1P3GB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKEISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gB00
3REJC 2YFVB 3LJAD 2PYOC 5GT0B 3AYWB 1ID3A 3A6ND 4E45A 5AVCA 3REKC 3X1UA 5B32A 3UTAD 4J8XA 3LELB 4J8UB 5CPIB 5AV5C 3W98C 2HIOD 5B1LB 5CP6A 3O62A 4Z2MH 3B0CT 5E5AC 5CPKC 1H3OB 3VH5A 3VH5W 4H9SA 3WKJA 5GT0C 2YFWA 3AYWC 5GSUA 3RELD 5AV6B 1HQ3A 3X1TB 4R8PD 3MVDB 5B0ZA 4X23B 4J8UC 5DNMD 5CPIC 5FUGB 3MGRD 3AZHD 1F1EA 5B1LC 3MGQB 4G92B 2L5AA 3AZJD 4WNNA 1P3LD 1M1AD 1P34A 3AZEB 5AV9D 4WU8B 3W96A 2NQBD 3AZGB 1P3FA 2JSSA 5BO0B 3C1CA 4XZQB 3MNNB 3WAAB 3AV2A 3X1TC 3MVDC 4KUDA 1P3AB 3WTPA 4ZBJC 4CSRB 1JFIB 4X23C 5KDMA 5AVCD 3TU4B 3REJA 3X1UD 2PYOA 3MGQC 4G92C 5B1MB 3B6FD 5B32D 3V9RA 4J8XD 3LZ0D 3REKA 3W97D 4WU8C 3B0BA 5CP6D 1P3OB 4UUZA 3AZGC 3WAAC 1N1JA 4XZQC 3MNNC 1P3IB 3C1BA 3MGSB 5B0YC 1P3AC 1P3KA 3WKJD 5GSUD 5CPKA 5AY8B 4AWLB 3X1SB 4WU9D 4XUJD 2YFVA 3AN2B 1M19B 5GT0A 5B1MC 5B0ZD 3AZKB 5GT3B 2FJ7B 1P3OC 3LELA 5CPIA 1P3IC 1P34D 3AZLD 3MGSC 1ZLAB 1P3PB 1KX4B 1KX5C 4H9QB 5AY8C 3C1CD 3X1VB 3X1SC 3LZ1B 3AZIB 3AV2D 1H3OA 4Z66D 3AN2C 4KUDD 3W99B 3REHB 5BNXB 3MGPB 5AV6A 4YM6A 3AZKC 3VH5T 5GT3C 3REJD 3MVDA 3X1TA 1P3GB 3WA9B 3AZNB 5CPJB 1HTAA 5AV8B 4H9RB 4X23A 1KX3B 5FUGA 1WWSA 4H9PA 3REKD 1P3MB 3MGQA 1ZLAC 1P3PC 1KX4C 5B40A 3X1VC 3R45B 3AZEA 3C1BD 3LZ1C 3AZIC 5GXQB 4DRBA 5AV5B 4WU8A 3W99C 4J8WB 4JJNB 3REHC 3AZGA 1P3KD 3WAAA 4XZQA 3MNNA 3MGPC 1F66B 1P3GC 3WA9C 3AZNC 4CSRA 5CPJC 5GT0D 1U35D 5AV8C 1KX3C 3TU4A 1M18B 1EQZB 1P3MC 5B1MA 4KHAB 4QLCB 1B67A 1B6WA 3LELD 5CPID 2F8NK 5GXQC 5F99B 4LD9B 4JJNC 4J8WC 3KUYB 3AV1B 1P3OA 2F8NB 4YS3B 1P3IA 1F66C 5B33D 4ZUXB 3MGSA 5AY8A 3X1SA 3B0DB 5AV6D 4YM6D 4M6BA 3NQUB 3X1TD 3MVDD 3AN2A 1M18C 1BH8B 3LJAB 1M19A 1TAFB 1EQZC 3KSYA 4QLCC 3A6NB 4X23D 4ZBJB 1TZYB 3AZKA 5GT3A 5B2ID 5F99C 3MGQD 2FJ7A 4LD9C 3UTAB 3KUYC 3AV1C 5B40D 4YS3C 4ZUXC 3AZED 1ZLAA 3WTPE 1P3PA 4KGCB 4WU8D 4H9QA 3UTBC 3X1VA 4XZQD 4EO5B 3B0DC 4Z5TD 3AZIA 2CV5D 5AVBB 4NE6A 3LJAC 3W99A 3REHA 5BNXA 3MGPA 3A6NC 5B0YB 2LY8A 3RELB 1TZYC 3TU4D 1P3GA 5G49B 4H9OA 3WA9A 4R8PB 1ID3D 3AZNA 3UT9B 5CPJA 3UTAC 5AV8A 4H9RA 1KX3A 3MGRB 5B32G 3AZHB 2HIOC 1P3MA 4KGCC 1P3OD 4WV4B 1P3LB 3VH6A 4EO5C 3O62D 5AVBC 4H9NB 5AV5A 5AV9B 4JJNA 4J8WA 3W98A 2NQBB 5AY8D 3RELC 3X1SD 1KX5B 5E5AA 4R8PC 1ULYA 1M19D 3UT9C 5B2JB 1HQ3D 3AYWA 1P3BB 3AZKD 3MGRC 3AZHC 1AOIB 1EQZA 5BT1D 4QLCA 4KHAA 2FJ7D 3B6FB 1P3LC 1M1AC 4NE5A 3LZ0B 1WWIA 1BH9B 3W97B 4J8UA 5F99A 3AZFB 5AV9C 1ZLAD 3AFAB 4LD9A 1P3PD 3AV1A 3KUYA 2NQBC 2RVQD 4YS3A 5B1LA 3X1VD 4ZUXA 2AROB 3W96D 1P3FD 3KWQB 5B2JC 4J8VB 3MGPD 3WTPD 4WU9B 1P3BC 4XUJB 4WZSB 3NQUA 2NZDB 3WA9D 3X1UC 1AOIC 1BH8A 3LJAA 3AZND 1TAFA 3B6GB 3B6FC 4DRAA 5AV8D 3A6NA 2PYOD 1TZYA 3LZ0C 3W97C 3AZFC 3AFAC 3AZLB 2AROC 5B24B 3NQJB 5JRGB 5BS7C 5AV5D 4JJND 3W98D 3KWQC 4J8WD 3REIB 4KGCA 2IO5B 5BNVB 4NFTA 4J8VC 3C1CB 4WU9C 5JA4B 4XUJC 2NZDC 5E5AD 5BO0A 5AVBA 4Z66B 5CPKD 3B6GC 4Z2MG 5B0YA 5B31B 1P3AA 3AYWD 5G49A 1BFMA 4R8PA 1JFIA 1EQZD 3UT9A 3AZMB 4G91B 5C3IB 3AZLC 5B24C 3MGRA 4J8UD 5F99D 5JRGC 4LD9D 3KUYD 3REIC 2IO5C 1P3LA 4YS3D 5B1LD 1R4VA 1N1JB 3C1CC 1S32B 3C1BB 5AV9A 4H9NA 4Z66C 5DNNB 2NQBA 1P3KB 5B31C 1KX5A 3KXBB 3UTBB 2HUEB 3AZMC 4G91C 5B2JA 1U35B 5C3IC 1P3BA 1TZYD 1AOIA 3B6FA 3LZ0A 1S32C 1BH9A 3C1BC 2F8NH 2BYMB 3W97A 3AZFA 3AFAA 4KGCD 5DNNC 1P3KC 2HIOB 4NE3A 1KX4A 2AROA 5B33B 2BYKB 3KXBC 3AZGD 3WAAD 2HUEC 5AVBD 5BS7A 3MNND 3KWQA 3LZ1A 1U35C 4J8VA 5B0YD 1P3AD 4WU9A 4XUJA 4YM6B 2NZDA 3B6GA 4CAYB 3UT9D 3LELC 5B1MD 4H9PB 5B2IB 5DNMB 5B40B 3AZLA 5B24A 5B33C 3AZJB 3NQJA 1M1AB 5JRGA 3VH6W 3R45A 1P3ID 3REIA 4HGAB 5GXQA 3MGSD 5BNVA 4Z5TB 5AV6C 5JA4A 4YM6C 1KX5D 2CV5B 4Z66A 1F66A 5B2JD 5B31A 3AN2D 1P3BD 1ID3B 5B2IC 1AOID 3AZMA 5DNMC 5AVCB 5GT3D 1M18A 3X1UB 5B40C 3AZJC 5B32B 3AZEC 4J8XB 3AZFD 3AFAD 3B0CW 4HGAC 1S32A 1KX4D 5CP6B 4Z5TC 2AROD 3O62B 2CV5C 2F8NA 5DNNA 3LZ1D 3KWQD 3AZID 4J8VD 3W99D 3WKJB 3TU4C 3REHD 2YFWB 3KXBA 2NZDD 5GSUB 3UTBA 1ID3C 1A7WA 3B6GD 5AVCC 1U35A 1P3GD 1HQ3B 5CPJD 5B32C 5B0ZB 4J8XC 1KX3D 1P3MD 1Q9CA 4E44A 5CP6C 2BYMA 5B24D 3O62C 3UTAA 4WNNB 5JRGD 1P34B 3REID 1KU5A 2HIOA 5GXQD 4AWLC 5B33A 2BYKA 4H9SC 3WKJC 3W96B 5GSUC 1P3FB 1F66D 1M19C 3AV2B 1HQ3C 4KUDB 5B31D 3WTPB 5B31G 5B0ZC 4H9OB 3RELA 5BT1C 4CAYA 5KDMB 2CWEA 3AZMD 2FJ7C 3REJB 1M18D 2PYOB 4QLCD 3V9RB 5B2IA 5DNMA 1P34C 3REKB 3AZHA 2RVQC 3AZJA 3W96C 3AV1D 1S32D 5CHLB 4UUZB 1M1AA 2F8ND 1P3FC 2F8NG 3W98B 4ZUXD 5DNND 3AV2C 4KUDC 3WTPC 4Z5TA 3VH6T 2CV5A 3KXBD 5E5AB 3UTBD 5CPKB
chains in the Genus database with same CATH superfamily
3REJC 2YFVB 3LJAD 2PYOC 5GT0B 3AYWB 1ID3A 3A6ND 4E45A 5AVCA 3AL0C 3REKC 3X1UA 5B32A 3UTAD 4J8XA 3LELB 4J8UB 5CPIB 5AV5C 3W98C 2HIOD 5B1LB 2Y2GA 5CP6A 3O62A 4Z2MH 3B0CT 5E5AC 5CPKC 3A1IA 1H3OB 3VH5A 3VH5W 4H9SA 3WKJA 2VQRA 5GT0C 2YFWA 3AYWC 5GSUA 3RELD 5AV6B 1HQ3A 3X1TB 4R8PD 3MVDB 5B0ZA 4X23B 4J8UC 5DNMD 5CPIC 5FUGB 3MGRD 3AZHD 2G5HC 3EPHA 1F1EA 5B1LC 3MGQB 4G92B 2L5AA 3AZJD 4WNNA 1P3LD 1M1AD 1P34A 3AZEB 5AV9D 4WU8B 3W96A 2F2AC 2NQBD 3AZGB 1P3FA 2JSSA 5BO0B 3C1CA 4XZQB 3MNNB 3WAAB 3AV2A 3X1TC 3MVDC 4KUDA 1P3AB 3WTPA 4ZBJC 4CSRB 1JFIB 4X23C 5KDMA 5AVCD 3TU4B 3REJA 3X1UD 2PYOA 3MGQC 4G92C 5B1MB 3B6FD 5B32D 3V9RA 4J8XD 3LZ0D 3REKA 3H0LC 3W97D 4WU8C 3B0BA 5CP6D 1P3OB 4UUZA 3AZGC 3WAAC 1N1JA 4XZQC 3MNNC 1P3IB 3C1BA 3MGSB 5B0YC 1P3AC 1P3KA 3WKJD 5GSUD 5CPKA 5AY8B 4AWLB 3X1SB 1PZRA 4WU9D 2FFFB 4XUJD 2YFVA 3AN2B 1M19B 5GT0A 5B1MC 5B0ZD 3AZKB 5GT3B 2FJ7B 1P3OC 2J8PA 3LELA 5CPIA 1P3IC 1P34D 3AZLD 3MGSC 1ZLAB 1P3PB 1KX4B 1KX5C 4H9QB 5AY8C 3C1CD 3X1VB 2DQNC 3X1SC 3LZ1B 3AZIB 3AV2D 1H3OA 4Z66D 3AN2C 4KUDD 3W99B 4WJ3C 3REHB 5BNXB 3MGPB 5AV6A 4YM6A 3AZKC 3VH5T 2RIQA 5GT3C 3MVDA 3REJD 3X1TA 1P3GB 3WA9B 3AZNB 5CPJB 1HTAA 5AV8B 4H9RB 4X23A 1KX3B 2W8SA 5FUGA 1WWSA 4H9PA 3REKD 1W2EA 2ZY4A 3MGQA 1P3MB 1ZLAC 1P3PC 1KX4C 5B40A 3X1VC 3R45B 3AZEA 3C1BD 3LZ1C 3AZIC 5GXQB 4DRBA 5AV5B 4WU8A 3W99C 4J8WB 4JJNB 3REHC 3AZGA 1P3KD 4DQYB 3WAAA 4XZQA 3MNNA 3MGPC 1F66B 1P3GC 3WA9C 3KFUG 3AZNC 4CSRA 5CPJC 5GT0D 1U35D 5AV8C 3F6TA 1KX3C 3TU4A 1M18B 1EQZB 1P3MC 5B1MA 4KHAB 4QLCB 2BG1A 1B67A 1B6WA 3LELD 2ZM5A 5CPID 2F8NK 5GXQC 5F99B 4LD9B 4JJNC 4J8WC 3KUYB 3AV1B 1P3OA 2F8NB 4YS3B 1P3IA 1F66C 5B33D 4ZUXB 3MGSA 5AY8A 3X1SA 3B0DB 5AV6D 4YM6D 4M6BA 3NQUB 3X1TD 3MVDD 3AN2A 1M18C 1BH8B 3LJAB 1M19A 1TAFB 1EQZC 3KSYA 4QLCC 3A6NB 2Y2MA 4X23D 4ZBJB 1TZYB 3AZKA 5GT3A 5B2ID 5F99C 3MGQD 2FJ7A 4LD9C 3UTAB 3KUYC 3AV1C 5B40D 4YS3C 4ZUXC 3AZED 1ZLAA 3WTPE 2Y2PA 2DF4C 4WU8D 1P3PA 4KGCB 3IP4C 4H9QA 3FDDA 3UTBC 3X1VA 4XZQD 4EO5B 3B0DC 4Z5TD 2JE5A 3AZIA 2Y2NA 2CV5D 5AVBB 4NE6A 3LJAC 3W99A 3REHA 5BNXA 3MGPA 3A6NC 5B0YB 2LY8A 3RELB 1TZYC 3TU4D 1P3GA 5G49B 4H9OA 3WA9A 4R8PB 1ID3D 3AZNA 3UT9B 5CPJA 3UTAC 5AV8A 4H9RA 1KX3A 3MGRB 5B32G 3AZHB 2HIOC 1T3UA 1P3MA 4KGCC 1P3OD 4WV4B 1P3LB 3VH6A 4EO5C 3O62D 5AVBC 4H9NB 5AV5A 5AV9B 4JJNA 4J8WA 3W98A 2NQBB 5AY8D 3RELC 3X1SD 1KX5B 5E5AA 4R8PC 1ULYA 1M19D 3UT9C 5B2JB 1HQ3D 3AYWA 1P3BB 3AZKD 3MGRC 3AZHC 1AOIB 1EQZA 5BT1D 4QLCA 4KHAA 2FJ7D 3B6FB 1P3LC 1M1AC 4NE5A 3LZ0B 1WWIA 1BH9B 3W97B 4J8UA 5F99A 3AZFB 5AV9C 1ZLAD 3AFAB 4LD9A 1P3PD 3AV1A 3KUYA 2NQBC 2RVQD 4YS3A 5B1LA 3X1VD 4ZUXA 2AROB 3W96D 3EPKA 1P3FD 3KWQB 5B2JC 4J8VB 3MGPD 3WTPD 4WU9B 1P3BC 4XUJB 4WZSB 3NQUA 2NZDB 3WA9D 3X1UC 1AOIC 1BH8A 3LJAA 3EG5B 1TAFA 2ZY5A 3AZND 3B6GB 3B6FC 4DRAA 5AV8D 3A6NA 2PYOD 1TZYA 3LZ0C 3W97C 3AZFC 3AFAC 3AZLB 2AROC 5B24B 3NQJB 3EPLA 5JRGB 5BS7C 5AV5D 4JJND 3W98D 3KWQC 4J8WD 3REIB 4KGCA 2IO5B 5BNVB 4NFTA 4J8VC 3C1CB 4WU9C 5JA4B 4XUJC 2NZDC 2Y2QA 5E5AD 5BO0A 4Z66B 5AVBA 5CPKD 2Y2HA 3B6GC 4Z2MG 5B0YA 5B31B 1P3AA 3AYWD 5G49A 1BFMA 4R8PA 1JFIA 1EQZD 3UT9A 3AZMB 4G91B 5C3IB 3AZLC 5B24C 3MGRA 2Y2JA 5F99D 5JRGC 4J8UD 4LD9D 3KUYD 3REIC 2IO5C 1P3LA 4YS3D 5B1LD 1R4VA 1N1JB 3C1CC 1S32B 3C1BB 2XD1A 5AV9A 4H9NA 4Z66C 5DNNB 2NQBA 1P3KB 3A1KA 5B31C 1KX5A 3KXBB 3UTBB 2HUEB 3H0RC 3AZMC 4G91C 5B2JA 1U35B 5C3IC 1P3BA 1TZYD 1AOIA 3B6FA 2ZY3A 3LZ0A 1S32C 1BH9A 3C1BC 2F8NH 2BYMB 3W97A 3AZFA 3AFAA 4KGCD 5DNNC 1P3KC 2HIOB 4NE3A 1KX4A 2AROA 5B33B 2BYKB 3KXBC 3AZGD 3WAAD 2HUEC 5AVBD 5BS7A 3MNND 3KWQA 3LZ1A 1U35C 4J8VA 5B0YD 1P3AD 4WU9A 4XUJA 4YM6B 2NZDA 2JCHA 3B6GA 4CAYB 3UT9D 3LELC 5B1MD 4H9PB 5B2IB 5DNMB 5B40B 3AZLA 5B24A 5B33C 1Z2CB 3AZJB 3NQJA 1M1AB 5JRGA 3VH6W 3R45A 1P3ID 3REIA 4HGAB 5GXQA 3MGSD 5BNVA 2ZY2A 4Z5TB 5AV6C 5JA4A 4YM6C 1KX5D 2CV5B 4Z66A 1F66A 5B2JD 5B31A 3AN2D 1P3BD 2XD5A 1ID3B 5B2IC 1AOID 3AZMA 5DNMC 5AVCB 5GT3D 1M18A 3X1UB 5B40C 3AZJC 5B32B 3AZEC 4J8XB 3AZFD 3AFAD 2Y2IA 3B0CW 4HGAC 2Y2OA 1S32A 1KX4D 5CP6B 4Z5TC 2AROD 3O62B 2CV5C 2F8NA 5DNNA 3LZ1D 3KWQD 3AZID 4UPKA 3H0MC 4J8VD 3W99D 3WKJB 3TU4C 3REHD 2YFWB 3KXBA 2NZDD 5GSUB 3UTBA 1ID3C 1A7WA 3B6GD 5AVCC 1U35A 1P3GD 1HQ3B 5CPJD 5B32C 5B0ZB 4J8XC 1KX3D 1P3MD 1Q9CA 4E44A 5CP6C 2BYMA 5B24D 3O62C 3UTAA 4WNNB 5JRGD 1P34B 3REID 1KU5A 2HIOA 5GXQD 4AWLC 5B33A 2BYKA 4H9SC 3WKJC 3W96B 5GSUC 2Y2LA 1P3FB 1F66D 1M19C 3AV2B 1HQ3C 4KUDB 5B31D 3WTPB 5B31G 5B0ZC 4H9OB 3RELA 5BT1C 4CAYA 5KDMB 2CWEA 3AZMD 2FJ7C 3REJB 1M18D 2PYOB 4QLCD 3V9RB 5B2IA 2UWXA 5DNMA 3EPJA 1P34C 3REKB 3AZHA 2RVQC 3P5JB 3AZJA 3W96C 3AV1D 1S32D 5CHLB 4UUZB 1M1AA 2Y2KA 1P3FC 2F8ND 2F8NG 3W98B 4ZUXD 5DNND 3AV2C 2G5IC 4KUDC 3WTPC 4Z5TA 3VH6T 2CV5A 3KXBD 5E5AB 3UTBD 5CPKB
chains in the Genus database with same CATH topology
3REJC 2YFVB 3LJAD 2PYOC 5GT0B 3AYWB 1ID3A 3A6ND 4E45A 5AVCA 3AL0C 3REKC 3X1UA 5B32A 3UTAD 4J8XA 3LELB 4J8UB 5CPIB 5AV5C 3W98C 2HIOD 5B1LB 2Y2GA 5CP6A 3O62A 4Z2MH 3B0CT 5E5AC 5CPKC 3A1IA 1H3OB 3VH5A 3VH5W 4H9SA 3WKJA 2VQRA 5GT0C 2YFWA 3AYWC 5GSUA 3RELD 5AV6B 1HQ3A 3X1TB 4R8PD 3MVDB 5B0ZA 4X23B 4J8UC 5DNMD 5CPIC 5FUGB 3MGRD 3AZHD 2G5HC 3EPHA 1F1EA 5B1LC 3MGQB 4G92B 2L5AA 3AZJD 4WNNA 1P3LD 1M1AD 1P34A 3AZEB 5AV9D 4WU8B 3W96A 2F2AC 2NQBD 3AZGB 1P3FA 2JSSA 5BO0B 3C1CA 4XZQB 3MNNB 3WAAB 3AV2A 3X1TC 3MVDC 4KUDA 1P3AB 3WTPA 4ZBJC 4CSRB 1JFIB 4X23C 5KDMA 5AVCD 3TU4B 3REJA 3X1UD 2PYOA 3MGQC 4G92C 5B1MB 3B6FD 5B32D 3V9RA 4J8XD 3LZ0D 3REKA 3H0LC 3W97D 4WU8C 3B0BA 5CP6D 1P3OB 4UUZA 3AZGC 3WAAC 1N1JA 4XZQC 3MNNC 1P3IB 3C1BA 3MGSB 5B0YC 1P3AC 1P3KA 3WKJD 5GSUD 5CPKA 5AY8B 4AWLB 3X1SB 1PZRA 4WU9D 2FFFB 4XUJD 2YFVA 3AN2B 1M19B 5GT0A 5B1MC 5B0ZD 3AZKB 5GT3B 2FJ7B 1P3OC 2J8PA 3LELA 5CPIA 1P3IC 1P34D 3AZLD 3MGSC 1ZLAB 1P3PB 1KX4B 1KX5C 4H9QB 5AY8C 3C1CD 3X1VB 2DQNC 3X1SC 3LZ1B 3AZIB 3AV2D 1H3OA 4Z66D 3AN2C 4KUDD 3W99B 4WJ3C 3REHB 5BNXB 3MGPB 5AV6A 4YM6A 3AZKC 3VH5T 2RIQA 5GT3C 3MVDA 3REJD 3X1TA 1P3GB 3WA9B 3AZNB 5CPJB 1HTAA 5AV8B 4H9RB 4X23A 1KX3B 2W8SA 5FUGA 1WWSA 4H9PA 3REKD 1W2EA 2ZY4A 3MGQA 1P3MB 1ZLAC 1P3PC 1KX4C 5B40A 3X1VC 3R45B 3AZEA 3C1BD 3LZ1C 3AZIC 5GXQB 4DRBA 5AV5B 4WU8A 3W99C 4J8WB 4JJNB 3REHC 3AZGA 1P3KD 4DQYB 3WAAA 4XZQA 3MNNA 3MGPC 1F66B 1P3GC 3WA9C 3KFUG 3AZNC 4CSRA 5CPJC 5GT0D 1U35D 5AV8C 3F6TA 1KX3C 3TU4A 1M18B 1EQZB 1P3MC 5B1MA 4KHAB 4QLCB 2BG1A 1B67A 1B6WA 3LELD 2ZM5A 5CPID 2F8NK 5GXQC 5F99B 4LD9B 4JJNC 4J8WC 3KUYB 3AV1B 1P3OA 2F8NB 4YS3B 1P3IA 1F66C 5B33D 4ZUXB 3MGSA 5AY8A 3X1SA 3B0DB 5AV6D 4YM6D 4M6BA 3NQUB 3X1TD 3MVDD 3AN2A 1M18C 1BH8B 3LJAB 1M19A 1TAFB 1EQZC 3KSYA 4QLCC 3A6NB 2Y2MA 4X23D 4ZBJB 1TZYB 3AZKA 5GT3A 5B2ID 5F99C 3MGQD 2FJ7A 4LD9C 3UTAB 3KUYC 3AV1C 5B40D 4YS3C 4ZUXC 3AZED 1ZLAA 3WTPE 2Y2PA 2DF4C 4WU8D 1P3PA 4KGCB 3IP4C 4H9QA 3FDDA 3UTBC 3X1VA 4XZQD 4EO5B 3B0DC 4Z5TD 2JE5A 3AZIA 2Y2NA 2CV5D 5AVBB 4NE6A 3LJAC 3W99A 3REHA 5BNXA 3MGPA 3A6NC 5B0YB 2LY8A 3RELB 1TZYC 3TU4D 1P3GA 5G49B 4H9OA 3WA9A 4R8PB 1ID3D 3AZNA 3UT9B 5CPJA 3UTAC 5AV8A 4H9RA 1KX3A 3MGRB 5B32G 3AZHB 2HIOC 1T3UA 1P3MA 4KGCC 1P3OD 4WV4B 1P3LB 3VH6A 4EO5C 3O62D 5AVBC 4H9NB 5AV5A 5AV9B 4JJNA 4J8WA 3W98A 2NQBB 5AY8D 3RELC 3X1SD 1KX5B 5E5AA 4R8PC 1ULYA 1M19D 3UT9C 5B2JB 1HQ3D 3AYWA 1P3BB 3AZKD 3MGRC 3AZHC 1AOIB 1EQZA 5BT1D 4QLCA 4KHAA 2FJ7D 3B6FB 1P3LC 1M1AC 4NE5A 3LZ0B 1WWIA 1BH9B 3W97B 4J8UA 5F99A 3AZFB 5AV9C 1ZLAD 3AFAB 4LD9A 1P3PD 3AV1A 3KUYA 2NQBC 2RVQD 4YS3A 5B1LA 3X1VD 4ZUXA 2AROB 3W96D 3EPKA 1P3FD 3KWQB 5B2JC 4J8VB 3MGPD 3WTPD 4WU9B 1P3BC 4XUJB 4WZSB 3NQUA 2NZDB 3WA9D 3X1UC 1AOIC 1BH8A 3LJAA 3EG5B 1TAFA 2ZY5A 3AZND 3B6GB 3B6FC 4DRAA 5AV8D 3A6NA 2PYOD 1TZYA 3LZ0C 3W97C 3AZFC 3AFAC 3AZLB 2AROC 5B24B 3NQJB 3EPLA 5JRGB 5BS7C 5AV5D 4JJND 3W98D 3KWQC 4J8WD 3REIB 4KGCA 2IO5B 5BNVB 4NFTA 4J8VC 3C1CB 4WU9C 5JA4B 4XUJC 2NZDC 2Y2QA 5E5AD 5BO0A 4Z66B 5AVBA 5CPKD 2Y2HA 3B6GC 4Z2MG 5B0YA 5B31B 1P3AA 3AYWD 5G49A 1BFMA 4R8PA 1JFIA 1EQZD 3UT9A 3AZMB 4G91B 5C3IB 3AZLC 5B24C 3MGRA 2Y2JA 5F99D 5JRGC 4J8UD 4LD9D 3KUYD 3REIC 2IO5C 1P3LA 4YS3D 5B1LD 1R4VA 1N1JB 3C1CC 1S32B 3C1BB 2XD1A 5AV9A 4H9NA 4Z66C 5DNNB 2NQBA 1P3KB 3A1KA 5B31C 1KX5A 3KXBB 3UTBB 2HUEB 3H0RC 3AZMC 4G91C 5B2JA 1U35B 5C3IC 1P3BA 1TZYD 1AOIA 3B6FA 2ZY3A 3LZ0A 1S32C 1BH9A 3C1BC 2F8NH 2BYMB 3W97A 3AZFA 3AFAA 4KGCD 5DNNC 1P3KC 2HIOB 4NE3A 1KX4A 2AROA 5B33B 2BYKB 3KXBC 3AZGD 3WAAD 2HUEC 5AVBD 5BS7A 3MNND 3KWQA 3LZ1A 1U35C 4J8VA 5B0YD 1P3AD 4WU9A 4XUJA 4YM6B 2NZDA 2JCHA 3B6GA 4CAYB 3UT9D 3LELC 5B1MD 4H9PB 5B2IB 5DNMB 5B40B 3AZLA 5B24A 5B33C 1Z2CB 3AZJB 3NQJA 1M1AB 5JRGA 3VH6W 3R45A 1P3ID 3REIA 4HGAB 5GXQA 3MGSD 5BNVA 2ZY2A 4Z5TB 5AV6C 5JA4A 4YM6C 1KX5D 2CV5B 4Z66A 1F66A 5B2JD 5B31A 3AN2D 1P3BD 2XD5A 1ID3B 5B2IC 1AOID 3AZMA 5DNMC 5AVCB 5GT3D 1M18A 3X1UB 5B40C 3AZJC 5B32B 3AZEC 4J8XB 3AZFD 3AFAD 2Y2IA 3B0CW 4HGAC 2Y2OA 1S32A 1KX4D 5CP6B 4Z5TC 2AROD 3O62B 2CV5C 2F8NA 5DNNA 3LZ1D 3KWQD 3AZID 4UPKA 3H0MC 4J8VD 3W99D 3WKJB 3TU4C 3REHD 2YFWB 3KXBA 2NZDD 5GSUB 3UTBA 1ID3C 1A7WA 3B6GD 5AVCC 1U35A 1P3GD 1HQ3B 5CPJD 5B32C 5B0ZB 4J8XC 1KX3D 1P3MD 1Q9CA 4E44A 5CP6C 2BYMA 5B24D 3O62C 3UTAA 4WNNB 5JRGD 1P34B 3REID 1KU5A 2HIOA 5GXQD 4AWLC 5B33A 2BYKA 4H9SC 3WKJC 3W96B 5GSUC 2Y2LA 1P3FB 1F66D 1M19C 3AV2B 1HQ3C 4KUDB 5B31D 3WTPB 5B31G 5B0ZC 4H9OB 3RELA 5BT1C 4CAYA 5KDMB 2CWEA 3AZMD 2FJ7C 3REJB 1M18D 2PYOB 4QLCD 3V9RB 5B2IA 2UWXA 5DNMA 3EPJA 1P34C 3REKB 3AZHA 2RVQC 3P5JB 3AZJA 3W96C 3AV1D 1S32D 5CHLB 4UUZB 1M1AA 2Y2KA 1P3FC 2F8ND 2F8NG 3W98B 4ZUXD 5DNND 3AV2C 2G5IC 4KUDC 3WTPC 4Z5TA 3VH6T 2CV5A 3KXBD 5E5AB 3UTBD 5CPKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ C;  2YFV B;  3LJA D;  2PYO C;  5GT0 B;  3AYW B;  1ID3 A;  3A6N D;  4E45 A;  5AVC A;  3REK C;  3X1U A;  5B32 A;  3UTA D;  4J8X A;  3LEL B;  4J8U B;  5CPI B;  5AV5 C;  3W98 C;  2HIO D;  5B1L B;  5CP6 A;  3O62 A;  4Z2M H;  3B0C T;  5E5A C;  5CPK C;  1H3O B;  3VH5 A;  3VH5 W;  4H9S A;  3WKJ A;  5GT0 C;  2YFW A;  3AYW C;  5GSU A;  3REL D;  5AV6 B;  1HQ3 A;  3X1T B;  4R8P D;  3MVD B;  5B0Z A;  4X23 B;  4J8U C;  5DNM D;  5CPI C;  5FUG B;  3MGR D;  3AZH D;  1F1E A;  5B1L C;  3MGQ B;  4G92 B;  2L5A A;  3AZJ D;  4WNN A;  1P3L D;  1M1A D;  1P34 A;  3AZE B;  5AV9 D;  4WU8 B;  3W96 A;  2NQB D;  3AZG B;  1P3F A;  2JSS A;  5BO0 B;  3C1C A;  4XZQ B;  3MNN B;  3WAA B;  3AV2 A;  3X1T C;  3MVD C;  4KUD A;  1P3A B;  3WTP A;  4ZBJ C;  4CSR B;  1JFI B;  4X23 C;  5KDM A;  5AVC D;  3TU4 B;  3REJ A;  3X1U D;  2PYO A;  3MGQ C;  4G92 C;  5B1M B;  3B6F D;  5B32 D;  3V9R A;  4J8X D;  3LZ0 D;  3REK A;  3W97 D;  4WU8 C;  3B0B A;  5CP6 D;  1P3O B;  4UUZ A;  3AZG C;  3WAA C;  1N1J A;  4XZQ C;  3MNN C;  1P3I B;  3C1B A;  3MGS B;  5B0Y C;  1P3A C;  1P3K A;  3WKJ D;  5GSU D;  5CPK A;  5AY8 B;  4AWL B;  3X1S B;  4WU9 D;  4XUJ D;  2YFV A;  3AN2 B;  1M19 B;  5GT0 A;  5B1M C;  5B0Z D;  3AZK B;  5GT3 B;  2FJ7 B;  1P3O C;  3LEL A;  5CPI A;  1P3I C;  1P34 D;  3AZL D;  3MGS C;  1ZLA B;  1P3P B;  1KX4 B;  1KX5 C;  4H9Q B;  5AY8 C;  3C1C D;  3X1V B;  3X1S C;  3LZ1 B;  3AZI B;  3AV2 D;  1H3O A;  4Z66 D;  3AN2 C;  4KUD D;  3W99 B;  3REH B;  5BNX B;  3MGP B;  5AV6 A;  4YM6 A;  3AZK C;  3VH5 T;  5GT3 C;  3REJ D;  3MVD A;  3X1T A;  1P3G B;  3WA9 B;  3AZN B;  5CPJ B;  1HTA A;  5AV8 B;  4H9R B;  4X23 A;  1KX3 B;  5FUG A;  1WWS A;  4H9P A;  3REK D;  1P3M B;  3MGQ A;  1ZLA C;  1P3P C;  1KX4 C;  5B40 A;  3X1V C;  3R45 B;  3AZE A;  3C1B D;  3LZ1 C;  3AZI C;  5GXQ B;  4DRB A;  5AV5 B;  4WU8 A;  3W99 C;  4J8W B;  4JJN B;  3REH C;  3AZG A;  1P3K D;  3WAA A;  4XZQ A;  3MNN A;  3MGP C;  1F66 B;  1P3G C;  3WA9 C;  3AZN C;  4CSR A;  5CPJ C;  5GT0 D;  1U35 D;  5AV8 C;  1KX3 C;  3TU4 A;  1M18 B;  1EQZ B;  1P3M C;  5B1M A;  4KHA B;  4QLC B;  1B67 A;  1B6W A;  3LEL D;  5CPI D;  2F8N K;  5GXQ C;  5F99 B;  4LD9 B;  4JJN C;  4J8W C;  3KUY B;  3AV1 B;  1P3O A;  2F8N B;  4YS3 B;  1P3I A;  1F66 C;  5B33 D;  4ZUX B;  3MGS A;  5AY8 A;  3X1S A;  3B0D B;  5AV6 D;  4YM6 D;  4M6B A;  3NQU B;  3X1T D;  3MVD D;  3AN2 A;  1M18 C;  1BH8 B;  3LJA B;  1M19 A;  1TAF B;  1EQZ C;  3KSY A;  4QLC C;  3A6N B;  4X23 D;  4ZBJ B;  1TZY B;  3AZK A;  5GT3 A;  5B2I D;  5F99 C;  3MGQ D;  2FJ7 A;  4LD9 C;  3UTA B;  3KUY C;  3AV1 C;  5B40 D;  4YS3 C;  4ZUX C;  3AZE D;  1ZLA A;  3WTP E;  1P3P A;  4KGC B;  4WU8 D;  4H9Q A;  3UTB C;  3X1V A;  4XZQ D;  4EO5 B;  3B0D C;  4Z5T D;  3AZI A;  2CV5 D;  5AVB B;  4NE6 A;  3LJA C;  3W99 A;  3REH A;  5BNX A;  3MGP A;  3A6N C;  5B0Y B;  2LY8 A;  3REL B;  1TZY C;  3TU4 D;  1P3G A;  5G49 B;  4H9O A;  3WA9 A;  4R8P B;  1ID3 D;  3AZN A;  3UT9 B;  5CPJ A;  3UTA C;  5AV8 A;  4H9R A;  1KX3 A;  3MGR B;  5B32 G;  3AZH B;  2HIO C;  1P3M A;  4KGC C;  1P3O D;  4WV4 B;  1P3L B;  3VH6 A;  4EO5 C;  3O62 D;  5AVB C;  4H9N B;  5AV5 A;  5AV9 B;  4JJN A;  4J8W A;  3W98 A;  2NQB B;  5AY8 D;  3REL C;  3X1S D;  1KX5 B;  5E5A A;  4R8P C;  1ULY A;  1M19 D;  3UT9 C;  5B2J B;  1HQ3 D;  3AYW A;  1P3B B;  3AZK D;  3MGR C;  3AZH C;  1AOI B;  1EQZ A;  5BT1 D;  4QLC A;  4KHA A;  2FJ7 D;  3B6F B;  1P3L C;  1M1A C;  4NE5 A;  3LZ0 B;  1WWI A;  1BH9 B;  3W97 B;  4J8U A;  5F99 A;  3AZF B;  5AV9 C;  1ZLA D;  3AFA B;  4LD9 A;  1P3P D;  3AV1 A;  3KUY A;  2NQB C;  2RVQ D;  4YS3 A;  5B1L A;  3X1V D;  4ZUX A;  2ARO B;  3W96 D;  1P3F D;  3KWQ B;  5B2J C;  4J8V B;  3MGP D;  3WTP D;  4WU9 B;  1P3B C;  4XUJ B;  4WZS B;  3NQU A;  2NZD B;  3WA9 D;  3X1U C;  1AOI C;  1BH8 A;  3LJA A;  3AZN D;  1TAF A;  3B6G B;  3B6F C;  4DRA A;  5AV8 D;  3A6N A;  2PYO D;  1TZY A;  3LZ0 C;  3W97 C;  3AZF C;  3AFA C;  3AZL B;  2ARO C;  5B24 B;  3NQJ B;  5JRG B;  5BS7 C;  5AV5 D;  4JJN D;  3W98 D;  3KWQ C;  4J8W D;  3REI B;  4KGC A;  2IO5 B;  5BNV B;  4NFT A;  4J8V C;  3C1C B;  4WU9 C;  5JA4 B;  4XUJ C;  2NZD C;  5E5A D;  5BO0 A;  5AVB A;  4Z66 B;  5CPK D;  3B6G C;  4Z2M G;  5B0Y A;  5B31 B;  1P3A A;  3AYW D;  5G49 A;  1BFM A;  4R8P A;  1JFI A;  1EQZ D;  3UT9 A;  3AZM B;  4G91 B;  5C3I B;  3AZL C;  5B24 C;  3MGR A;  4J8U D;  5F99 D;  5JRG C;  4LD9 D;  3KUY D;  3REI C;  2IO5 C;  1P3L A;  4YS3 D;  5B1L D;  1R4V A;  1N1J B;  3C1C C;  1S32 B;  3C1B B;  5AV9 A;  4H9N A;  4Z66 C;  5DNN B;  2NQB A;  1P3K B;  5B31 C;  1KX5 A;  3KXB B;  3UTB B;  2HUE B;  3AZM C;  4G91 C;  5B2J A;  1U35 B;  5C3I C;  1P3B A;  1TZY D;  1AOI A;  3B6F A;  3LZ0 A;  1S32 C;  1BH9 A;  3C1B C;  2F8N H;  2BYM B;  3W97 A;  3AZF A;  3AFA A;  4KGC D;  5DNN C;  1P3K C;  2HIO B;  4NE3 A;  1KX4 A;  2ARO A;  5B33 B;  2BYK B;  3KXB C;  3AZG D;  3WAA D;  2HUE C;  5AVB D;  5BS7 A;  3MNN D;  3KWQ A;  3LZ1 A;  1U35 C;  4J8V A;  5B0Y D;  1P3A D;  4WU9 A;  4XUJ A;  4YM6 B;  2NZD A;  3B6G A;  4CAY B;  3UT9 D;  3LEL C;  5B1M D;  4H9P B;  5B2I B;  5DNM B;  5B40 B;  3AZL A;  5B24 A;  5B33 C;  3AZJ B;  3NQJ A;  1M1A B;  5JRG A;  3VH6 W;  3R45 A;  1P3I D;  3REI A;  4HGA B;  5GXQ A;  3MGS D;  5BNV A;  4Z5T B;  5AV6 C;  5JA4 A;  4YM6 C;  1KX5 D;  2CV5 B;  4Z66 A;  1F66 A;  5B2J D;  5B31 A;  3AN2 D;  1P3B D;  1ID3 B;  5B2I C;  1AOI D;  3AZM A;  5DNM C;  5AVC B;  5GT3 D;  1M18 A;  3X1U B;  5B40 C;  3AZJ C;  5B32 B;  3AZE C;  4J8X B;  3AZF D;  3AFA D;  3B0C W;  4HGA C;  1S32 A;  1KX4 D;  5CP6 B;  4Z5T C;  2ARO D;  3O62 B;  2CV5 C;  2F8N A;  5DNN A;  3LZ1 D;  3KWQ D;  3AZI D;  4J8V D;  3W99 D;  3WKJ B;  3TU4 C;  3REH D;  2YFW B;  3KXB A;  2NZD D;  5GSU B;  3UTB A;  1ID3 C;  1A7W A;  3B6G D;  5AVC C;  1U35 A;  1P3G D;  1HQ3 B;  5CPJ D;  5B32 C;  5B0Z B;  4J8X C;  1KX3 D;  1P3M D;  1Q9C A;  4E44 A;  5CP6 C;  2BYM A;  5B24 D;  3O62 C;  3UTA A;  4WNN B;  5JRG D;  1P34 B;  3REI D;  1KU5 A;  2HIO A;  5GXQ D;  4AWL C;  5B33 A;  2BYK A;  4H9S C;  3WKJ C;  3W96 B;  5GSU C;  1P3F B;  1F66 D;  1M19 C;  3AV2 B;  1HQ3 C;  4KUD B;  5B31 D;  3WTP B;  5B31 G;  5B0Z C;  4H9O B;  3REL A;  5BT1 C;  4CAY A;  5KDM B;  2CWE A;  3AZM D;  2FJ7 C;  3REJ B;  1M18 D;  2PYO B;  4QLC D;  3V9R B;  5B2I A;  5DNM A;  1P34 C;  3REK B;  3AZH A;  2RVQ C;  3AZJ A;  3W96 C;  3AV1 D;  1S32 D;  5CHL B;  4UUZ B;  1M1A A;  2F8N D;  1P3F C;  2F8N G;  3W98 B;  4ZUX D;  5DNN D;  3AV2 C;  4KUD C;  3WTP C;  4Z5T A;  3VH6 T;  2CV5 A;  3KXB D;  5E5A B;  3UTB D;  5CPK B; 
#chains in the Genus database with same CATH topology
 3REJ C;  2YFV B;  3LJA D;  2PYO C;  5GT0 B;  3AYW B;  1ID3 A;  3A6N D;  4E45 A;  5AVC A;  3AL0 C;  3REK C;  3X1U A;  5B32 A;  3UTA D;  4J8X A;  3LEL B;  4J8U B;  5CPI B;  5AV5 C;  3W98 C;  2HIO D;  5B1L B;  2Y2G A;  5CP6 A;  3O62 A;  4Z2M H;  3B0C T;  5E5A C;  5CPK C;  3A1I A;  1H3O B;  3VH5 A;  3VH5 W;  4H9S A;  3WKJ A;  2VQR A;  5GT0 C;  2YFW A;  3AYW C;  5GSU A;  3REL D;  5AV6 B;  1HQ3 A;  3X1T B;  4R8P D;  3MVD B;  5B0Z A;  4X23 B;  4J8U C;  5DNM D;  5CPI C;  5FUG B;  3MGR D;  3AZH D;  2G5H C;  3EPH A;  1F1E A;  5B1L C;  3MGQ B;  4G92 B;  2L5A A;  3AZJ D;  4WNN A;  1P3L D;  1M1A D;  1P34 A;  3AZE B;  5AV9 D;  4WU8 B;  3W96 A;  2F2A C;  2NQB D;  3AZG B;  1P3F A;  2JSS A;  5BO0 B;  3C1C A;  4XZQ B;  3MNN B;  3WAA B;  3AV2 A;  3X1T C;  3MVD C;  4KUD A;  1P3A B;  3WTP A;  4ZBJ C;  4CSR B;  1JFI B;  4X23 C;  5KDM A;  5AVC D;  3TU4 B;  3REJ A;  3X1U D;  2PYO A;  3MGQ C;  4G92 C;  5B1M B;  3B6F D;  5B32 D;  3V9R A;  4J8X D;  3LZ0 D;  3REK A;  3H0L C;  3W97 D;  4WU8 C;  3B0B A;  5CP6 D;  1P3O B;  4UUZ A;  3AZG C;  3WAA C;  1N1J A;  4XZQ C;  3MNN C;  1P3I B;  3C1B A;  3MGS B;  5B0Y C;  1P3A C;  1P3K A;  3WKJ D;  5GSU D;  5CPK A;  5AY8 B;  4AWL B;  3X1S B;  1PZR A;  4WU9 D;  2FFF B;  4XUJ D;  2YFV A;  3AN2 B;  1M19 B;  5GT0 A;  5B1M C;  5B0Z D;  3AZK B;  5GT3 B;  2FJ7 B;  1P3O C;  2J8P A;  3LEL A;  5CPI A;  1P3I C;  1P34 D;  3AZL D;  3MGS C;  1ZLA B;  1P3P B;  1KX4 B;  1KX5 C;  4H9Q B;  5AY8 C;  3C1C D;  3X1V B;  2DQN C;  3X1S C;  3LZ1 B;  3AZI B;  3AV2 D;  1H3O A;  4Z66 D;  3AN2 C;  4KUD D;  3W99 B;  4WJ3 C;  3REH B;  5BNX B;  3MGP B;  5AV6 A;  4YM6 A;  3AZK C;  3VH5 T;  2RIQ A;  5GT3 C;  3MVD A;  3REJ D;  3X1T A;  1P3G B;  3WA9 B;  3AZN B;  5CPJ B;  1HTA A;  5AV8 B;  4H9R B;  4X23 A;  1KX3 B;  2W8S A;  5FUG A;  1WWS A;  4H9P A;  3REK D;  1W2E A;  2ZY4 A;  3MGQ A;  1P3M B;  1ZLA C;  1P3P C;  1KX4 C;  5B40 A;  3X1V C;  3R45 B;  3AZE A;  3C1B D;  3LZ1 C;  3AZI C;  5GXQ B;  4DRB A;  5AV5 B;  4WU8 A;  3W99 C;  4J8W B;  4JJN B;  3REH C;  3AZG A;  1P3K D;  4DQY B;  3WAA A;  4XZQ A;  3MNN A;  3MGP C;  1F66 B;  1P3G C;  3WA9 C;  3KFU G;  3AZN C;  4CSR A;  5CPJ C;  5GT0 D;  1U35 D;  5AV8 C;  3F6T A;  1KX3 C;  3TU4 A;  1M18 B;  1EQZ B;  1P3M C;  5B1M A;  4KHA B;  4QLC B;  2BG1 A;  1B67 A;  1B6W A;  3LEL D;  2ZM5 A;  5CPI D;  2F8N K;  5GXQ C;  5F99 B;  4LD9 B;  4JJN C;  4J8W C;  3KUY B;  3AV1 B;  1P3O A;  2F8N B;  4YS3 B;  1P3I A;  1F66 C;  5B33 D;  4ZUX B;  3MGS A;  5AY8 A;  3X1S A;  3B0D B;  5AV6 D;  4YM6 D;  4M6B A;  3NQU B;  3X1T D;  3MVD D;  3AN2 A;  1M18 C;  1BH8 B;  3LJA B;  1M19 A;  1TAF B;  1EQZ C;  3KSY A;  4QLC C;  3A6N B;  2Y2M A;  4X23 D;  4ZBJ B;  1TZY B;  3AZK A;  5GT3 A;  5B2I D;  5F99 C;  3MGQ D;  2FJ7 A;  4LD9 C;  3UTA B;  3KUY C;  3AV1 C;  5B40 D;  4YS3 C;  4ZUX C;  3AZE D;  1ZLA A;  3WTP E;  2Y2P A;  2DF4 C;  4WU8 D;  1P3P A;  4KGC B;  3IP4 C;  4H9Q A;  3FDD A;  3UTB C;  3X1V A;  4XZQ D;  4EO5 B;  3B0D C;  4Z5T D;  2JE5 A;  3AZI A;  2Y2N A;  2CV5 D;  5AVB B;  4NE6 A;  3LJA C;  3W99 A;  3REH A;  5BNX A;  3MGP A;  3A6N C;  5B0Y B;  2LY8 A;  3REL B;  1TZY C;  3TU4 D;  1P3G A;  5G49 B;  4H9O A;  3WA9 A;  4R8P B;  1ID3 D;  3AZN A;  3UT9 B;  5CPJ A;  3UTA C;  5AV8 A;  4H9R A;  1KX3 A;  3MGR B;  5B32 G;  3AZH B;  2HIO C;  1T3U A;  1P3M A;  4KGC C;  1P3O D;  4WV4 B;  1P3L B;  3VH6 A;  4EO5 C;  3O62 D;  5AVB C;  4H9N B;  5AV5 A;  5AV9 B;  4JJN A;  4J8W A;  3W98 A;  2NQB B;  5AY8 D;  3REL C;  3X1S D;  1KX5 B;  5E5A A;  4R8P C;  1ULY A;  1M19 D;  3UT9 C;  5B2J B;  1HQ3 D;  3AYW A;  1P3B B;  3AZK D;  3MGR C;  3AZH C;  1AOI B;  1EQZ A;  5BT1 D;  4QLC A;  4KHA A;  2FJ7 D;  3B6F B;  1P3L C;  1M1A C;  4NE5 A;  3LZ0 B;  1WWI A;  1BH9 B;  3W97 B;  4J8U A;  5F99 A;  3AZF B;  5AV9 C;  1ZLA D;  3AFA B;  4LD9 A;  1P3P D;  3AV1 A;  3KUY A;  2NQB C;  2RVQ D;  4YS3 A;  5B1L A;  3X1V D;  4ZUX A;  2ARO B;  3W96 D;  3EPK A;  1P3F D;  3KWQ B;  5B2J C;  4J8V B;  3MGP D;  3WTP D;  4WU9 B;  1P3B C;  4XUJ B;  4WZS B;  3NQU A;  2NZD B;  3WA9 D;  3X1U C;  1AOI C;  1BH8 A;  3LJA A;  3EG5 B;  1TAF A;  2ZY5 A;  3AZN D;  3B6G B;  3B6F C;  4DRA A;  5AV8 D;  3A6N A;  2PYO D;  1TZY A;  3LZ0 C;  3W97 C;  3AZF C;  3AFA C;  3AZL B;  2ARO C;  5B24 B;  3NQJ B;  3EPL A;  5JRG B;  5BS7 C;  5AV5 D;  4JJN D;  3W98 D;  3KWQ C;  4J8W D;  3REI B;  4KGC A;  2IO5 B;  5BNV B;  4NFT A;  4J8V C;  3C1C B;  4WU9 C;  5JA4 B;  4XUJ C;  2NZD C;  2Y2Q A;  5E5A D;  5BO0 A;  4Z66 B;  5AVB A;  5CPK D;  2Y2H A;  3B6G C;  4Z2M G;  5B0Y A;  5B31 B;  1P3A A;  3AYW D;  5G49 A;  1BFM A;  4R8P A;  1JFI A;  1EQZ D;  3UT9 A;  3AZM B;  4G91 B;  5C3I B;  3AZL C;  5B24 C;  3MGR A;  2Y2J A;  5F99 D;  5JRG C;  4J8U D;  4LD9 D;  3KUY D;  3REI C;  2IO5 C;  1P3L A;  4YS3 D;  5B1L D;  1R4V A;  1N1J B;  3C1C C;  1S32 B;  3C1B B;  2XD1 A;  5AV9 A;  4H9N A;  4Z66 C;  5DNN B;  2NQB A;  1P3K B;  3A1K A;  5B31 C;  1KX5 A;  3KXB B;  3UTB B;  2HUE B;  3H0R C;  3AZM C;  4G91 C;  5B2J A;  1U35 B;  5C3I C;  1P3B A;  1TZY D;  1AOI A;  3B6F A;  2ZY3 A;  3LZ0 A;  1S32 C;  1BH9 A;  3C1B C;  2F8N H;  2BYM B;  3W97 A;  3AZF A;  3AFA A;  4KGC D;  5DNN C;  1P3K C;  2HIO B;  4NE3 A;  1KX4 A;  2ARO A;  5B33 B;  2BYK B;  3KXB C;  3AZG D;  3WAA D;  2HUE C;  5AVB D;  5BS7 A;  3MNN D;  3KWQ A;  3LZ1 A;  1U35 C;  4J8V A;  5B0Y D;  1P3A D;  4WU9 A;  4XUJ A;  4YM6 B;  2NZD A;  2JCH A;  3B6G A;  4CAY B;  3UT9 D;  3LEL C;  5B1M D;  4H9P B;  5B2I B;  5DNM B;  5B40 B;  3AZL A;  5B24 A;  5B33 C;  1Z2C B;  3AZJ B;  3NQJ A;  1M1A B;  5JRG A;  3VH6 W;  3R45 A;  1P3I D;  3REI A;  4HGA B;  5GXQ A;  3MGS D;  5BNV A;  2ZY2 A;  4Z5T B;  5AV6 C;  5JA4 A;  4YM6 C;  1KX5 D;  2CV5 B;  4Z66 A;  1F66 A;  5B2J D;  5B31 A;  3AN2 D;  1P3B D;  2XD5 A;  1ID3 B;  5B2I C;  1AOI D;  3AZM A;  5DNM C;  5AVC B;  5GT3 D;  1M18 A;  3X1U B;  5B40 C;  3AZJ C;  5B32 B;  3AZE C;  4J8X B;  3AZF D;  3AFA D;  2Y2I A;  3B0C W;  4HGA C;  2Y2O A;  1S32 A;  1KX4 D;  5CP6 B;  4Z5T C;  2ARO D;  3O62 B;  2CV5 C;  2F8N A;  5DNN A;  3LZ1 D;  3KWQ D;  3AZI D;  4UPK A;  3H0M C;  4J8V D;  3W99 D;  3WKJ B;  3TU4 C;  3REH D;  2YFW B;  3KXB A;  2NZD D;  5GSU B;  3UTB A;  1ID3 C;  1A7W A;  3B6G D;  5AVC C;  1U35 A;  1P3G D;  1HQ3 B;  5CPJ D;  5B32 C;  5B0Z B;  4J8X C;  1KX3 D;  1P3M D;  1Q9C A;  4E44 A;  5CP6 C;  2BYM A;  5B24 D;  3O62 C;  3UTA A;  4WNN B;  5JRG D;  1P34 B;  3REI D;  1KU5 A;  2HIO A;  5GXQ D;  4AWL C;  5B33 A;  2BYK A;  4H9S C;  3WKJ C;  3W96 B;  5GSU C;  2Y2L A;  1P3F B;  1F66 D;  1M19 C;  3AV2 B;  1HQ3 C;  4KUD B;  5B31 D;  3WTP B;  5B31 G;  5B0Z C;  4H9O B;  3REL A;  5BT1 C;  4CAY A;  5KDM B;  2CWE A;  3AZM D;  2FJ7 C;  3REJ B;  1M18 D;  2PYO B;  4QLC D;  3V9R B;  5B2I A;  2UWX A;  5DNM A;  3EPJ A;  1P34 C;  3REK B;  3AZH A;  2RVQ C;  3P5J B;  3AZJ A;  3W96 C;  3AV1 D;  1S32 D;  5CHL B;  4UUZ B;  1M1A A;  2Y2K A;  1P3F C;  2F8N D;  2F8N G;  3W98 B;  4ZUX D;  5DNN D;  3AV2 C;  2G5I C;  4KUD C;  3WTP C;  4Z5T A;  3VH6 T;  2CV5 A;  3KXB D;  5E5A B;  3UTB D;  5CPK B; 
#chains in the Genus database with same CATH homology
 3REJ C;  2YFV B;  3LJA D;  2PYO C;  5GT0 B;  3AYW B;  1ID3 A;  3A6N D;  4E45 A;  5AVC A;  3AL0 C;  3REK C;  3X1U A;  5B32 A;  3UTA D;  4J8X A;  3LEL B;  4J8U B;  5CPI B;  5AV5 C;  3W98 C;  2HIO D;  5B1L B;  2Y2G A;  5CP6 A;  3O62 A;  4Z2M H;  3B0C T;  5E5A C;  5CPK C;  3A1I A;  1H3O B;  3VH5 A;  3VH5 W;  4H9S A;  3WKJ A;  2VQR A;  5GT0 C;  2YFW A;  3AYW C;  5GSU A;  3REL D;  5AV6 B;  1HQ3 A;  3X1T B;  4R8P D;  3MVD B;  5B0Z A;  4X23 B;  4J8U C;  5DNM D;  5CPI C;  5FUG B;  3MGR D;  3AZH D;  2G5H C;  3EPH A;  1F1E A;  5B1L C;  3MGQ B;  4G92 B;  2L5A A;  3AZJ D;  4WNN A;  1P3L D;  1M1A D;  1P34 A;  3AZE B;  5AV9 D;  4WU8 B;  3W96 A;  2F2A C;  2NQB D;  3AZG B;  1P3F A;  2JSS A;  5BO0 B;  3C1C A;  4XZQ B;  3MNN B;  3WAA B;  3AV2 A;  3X1T C;  3MVD C;  4KUD A;  1P3A B;  3WTP A;  4ZBJ C;  4CSR B;  1JFI B;  4X23 C;  5KDM A;  5AVC D;  3TU4 B;  3REJ A;  3X1U D;  2PYO A;  3MGQ C;  4G92 C;  5B1M B;  3B6F D;  5B32 D;  3V9R A;  4J8X D;  3LZ0 D;  3REK A;  3H0L C;  3W97 D;  4WU8 C;  3B0B A;  5CP6 D;  1P3O B;  4UUZ A;  3AZG C;  3WAA C;  1N1J A;  4XZQ C;  3MNN C;  1P3I B;  3C1B A;  3MGS B;  5B0Y C;  1P3A C;  1P3K A;  3WKJ D;  5GSU D;  5CPK A;  5AY8 B;  4AWL B;  3X1S B;  1PZR A;  4WU9 D;  2FFF B;  4XUJ D;  2YFV A;  3AN2 B;  1M19 B;  5GT0 A;  5B1M C;  5B0Z D;  3AZK B;  5GT3 B;  2FJ7 B;  1P3O C;  2J8P A;  3LEL A;  5CPI A;  1P3I C;  1P34 D;  3AZL D;  3MGS C;  1ZLA B;  1P3P B;  1KX4 B;  1KX5 C;  4H9Q B;  5AY8 C;  3C1C D;  3X1V B;  2DQN C;  3X1S C;  3LZ1 B;  3AZI B;  3AV2 D;  1H3O A;  4Z66 D;  3AN2 C;  4KUD D;  3W99 B;  4WJ3 C;  3REH B;  5BNX B;  3MGP B;  5AV6 A;  4YM6 A;  3AZK C;  3VH5 T;  2RIQ A;  5GT3 C;  3MVD A;  3REJ D;  3X1T A;  1P3G B;  3WA9 B;  3AZN B;  5CPJ B;  1HTA A;  5AV8 B;  4H9R B;  4X23 A;  1KX3 B;  2W8S A;  5FUG A;  1WWS A;  4H9P A;  3REK D;  1W2E A;  2ZY4 A;  3MGQ A;  1P3M B;  1ZLA C;  1P3P C;  1KX4 C;  5B40 A;  3X1V C;  3R45 B;  3AZE A;  3C1B D;  3LZ1 C;  3AZI C;  5GXQ B;  4DRB A;  5AV5 B;  4WU8 A;  3W99 C;  4J8W B;  4JJN B;  3REH C;  3AZG A;  1P3K D;  4DQY B;  3WAA A;  4XZQ A;  3MNN A;  3MGP C;  1F66 B;  1P3G C;  3WA9 C;  3KFU G;  3AZN C;  4CSR A;  5CPJ C;  5GT0 D;  1U35 D;  5AV8 C;  3F6T A;  1KX3 C;  3TU4 A;  1M18 B;  1EQZ B;  1P3M C;  5B1M A;  4KHA B;  4QLC B;  2BG1 A;  1B67 A;  1B6W A;  3LEL D;  2ZM5 A;  5CPI D;  2F8N K;  5GXQ C;  5F99 B;  4LD9 B;  4JJN C;  4J8W C;  3KUY B;  3AV1 B;  1P3O A;  2F8N B;  4YS3 B;  1P3I A;  1F66 C;  5B33 D;  4ZUX B;  3MGS A;  5AY8 A;  3X1S A;  3B0D B;  5AV6 D;  4YM6 D;  4M6B A;  3NQU B;  3X1T D;  3MVD D;  3AN2 A;  1M18 C;  1BH8 B;  3LJA B;  1M19 A;  1TAF B;  1EQZ C;  3KSY A;  4QLC C;  3A6N B;  2Y2M A;  4X23 D;  4ZBJ B;  1TZY B;  3AZK A;  5GT3 A;  5B2I D;  5F99 C;  3MGQ D;  2FJ7 A;  4LD9 C;  3UTA B;  3KUY C;  3AV1 C;  5B40 D;  4YS3 C;  4ZUX C;  3AZE D;  1ZLA A;  3WTP E;  2Y2P A;  2DF4 C;  4WU8 D;  1P3P A;  4KGC B;  3IP4 C;  4H9Q A;  3FDD A;  3UTB C;  3X1V A;  4XZQ D;  4EO5 B;  3B0D C;  4Z5T D;  2JE5 A;  3AZI A;  2Y2N A;  2CV5 D;  5AVB B;  4NE6 A;  3LJA C;  3W99 A;  3REH A;  5BNX A;  3MGP A;  3A6N C;  5B0Y B;  2LY8 A;  3REL B;  1TZY C;  3TU4 D;  1P3G A;  5G49 B;  4H9O A;  3WA9 A;  4R8P B;  1ID3 D;  3AZN A;  3UT9 B;  5CPJ A;  3UTA C;  5AV8 A;  4H9R A;  1KX3 A;  3MGR B;  5B32 G;  3AZH B;  2HIO C;  1T3U A;  1P3M A;  4KGC C;  1P3O D;  4WV4 B;  1P3L B;  3VH6 A;  4EO5 C;  3O62 D;  5AVB C;  4H9N B;  5AV5 A;  5AV9 B;  4JJN A;  4J8W A;  3W98 A;  2NQB B;  5AY8 D;  3REL C;  3X1S D;  1KX5 B;  5E5A A;  4R8P C;  1ULY A;  1M19 D;  3UT9 C;  5B2J B;  1HQ3 D;  3AYW A;  1P3B B;  3AZK D;  3MGR C;  3AZH C;  1AOI B;  1EQZ A;  5BT1 D;  4QLC A;  4KHA A;  2FJ7 D;  3B6F B;  1P3L C;  1M1A C;  4NE5 A;  3LZ0 B;  1WWI A;  1BH9 B;  3W97 B;  4J8U A;  5F99 A;  3AZF B;  5AV9 C;  1ZLA D;  3AFA B;  4LD9 A;  1P3P D;  3AV1 A;  3KUY A;  2NQB C;  2RVQ D;  4YS3 A;  5B1L A;  3X1V D;  4ZUX A;  2ARO B;  3W96 D;  3EPK A;  1P3F D;  3KWQ B;  5B2J C;  4J8V B;  3MGP D;  3WTP D;  4WU9 B;  1P3B C;  4XUJ B;  4WZS B;  3NQU A;  2NZD B;  3WA9 D;  3X1U C;  1AOI C;  1BH8 A;  3LJA A;  3EG5 B;  1TAF A;  2ZY5 A;  3AZN D;  3B6G B;  3B6F C;  4DRA A;  5AV8 D;  3A6N A;  2PYO D;  1TZY A;  3LZ0 C;  3W97 C;  3AZF C;  3AFA C;  3AZL B;  2ARO C;  5B24 B;  3NQJ B;  3EPL A;  5JRG B;  5BS7 C;  5AV5 D;  4JJN D;  3W98 D;  3KWQ C;  4J8W D;  3REI B;  4KGC A;  2IO5 B;  5BNV B;  4NFT A;  4J8V C;  3C1C B;  4WU9 C;  5JA4 B;  4XUJ C;  2NZD C;  2Y2Q A;  5E5A D;  5BO0 A;  4Z66 B;  5AVB A;  5CPK D;  2Y2H A;  3B6G C;  4Z2M G;  5B0Y A;  5B31 B;  1P3A A;  3AYW D;  5G49 A;  1BFM A;  4R8P A;  1JFI A;  1EQZ D;  3UT9 A;  3AZM B;  4G91 B;  5C3I B;  3AZL C;  5B24 C;  3MGR A;  2Y2J A;  5F99 D;  5JRG C;  4J8U D;  4LD9 D;  3KUY D;  3REI C;  2IO5 C;  1P3L A;  4YS3 D;  5B1L D;  1R4V A;  1N1J B;  3C1C C;  1S32 B;  3C1B B;  2XD1 A;  5AV9 A;  4H9N A;  4Z66 C;  5DNN B;  2NQB A;  1P3K B;  3A1K A;  5B31 C;  1KX5 A;  3KXB B;  3UTB B;  2HUE B;  3H0R C;  3AZM C;  4G91 C;  5B2J A;  1U35 B;  5C3I C;  1P3B A;  1TZY D;  1AOI A;  3B6F A;  2ZY3 A;  3LZ0 A;  1S32 C;  1BH9 A;  3C1B C;  2F8N H;  2BYM B;  3W97 A;  3AZF A;  3AFA A;  4KGC D;  5DNN C;  1P3K C;  2HIO B;  4NE3 A;  1KX4 A;  2ARO A;  5B33 B;  2BYK B;  3KXB C;  3AZG D;  3WAA D;  2HUE C;  5AVB D;  5BS7 A;  3MNN D;  3KWQ A;  3LZ1 A;  1U35 C;  4J8V A;  5B0Y D;  1P3A D;  4WU9 A;  4XUJ A;  4YM6 B;  2NZD A;  2JCH A;  3B6G A;  4CAY B;  3UT9 D;  3LEL C;  5B1M D;  4H9P B;  5B2I B;  5DNM B;  5B40 B;  3AZL A;  5B24 A;  5B33 C;  1Z2C B;  3AZJ B;  3NQJ A;  1M1A B;  5JRG A;  3VH6 W;  3R45 A;  1P3I D;  3REI A;  4HGA B;  5GXQ A;  3MGS D;  5BNV A;  2ZY2 A;  4Z5T B;  5AV6 C;  5JA4 A;  4YM6 C;  1KX5 D;  2CV5 B;  4Z66 A;  1F66 A;  5B2J D;  5B31 A;  3AN2 D;  1P3B D;  2XD5 A;  1ID3 B;  5B2I C;  1AOI D;  3AZM A;  5DNM C;  5AVC B;  5GT3 D;  1M18 A;  3X1U B;  5B40 C;  3AZJ C;  5B32 B;  3AZE C;  4J8X B;  3AZF D;  3AFA D;  2Y2I A;  3B0C W;  4HGA C;  2Y2O A;  1S32 A;  1KX4 D;  5CP6 B;  4Z5T C;  2ARO D;  3O62 B;  2CV5 C;  2F8N A;  5DNN A;  3LZ1 D;  3KWQ D;  3AZI D;  4UPK A;  3H0M C;  4J8V D;  3W99 D;  3WKJ B;  3TU4 C;  3REH D;  2YFW B;  3KXB A;  2NZD D;  5GSU B;  3UTB A;  1ID3 C;  1A7W A;  3B6G D;  5AVC C;  1U35 A;  1P3G D;  1HQ3 B;  5CPJ D;  5B32 C;  5B0Z B;  4J8X C;  1KX3 D;  1P3M D;  1Q9C A;  4E44 A;  5CP6 C;  2BYM A;  5B24 D;  3O62 C;  3UTA A;  4WNN B;  5JRG D;  1P34 B;  3REI D;  1KU5 A;  2HIO A;  5GXQ D;  4AWL C;  5B33 A;  2BYK A;  4H9S C;  3WKJ C;  3W96 B;  5GSU C;  2Y2L A;  1P3F B;  1F66 D;  1M19 C;  3AV2 B;  1HQ3 C;  4KUD B;  5B31 D;  3WTP B;  5B31 G;  5B0Z C;  4H9O B;  3REL A;  5BT1 C;  4CAY A;  5KDM B;  2CWE A;  3AZM D;  2FJ7 C;  3REJ B;  1M18 D;  2PYO B;  4QLC D;  3V9R B;  5B2I A;  2UWX A;  5DNM A;  3EPJ A;  1P34 C;  3REK B;  3AZH A;  2RVQ C;  3P5J B;  3AZJ A;  3W96 C;  3AV1 D;  1S32 D;  5CHL B;  4UUZ B;  1M1A A;  2Y2K A;  1P3F C;  2F8N D;  2F8N G;  3W98 B;  4ZUX D;  5DNN D;  3AV2 C;  2G5I C;  4KUD C;  3WTP C;  4Z5T A;  3VH6 T;  2CV5 A;  3KXB D;  5E5A B;  3UTB D;  5CPK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...