1P3GB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKEISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gB00
1B6WA 2NQBC 4G92B 5AY8B 5BO0A 4XUJB 2FJ7A 4YM6C 4H9SC 3LJAA 1TAFB 3AZJB 1P3AD 5AVBC 3LELC 4ZUXD 3UT9A 3AZGA 3B6FB 4KGCC 1AOIC 5CPJD 4AWLC 5CP6A 4J8WA 5BT1D 1KX5B 5AV6D 5GT3B 3REIA 3AV2B 4X23D 3REKC 5B32G 3O62C 3NQJB 1HQ3C 3W98D 4YS3D 1WWIA 1P3IB 5JRGD 3X1TA 5B24C 1P3KD 1EQZA 4KUDA 3REHA 2PYOC 2NQBB 3WKJA 4WU8A 3AZED 4LD9A 4WU9D 1P3GA 4YM6B 3WAAC 3AZKD 1S32A 5DNMD 3WA9D 2LY8A 4J8VC 1P3PC 3A6NA 5AVBB 3LELB 4ZUXC 3MGRA 3UTBB 4KGCB 1AOIB 2FJ7D 4AWLB 5AV6C 2NZDC 3C1BA 4X23C 3LJAD 3REKB 3O62B 1HQ3B 4Z66C 3W98C 3VH6W 3UT9D 4YS3C 3AZGD 3NQUB 1N1JA 5CP6D 5B24B 4J8WD 1P3KC 1ZLAB 2PYOB 5AV9A 3REID 5B0ZA 1P3OA 3MGQA 3WAAB 1P3MC 3B0BA 5BNXA 5DNMC 3X1UA 3WA9C 3X1TD 3LZ0A 1EQZD 3MVDA 4KUDD 4J8VB 1P3PB 3WKJD 4WU8D 4ZUXB 4LD9D 1KX3A 1P3GD 1S32D 5AV6B 1U35A 2NZDB 4X23B 4J8UC 4HGAC 1P3FC 4Z66B 3MGPA 2AROC 3W98B 4YS3B 3MGRD 4H9PA 4H9OA 5CHLB 3LZ1D 1P3KB 4JJNA 2F8NG 5CPIA 5B40A 3W96A 4M6BA 3C1BD 5AVCA 4WU9B 3KWQC 1F66A 5B33C 1P3MB 3MNNC 3C1CC 5DNMB 5B0YA 3WA9B 3AZFC 3X1TC 3KSYA 5B1LA 5BNVA 5B32A 3WKJC 4XZQA 1P3OD 4R8PA 3MGQD 1P3GC 1M19A 3AZMC 3X1UD 4H9QA 3LZ0D 3MVDD 4J8UB 4HGAB 1P3FB 2AROB 3X1SA 1KX3D 1TZYD 4J8WB 3LZ1C 1U35D 3AZNC 3MGSD 5CPKA 3KWQB 5B33B 3REJC 3MNNB 4QLCD 3AZFB 3X1TB 4JJND 1EQZB 1KX4A 5B40D 4E44A 3WKJB 3W96D 3V9RA 1P3OC 4LD9B 1F66D 1P3GB 1P3LC 4E45A 3AZMB 3AZHA 5B0YD 3X1UC 5KDMB 3LZ0C 2YFVB 4H9NB 4XZQD 3MGRB 5DNNA 4R8PD 1P34A 5GSUD 4H9RA 5FUGB 1TZYC 1M19D 3LZ1B 5B31C 3MGSC 3AN2A 3REJB 4QLCC 3X1SD 3W97A 4WNNB 3W96C 5C3IC 2YFWA 1P3OB 2BYMA 3X1UB 3AYWA 3LZ0B 1KX4D 4G91C 3RELA 5GSUC 1TZYB 3B6GA 4Z5TA 3B0DC 3AZHD 1U35B 5B31B 2HIOA 3MGSB 2F8NH 3UTBC 3AV1A 5DNND 5JA4B 2BYKA 4QLCB 1P34D 4ZBJC 5GT0C 3W96B 4J8XA 5C3IB 5B2IC 2IO5C 3AN2D 4CAYA 3X1VA 1ZLAC 1KX4C 3W97D 4G91B 5GSUB 3VH5T 3B0DB 5G49A 3AYWD 1P3AC 4Z2MG 2L5AA 1H3OA 1WWSA 5AV5A 5CPJC 3RELD 5BT1C 3VH6T 3B6GD 4Z5TD 4ZBJB 1JFIB 5GT0B 2HIOD 5B2IB 5BS7A 2IO5B 5E5AA 3KXBA 3AN2C 3AV1D 2RVQD 3KUYA 5JRGC 1M1AA 1KX4B 3R45B 1B67A 3AZEC 4J8XD 4WU9C 3V9RB 5AV8A 3AZKC 3X1VD 3REHD 3AZLA 1P3AB 5B2JA 4EO5C 3UTAA 2FJ7C 5CPJB 3RELC 3W99A 5GXQA 1P3BA 3LJAC 2JSSA 2HIOC 3A6ND 4NFTA 1BH8A 3UT9C 1HTAA 3AZGC 3AN2B 4KHAA 2RVQC 5AV5D 4UUZB 5JRGB 5CP6C 4J8WC 3REIC 1M18A 5B1MA 5F99A 3WTPA 3AZEB 3AZIA 3AFAA 2YFWB 3KXBD 5E5AD 3AZKB 3KUYD 3X1VC 5AY8A 1EQZC 4KUDC 3REHC 4CSRA 5AV9D 4XUJA 1M1AD 5B0ZD 4WU8C 5BO0B 4LD9C 4EO5B 5AV8D 2FJ7B 3RELB 1S32C 3B6GB 3B6FA 3LJAB 3AZLD 2HIOB 5B2JD 3A6NC 1KX5A 3UT9B 3MGRC 3AZGB 5GT3A 3AV2A 5CP6B 3REIB 3W99D 5GXQD 3C1BC 2CV5A 1P3BD 3MGPD 4J8XB 3KXBC 2NQBA 3X1VB 4KUDB 3REHB 5AV9C 5CPID 1M18D 5B1MD 5F99D 3WTPD 5B0ZC 4WU8B 3AZID 3AFAD 5AVCD 4H9SA 3MGQC 4Z2MH 1S32B 5AVBA 3LELA 5AY8D 3MVDC 4XUJD 1AOIA 5B1LD 5B32D 3A6NB 1KX3C 3REKA 1U35C 3C1BB 3MGPC 1KX5D 3KXBB 2PYOA 5GT3D 3KUYB 1N1JB 4JJNC 5AV9B 5CPIC 5B40C 5F99C 5B0ZB 2CV5D 3WAAA 3AZIC 3B0CW 5AVCC 5CPKD 1F66C 3MGQB 5AV8B 3TU4A 4J8VA 1P3PA 5BNXB 2NQBD 5B0YC 2F8NA 2HUEC 4ZUXA 3MVDB 5B1LC 5B32C 4XZQC 2NZDA 4R8PC 1KX3B 1M19C 4Z66A 3W98A 3LELD 3W99B 4YS3A 1BH9A 1AOID 3MGPB 3X1SC 4H9PB 4H9OB 4JJNB 5CPIB 5B40B 5F99B 3WTPB 1P3MA 3AZIB 3AFAB 5AVCB 5CPKC 1F66B 2PYOD 5B31G 5B0YB 2HUEB 4CSRB 5B1LB 5BNVB 1ULYA 5B32B 3WAAD 4XZQB 4R8PB 3TU4D 1M19B 4J8VD 4J8UA 3AZHC 1P3PD 1P3FA 2F8ND 4H9QB 2AROA 4NE3A 5DNNC 2NZDD 1P34C 3X1SB 4Z66D 3KWQA 5B33A 2CV5B 3MNNA 3C1CA 5CPKB 3AZFA 3W97C 3AZMA 1P3MD 5KDMA 1ID3A 2YFVA 3TU4C 4H9NA 3AZHB 3AYWC 1BFMA 3VH5W 5FUGA 3LZ1A 5DNNB 1P34B 4H9RB 3AZNA 3B6GC 4Z5TC 4DRBA 4J8UD 1P3FD 2AROD 3REJA 3AV1C 1KU5A 1Q9CA 4WNNA 3KWQD 3W97B 1P3LA 5B33D 4J8XC 3MNND 3C1CD 3AZFD 2BYMB 1A7WA 3TU4B 2F8NB 3AYWB 1TZYA 3AZMD 1TAFA 3AZJA 1ID3D 5B31A 4Z5TB 3MGSA 5JA4A 1BH9B 4QLCA 3AV1B 3UTAD 5AV5C 2BYKB 3NQJA 3AZND 1P3IA 3REJD 5BS7C 5E5AC 3WTPE 4CAYB 3KUYC 1M1AC 4YM6A 5GSUA 4WZSB 1P3LD 5AV8C 1R4VA 1ID3C 5G49B 3UTBA 4KGCA 3AZLC 5B2JC 4NE5A 1H3OB 3UTAC 5AV5B 3O62A 1JFIA 5GT0A 3AZJD 1HQ3A 4NE6A 5B31D 5B2IA 3W99C 3B6FD 5GXQC 1P3BC 3NQUA 5B24A 3C1CB 1ZLAA 5E5AB 3AV2D 3B0CT 3R45A 1M1AB 1M18C 5B1MC 3WTPC 1P3ID 3AFAC 2CWEA 3VH5A 1ID3B 1P3AA 4WV4B 4G92C 5AY8C 4XUJC 3AZLB 5CPJA 5B2JB 4YM6D 5AV6A 3UTAB 3VH6A 4X23A 3AZJC 3AZNB 5AVBD 3B6FC 3UTBD 5GXQB 4KGCD 1P3BB 4UUZA 5JRGA 1P3KA 1KX5C 1BH8B 5GT3C 4KHAB 3AV2C 3REKD 3AZEA 3O62D 5GT0D 1HQ3D 4DRAA 4WU9A 5B2ID 1M18B 5B1MB 2F8NK 2CV5C 3AZKA 5DNMA 1P3IC 1P3LB 3WA9A 1F1EA 5B24D 1ZLAD
chains in the Genus database with same CATH superfamily
1B6WA 2NQBC 4G92B 5AY8B 2ZY3A 5BO0A 4XUJB 2FJ7A 4YM6C 4H9SC 3LJAA 1TAFB 3AZJB 1P3AD 5AVBC 3LELC 4ZUXD 3UT9A 3AZGA 3B6FB 4KGCC 1AOIC 5CPJD 4AWLC 5CP6A 4J8WA 5BT1D 1KX5B 5AV6D 2DQNC 5GT3B 3REIA 3AV2B 4X23D 3REKC 5B32G 3O62C 3NQJB 1HQ3C 3W98D 4YS3D 1WWIA 1P3IB 5JRGD 3X1TA 5B24C 1P3KD 2Y2KA 1EQZA 3REHA 4KUDA 2PYOC 2NQBB 3WKJA 4WU8A 3AZED 4LD9A 4WU9D 1P3GA 2Y2QA 4YM6B 3WAAC 3AZKD 1S32A 5DNMD 3WA9D 2LY8A 4J8VC 1P3PC 3A6NA 5AVBB 3LELB 4ZUXC 3MGRA 3UTBB 4KGCB 2Y2LA 1AOIB 2FJ7D 4AWLB 5AV6C 2NZDC 3C1BA 4X23C 3LJAD 3REKB 3O62B 1HQ3B 4Z66C 3W98C 3VH6W 3UT9D 4YS3C 3AZGD 3FDDA 3NQUB 1N1JA 5CP6D 5B24B 4J8WD 1P3KC 1ZLAB 2PYOB 5AV9A 3REID 5B0ZA 1P3OA 3MGQA 2JCHA 3WAAB 1P3MC 3B0BA 5BNXA 5DNMC 3X1UA 3WA9C 3X1TD 3LZ0A 1EQZD 3MVDA 4KUDD 4J8VB 1P3PB 3WKJD 4WU8D 4ZUXB 4LD9D 1KX3A 1P3GD 1S32D 5AV6B 1U35A 2NZDB 4X23B 4J8UC 4HGAC 1P3FC 4Z66B 3MGPA 2AROC 3W98B 4YS3B 3MGRD 2Y2HA 4H9OA 4H9PA 5CHLB 3LZ1D 4JJNA 1P3KB 2F8NG 5CPIA 5B40A 3W96A 4M6BA 3C1BD 5AVCA 4WU9B 3KWQC 1F66A 5B33C 1P3MB 3MNNC 3C1CC 5DNMB 5B0YA 3WA9B 3AZFC 3X1TC 3KSYA 2Y2GA 5B1LA 5BNVA 5B32A 3WKJC 4XZQA 1P3OD 4R8PA 3MGQD 1P3GC 1M19A 3AZMC 3EPHA 3X1UD 4H9QA 3LZ0D 3MVDD 4J8UB 4HGAB 1P3FB 2AROB 3X1SA 1KX3D 1TZYD 4J8WB 3LZ1C 1U35D 3AZNC 3MGSD 3H0RC 5CPKA 3KWQB 5B33B 2Y2JA 3REJC 3MNNB 4QLCD 3AZFB 3X1TB 4JJND 1EQZB 1KX4A 5B40D 4E44A 3WKJB 3W96D 3V9RA 1P3OC 4LD9B 1F66D 1P3GB 1P3LC 4E45A 3AZMB 3AZHA 5B0YD 3X1UC 5KDMB 3LZ0C 2YFVB 4H9NB 4XZQD 3MGRB 5DNNA 4R8PD 1P34A 5GSUD 4H9RA 5FUGB 1TZYC 1M19D 3LZ1B 5B31C 3MGSC 3AN2A 3REJB 4QLCC 3X1SD 2BG1A 3W97A 4WNNB 3W96C 5C3IC 2YFWA 1P3OB 3EG5B 2BYMA 3H0MC 3X1UB 3AYWA 3LZ0B 1KX4D 4G91C 3RELA 5GSUC 1TZYB 3B6GA 4Z5TA 3B0DC 3AZHD 1U35B 4UPKA 2HIOA 5B31B 3MGSB 2F8NH 3UTBC 3AV1A 5DNND 5JA4B 3KFUG 2BYKA 4QLCB 1P34D 4ZBJC 5GT0C 3W96B 4J8XA 5C3IB 5B2IC 2IO5C 3AN2D 4CAYA 3X1VA 1ZLAC 1KX4C 3W97D 4G91B 5GSUB 3VH5T 3B0DB 5G49A 3AYWD 1P3AC 4Z2MG 2L5AA 1H3OA 1WWSA 5AV5A 5CPJC 3RELD 5BT1C 3VH6T 3B6GD 4Z5TD 4ZBJB 1JFIB 5GT0B 2HIOD 5B2IB 5BS7A 2IO5B 5E5AA 3KXBA 2Y2MA 2ZY2A 3AN2C 3AV1D 2RVQD 3KUYA 5JRGC 3EPJA 2FFFB 1M1AA 1KX4B 3R45B 1B67A 3AZEC 3EPKA 4J8XD 4WU9C 3V9RB 5AV8A 3AZKC 3AL0C 3X1VD 3REHD 3AZLA 1P3AB 5B2JA 2UWXA 4EO5C 3UTAA 2FJ7C 5CPJB 3RELC 3P5JB 3W99A 5GXQA 1P3BA 3LJAC 2JSSA 2HIOC 3A6ND 2Y2IA 1BH8A 4NFTA 3UT9C 1HTAA 3AZGC 3AN2B 4KHAA 2RVQC 5AV5D 4UUZB 5JRGB 5CP6C 4J8WC 3REIC 1M18A 5B1MA 5F99A 3WTPA 3AZEB 3AZIA 3AFAA 2YFWB 3KXBD 5E5AD 3AZKB 3KUYD 3X1VC 5AY8A 1EQZC 4KUDC 3REHC 4CSRA 5AV9D 4XUJA 1M1AD 5B0ZD 4WU8C 5BO0B 4LD9C 4EO5B 5AV8D 2FJ7B 3RELB 1S32C 3B6GB 3B6FA 3H0LC 3LJAB 3AZLD 2HIOB 5B2JD 3A6NC 1KX5A 3UT9B 3MGRC 3AZGB 5GT3A 3AV2A 2RIQA 4WJ3C 5CP6B 3REIB 3W99D 5GXQD 3C1BC 2CV5A 1P3BD 3MGPD 4J8XB 3KXBC 1T3UA 1Z2CB 2NQBA 3X1VB 4KUDB 3REHB 5AV9C 5CPID 1M18D 5B1MD 5F99D 3WTPD 5B0ZC 4WU8B 3AZID 3AFAD 5AVCD 4H9SA 3MGQC 4Z2MH 1S32B 5AVBA 3LELA 5AY8D 3MVDC 4XUJD 1AOIA 5B1LD 5B32D 3A6NB 1KX3C 3REKA 2W8SA 1U35C 3C1BB 3F6TA 3MGPC 1KX5D 3KXBB 2PYOA 5GT3D 3KUYB 1N1JB 4JJNC 5AV9B 5CPIC 5B40C 5F99C 5B0ZB 2CV5D 3WAAA 3AZIC 3B0CW 5AVCC 5CPKD 1F66C 3MGQB 5AV8B 3TU4A 4J8VA 1P3PA 5BNXB 2NQBD 5B0YC 2F8NA 2HUEC 4ZUXA 3MVDB 3EPLA 5B1LC 5B32C 2ZM5A 4XZQC 2NZDA 4R8PC 1KX3B 4DQYB 1M19C 2DF4C 4Z66A 3W98A 3LELD 3W99B 4YS3A 1BH9A 1AOID 3MGPB 3X1SC 4H9PB 4H9OB 4JJNB 5CPIB 5B40B 5F99B 3WTPB 2F2AC 1P3MA 3AZIB 3AFAB 5AVCB 5CPKC 1F66B 2PYOD 5B31G 5B0YB 2ZY4A 2HUEB 4CSRB 5B1LB 5BNVB 1ULYA 5B32B 3WAAD 4XZQB 4R8PB 3TU4D 1M19B 4J8VD 4J8UA 3AZHC 1P3PD 1P3FA 2F8ND 4H9QB 2AROA 4NE3A 5DNNC 2NZDD 1P34C 3X1SB 4Z66D 3KWQA 5B33A 2CV5B 3MNNA 3C1CA 5CPKB 3AZFA 2ZY5A 2J8PA 3W97C 3AZMA 1P3MD 5KDMA 1ID3A 2YFVA 3TU4C 4H9NA 3AZHB 2G5HC 3AYWC 1BFMA 3VH5W 5FUGA 3LZ1A 5DNNB 1P34B 2Y2OA 4H9RB 3AZNA 3B6GC 4Z5TC 4DRBA 4J8UD 1P3FD 2AROD 3REJA 3AV1C 1KU5A 2JE5A 1Q9CA 1PZRA 4WNNA 3KWQD 3W97B 1P3LA 5B33D 4J8XC 3MNND 3C1CD 3AZFD 2BYMB 1A7WA 3TU4B 2F8NB 3AYWB 3IP4C 1TZYA 3AZMD 1TAFA 2Y2NA 3AZJA 5B31A 2G5IC 4Z5TB 3MGSA 1ID3D 1W2EA 5JA4A 1BH9B 2Y2PA 4QLCA 3AV1B 3UTAD 5AV5C 2BYKB 3NQJA 3AZND 3A1KA 1P3IA 3REJD 5BS7C 5E5AC 3WTPE 4CAYB 3KUYC 3A1IA 1M1AC 4YM6A 5GSUA 4WZSB 1P3LD 5AV8C 1R4VA 1ID3C 5G49B 3UTBA 4KGCA 3AZLC 5B2JC 4NE5A 1H3OB 3UTAC 5AV5B 3O62A 1JFIA 5GT0A 3AZJD 1HQ3A 4NE6A 5B31D 5B2IA 2XD5A 3W99C 3B6FD 5GXQC 1P3BC 3NQUA 5B24A 3C1CB 1ZLAA 5E5AB 3AV2D 3B0CT 3R45A 1M1AB 1M18C 5B1MC 2VQRA 3WTPC 1P3ID 3AFAC 2CWEA 2XD1A 3VH5A 1ID3B 1P3AA 4WV4B 4G92C 5AY8C 4XUJC 3AZLB 5CPJA 5B2JB 4YM6D 5AV6A 3UTAB 3VH6A 4X23A 3AZJC 3AZNB 5AVBD 3B6FC 3UTBD 5GXQB 4KGCD 1P3BB 4UUZA 5JRGA 1P3KA 1KX5C 1BH8B 5GT3C 4KHAB 3AV2C 3REKD 3AZEA 3O62D 5GT0D 1HQ3D 4DRAA 4WU9A 5B2ID 1M18B 5B1MB 2F8NK 2CV5C 3AZKA 5DNMA 1P3IC 1P3LB 3WA9A 1F1EA 5B24D 1ZLAD
chains in the Genus database with same CATH topology
1B6WA 2NQBC 4G92B 5AY8B 2ZY3A 5BO0A 4XUJB 2FJ7A 4YM6C 4H9SC 3LJAA 1TAFB 3AZJB 1P3AD 5AVBC 3LELC 4ZUXD 3UT9A 3AZGA 3B6FB 4KGCC 1AOIC 5CPJD 4AWLC 5CP6A 4J8WA 5BT1D 1KX5B 5AV6D 2DQNC 5GT3B 3REIA 3AV2B 4X23D 3REKC 5B32G 3O62C 3NQJB 1HQ3C 3W98D 4YS3D 1WWIA 1P3IB 5JRGD 3X1TA 5B24C 1P3KD 2Y2KA 1EQZA 3REHA 4KUDA 2PYOC 2NQBB 3WKJA 4WU8A 3AZED 4LD9A 4WU9D 1P3GA 2Y2QA 4YM6B 3WAAC 3AZKD 1S32A 5DNMD 3WA9D 2LY8A 4J8VC 1P3PC 3A6NA 5AVBB 3LELB 4ZUXC 3MGRA 3UTBB 4KGCB 2Y2LA 1AOIB 2FJ7D 4AWLB 5AV6C 2NZDC 3C1BA 4X23C 3LJAD 3REKB 3O62B 1HQ3B 4Z66C 3W98C 3VH6W 3UT9D 4YS3C 3AZGD 3FDDA 3NQUB 1N1JA 5CP6D 5B24B 4J8WD 1P3KC 1ZLAB 2PYOB 5AV9A 3REID 5B0ZA 1P3OA 3MGQA 2JCHA 3WAAB 1P3MC 3B0BA 5BNXA 5DNMC 3X1UA 3WA9C 3X1TD 3LZ0A 1EQZD 3MVDA 4KUDD 4J8VB 1P3PB 3WKJD 4WU8D 4ZUXB 4LD9D 1KX3A 1P3GD 1S32D 5AV6B 1U35A 2NZDB 4X23B 4J8UC 4HGAC 1P3FC 4Z66B 3MGPA 2AROC 3W98B 4YS3B 3MGRD 2Y2HA 4H9OA 4H9PA 5CHLB 3LZ1D 4JJNA 1P3KB 2F8NG 5CPIA 5B40A 3W96A 4M6BA 3C1BD 5AVCA 4WU9B 3KWQC 1F66A 5B33C 1P3MB 3MNNC 3C1CC 5DNMB 5B0YA 3WA9B 3AZFC 3X1TC 3KSYA 2Y2GA 5B1LA 5BNVA 5B32A 3WKJC 4XZQA 1P3OD 4R8PA 3MGQD 1P3GC 1M19A 3AZMC 3EPHA 3X1UD 4H9QA 3LZ0D 3MVDD 4J8UB 4HGAB 1P3FB 2AROB 3X1SA 1KX3D 1TZYD 4J8WB 3LZ1C 1U35D 3AZNC 3MGSD 3H0RC 5CPKA 3KWQB 5B33B 2Y2JA 3REJC 3MNNB 4QLCD 3AZFB 3X1TB 4JJND 1EQZB 1KX4A 5B40D 4E44A 3WKJB 3W96D 3V9RA 1P3OC 4LD9B 1F66D 1P3GB 1P3LC 4E45A 3AZMB 3AZHA 5B0YD 3X1UC 5KDMB 3LZ0C 2YFVB 4H9NB 4XZQD 3MGRB 5DNNA 4R8PD 1P34A 5GSUD 4H9RA 5FUGB 1TZYC 1M19D 3LZ1B 5B31C 3MGSC 3AN2A 3REJB 4QLCC 3X1SD 2BG1A 3W97A 4WNNB 3W96C 5C3IC 2YFWA 1P3OB 3EG5B 2BYMA 3H0MC 3X1UB 3AYWA 3LZ0B 1KX4D 4G91C 3RELA 5GSUC 1TZYB 3B6GA 4Z5TA 3B0DC 3AZHD 1U35B 4UPKA 2HIOA 5B31B 3MGSB 2F8NH 3UTBC 3AV1A 5DNND 5JA4B 3KFUG 2BYKA 4QLCB 1P34D 4ZBJC 5GT0C 3W96B 4J8XA 5C3IB 5B2IC 2IO5C 3AN2D 4CAYA 3X1VA 1ZLAC 1KX4C 3W97D 4G91B 5GSUB 3VH5T 3B0DB 5G49A 3AYWD 1P3AC 4Z2MG 2L5AA 1H3OA 1WWSA 5AV5A 5CPJC 3RELD 5BT1C 3VH6T 3B6GD 4Z5TD 4ZBJB 1JFIB 5GT0B 2HIOD 5B2IB 5BS7A 2IO5B 5E5AA 3KXBA 2Y2MA 2ZY2A 3AN2C 3AV1D 2RVQD 3KUYA 5JRGC 3EPJA 2FFFB 1M1AA 1KX4B 3R45B 1B67A 3AZEC 3EPKA 4J8XD 4WU9C 3V9RB 5AV8A 3AZKC 3AL0C 3X1VD 3REHD 3AZLA 1P3AB 5B2JA 2UWXA 4EO5C 3UTAA 2FJ7C 5CPJB 3RELC 3P5JB 3W99A 5GXQA 1P3BA 3LJAC 2JSSA 2HIOC 3A6ND 2Y2IA 1BH8A 4NFTA 3UT9C 1HTAA 3AZGC 3AN2B 4KHAA 2RVQC 5AV5D 4UUZB 5JRGB 5CP6C 4J8WC 3REIC 1M18A 5B1MA 5F99A 3WTPA 3AZEB 3AZIA 3AFAA 2YFWB 3KXBD 5E5AD 3AZKB 3KUYD 3X1VC 5AY8A 1EQZC 4KUDC 3REHC 4CSRA 5AV9D 4XUJA 1M1AD 5B0ZD 4WU8C 5BO0B 4LD9C 4EO5B 5AV8D 2FJ7B 3RELB 1S32C 3B6GB 3B6FA 3H0LC 3LJAB 3AZLD 2HIOB 5B2JD 3A6NC 1KX5A 3UT9B 3MGRC 3AZGB 5GT3A 3AV2A 2RIQA 4WJ3C 5CP6B 3REIB 3W99D 5GXQD 3C1BC 2CV5A 1P3BD 3MGPD 4J8XB 3KXBC 1T3UA 1Z2CB 2NQBA 3X1VB 4KUDB 3REHB 5AV9C 5CPID 1M18D 5B1MD 5F99D 3WTPD 5B0ZC 4WU8B 3AZID 3AFAD 5AVCD 4H9SA 3MGQC 4Z2MH 1S32B 5AVBA 3LELA 5AY8D 3MVDC 4XUJD 1AOIA 5B1LD 5B32D 3A6NB 1KX3C 3REKA 2W8SA 1U35C 3C1BB 3F6TA 3MGPC 1KX5D 3KXBB 2PYOA 5GT3D 3KUYB 1N1JB 4JJNC 5AV9B 5CPIC 5B40C 5F99C 5B0ZB 2CV5D 3WAAA 3AZIC 3B0CW 5AVCC 5CPKD 1F66C 3MGQB 5AV8B 3TU4A 4J8VA 1P3PA 5BNXB 2NQBD 5B0YC 2F8NA 2HUEC 4ZUXA 3MVDB 3EPLA 5B1LC 5B32C 2ZM5A 4XZQC 2NZDA 4R8PC 1KX3B 4DQYB 1M19C 2DF4C 4Z66A 3W98A 3LELD 3W99B 4YS3A 1BH9A 1AOID 3MGPB 3X1SC 4H9PB 4H9OB 4JJNB 5CPIB 5B40B 5F99B 3WTPB 2F2AC 1P3MA 3AZIB 3AFAB 5AVCB 5CPKC 1F66B 2PYOD 5B31G 5B0YB 2ZY4A 2HUEB 4CSRB 5B1LB 5BNVB 1ULYA 5B32B 3WAAD 4XZQB 4R8PB 3TU4D 1M19B 4J8VD 4J8UA 3AZHC 1P3PD 1P3FA 2F8ND 4H9QB 2AROA 4NE3A 5DNNC 2NZDD 1P34C 3X1SB 4Z66D 3KWQA 5B33A 2CV5B 3MNNA 3C1CA 5CPKB 3AZFA 2ZY5A 2J8PA 3W97C 3AZMA 1P3MD 5KDMA 1ID3A 2YFVA 3TU4C 4H9NA 3AZHB 2G5HC 3AYWC 1BFMA 3VH5W 5FUGA 3LZ1A 5DNNB 1P34B 2Y2OA 4H9RB 3AZNA 3B6GC 4Z5TC 4DRBA 4J8UD 1P3FD 2AROD 3REJA 3AV1C 1KU5A 2JE5A 1Q9CA 1PZRA 4WNNA 3KWQD 3W97B 1P3LA 5B33D 4J8XC 3MNND 3C1CD 3AZFD 2BYMB 1A7WA 3TU4B 2F8NB 3AYWB 3IP4C 1TZYA 3AZMD 1TAFA 2Y2NA 3AZJA 5B31A 2G5IC 4Z5TB 3MGSA 1ID3D 1W2EA 5JA4A 1BH9B 2Y2PA 4QLCA 3AV1B 3UTAD 5AV5C 2BYKB 3NQJA 3AZND 3A1KA 1P3IA 3REJD 5BS7C 5E5AC 3WTPE 4CAYB 3KUYC 3A1IA 1M1AC 4YM6A 5GSUA 4WZSB 1P3LD 5AV8C 1R4VA 1ID3C 5G49B 3UTBA 4KGCA 3AZLC 5B2JC 4NE5A 1H3OB 3UTAC 5AV5B 3O62A 1JFIA 5GT0A 3AZJD 1HQ3A 4NE6A 5B31D 5B2IA 2XD5A 3W99C 3B6FD 5GXQC 1P3BC 3NQUA 5B24A 3C1CB 1ZLAA 5E5AB 3AV2D 3B0CT 3R45A 1M1AB 1M18C 5B1MC 2VQRA 3WTPC 1P3ID 3AFAC 2CWEA 2XD1A 3VH5A 1ID3B 1P3AA 4WV4B 4G92C 5AY8C 4XUJC 3AZLB 5CPJA 5B2JB 4YM6D 5AV6A 3UTAB 3VH6A 4X23A 3AZJC 3AZNB 5AVBD 3B6FC 3UTBD 5GXQB 4KGCD 1P3BB 4UUZA 5JRGA 1P3KA 1KX5C 1BH8B 5GT3C 4KHAB 3AV2C 3REKD 3AZEA 3O62D 5GT0D 1HQ3D 4DRAA 4WU9A 5B2ID 1M18B 5B1MB 2F8NK 2CV5C 3AZKA 5DNMA 1P3IC 1P3LB 3WA9A 1F1EA 5B24D 1ZLAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6W A;  2NQB C;  4G92 B;  5AY8 B;  5BO0 A;  4XUJ B;  2FJ7 A;  4YM6 C;  4H9S C;  3LJA A;  1TAF B;  3AZJ B;  1P3A D;  5AVB C;  3LEL C;  4ZUX D;  3UT9 A;  3AZG A;  3B6F B;  4KGC C;  1AOI C;  5CPJ D;  4AWL C;  5CP6 A;  4J8W A;  5BT1 D;  1KX5 B;  5AV6 D;  5GT3 B;  3REI A;  3AV2 B;  4X23 D;  3REK C;  5B32 G;  3O62 C;  3NQJ B;  1HQ3 C;  3W98 D;  4YS3 D;  1WWI A;  1P3I B;  5JRG D;  3X1T A;  5B24 C;  1P3K D;  1EQZ A;  4KUD A;  3REH A;  2PYO C;  2NQB B;  3WKJ A;  4WU8 A;  3AZE D;  4LD9 A;  4WU9 D;  1P3G A;  4YM6 B;  3WAA C;  3AZK D;  1S32 A;  5DNM D;  3WA9 D;  2LY8 A;  4J8V C;  1P3P C;  3A6N A;  5AVB B;  3LEL B;  4ZUX C;  3MGR A;  3UTB B;  4KGC B;  1AOI B;  2FJ7 D;  4AWL B;  5AV6 C;  2NZD C;  3C1B A;  4X23 C;  3LJA D;  3REK B;  3O62 B;  1HQ3 B;  4Z66 C;  3W98 C;  3VH6 W;  3UT9 D;  4YS3 C;  3AZG D;  3NQU B;  1N1J A;  5CP6 D;  5B24 B;  4J8W D;  1P3K C;  1ZLA B;  2PYO B;  5AV9 A;  3REI D;  5B0Z A;  1P3O A;  3MGQ A;  3WAA B;  1P3M C;  3B0B A;  5BNX A;  5DNM C;  3X1U A;  3WA9 C;  3X1T D;  3LZ0 A;  1EQZ D;  3MVD A;  4KUD D;  4J8V B;  1P3P B;  3WKJ D;  4WU8 D;  4ZUX B;  4LD9 D;  1KX3 A;  1P3G D;  1S32 D;  5AV6 B;  1U35 A;  2NZD B;  4X23 B;  4J8U C;  4HGA C;  1P3F C;  4Z66 B;  3MGP A;  2ARO C;  3W98 B;  4YS3 B;  3MGR D;  4H9P A;  4H9O A;  5CHL B;  3LZ1 D;  1P3K B;  4JJN A;  2F8N G;  5CPI A;  5B40 A;  3W96 A;  4M6B A;  3C1B D;  5AVC A;  4WU9 B;  3KWQ C;  1F66 A;  5B33 C;  1P3M B;  3MNN C;  3C1C C;  5DNM B;  5B0Y A;  3WA9 B;  3AZF C;  3X1T C;  3KSY A;  5B1L A;  5BNV A;  5B32 A;  3WKJ C;  4XZQ A;  1P3O D;  4R8P A;  3MGQ D;  1P3G C;  1M19 A;  3AZM C;  3X1U D;  4H9Q A;  3LZ0 D;  3MVD D;  4J8U B;  4HGA B;  1P3F B;  2ARO B;  3X1S A;  1KX3 D;  1TZY D;  4J8W B;  3LZ1 C;  1U35 D;  3AZN C;  3MGS D;  5CPK A;  3KWQ B;  5B33 B;  3REJ C;  3MNN B;  4QLC D;  3AZF B;  3X1T B;  4JJN D;  1EQZ B;  1KX4 A;  5B40 D;  4E44 A;  3WKJ B;  3W96 D;  3V9R A;  1P3O C;  4LD9 B;  1F66 D;  1P3G B;  1P3L C;  4E45 A;  3AZM B;  3AZH A;  5B0Y D;  3X1U C;  5KDM B;  3LZ0 C;  2YFV B;  4H9N B;  4XZQ D;  3MGR B;  5DNN A;  4R8P D;  1P34 A;  5GSU D;  4H9R A;  5FUG B;  1TZY C;  1M19 D;  3LZ1 B;  5B31 C;  3MGS C;  3AN2 A;  3REJ B;  4QLC C;  3X1S D;  3W97 A;  4WNN B;  3W96 C;  5C3I C;  2YFW A;  1P3O B;  2BYM A;  3X1U B;  3AYW A;  3LZ0 B;  1KX4 D;  4G91 C;  3REL A;  5GSU C;  1TZY B;  3B6G A;  4Z5T A;  3B0D C;  3AZH D;  1U35 B;  5B31 B;  2HIO A;  3MGS B;  2F8N H;  3UTB C;  3AV1 A;  5DNN D;  5JA4 B;  2BYK A;  4QLC B;  1P34 D;  4ZBJ C;  5GT0 C;  3W96 B;  4J8X A;  5C3I B;  5B2I C;  2IO5 C;  3AN2 D;  4CAY A;  3X1V A;  1ZLA C;  1KX4 C;  3W97 D;  4G91 B;  5GSU B;  3VH5 T;  3B0D B;  5G49 A;  3AYW D;  1P3A C;  4Z2M G;  2L5A A;  1H3O A;  1WWS A;  5AV5 A;  5CPJ C;  3REL D;  5BT1 C;  3VH6 T;  3B6G D;  4Z5T D;  4ZBJ B;  1JFI B;  5GT0 B;  2HIO D;  5B2I B;  5BS7 A;  2IO5 B;  5E5A A;  3KXB A;  3AN2 C;  3AV1 D;  2RVQ D;  3KUY A;  5JRG C;  1M1A A;  1KX4 B;  3R45 B;  1B67 A;  3AZE C;  4J8X D;  4WU9 C;  3V9R B;  5AV8 A;  3AZK C;  3X1V D;  3REH D;  3AZL A;  1P3A B;  5B2J A;  4EO5 C;  3UTA A;  2FJ7 C;  5CPJ B;  3REL C;  3W99 A;  5GXQ A;  1P3B A;  3LJA C;  2JSS A;  2HIO C;  3A6N D;  4NFT A;  1BH8 A;  3UT9 C;  1HTA A;  3AZG C;  3AN2 B;  4KHA A;  2RVQ C;  5AV5 D;  4UUZ B;  5JRG B;  5CP6 C;  4J8W C;  3REI C;  1M18 A;  5B1M A;  5F99 A;  3WTP A;  3AZE B;  3AZI A;  3AFA A;  2YFW B;  3KXB D;  5E5A D;  3AZK B;  3KUY D;  3X1V C;  5AY8 A;  1EQZ C;  4KUD C;  3REH C;  4CSR A;  5AV9 D;  4XUJ A;  1M1A D;  5B0Z D;  4WU8 C;  5BO0 B;  4LD9 C;  4EO5 B;  5AV8 D;  2FJ7 B;  3REL B;  1S32 C;  3B6G B;  3B6F A;  3LJA B;  3AZL D;  2HIO B;  5B2J D;  3A6N C;  1KX5 A;  3UT9 B;  3MGR C;  3AZG B;  5GT3 A;  3AV2 A;  5CP6 B;  3REI B;  3W99 D;  5GXQ D;  3C1B C;  2CV5 A;  1P3B D;  3MGP D;  4J8X B;  3KXB C;  2NQB A;  3X1V B;  4KUD B;  3REH B;  5AV9 C;  5CPI D;  1M18 D;  5B1M D;  5F99 D;  3WTP D;  5B0Z C;  4WU8 B;  3AZI D;  3AFA D;  5AVC D;  4H9S A;  3MGQ C;  4Z2M H;  1S32 B;  5AVB A;  3LEL A;  5AY8 D;  3MVD C;  4XUJ D;  1AOI A;  5B1L D;  5B32 D;  3A6N B;  1KX3 C;  3REK A;  1U35 C;  3C1B B;  3MGP C;  1KX5 D;  3KXB B;  2PYO A;  5GT3 D;  3KUY B;  1N1J B;  4JJN C;  5AV9 B;  5CPI C;  5B40 C;  5F99 C;  5B0Z B;  2CV5 D;  3WAA A;  3AZI C;  3B0C W;  5AVC C;  5CPK D;  1F66 C;  3MGQ B;  5AV8 B;  3TU4 A;  4J8V A;  1P3P A;  5BNX B;  2NQB D;  5B0Y C;  2F8N A;  2HUE C;  4ZUX A;  3MVD B;  5B1L C;  5B32 C;  4XZQ C;  2NZD A;  4R8P C;  1KX3 B;  1M19 C;  4Z66 A;  3W98 A;  3LEL D;  3W99 B;  4YS3 A;  1BH9 A;  1AOI D;  3MGP B;  3X1S C;  4H9P B;  4H9O B;  4JJN B;  5CPI B;  5B40 B;  5F99 B;  3WTP B;  1P3M A;  3AZI B;  3AFA B;  5AVC B;  5CPK C;  1F66 B;  2PYO D;  5B31 G;  5B0Y B;  2HUE B;  4CSR B;  5B1L B;  5BNV B;  1ULY A;  5B32 B;  3WAA D;  4XZQ B;  4R8P B;  3TU4 D;  1M19 B;  4J8V D;  4J8U A;  3AZH C;  1P3P D;  1P3F A;  2F8N D;  4H9Q B;  2ARO A;  4NE3 A;  5DNN C;  2NZD D;  1P34 C;  3X1S B;  4Z66 D;  3KWQ A;  5B33 A;  2CV5 B;  3MNN A;  3C1C A;  5CPK B;  3AZF A;  3W97 C;  3AZM A;  1P3M D;  5KDM A;  1ID3 A;  2YFV A;  3TU4 C;  4H9N A;  3AZH B;  3AYW C;  1BFM A;  3VH5 W;  5FUG A;  3LZ1 A;  5DNN B;  1P34 B;  4H9R B;  3AZN A;  3B6G C;  4Z5T C;  4DRB A;  4J8U D;  1P3F D;  2ARO D;  3REJ A;  3AV1 C;  1KU5 A;  1Q9C A;  4WNN A;  3KWQ D;  3W97 B;  1P3L A;  5B33 D;  4J8X C;  3MNN D;  3C1C D;  3AZF D;  2BYM B;  1A7W A;  3TU4 B;  2F8N B;  3AYW B;  1TZY A;  3AZM D;  1TAF A;  3AZJ A;  1ID3 D;  5B31 A;  4Z5T B;  3MGS A;  5JA4 A;  1BH9 B;  4QLC A;  3AV1 B;  3UTA D;  5AV5 C;  2BYK B;  3NQJ A;  3AZN D;  1P3I A;  3REJ D;  5BS7 C;  5E5A C;  3WTP E;  4CAY B;  3KUY C;  1M1A C;  4YM6 A;  5GSU A;  4WZS B;  1P3L D;  5AV8 C;  1R4V A;  1ID3 C;  5G49 B;  3UTB A;  4KGC A;  3AZL C;  5B2J C;  4NE5 A;  1H3O B;  3UTA C;  5AV5 B;  3O62 A;  1JFI A;  5GT0 A;  3AZJ D;  1HQ3 A;  4NE6 A;  5B31 D;  5B2I A;  3W99 C;  3B6F D;  5GXQ C;  1P3B C;  3NQU A;  5B24 A;  3C1C B;  1ZLA A;  5E5A B;  3AV2 D;  3B0C T;  3R45 A;  1M1A B;  1M18 C;  5B1M C;  3WTP C;  1P3I D;  3AFA C;  2CWE A;  3VH5 A;  1ID3 B;  1P3A A;  4WV4 B;  4G92 C;  5AY8 C;  4XUJ C;  3AZL B;  5CPJ A;  5B2J B;  4YM6 D;  5AV6 A;  3UTA B;  3VH6 A;  4X23 A;  3AZJ C;  3AZN B;  5AVB D;  3B6F C;  3UTB D;  5GXQ B;  4KGC D;  1P3B B;  4UUZ A;  5JRG A;  1P3K A;  1KX5 C;  1BH8 B;  5GT3 C;  4KHA B;  3AV2 C;  3REK D;  3AZE A;  3O62 D;  5GT0 D;  1HQ3 D;  4DRA A;  4WU9 A;  5B2I D;  1M18 B;  5B1M B;  2F8N K;  2CV5 C;  3AZK A;  5DNM A;  1P3I C;  1P3L B;  3WA9 A;  1F1E A;  5B24 D;  1ZLA D; 
#chains in the Genus database with same CATH topology
 1B6W A;  2NQB C;  4G92 B;  5AY8 B;  2ZY3 A;  5BO0 A;  4XUJ B;  2FJ7 A;  4YM6 C;  4H9S C;  3LJA A;  1TAF B;  3AZJ B;  1P3A D;  5AVB C;  3LEL C;  4ZUX D;  3UT9 A;  3AZG A;  3B6F B;  4KGC C;  1AOI C;  5CPJ D;  4AWL C;  5CP6 A;  4J8W A;  5BT1 D;  1KX5 B;  5AV6 D;  2DQN C;  5GT3 B;  3REI A;  3AV2 B;  4X23 D;  3REK C;  5B32 G;  3O62 C;  3NQJ B;  1HQ3 C;  3W98 D;  4YS3 D;  1WWI A;  1P3I B;  5JRG D;  3X1T A;  5B24 C;  1P3K D;  2Y2K A;  1EQZ A;  3REH A;  4KUD A;  2PYO C;  2NQB B;  3WKJ A;  4WU8 A;  3AZE D;  4LD9 A;  4WU9 D;  1P3G A;  2Y2Q A;  4YM6 B;  3WAA C;  3AZK D;  1S32 A;  5DNM D;  3WA9 D;  2LY8 A;  4J8V C;  1P3P C;  3A6N A;  5AVB B;  3LEL B;  4ZUX C;  3MGR A;  3UTB B;  4KGC B;  2Y2L A;  1AOI B;  2FJ7 D;  4AWL B;  5AV6 C;  2NZD C;  3C1B A;  4X23 C;  3LJA D;  3REK B;  3O62 B;  1HQ3 B;  4Z66 C;  3W98 C;  3VH6 W;  3UT9 D;  4YS3 C;  3AZG D;  3FDD A;  3NQU B;  1N1J A;  5CP6 D;  5B24 B;  4J8W D;  1P3K C;  1ZLA B;  2PYO B;  5AV9 A;  3REI D;  5B0Z A;  1P3O A;  3MGQ A;  2JCH A;  3WAA B;  1P3M C;  3B0B A;  5BNX A;  5DNM C;  3X1U A;  3WA9 C;  3X1T D;  3LZ0 A;  1EQZ D;  3MVD A;  4KUD D;  4J8V B;  1P3P B;  3WKJ D;  4WU8 D;  4ZUX B;  4LD9 D;  1KX3 A;  1P3G D;  1S32 D;  5AV6 B;  1U35 A;  2NZD B;  4X23 B;  4J8U C;  4HGA C;  1P3F C;  4Z66 B;  3MGP A;  2ARO C;  3W98 B;  4YS3 B;  3MGR D;  2Y2H A;  4H9O A;  4H9P A;  5CHL B;  3LZ1 D;  4JJN A;  1P3K B;  2F8N G;  5CPI A;  5B40 A;  3W96 A;  4M6B A;  3C1B D;  5AVC A;  4WU9 B;  3KWQ C;  1F66 A;  5B33 C;  1P3M B;  3MNN C;  3C1C C;  5DNM B;  5B0Y A;  3WA9 B;  3AZF C;  3X1T C;  3KSY A;  2Y2G A;  5B1L A;  5BNV A;  5B32 A;  3WKJ C;  4XZQ A;  1P3O D;  4R8P A;  3MGQ D;  1P3G C;  1M19 A;  3AZM C;  3EPH A;  3X1U D;  4H9Q A;  3LZ0 D;  3MVD D;  4J8U B;  4HGA B;  1P3F B;  2ARO B;  3X1S A;  1KX3 D;  1TZY D;  4J8W B;  3LZ1 C;  1U35 D;  3AZN C;  3MGS D;  3H0R C;  5CPK A;  3KWQ B;  5B33 B;  2Y2J A;  3REJ C;  3MNN B;  4QLC D;  3AZF B;  3X1T B;  4JJN D;  1EQZ B;  1KX4 A;  5B40 D;  4E44 A;  3WKJ B;  3W96 D;  3V9R A;  1P3O C;  4LD9 B;  1F66 D;  1P3G B;  1P3L C;  4E45 A;  3AZM B;  3AZH A;  5B0Y D;  3X1U C;  5KDM B;  3LZ0 C;  2YFV B;  4H9N B;  4XZQ D;  3MGR B;  5DNN A;  4R8P D;  1P34 A;  5GSU D;  4H9R A;  5FUG B;  1TZY C;  1M19 D;  3LZ1 B;  5B31 C;  3MGS C;  3AN2 A;  3REJ B;  4QLC C;  3X1S D;  2BG1 A;  3W97 A;  4WNN B;  3W96 C;  5C3I C;  2YFW A;  1P3O B;  3EG5 B;  2BYM A;  3H0M C;  3X1U B;  3AYW A;  3LZ0 B;  1KX4 D;  4G91 C;  3REL A;  5GSU C;  1TZY B;  3B6G A;  4Z5T A;  3B0D C;  3AZH D;  1U35 B;  4UPK A;  2HIO A;  5B31 B;  3MGS B;  2F8N H;  3UTB C;  3AV1 A;  5DNN D;  5JA4 B;  3KFU G;  2BYK A;  4QLC B;  1P34 D;  4ZBJ C;  5GT0 C;  3W96 B;  4J8X A;  5C3I B;  5B2I C;  2IO5 C;  3AN2 D;  4CAY A;  3X1V A;  1ZLA C;  1KX4 C;  3W97 D;  4G91 B;  5GSU B;  3VH5 T;  3B0D B;  5G49 A;  3AYW D;  1P3A C;  4Z2M G;  2L5A A;  1H3O A;  1WWS A;  5AV5 A;  5CPJ C;  3REL D;  5BT1 C;  3VH6 T;  3B6G D;  4Z5T D;  4ZBJ B;  1JFI B;  5GT0 B;  2HIO D;  5B2I B;  5BS7 A;  2IO5 B;  5E5A A;  3KXB A;  2Y2M A;  2ZY2 A;  3AN2 C;  3AV1 D;  2RVQ D;  3KUY A;  5JRG C;  3EPJ A;  2FFF B;  1M1A A;  1KX4 B;  3R45 B;  1B67 A;  3AZE C;  3EPK A;  4J8X D;  4WU9 C;  3V9R B;  5AV8 A;  3AZK C;  3AL0 C;  3X1V D;  3REH D;  3AZL A;  1P3A B;  5B2J A;  2UWX A;  4EO5 C;  3UTA A;  2FJ7 C;  5CPJ B;  3REL C;  3P5J B;  3W99 A;  5GXQ A;  1P3B A;  3LJA C;  2JSS A;  2HIO C;  3A6N D;  2Y2I A;  1BH8 A;  4NFT A;  3UT9 C;  1HTA A;  3AZG C;  3AN2 B;  4KHA A;  2RVQ C;  5AV5 D;  4UUZ B;  5JRG B;  5CP6 C;  4J8W C;  3REI C;  1M18 A;  5B1M A;  5F99 A;  3WTP A;  3AZE B;  3AZI A;  3AFA A;  2YFW B;  3KXB D;  5E5A D;  3AZK B;  3KUY D;  3X1V C;  5AY8 A;  1EQZ C;  4KUD C;  3REH C;  4CSR A;  5AV9 D;  4XUJ A;  1M1A D;  5B0Z D;  4WU8 C;  5BO0 B;  4LD9 C;  4EO5 B;  5AV8 D;  2FJ7 B;  3REL B;  1S32 C;  3B6G B;  3B6F A;  3H0L C;  3LJA B;  3AZL D;  2HIO B;  5B2J D;  3A6N C;  1KX5 A;  3UT9 B;  3MGR C;  3AZG B;  5GT3 A;  3AV2 A;  2RIQ A;  4WJ3 C;  5CP6 B;  3REI B;  3W99 D;  5GXQ D;  3C1B C;  2CV5 A;  1P3B D;  3MGP D;  4J8X B;  3KXB C;  1T3U A;  1Z2C B;  2NQB A;  3X1V B;  4KUD B;  3REH B;  5AV9 C;  5CPI D;  1M18 D;  5B1M D;  5F99 D;  3WTP D;  5B0Z C;  4WU8 B;  3AZI D;  3AFA D;  5AVC D;  4H9S A;  3MGQ C;  4Z2M H;  1S32 B;  5AVB A;  3LEL A;  5AY8 D;  3MVD C;  4XUJ D;  1AOI A;  5B1L D;  5B32 D;  3A6N B;  1KX3 C;  3REK A;  2W8S A;  1U35 C;  3C1B B;  3F6T A;  3MGP C;  1KX5 D;  3KXB B;  2PYO A;  5GT3 D;  3KUY B;  1N1J B;  4JJN C;  5AV9 B;  5CPI C;  5B40 C;  5F99 C;  5B0Z B;  2CV5 D;  3WAA A;  3AZI C;  3B0C W;  5AVC C;  5CPK D;  1F66 C;  3MGQ B;  5AV8 B;  3TU4 A;  4J8V A;  1P3P A;  5BNX B;  2NQB D;  5B0Y C;  2F8N A;  2HUE C;  4ZUX A;  3MVD B;  3EPL A;  5B1L C;  5B32 C;  2ZM5 A;  4XZQ C;  2NZD A;  4R8P C;  1KX3 B;  4DQY B;  1M19 C;  2DF4 C;  4Z66 A;  3W98 A;  3LEL D;  3W99 B;  4YS3 A;  1BH9 A;  1AOI D;  3MGP B;  3X1S C;  4H9P B;  4H9O B;  4JJN B;  5CPI B;  5B40 B;  5F99 B;  3WTP B;  2F2A C;  1P3M A;  3AZI B;  3AFA B;  5AVC B;  5CPK C;  1F66 B;  2PYO D;  5B31 G;  5B0Y B;  2ZY4 A;  2HUE B;  4CSR B;  5B1L B;  5BNV B;  1ULY A;  5B32 B;  3WAA D;  4XZQ B;  4R8P B;  3TU4 D;  1M19 B;  4J8V D;  4J8U A;  3AZH C;  1P3P D;  1P3F A;  2F8N D;  4H9Q B;  2ARO A;  4NE3 A;  5DNN C;  2NZD D;  1P34 C;  3X1S B;  4Z66 D;  3KWQ A;  5B33 A;  2CV5 B;  3MNN A;  3C1C A;  5CPK B;  3AZF A;  2ZY5 A;  2J8P A;  3W97 C;  3AZM A;  1P3M D;  5KDM A;  1ID3 A;  2YFV A;  3TU4 C;  4H9N A;  3AZH B;  2G5H C;  3AYW C;  1BFM A;  3VH5 W;  5FUG A;  3LZ1 A;  5DNN B;  1P34 B;  2Y2O A;  4H9R B;  3AZN A;  3B6G C;  4Z5T C;  4DRB A;  4J8U D;  1P3F D;  2ARO D;  3REJ A;  3AV1 C;  1KU5 A;  2JE5 A;  1Q9C A;  1PZR A;  4WNN A;  3KWQ D;  3W97 B;  1P3L A;  5B33 D;  4J8X C;  3MNN D;  3C1C D;  3AZF D;  2BYM B;  1A7W A;  3TU4 B;  2F8N B;  3AYW B;  3IP4 C;  1TZY A;  3AZM D;  1TAF A;  2Y2N A;  3AZJ A;  5B31 A;  2G5I C;  4Z5T B;  3MGS A;  1ID3 D;  1W2E A;  5JA4 A;  1BH9 B;  2Y2P A;  4QLC A;  3AV1 B;  3UTA D;  5AV5 C;  2BYK B;  3NQJ A;  3AZN D;  3A1K A;  1P3I A;  3REJ D;  5BS7 C;  5E5A C;  3WTP E;  4CAY B;  3KUY C;  3A1I A;  1M1A C;  4YM6 A;  5GSU A;  4WZS B;  1P3L D;  5AV8 C;  1R4V A;  1ID3 C;  5G49 B;  3UTB A;  4KGC A;  3AZL C;  5B2J C;  4NE5 A;  1H3O B;  3UTA C;  5AV5 B;  3O62 A;  1JFI A;  5GT0 A;  3AZJ D;  1HQ3 A;  4NE6 A;  5B31 D;  5B2I A;  2XD5 A;  3W99 C;  3B6F D;  5GXQ C;  1P3B C;  3NQU A;  5B24 A;  3C1C B;  1ZLA A;  5E5A B;  3AV2 D;  3B0C T;  3R45 A;  1M1A B;  1M18 C;  5B1M C;  2VQR A;  3WTP C;  1P3I D;  3AFA C;  2CWE A;  2XD1 A;  3VH5 A;  1ID3 B;  1P3A A;  4WV4 B;  4G92 C;  5AY8 C;  4XUJ C;  3AZL B;  5CPJ A;  5B2J B;  4YM6 D;  5AV6 A;  3UTA B;  3VH6 A;  4X23 A;  3AZJ C;  3AZN B;  5AVB D;  3B6F C;  3UTB D;  5GXQ B;  4KGC D;  1P3B B;  4UUZ A;  5JRG A;  1P3K A;  1KX5 C;  1BH8 B;  5GT3 C;  4KHA B;  3AV2 C;  3REK D;  3AZE A;  3O62 D;  5GT0 D;  1HQ3 D;  4DRA A;  4WU9 A;  5B2I D;  1M18 B;  5B1M B;  2F8N K;  2CV5 C;  3AZK A;  5DNM A;  1P3I C;  1P3L B;  3WA9 A;  1F1E A;  5B24 D;  1ZLA D; 
#chains in the Genus database with same CATH homology
 1B6W A;  2NQB C;  4G92 B;  5AY8 B;  2ZY3 A;  5BO0 A;  4XUJ B;  2FJ7 A;  4YM6 C;  4H9S C;  3LJA A;  1TAF B;  3AZJ B;  1P3A D;  5AVB C;  3LEL C;  4ZUX D;  3UT9 A;  3AZG A;  3B6F B;  4KGC C;  1AOI C;  5CPJ D;  4AWL C;  5CP6 A;  4J8W A;  5BT1 D;  1KX5 B;  5AV6 D;  2DQN C;  5GT3 B;  3REI A;  3AV2 B;  4X23 D;  3REK C;  5B32 G;  3O62 C;  3NQJ B;  1HQ3 C;  3W98 D;  4YS3 D;  1WWI A;  1P3I B;  5JRG D;  3X1T A;  5B24 C;  1P3K D;  2Y2K A;  1EQZ A;  3REH A;  4KUD A;  2PYO C;  2NQB B;  3WKJ A;  4WU8 A;  3AZE D;  4LD9 A;  4WU9 D;  1P3G A;  2Y2Q A;  4YM6 B;  3WAA C;  3AZK D;  1S32 A;  5DNM D;  3WA9 D;  2LY8 A;  4J8V C;  1P3P C;  3A6N A;  5AVB B;  3LEL B;  4ZUX C;  3MGR A;  3UTB B;  4KGC B;  2Y2L A;  1AOI B;  2FJ7 D;  4AWL B;  5AV6 C;  2NZD C;  3C1B A;  4X23 C;  3LJA D;  3REK B;  3O62 B;  1HQ3 B;  4Z66 C;  3W98 C;  3VH6 W;  3UT9 D;  4YS3 C;  3AZG D;  3FDD A;  3NQU B;  1N1J A;  5CP6 D;  5B24 B;  4J8W D;  1P3K C;  1ZLA B;  2PYO B;  5AV9 A;  3REI D;  5B0Z A;  1P3O A;  3MGQ A;  2JCH A;  3WAA B;  1P3M C;  3B0B A;  5BNX A;  5DNM C;  3X1U A;  3WA9 C;  3X1T D;  3LZ0 A;  1EQZ D;  3MVD A;  4KUD D;  4J8V B;  1P3P B;  3WKJ D;  4WU8 D;  4ZUX B;  4LD9 D;  1KX3 A;  1P3G D;  1S32 D;  5AV6 B;  1U35 A;  2NZD B;  4X23 B;  4J8U C;  4HGA C;  1P3F C;  4Z66 B;  3MGP A;  2ARO C;  3W98 B;  4YS3 B;  3MGR D;  2Y2H A;  4H9O A;  4H9P A;  5CHL B;  3LZ1 D;  4JJN A;  1P3K B;  2F8N G;  5CPI A;  5B40 A;  3W96 A;  4M6B A;  3C1B D;  5AVC A;  4WU9 B;  3KWQ C;  1F66 A;  5B33 C;  1P3M B;  3MNN C;  3C1C C;  5DNM B;  5B0Y A;  3WA9 B;  3AZF C;  3X1T C;  3KSY A;  2Y2G A;  5B1L A;  5BNV A;  5B32 A;  3WKJ C;  4XZQ A;  1P3O D;  4R8P A;  3MGQ D;  1P3G C;  1M19 A;  3AZM C;  3EPH A;  3X1U D;  4H9Q A;  3LZ0 D;  3MVD D;  4J8U B;  4HGA B;  1P3F B;  2ARO B;  3X1S A;  1KX3 D;  1TZY D;  4J8W B;  3LZ1 C;  1U35 D;  3AZN C;  3MGS D;  3H0R C;  5CPK A;  3KWQ B;  5B33 B;  2Y2J A;  3REJ C;  3MNN B;  4QLC D;  3AZF B;  3X1T B;  4JJN D;  1EQZ B;  1KX4 A;  5B40 D;  4E44 A;  3WKJ B;  3W96 D;  3V9R A;  1P3O C;  4LD9 B;  1F66 D;  1P3G B;  1P3L C;  4E45 A;  3AZM B;  3AZH A;  5B0Y D;  3X1U C;  5KDM B;  3LZ0 C;  2YFV B;  4H9N B;  4XZQ D;  3MGR B;  5DNN A;  4R8P D;  1P34 A;  5GSU D;  4H9R A;  5FUG B;  1TZY C;  1M19 D;  3LZ1 B;  5B31 C;  3MGS C;  3AN2 A;  3REJ B;  4QLC C;  3X1S D;  2BG1 A;  3W97 A;  4WNN B;  3W96 C;  5C3I C;  2YFW A;  1P3O B;  3EG5 B;  2BYM A;  3H0M C;  3X1U B;  3AYW A;  3LZ0 B;  1KX4 D;  4G91 C;  3REL A;  5GSU C;  1TZY B;  3B6G A;  4Z5T A;  3B0D C;  3AZH D;  1U35 B;  4UPK A;  2HIO A;  5B31 B;  3MGS B;  2F8N H;  3UTB C;  3AV1 A;  5DNN D;  5JA4 B;  3KFU G;  2BYK A;  4QLC B;  1P34 D;  4ZBJ C;  5GT0 C;  3W96 B;  4J8X A;  5C3I B;  5B2I C;  2IO5 C;  3AN2 D;  4CAY A;  3X1V A;  1ZLA C;  1KX4 C;  3W97 D;  4G91 B;  5GSU B;  3VH5 T;  3B0D B;  5G49 A;  3AYW D;  1P3A C;  4Z2M G;  2L5A A;  1H3O A;  1WWS A;  5AV5 A;  5CPJ C;  3REL D;  5BT1 C;  3VH6 T;  3B6G D;  4Z5T D;  4ZBJ B;  1JFI B;  5GT0 B;  2HIO D;  5B2I B;  5BS7 A;  2IO5 B;  5E5A A;  3KXB A;  2Y2M A;  2ZY2 A;  3AN2 C;  3AV1 D;  2RVQ D;  3KUY A;  5JRG C;  3EPJ A;  2FFF B;  1M1A A;  1KX4 B;  3R45 B;  1B67 A;  3AZE C;  3EPK A;  4J8X D;  4WU9 C;  3V9R B;  5AV8 A;  3AZK C;  3AL0 C;  3X1V D;  3REH D;  3AZL A;  1P3A B;  5B2J A;  2UWX A;  4EO5 C;  3UTA A;  2FJ7 C;  5CPJ B;  3REL C;  3P5J B;  3W99 A;  5GXQ A;  1P3B A;  3LJA C;  2JSS A;  2HIO C;  3A6N D;  2Y2I A;  1BH8 A;  4NFT A;  3UT9 C;  1HTA A;  3AZG C;  3AN2 B;  4KHA A;  2RVQ C;  5AV5 D;  4UUZ B;  5JRG B;  5CP6 C;  4J8W C;  3REI C;  1M18 A;  5B1M A;  5F99 A;  3WTP A;  3AZE B;  3AZI A;  3AFA A;  2YFW B;  3KXB D;  5E5A D;  3AZK B;  3KUY D;  3X1V C;  5AY8 A;  1EQZ C;  4KUD C;  3REH C;  4CSR A;  5AV9 D;  4XUJ A;  1M1A D;  5B0Z D;  4WU8 C;  5BO0 B;  4LD9 C;  4EO5 B;  5AV8 D;  2FJ7 B;  3REL B;  1S32 C;  3B6G B;  3B6F A;  3H0L C;  3LJA B;  3AZL D;  2HIO B;  5B2J D;  3A6N C;  1KX5 A;  3UT9 B;  3MGR C;  3AZG B;  5GT3 A;  3AV2 A;  2RIQ A;  4WJ3 C;  5CP6 B;  3REI B;  3W99 D;  5GXQ D;  3C1B C;  2CV5 A;  1P3B D;  3MGP D;  4J8X B;  3KXB C;  1T3U A;  1Z2C B;  2NQB A;  3X1V B;  4KUD B;  3REH B;  5AV9 C;  5CPI D;  1M18 D;  5B1M D;  5F99 D;  3WTP D;  5B0Z C;  4WU8 B;  3AZI D;  3AFA D;  5AVC D;  4H9S A;  3MGQ C;  4Z2M H;  1S32 B;  5AVB A;  3LEL A;  5AY8 D;  3MVD C;  4XUJ D;  1AOI A;  5B1L D;  5B32 D;  3A6N B;  1KX3 C;  3REK A;  2W8S A;  1U35 C;  3C1B B;  3F6T A;  3MGP C;  1KX5 D;  3KXB B;  2PYO A;  5GT3 D;  3KUY B;  1N1J B;  4JJN C;  5AV9 B;  5CPI C;  5B40 C;  5F99 C;  5B0Z B;  2CV5 D;  3WAA A;  3AZI C;  3B0C W;  5AVC C;  5CPK D;  1F66 C;  3MGQ B;  5AV8 B;  3TU4 A;  4J8V A;  1P3P A;  5BNX B;  2NQB D;  5B0Y C;  2F8N A;  2HUE C;  4ZUX A;  3MVD B;  3EPL A;  5B1L C;  5B32 C;  2ZM5 A;  4XZQ C;  2NZD A;  4R8P C;  1KX3 B;  4DQY B;  1M19 C;  2DF4 C;  4Z66 A;  3W98 A;  3LEL D;  3W99 B;  4YS3 A;  1BH9 A;  1AOI D;  3MGP B;  3X1S C;  4H9P B;  4H9O B;  4JJN B;  5CPI B;  5B40 B;  5F99 B;  3WTP B;  2F2A C;  1P3M A;  3AZI B;  3AFA B;  5AVC B;  5CPK C;  1F66 B;  2PYO D;  5B31 G;  5B0Y B;  2ZY4 A;  2HUE B;  4CSR B;  5B1L B;  5BNV B;  1ULY A;  5B32 B;  3WAA D;  4XZQ B;  4R8P B;  3TU4 D;  1M19 B;  4J8V D;  4J8U A;  3AZH C;  1P3P D;  1P3F A;  2F8N D;  4H9Q B;  2ARO A;  4NE3 A;  5DNN C;  2NZD D;  1P34 C;  3X1S B;  4Z66 D;  3KWQ A;  5B33 A;  2CV5 B;  3MNN A;  3C1C A;  5CPK B;  3AZF A;  2ZY5 A;  2J8P A;  3W97 C;  3AZM A;  1P3M D;  5KDM A;  1ID3 A;  2YFV A;  3TU4 C;  4H9N A;  3AZH B;  2G5H C;  3AYW C;  1BFM A;  3VH5 W;  5FUG A;  3LZ1 A;  5DNN B;  1P34 B;  2Y2O A;  4H9R B;  3AZN A;  3B6G C;  4Z5T C;  4DRB A;  4J8U D;  1P3F D;  2ARO D;  3REJ A;  3AV1 C;  1KU5 A;  2JE5 A;  1Q9C A;  1PZR A;  4WNN A;  3KWQ D;  3W97 B;  1P3L A;  5B33 D;  4J8X C;  3MNN D;  3C1C D;  3AZF D;  2BYM B;  1A7W A;  3TU4 B;  2F8N B;  3AYW B;  3IP4 C;  1TZY A;  3AZM D;  1TAF A;  2Y2N A;  3AZJ A;  5B31 A;  2G5I C;  4Z5T B;  3MGS A;  1ID3 D;  1W2E A;  5JA4 A;  1BH9 B;  2Y2P A;  4QLC A;  3AV1 B;  3UTA D;  5AV5 C;  2BYK B;  3NQJ A;  3AZN D;  3A1K A;  1P3I A;  3REJ D;  5BS7 C;  5E5A C;  3WTP E;  4CAY B;  3KUY C;  3A1I A;  1M1A C;  4YM6 A;  5GSU A;  4WZS B;  1P3L D;  5AV8 C;  1R4V A;  1ID3 C;  5G49 B;  3UTB A;  4KGC A;  3AZL C;  5B2J C;  4NE5 A;  1H3O B;  3UTA C;  5AV5 B;  3O62 A;  1JFI A;  5GT0 A;  3AZJ D;  1HQ3 A;  4NE6 A;  5B31 D;  5B2I A;  2XD5 A;  3W99 C;  3B6F D;  5GXQ C;  1P3B C;  3NQU A;  5B24 A;  3C1C B;  1ZLA A;  5E5A B;  3AV2 D;  3B0C T;  3R45 A;  1M1A B;  1M18 C;  5B1M C;  2VQR A;  3WTP C;  1P3I D;  3AFA C;  2CWE A;  2XD1 A;  3VH5 A;  1ID3 B;  1P3A A;  4WV4 B;  4G92 C;  5AY8 C;  4XUJ C;  3AZL B;  5CPJ A;  5B2J B;  4YM6 D;  5AV6 A;  3UTA B;  3VH6 A;  4X23 A;  3AZJ C;  3AZN B;  5AVB D;  3B6F C;  3UTB D;  5GXQ B;  4KGC D;  1P3B B;  4UUZ A;  5JRG A;  1P3K A;  1KX5 C;  1BH8 B;  5GT3 C;  4KHA B;  3AV2 C;  3REK D;  3AZE A;  3O62 D;  5GT0 D;  1HQ3 D;  4DRA A;  4WU9 A;  5B2I D;  1M18 B;  5B1M B;  2F8N K;  2CV5 C;  3AZK A;  5DNM A;  1P3I C;  1P3L B;  3WA9 A;  1F1E A;  5B24 D;  1ZLA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...