F1E A;  5CPK D;  1T3U A;  1M1A D;  1ZLA D;  3B0D C;  5B40 C;  4Z5T B;  4QLC B;  3W98 D;  5GT3 C;  3AZH B;  5B2J A;  1P3O A;  2ARO D;  3AZI D;  3WAA B;  3AZN B;  3A1K A;  5B33 B;  3MGS C;  3AZE B;  4H9N B;  4H9Q B;  3REJ A;  3W97 B;  3UT9 B;  3AL0 C;  5GT3 D;  4H9R B;  1P3G B;  3LZ0 B;  3NQJ B;  3MGP C;  5B24 C;  4XUJ D;  5F99 C;  3X1U B;  3B6F C;  3LJA D;  3MGS D;  3KWQ A;  2IO5 C;  4Z66 C;  1PZR A;  3NQU A;  3WA9 C;  3UTB B;  5CHL B;  4DRB A;  3MGP D;  4UUZ A;  5B24 D;  5JRG B;  5DNN A;  3W99 A;  5F99 D;  5B2I A;  3B6F D;  5JA4 A;  1TZY C;  1P3M D;  2PYO B;  3B6G D;  3KXB A;  3X1S A;  5C3I B;  2VQR A;  4Z66 D;  3REK A;  1P3P B;  3WA9 D;  5AY8 A;  3MVD C;  3AZL C;  2Y2I A;  4XZQ A;  2NQB B;  3A1I A;  3X1V B;  3KUY B;  2HIO B;  2F8N H;  2F8N A;  2NZD B;  3MVD D;  2FFF B;  3REI A;  3AZL D;  1ZLA B;  2YFW B;  5B1L B;  1EQZ A;  5B1M B;  2RIQ A;  4G91 C;  3MGR B;  1M18 B;  4ZBJ C;  4R8P C;  5AVB C;  2FJ7 B;  4QLC A;  3B0D B;  5B40 B;  3KWQ D;  3C1C D;  4AWL C;  5GXQ A;  1P3A C;  3AZH A;  1ID3 A;  4R8P D;  3WKJ A;  3WAA A;  3AZN A;  5B33 A;  2Y2G A;  3MGQ C;  1HQ3 C;  3WTP C;  1KX4 C;  3MGS B;  5DNN D;  4H9N A;  5B2I D;  4H9Q A;  3KXB D;  1N1J A;  3B0C T;  1P3A D;  4H9R A;  3LZ0 A;  3NQJ A;  3KFU G;  5AVC C;  3MGQ D;  1KX3 C;  4H9P B;  4XZQ D;  1U35 C;  2IO5 B;  3X1T A;  3UTB A;  4Z66 B;  4J8X D;  4JJN C;  1P3K C;  2ZM5 A;  5FUG B;  5JRG A;  1TZY B;  2RVQ C;  3AZK C;  1U35 D;  4Z5T C;  1P3P A;  3V9R B;  5CP6 C;  3LZ1 C;  2HUE C;  4JJN D;  3MVD B;  4X23 B;  4KGC C;  1BH8 B;  1W2E A;  3AZG A;  3AZE C;  3B0C W;  3AZK D;  2Y2P A;  4Z5T D;  3MNN B;  3W97 C;  3B0B A;  1Z2C B;  2NQB A;  2Y2N A;  3UT9 C;  1P3G C;  4E44 A;  2ZY4 A;  3X1U C;  1ZLA A;  1M1A A;  3AZE D;  1KU5 A;  3W97 D;  4WU8 C;  2W8S A;  2ARO A;  3UT9 D;  1BFM A;  4ZBJ B;  3AZI A;  2BYM B;  1P3G D;  3LZ0 D;  3A6N B;  1JFI B;  4NE3 A;  5AVB B;  3X1U D;  2PYO C;  5B40 A;  5GT3 A;  3IP4 C;  3UTB D;  4XUJ A;  4CSR B;  3AYW B;  3LJA A;  3MGS A;  1HQ3 B;  3WTP B;  1KX4 B;  2PYO D;  5DNM B;  1P3F C;  3X1V C;  3KUY C;  2HIO C;  1P3P D;  3MGP A;  4Z2M H;  3REL B;  5B24 A;  2Y2O A;  2NZD C;  5F99 A;  3B6F A;  5AVC B;  1P3M A;  1KX3 B;  3VH5 T;  4LD9 B;  5B1L C;  5AV6 C;  5B1M C;  4Z66 A;  3WA9 A;  2NQB D;  1TAF B;  3MGR C;  3KUY D;  3X1V D;  2HIO D;  5FUG A;  1P3K B;  1M18 C;  2NZD D;  3AV1 C;  5B0Y B;  1TZY A;  2FJ7 C;  3AZK B;  5B1L D;  3V9R A;  2CV5 C;  5AV6 D;  5B1M D;  4ZUX C;  3LZ1 B;  5CP6 B;  2HUE B;  3MVD A;  3MGR D;  3AZL A;  2BYK B;  1M18 D;  1BH8 A;  4KGC B;  1KX5 B;  4KHA A;  3REH C;  2FJ7 D;  5B40 D;  2Y2K A;  2Y2Q A;  4ZUX D;  5BS7 C;  3C1C A;  3REH D;  4WU8 B;  5B32 B;  4R8P A;  3TU4 C;  1JFI A;  5AVB A;  4J8V C;  2CWE A;  1F66 C;  1P3A A;  5KDM B;  5CPJ C;  5BT1 C;  4CSR A;  4X23 C;  2LY8 A;  3MGQ A;  3TU4 D;  1HQ3 A;  3WTP A;  1M19 C;  1KX4 A;  1TZY D;  3LEL C;  3MNN C;  1P3F B;  1WWS A;  4J8X A;  5GT0 C;  5BT1 D;  4X23 D;  1M19 D;  1U35 A;  5B0Z C;  5B31 C;  3MNN D;  5AV6 B;  1TAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...