3WAAC

The nucleosome containing human h2a.z.2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaC00
3WA9B 2YFVA 4H9RA 5BNVA 2F8NA 3WAAD 4Z66B 1KX3C 1P3AC 3UTBB 1JFIA 5B2IB 3AZJA 1P3FD 3REKD 5B31G 5AY8A 4KUDC 3AZED 3RELB 1P3BC 3AV1D 4JJNA 4CAYA 5B40C 5BS7C 5B31C 3LJAD 5B0ZA 3MGRC 3UT9A 3V9RB 1M1AD 3AYWD 3B0BA 4H9NA 2NZDC 1N1JB 1P3OC 1P3GC 3MGQC 4KGCD 2JSSA 5AV6A 5G49B 3W98B 5B0YB 3X1SB 5AVCC 1KX4B 5CPKC 5GXQB 4QLCC 2CV5D 1TZYB 4KHAB 5F99B 3LELB 2RVQD 1EQZD 4Z66A 3TU4D 4J8UA 5B32B 5B2IA 3W96C 3C1CD 5AV9C 4J8XD 1AOIA 5B2JC 5B33C 2PYOC 5AY8D 3UTAB 4Z5TD 3W97D 3X1TC 4LD9C 3V9RA 3VH5T 3X1UD 3REJC 5B0ZD 3UT9D 4NE3A 3AZNC 1N1JA 3O62C 3X1VC 1P3LD 3AZIC 1U35C 4ZUXB 4CSRB 5AV5C 1HQ3C 5B0YA 5DNNA 3W98A 2LY8A 1KX4A 5AV6D 5GXQA 5B31A 3MGRA 5B1MC 1TZYA 4NE6A 3VH6W 4KHAA 3AZHB 4YS3A 1P3PB 3AFAD 2F8NG 3KUYC 4WU8A 3MGSC 3C1BB 4H9OB 3AZGC 5B24B 4J8VC 3REHD 4EO5B 3LZ1C 1F66B 4J8UD 1KU5A 4WU9C 3AN2D 3UTAA 5GSUC 3MGPB 1P34D 1AOID 3AZJC 1KX5C 2NQBB 3R45A 5DNMD 3REIC 4JJNC 3W96A 4ZUXA 5B0ZC 1KX3D 2BYKA 1P3AD 4CSRA 3B6FB 3A6NB 3AZKB 3NQUB 4KUDD 5DNND 3AZHA 1HTAA 2FJ7C 5B40D 3REJA 5B31D 3MGRD 3WKJB 4YS3D 4H9SC 3X1VA 4R8PB 3AZIA 3C1BA 4H9OA 2NZDD 1P3OD 1ZLAB 3MGQD 1F66A 4WU8D 3AZLB 3VH6A 1M18B 4Z66C 3B6GB 5AVCD 3UTBC 3MGPA 4J8UC 5B2IC 5GT0B 4HGAB 1R4VA 2NQBA 4WV4B 5E5AB 1AOIC 4G91B 3RELC 5JA4B 3KUYA 4J8VA 3LZ1A 1S32B 5AV8A 3WTPB 3AZKA 3W96D 4XZQB 5AV9D 4WU9A 5GSUA 1TAFA 5B2JD 5B33D 3MNNB 5BNXB 4UUZB 2PYOD 1KX5A 3MVDB 3X1TD 3W98C 5B0YC 5DNNC 3AZMB 3X1SC 4LD9D 1KX4C 3AZFB 3REIA 5GXQC 3REJD 2IO5B 3AZND 2L5AA 1TZYC 3O62D 5B32G 1ZLAA 5F99C 3LELC 4YS3C 3X1VD 3AZID 1U35D 5JRGB 4J8WB 4X23B 1M18A 5AV5D 1HQ3D 3B6GA 5AVBB 5B32C 3B0CW 4WU8C 2FJ7A 5B1MD 4E45A 5GT3B 4H9SA 5JA4A 5BT1C 3UTAC 1H3OB 1P3MB 3WA9A 3KUYD 1S32A 4YM6B 3W99B 3AZGD 3MGSD 3NQJB 4XZQA 4J8VD 2F8NH 3LZ1D 5AV8D 4XUJB 3UTBA 1M19B 2F8ND 3MNNA 5BNXA 4UUZA 2BYMB 4ZUXC 4WU9D 1P3KB 5GSUD 3AZJD 3RELA 3AZFA 1KX5D 1WWIA 1P3BB 3AV2B 3AZHC 3REID 2HIOB 4JJND 5CPJB 5B1LB 5JRGA 4J8WA 4X23A 4AWLC 5AVBA 5BO0B 3C1BC 1P3IB 3KXBB 5B24C 1P3GB 4H9QB 5G49A 3KSYA 2AROB 4EO5C 3X1SA 1F66C 5GT3A 2FJ7D 1ULYA 1H3OA 5CPIB 1B67A 5CPKB 3MGPC 1ID3B 4NE5A 4ZBJB 5F99A 4QLCB 5CP6B 3LELA 3W99A 4YM6A 1Q9CA 3LZ0B 3KWQB 3NQJA 2NQBC 3WA9D 5B32A 4G92C 4Z66D 5AV8C 3UTBD 3A6NC 3AZKC 5B2ID 3WAAB 4WNNB 1P3FB 3REKB 3RELD 4Z2MH 4NFTA 2HIOA 3AZEB 5CPJA 5B1LA 3AV1B 3WKJC 3LJAB 4R8PC 5BO0A 3B0DB 1P3IA 3KXBA 1M1AB 4H9QA 1ZLAC 3AYWB 1M18C 4KGCB 5CPIA 3W98D 5B0YD 3X1SD 3B6GC 1ID3A 1KX4D 5GT0C 5CP6A 5GXQD 4HGAC 1P3PA 3KWQA 1TZYD 5E5AC 4G91C 5F99D 3LELD 2CV5B 4M6BA 5B24A 3WA9C 1S32C 2YFWB 3VH6T 5B32D 3WTPC 1EQZB 3WAAA 4XZQC 3WTPE 3TU4B 5FUGB 2YFVB 5BNVB 3C1CB 3REKA 1P3FA 3MNNC 4Z2MG 5BT1D 4J8XB 3UTAD 3MVDC 1BFMA 3AV1A 4DRBA 5AY8B 4Z5TB 3AZFC 3W97B 3LJAA 2IO5C 4CAYB 3X1UB 3AYWA 3A6NA 3B6FA 5C3IB 5B0ZB 3UT9B 4ZUXD 5JRGC 4J8WC 3NQUA 2HUEB 4X23C 1P3LB 4KGCA 4H9NB 5AVBC 5AV6B 1B6WA 3AZHD 3WKJA 5GT3C 2CV5A 1WWSA 4R8PA 1P3PD 1P3MC 3W99C 2YFWA 4YM6C 3AFAB 3C1BD 3AZLA 1EQZA 5B24D 3TU4A 5CHLB 5FUGA 1F66D 3C1CA 4XUJC 1M19C 5GT0A 3REHB 4J8XA 4J8UB 1P3KC 3VH5W 3MGPD 5E5AA 3AN2B 1F1EA 4Z5TA 3W97A 1P34B 1AOIB 2NQBD 3AV2C 3X1UA 2HIOC 3WTPA 5CPJC 5DNMB 5B1LC 1P3LA 3B6FD 3A6ND 3AZKD 1KX3B 1P3AB 2F8NK 1P3IC 4E44A 3KXBC 3MVDA 2AROC 3AZMA 1BH9B 4KUDB 5DNNB 5CPIC 1ID3C 5B40B 3WKJD 4ZBJC 5B31B 5CP6C 4R8PD 3LZ0C 3AFAA 3MGRB 1P3PC 3KWQC 4YS3B 1ZLAD 2NZDB 3AZLD 1P3OB 3REHA 3MGQB 1M18D 1BH8B 4WU8B 3B6GD 3WAAC 3AN2A 2CWEA 5GT0D 5AVCB 1P34A 1P3MA 1P3FC 3REKC 5E5AD 3B0CT 3AZEC 5DNMA 3AV1C 1S32D 1M19A 4XUJA 3WTPD 3VH5A 4XZQD 3LJAC 3R45B 1P3AA 1KX3A 2BYMA 3B0DC 1P3KA 1M1AC 3W96B 3AYWC 5AV9B 3B6FC 5KDMB 4DRAA 3MNND 2BYKB 1BH9A 4KUDA 4KGCC 5B2JB 3MVDD 1P3BA 5B33B 2PYOB 3AZMD 3AV2A 5B40A 3AZFD 5BS7A 3X1TB 4LD9B 2CV5C 3REJB 3AZNB 2NZDA 3O62B 1P3OA 1P3GA 5JRGD 3MGQA 4X23D 4J8WD 4AWLB 1BH8A 3AZIB 2AROA 2RVQC 3X1VB 1U35B 4H9PB 5AVBD 1EQZC 3AZLC 5AV5B 1HQ3B 3TU4C 5AVCA 5CPKA 3C1CC 4WZSB 4QLCA 5GT3D 3LZ0A 5B1MB 4J8XC 1P3MD 5AY8C 4Z5TC 3W99D 4YM6D 3W97C 3KUYB 3AZGB 3MGSB 1M19D 3X1UC 4XUJD 5AV9A 5KDMA 4J8VB 4G92B 5C3IC 3UT9C 3LZ1B 5AV8B 1P3KD 4WNNA 4H9RB 2HUEC 5B2JA 1P3LC 5B33A 2F8NB 4WU9B 2PYOA 5GSUB 1TAFB 3X1TA 3AZEA 1JFIB 3AZJB 1P3BD 4LD9A 3AZMC 1KX5B 5AV6C 3AV2D 2HIOD 5CPJD 3AZNA 5B1LD 3O62A 3REIB 1M1AA 1A7WA 4JJNB 1U35A 4H9PA 3AFAC 1P3ID 3KXBD 1P3GD 5AV5A 1HQ3A 2AROD 3REHC 5B1MA 5CPID 5CPKD 1ID3D 2FJ7B 3AN2C 4QLCD 5CP6D 3LZ0D 1P34C 3KWQD 3AZGA 3MGSA 5DNMC
chains in the Genus database with same CATH superfamily
3WA9B 2YFVA 4H9RA 5BNVA 2F8NA 3WAAD 4Z66B 1KX3C 1P3AC 3UTBB 3A1IA 1JFIA 5B2IB 3AZJA 1P3FD 3REKD 5B31G 5AY8A 4KUDC 3AZED 3RELB 1P3BC 2FFFB 3AV1D 4JJNA 4CAYA 5B40C 5BS7C 5B31C 3LJAD 5B0ZA 3MGRC 3UT9A 2Y2LA 3V9RB 1M1AD 3AYWD 3B0BA 2ZM5A 2Y2PA 4H9NA 2NZDC 1N1JB 1P3OC 1P3GC 3MGQC 4KGCD 2JSSA 5AV6A 5G49B 3W98B 5B0YB 3X1SB 5AVCC 1KX4B 5CPKC 5GXQB 4QLCC 2CV5D 1TZYB 4KHAB 5F99B 3LELB 2RVQD 2Y2QA 1EQZD 2UWXA 4Z66A 3TU4D 4J8UA 5B32B 5B2IA 3W96C 3C1CD 5AV9C 4J8XD 1AOIA 5B2JC 5B33C 2PYOC 5AY8D 3UTAB 4Z5TD 3W97D 3X1TC 4LD9C 3V9RA 3VH5T 3X1UD 3REJC 5B0ZD 3UT9D 4NE3A 3AZNC 1N1JA 3O62C 3X1VC 1P3LD 3AZIC 1U35C 4ZUXB 4CSRB 5AV5C 1HQ3C 5B0YA 5DNNA 3W98A 2LY8A 2ZY5A 1KX4A 5AV6D 5GXQA 5B31A 3H0RC 3MGRA 5B1MC 1TZYA 4NE6A 3VH6W 4KHAA 3AZHB 4YS3A 1P3PB 3AFAD 2F8NG 3KUYC 4WU8A 3MGSC 3C1BB 4H9OB 3AZGC 5B24B 4J8VC 3REHD 4EO5B 3LZ1C 1F66B 2DQNC 4J8UD 1KU5A 4WU9C 3AN2D 3UTAA 5GSUC 3MGPB 1P34D 1AOID 3AZJC 1KX5C 2NQBB 3R45A 5DNMD 3REIC 4JJNC 3W96A 4ZUXA 5B0ZC 1KX3D 2BYKA 1P3AD 4CSRA 3B6FB 3A6NB 3AZKB 3NQUB 4KUDD 5DNND 3AZHA 1HTAA 2FJ7C 5B40D 2W8SA 5B31D 3REJA 3MGRD 3WKJB 2Y2NA 3EPJA 4YS3D 4H9SC 3X1VA 4R8PB 3AZIA 3C1BA 4H9OA 3FDDA 2NZDD 1P3OD 1ZLAB 3MGQD 1F66A 4WU8D 3AZLB 2ZY2A 3VH6A 1M18B 4Z66C 3B6GB 5AVCD 3UTBC 3MGPA 4J8UC 2Y2MA 5B2IC 5GT0B 4HGAB 1R4VA 2NQBA 4WV4B 3KFUG 5E5AB 1AOIC 4G91B 2Y2GA 3RELC 5JA4B 3KUYA 4J8VA 3LZ1A 1S32B 5AV8A 3WTPB 3AZKA 3W96D 4XZQB 5AV9D 4WU9A 5GSUA 1TAFA 5B2JD 5B33D 3MNNB 5BNXB 4UUZB 2XD5A 1KX5A 2PYOD 3MVDB 3X1TD 3W98C 5B0YC 5DNNC 3AZMB 3X1SC 4LD9D 1KX4C 3AZFB 3REIA 5GXQC 3EPLA 3REJD 2IO5B 3AZND 2L5AA 1TZYC 3O62D 5B32G 1ZLAA 5F99C 3LELC 3A1KA 4YS3C 4DQYB 2ZY3A 3AZID 3X1VD 1U35D 5JRGB 4J8WB 4X23B 1M18A 5AV5D 1HQ3D 3B6GA 5AVBB 2J8PA 5B32C 3B0CW 4WU8C 2FJ7A 2Y2IA 5B1MD 4E45A 5GT3B 4H9SA 5JA4A 5BT1C 3UTAC 1H3OB 1P3MB 3WA9A 3KUYD 1S32A 4YM6B 3W99B 3AZGD 3MGSD 3NQJB 4XZQA 4J8VD 2F8NH 3LZ1D 5AV8D 4XUJB 3UTBA 1M19B 2F8ND 3MNNA 5BNXA 4UUZA 2BYMB 4ZUXC 4WU9D 1P3KB 5GSUD 3AZJD 3F6TA 3RELA 3AZFA 1KX5D 1WWIA 1P3BB 3AV2B 3AZHC 3REID 2HIOB 4JJND 5CPJB 5B1LB 5JRGA 4J8WA 4X23A 4AWLC 5AVBA 5BO0B 3C1BC 1P3IB 3KXBB 5B24C 1P3GB 4H9QB 5G49A 3KSYA 2RIQA 2AROB 4EO5C 3X1SA 1F66C 5GT3A 2FJ7D 2JCHA 1ULYA 1H3OA 5CPIB 1B67A 5CPKB 3MGPC 1ID3B 4NE5A 4ZBJB 5F99A 4QLCB 5CP6B 3LELA 3W99A 4YM6A 1Q9CA 3LZ0B 3KWQB 3NQJA 2NQBC 2Y2JA 3EPKA 3WA9D 5B32A 4G92C 4Z66D 5AV8C 3UTBD 3A6NC 3AZKC 5B2ID 3WAAB 2JE5A 4WNNB 1P3FB 3REKB 3RELD 4Z2MH 4NFTA 2HIOA 3AZEB 5CPJA 5B1LA 3AV1B 3WKJC 3LJAB 4R8PC 5BO0A 3B0DB 1P3IA 3KXBA 1M1AB 4H9QA 1ZLAC 3AYWB 1M18C 4KGCB 5CPIA 3W98D 5B0YD 3X1SD 3B6GC 1ID3A 1KX4D 5GT0C 5CP6A 5GXQD 4HGAC 3IP4C 1P3PA 3KWQA 1TZYD 5E5AC 4G91C 5F99D 3LELD 2CV5B 4M6BA 3H0MC 5B24A 2Y2KA 3WA9C 1S32C 2YFWB 3VH6T 5B32D 3WTPC 1EQZB 3WAAA 2Y2OA 4XZQC 2VQRA 3WTPE 3TU4B 5FUGB 2YFVB 5BNVB 2G5HC 3C1CB 3REKA 1P3FA 3MNNC 4Z2MG 5BT1D 4J8XB 3UTAD 4WJ3C 3MVDC 1BFMA 3AV1A 4DRBA 5AY8B 4Z5TB 3AZFC 3W97B 3LJAA 2IO5C 4CAYB 3X1UB 3AYWA 3A6NA 3B6FA 5C3IB 5B0ZB 3UT9B 1Z2CB 4ZUXD 1T3UA 5JRGC 3NQUA 2HUEB 4X23C 4J8WC 1P3LB 4KGCA 4H9NB 5AVBC 5AV6B 1B6WA 3AZHD 3WKJA 5GT3C 2CV5A 1WWSA 4R8PA 1P3PD 1P3MC 3W99C 2YFWA 4YM6C 3AFAB 3C1BD 3AZLA 1EQZA 5B24D 3TU4A 5CHLB 5FUGA 1F66D 3C1CA 4XUJC 2F2AC 1M19C 5GT0A 3REHB 4J8XA 4J8UB 1P3KC 3VH5W 3MGPD 5E5AA 3AN2B 1F1EA 4Z5TA 3W97A 1P34B 1AOIB 2NQBD 3AV2C 3X1UA 2HIOC 3WTPA 5CPJC 5DNMB 5B1LC 1P3LA 3B6FD 3A6ND 3AZKD 1KX3B 1P3AB 2F8NK 1P3IC 4E44A 3KXBC 3MVDA 2AROC 3AZMA 3AL0C 1BH9B 4KUDB 5DNNB 5CPIC 1ID3C 5B40B 3WKJD 4ZBJC 5B31B 5CP6C 4R8PD 3LZ0C 3AFAA 3MGRB 1P3PC 3KWQC 4YS3B 1ZLAD 3H0LC 2NZDB 3AZLD 1P3OB 3REHA 3MGQB 1M18D 1BH8B 4WU8B 3B6GD 2ZY4A 3WAAC 3AN2A 2CWEA 4UPKA 5GT0D 5AVCB 1P34A 1P3MA 1P3FC 3REKC 5E5AD 3B0CT 3AZEC 5DNMA 2BG1A 3AV1C 1S32D 1M19A 4XUJA 3WTPD 3VH5A 4XZQD 3LJAC 3R45B 1P3AA 1KX3A 2BYMA 3B0DC 1P3KA 1M1AC 3W96B 3AYWC 5AV9B 3B6FC 5KDMB 4DRAA 3MNND 2BYKB 1BH9A 4KUDA 4KGCC 5B2JB 3MVDD 1P3BA 5B33B 2PYOB 3AZMD 3AV2A 5B40A 3AZFD 5BS7A 3X1TB 4LD9B 2CV5C 3REJB 1W2EA 3AZNB 2NZDA 3O62B 1P3OA 1P3GA 5JRGD 3MGQA 4X23D 4J8WD 4AWLB 1BH8A 3AZIB 2AROA 2RVQC 3X1VB 2G5IC 4H9PB 1U35B 5AVBD 1EQZC 3AZLC 5AV5B 1HQ3B 3TU4C 5AVCA 3EPHA 5CPKA 3C1CC 4WZSB 4QLCA 5GT3D 3LZ0A 5B1MB 4J8XC 1P3MD 5AY8C 4Z5TC 3W99D 4YM6D 3W97C 3P5JB 3KUYB 3AZGB 3MGSB 1M19D 4XUJD 5AV9A 3X1UC 5KDMA 4J8VB 4G92B 5C3IC 3UT9C 3LZ1B 5AV8B 1P3KD 4WNNA 4H9RB 2HUEC 5B2JA 1P3LC 5B33A 2F8NB 4WU9B 2PYOA 5GSUB 1TAFB 3EG5B 3AZEA 3X1TA 1JFIB 3AZJB 1P3BD 4LD9A 3AZMC 1KX5B 5AV6C 3AV2D 2HIOD 5CPJD 3AZNA 5B1LD 3O62A 3REIB 1M1AA 1A7WA 4JJNB 1U35A 4H9PA 2DF4C 3AFAC 2XD1A 1P3ID 3KXBD 1P3GD 1PZRA 1HQ3A 5AV5A 2AROD 3REHC 5B1MA 2Y2HA 5CPID 5CPKD 1ID3D 2FJ7B 3AN2C 4QLCD 5CP6D 3LZ0D 1P34C 3KWQD 3AZGA 3MGSA 5DNMC
chains in the Genus database with same CATH topology
3WA9B 2YFVA 4H9RA 5BNVA 2F8NA 3WAAD 4Z66B 1KX3C 1P3AC 3UTBB 3A1IA 1JFIA 5B2IB 3AZJA 1P3FD 3REKD 5B31G 5AY8A 4KUDC 3AZED 3RELB 1P3BC 2FFFB 3AV1D 4JJNA 4CAYA 5B40C 5BS7C 5B31C 3LJAD 5B0ZA 3MGRC 3UT9A 2Y2LA 3V9RB 1M1AD 3AYWD 3B0BA 2ZM5A 2Y2PA 4H9NA 2NZDC 1N1JB 1P3OC 1P3GC 3MGQC 4KGCD 2JSSA 5AV6A 5G49B 3W98B 5B0YB 3X1SB 5AVCC 1KX4B 5CPKC 5GXQB 4QLCC 2CV5D 1TZYB 4KHAB 5F99B 3LELB 2RVQD 2Y2QA 1EQZD 2UWXA 4Z66A 3TU4D 4J8UA 5B32B 5B2IA 3W96C 3C1CD 5AV9C 4J8XD 1AOIA 5B2JC 5B33C 2PYOC 5AY8D 3UTAB 4Z5TD 3W97D 3X1TC 4LD9C 3V9RA 3VH5T 3X1UD 3REJC 5B0ZD 3UT9D 4NE3A 3AZNC 1N1JA 3O62C 3X1VC 1P3LD 3AZIC 1U35C 4ZUXB 4CSRB 5AV5C 1HQ3C 5B0YA 5DNNA 3W98A 2LY8A 2ZY5A 1KX4A 5AV6D 5GXQA 5B31A 3H0RC 3MGRA 5B1MC 1TZYA 4NE6A 3VH6W 4KHAA 3AZHB 4YS3A 1P3PB 3AFAD 2F8NG 3KUYC 4WU8A 3MGSC 3C1BB 4H9OB 3AZGC 5B24B 4J8VC 3REHD 4EO5B 3LZ1C 1F66B 2DQNC 4J8UD 1KU5A 4WU9C 3AN2D 3UTAA 5GSUC 3MGPB 1P34D 1AOID 3AZJC 1KX5C 2NQBB 3R45A 5DNMD 3REIC 4JJNC 3W96A 4ZUXA 5B0ZC 1KX3D 2BYKA 1P3AD 4CSRA 3B6FB 3A6NB 3AZKB 3NQUB 4KUDD 5DNND 3AZHA 1HTAA 2FJ7C 5B40D 2W8SA 5B31D 3REJA 3MGRD 3WKJB 2Y2NA 3EPJA 4YS3D 4H9SC 3X1VA 4R8PB 3AZIA 3C1BA 4H9OA 3FDDA 2NZDD 1P3OD 1ZLAB 3MGQD 1F66A 4WU8D 3AZLB 2ZY2A 3VH6A 1M18B 4Z66C 3B6GB 5AVCD 3UTBC 3MGPA 4J8UC 2Y2MA 5B2IC 5GT0B 4HGAB 1R4VA 2NQBA 4WV4B 3KFUG 5E5AB 1AOIC 4G91B 2Y2GA 3RELC 5JA4B 3KUYA 4J8VA 3LZ1A 1S32B 5AV8A 3WTPB 3AZKA 3W96D 4XZQB 5AV9D 4WU9A 5GSUA 1TAFA 5B2JD 5B33D 3MNNB 5BNXB 4UUZB 2XD5A 1KX5A 2PYOD 3MVDB 3X1TD 3W98C 5B0YC 5DNNC 3AZMB 3X1SC 4LD9D 1KX4C 3AZFB 3REIA 5GXQC 3EPLA 3REJD 2IO5B 3AZND 2L5AA 1TZYC 3O62D 5B32G 1ZLAA 5F99C 3LELC 3A1KA 4YS3C 4DQYB 2ZY3A 3AZID 3X1VD 1U35D 5JRGB 4J8WB 4X23B 1M18A 5AV5D 1HQ3D 3B6GA 5AVBB 2J8PA 5B32C 3B0CW 4WU8C 2FJ7A 2Y2IA 5B1MD 4E45A 5GT3B 4H9SA 5JA4A 5BT1C 3UTAC 1H3OB 1P3MB 3WA9A 3KUYD 1S32A 4YM6B 3W99B 3AZGD 3MGSD 3NQJB 4XZQA 4J8VD 2F8NH 3LZ1D 5AV8D 4XUJB 3UTBA 1M19B 2F8ND 3MNNA 5BNXA 4UUZA 2BYMB 4ZUXC 4WU9D 1P3KB 5GSUD 3AZJD 3F6TA 3RELA 3AZFA 1KX5D 1WWIA 1P3BB 3AV2B 3AZHC 3REID 2HIOB 4JJND 5CPJB 5B1LB 5JRGA 4J8WA 4X23A 4AWLC 5AVBA 5BO0B 3C1BC 1P3IB 3KXBB 5B24C 1P3GB 4H9QB 5G49A 3KSYA 2RIQA 2AROB 4EO5C 3X1SA 1F66C 5GT3A 2FJ7D 2JCHA 1ULYA 1H3OA 5CPIB 1B67A 5CPKB 3MGPC 1ID3B 4NE5A 4ZBJB 5F99A 4QLCB 5CP6B 3LELA 3W99A 4YM6A 1Q9CA 3LZ0B 3KWQB 3NQJA 2NQBC 2Y2JA 3EPKA 3WA9D 5B32A 4G92C 4Z66D 5AV8C 3UTBD 3A6NC 3AZKC 5B2ID 3WAAB 2JE5A 4WNNB 1P3FB 3REKB 3RELD 4Z2MH 4NFTA 2HIOA 3AZEB 5CPJA 5B1LA 3AV1B 3WKJC 3LJAB 4R8PC 5BO0A 3B0DB 1P3IA 3KXBA 1M1AB 4H9QA 1ZLAC 3AYWB 1M18C 4KGCB 5CPIA 3W98D 5B0YD 3X1SD 3B6GC 1ID3A 1KX4D 5GT0C 5CP6A 5GXQD 4HGAC 3IP4C 1P3PA 3KWQA 1TZYD 5E5AC 4G91C 5F99D 3LELD 2CV5B 4M6BA 3H0MC 5B24A 2Y2KA 3WA9C 1S32C 2YFWB 3VH6T 5B32D 3WTPC 1EQZB 3WAAA 2Y2OA 4XZQC 2VQRA 3WTPE 3TU4B 5FUGB 2YFVB 5BNVB 2G5HC 3C1CB 3REKA 1P3FA 3MNNC 4Z2MG 5BT1D 4J8XB 3UTAD 4WJ3C 3MVDC 1BFMA 3AV1A 4DRBA 5AY8B 4Z5TB 3AZFC 3W97B 3LJAA 2IO5C 4CAYB 3X1UB 3AYWA 3A6NA 3B6FA 5C3IB 5B0ZB 3UT9B 1Z2CB 4ZUXD 1T3UA 5JRGC 3NQUA 2HUEB 4X23C 4J8WC 1P3LB 4KGCA 4H9NB 5AVBC 5AV6B 1B6WA 3AZHD 3WKJA 5GT3C 2CV5A 1WWSA 4R8PA 1P3PD 1P3MC 3W99C 2YFWA 4YM6C 3AFAB 3C1BD 3AZLA 1EQZA 5B24D 3TU4A 5CHLB 5FUGA 1F66D 3C1CA 4XUJC 2F2AC 1M19C 5GT0A 3REHB 4J8XA 4J8UB 1P3KC 3VH5W 3MGPD 5E5AA 3AN2B 1F1EA 4Z5TA 3W97A 1P34B 1AOIB 2NQBD 3AV2C 3X1UA 2HIOC 3WTPA 5CPJC 5DNMB 5B1LC 1P3LA 3B6FD 3A6ND 3AZKD 1KX3B 1P3AB 2F8NK 1P3IC 4E44A 3KXBC 3MVDA 2AROC 3AZMA 3AL0C 1BH9B 4KUDB 5DNNB 5CPIC 1ID3C 5B40B 3WKJD 4ZBJC 5B31B 5CP6C 4R8PD 3LZ0C 3AFAA 3MGRB 1P3PC 3KWQC 4YS3B 1ZLAD 3H0LC 2NZDB 3AZLD 1P3OB 3REHA 3MGQB 1M18D 1BH8B 4WU8B 3B6GD 2ZY4A 3WAAC 3AN2A 2CWEA 4UPKA 5GT0D 5AVCB 1P34A 1P3MA 1P3FC 3REKC 5E5AD 3B0CT 3AZEC 5DNMA 2BG1A 3AV1C 1S32D 1M19A 4XUJA 3WTPD 3VH5A 4XZQD 3LJAC 3R45B 1P3AA 1KX3A 2BYMA 3B0DC 1P3KA 1M1AC 3W96B 3AYWC 5AV9B 3B6FC 5KDMB 4DRAA 3MNND 2BYKB 1BH9A 4KUDA 4KGCC 5B2JB 3MVDD 1P3BA 5B33B 2PYOB 3AZMD 3AV2A 5B40A 3AZFD 5BS7A 3X1TB 4LD9B 2CV5C 3REJB 1W2EA 3AZNB 2NZDA 3O62B 1P3OA 1P3GA 5JRGD 3MGQA 4X23D 4J8WD 4AWLB 1BH8A 3AZIB 2AROA 2RVQC 3X1VB 2G5IC 4H9PB 1U35B 5AVBD 1EQZC 3AZLC 5AV5B 1HQ3B 3TU4C 5AVCA 3EPHA 5CPKA 3C1CC 4WZSB 4QLCA 5GT3D 3LZ0A 5B1MB 4J8XC 1P3MD 5AY8C 4Z5TC 3W99D 4YM6D 3W97C 3P5JB 3KUYB 3AZGB 3MGSB 1M19D 4XUJD 5AV9A 3X1UC 5KDMA 4J8VB 4G92B 5C3IC 3UT9C 3LZ1B 5AV8B 1P3KD 4WNNA 4H9RB 2HUEC 5B2JA 1P3LC 5B33A 2F8NB 4WU9B 2PYOA 5GSUB 1TAFB 3EG5B 3AZEA 3X1TA 1JFIB 3AZJB 1P3BD 4LD9A 3AZMC 1KX5B 5AV6C 3AV2D 2HIOD 5CPJD 3AZNA 5B1LD 3O62A 3REIB 1M1AA 1A7WA 4JJNB 1U35A 4H9PA 2DF4C 3AFAC 2XD1A 1P3ID 3KXBD 1P3GD 1PZRA 1HQ3A 5AV5A 2AROD 3REHC 5B1MA 2Y2HA 5CPID 5CPKD 1ID3D 2FJ7B 3AN2C 4QLCD 5CP6D 3LZ0D 1P34C 3KWQD 3AZGA 3MGSA 5DNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 B;  2YFV A;  4H9R A;  5BNV A;  2F8N A;  3WAA D;  4Z66 B;  1KX3 C;  1P3A C;  3UTB B;  1JFI A;  5B2I B;  3AZJ A;  1P3F D;  3REK D;  5B31 G;  5AY8 A;  4KUD C;  3AZE D;  3REL B;  1P3B C;  3AV1 D;  4JJN A;  4CAY A;  5B40 C;  5BS7 C;  5B31 C;  3LJA D;  5B0Z A;  3MGR C;  3UT9 A;  3V9R B;  1M1A D;  3AYW D;  3B0B A;  4H9N A;  2NZD C;  1N1J B;  1P3O C;  1P3G C;  3MGQ C;  4KGC D;  2JSS A;  5AV6 A;  5G49 B;  3W98 B;  5B0Y B;  3X1S B;  5AVC C;  1KX4 B;  5CPK C;  5GXQ B;  4QLC C;  2CV5 D;  1TZY B;  4KHA B;  5F99 B;  3LEL B;  2RVQ D;  1EQZ D;  4Z66 A;  3TU4 D;  4J8U A;  5B32 B;  5B2I A;  3W96 C;  3C1C D;  5AV9 C;  4J8X D;  1AOI A;  5B2J C;  5B33 C;  2PYO C;  5AY8 D;  3UTA B;  4Z5T D;  3W97 D;  3X1T C;  4LD9 C;  3V9R A;  3VH5 T;  3X1U D;  3REJ C;  5B0Z D;  3UT9 D;  4NE3 A;  3AZN C;  1N1J A;  3O62 C;  3X1V C;  1P3L D;  3AZI C;  1U35 C;  4ZUX B;  4CSR B;  5AV5 C;  1HQ3 C;  5B0Y A;  5DNN A;  3W98 A;  2LY8 A;  1KX4 A;  5AV6 D;  5GXQ A;  5B31 A;  3MGR A;  5B1M C;  1TZY A;  4NE6 A;  3VH6 W;  4KHA A;  3AZH B;  4YS3 A;  1P3P B;  3AFA D;  2F8N G;  3KUY C;  4WU8 A;  3MGS C;  3C1B B;  4H9O B;  3AZG C;  5B24 B;  4J8V C;  3REH D;  4EO5 B;  3LZ1 C;  1F66 B;  4J8U D;  1KU5 A;  4WU9 C;  3AN2 D;  3UTA A;  5GSU C;  3MGP B;  1P34 D;  1AOI D;  3AZJ C;  1KX5 C;  2NQB B;  3R45 A;  5DNM D;  3REI C;  4JJN C;  3W96 A;  4ZUX A;  5B0Z C;  1KX3 D;  2BYK A;  1P3A D;  4CSR A;  3B6F B;  3A6N B;  3AZK B;  3NQU B;  4KUD D;  5DNN D;  3AZH A;  1HTA A;  2FJ7 C;  5B40 D;  3REJ A;  5B31 D;  3MGR D;  3WKJ B;  4YS3 D;  4H9S C;  3X1V A;  4R8P B;  3AZI A;  3C1B A;  4H9O A;  2NZD D;  1P3O D;  1ZLA B;  3MGQ D;  1F66 A;  4WU8 D;  3AZL B;  3VH6 A;  1M18 B;  4Z66 C;  3B6G B;  5AVC D;  3UTB C;  3MGP A;  4J8U C;  5B2I C;  5GT0 B;  4HGA B;  1R4V A;  2NQB A;  4WV4 B;  5E5A B;  1AOI C;  4G91 B;  3REL C;  5JA4 B;  3KUY A;  4J8V A;  3LZ1 A;  1S32 B;  5AV8 A;  3WTP B;  3AZK A;  3W96 D;  4XZQ B;  5AV9 D;  4WU9 A;  5GSU A;  1TAF A;  5B2J D;  5B33 D;  3MNN B;  5BNX B;  4UUZ B;  2PYO D;  1KX5 A;  3MVD B;  3X1T D;  3W98 C;  5B0Y C;  5DNN C;  3AZM B;  3X1S C;  4LD9 D;  1KX4 C;  3AZF B;  3REI A;  5GXQ C;  3REJ D;  2IO5 B;  3AZN D;  2L5A A;  1TZY C;  3O62 D;  5B32 G;  1ZLA A;  5F99 C;  3LEL C;  4YS3 C;  3X1V D;  3AZI D;  1U35 D;  5JRG B;  4J8W B;  4X23 B;  1M18 A;  5AV5 D;  1HQ3 D;  3B6G A;  5AVB B;  5B32 C;  3B0C W;  4WU8 C;  2FJ7 A;  5B1M D;  4E45 A;  5GT3 B;  4H9S A;  5JA4 A;  5BT1 C;  3UTA C;  1H3O B;  1P3M B;  3WA9 A;  3KUY D;  1S32 A;  4YM6 B;  3W99 B;  3AZG D;  3MGS D;  3NQJ B;  4XZQ A;  4J8V D;  2F8N H;  3LZ1 D;  5AV8 D;  4XUJ B;  3UTB A;  1M19 B;  2F8N D;  3MNN A;  5BNX A;  4UUZ A;  2BYM B;  4ZUX C;  4WU9 D;  1P3K B;  5GSU D;  3AZJ D;  3REL A;  3AZF A;  1KX5 D;  1WWI A;  1P3B B;  3AV2 B;  3AZH C;  3REI D;  2HIO B;  4JJN D;  5CPJ B;  5B1L B;  5JRG A;  4J8W A;  4X23 A;  4AWL C;  5AVB A;  5BO0 B;  3C1B C;  1P3I B;  3KXB B;  5B24 C;  1P3G B;  4H9Q B;  5G49 A;  3KSY A;  2ARO B;  4EO5 C;  3X1S A;  1F66 C;  5GT3 A;  2FJ7 D;  1ULY A;  1H3O A;  5CPI B;  1B67 A;  5CPK B;  3MGP C;  1ID3 B;  4NE5 A;  4ZBJ B;  5F99 A;  4QLC B;  5CP6 B;  3LEL A;  3W99 A;  4YM6 A;  1Q9C A;  3LZ0 B;  3KWQ B;  3NQJ A;  2NQB C;  3WA9 D;  5B32 A;  4G92 C;  4Z66 D;  5AV8 C;  3UTB D;  3A6N C;  3AZK C;  5B2I D;  3WAA B;  4WNN B;  1P3F B;  3REK B;  3REL D;  4Z2M H;  4NFT A;  2HIO A;  3AZE B;  5CPJ A;  5B1L A;  3AV1 B;  3WKJ C;  3LJA B;  4R8P C;  5BO0 A;  3B0D B;  1P3I A;  3KXB A;  1M1A B;  4H9Q A;  1ZLA C;  3AYW B;  1M18 C;  4KGC B;  5CPI A;  3W98 D;  5B0Y D;  3X1S D;  3B6G C;  1ID3 A;  1KX4 D;  5GT0 C;  5CP6 A;  5GXQ D;  4HGA C;  1P3P A;  3KWQ A;  1TZY D;  5E5A C;  4G91 C;  5F99 D;  3LEL D;  2CV5 B;  4M6B A;  5B24 A;  3WA9 C;  1S32 C;  2YFW B;  3VH6 T;  5B32 D;  3WTP C;  1EQZ B;  3WAA A;  4XZQ C;  3WTP E;  3TU4 B;  5FUG B;  2YFV B;  5BNV B;  3C1C B;  3REK A;  1P3F A;  3MNN C;  4Z2M G;  5BT1 D;  4J8X B;  3UTA D;  3MVD C;  1BFM A;  3AV1 A;  4DRB A;  5AY8 B;  4Z5T B;  3AZF C;  3W97 B;  3LJA A;  2IO5 C;  4CAY B;  3X1U B;  3AYW A;  3A6N A;  3B6F A;  5C3I B;  5B0Z B;  3UT9 B;  4ZUX D;  5JRG C;  4J8W C;  3NQU A;  2HUE B;  4X23 C;  1P3L B;  4KGC A;  4H9N B;  5AVB C;  5AV6 B;  1B6W A;  3AZH D;  3WKJ A;  5GT3 C;  2CV5 A;  1WWS A;  4R8P A;  1P3P D;  1P3M C;  3W99 C;  2YFW A;  4YM6 C;  3AFA B;  3C1B D;  3AZL A;  1EQZ A;  5B24 D;  3TU4 A;  5CHL B;  5FUG A;  1F66 D;  3C1C A;  4XUJ C;  1M19 C;  5GT0 A;  3REH B;  4J8X A;  4J8U B;  1P3K C;  3VH5 W;  3MGP D;  5E5A A;  3AN2 B;  1F1E A;  4Z5T A;  3W97 A;  1P34 B;  1AOI B;  2NQB D;  3AV2 C;  3X1U A;  2HIO C;  3WTP A;  5CPJ C;  5DNM B;  5B1L C;  1P3L A;  3B6F D;  3A6N D;  3AZK D;  1KX3 B;  1P3A B;  2F8N K;  1P3I C;  4E44 A;  3KXB C;  3MVD A;  2ARO C;  3AZM A;  1BH9 B;  4KUD B;  5DNN B;  5CPI C;  1ID3 C;  5B40 B;  3WKJ D;  4ZBJ C;  5B31 B;  5CP6 C;  4R8P D;  3LZ0 C;  3AFA A;  3MGR B;  1P3P C;  3KWQ C;  4YS3 B;  1ZLA D;  2NZD B;  3AZL D;  1P3O B;  3REH A;  3MGQ B;  1M18 D;  1BH8 B;  4WU8 B;  3B6G D;  3WAA C;  3AN2 A;  2CWE A;  5GT0 D;  5AVC B;  1P34 A;  1P3M A;  1P3F C;  3REK C;  5E5A D;  3B0C T;  3AZE C;  5DNM A;  3AV1 C;  1S32 D;  1M19 A;  4XUJ A;  3WTP D;  3VH5 A;  4XZQ D;  3LJA C;  3R45 B;  1P3A A;  1KX3 A;  2BYM A;  3B0D C;  1P3K A;  1M1A C;  3W96 B;  3AYW C;  5AV9 B;  3B6F C;  5KDM B;  4DRA A;  3MNN D;  2BYK B;  1BH9 A;  4KUD A;  4KGC C;  5B2J B;  3MVD D;  1P3B A;  5B33 B;  2PYO B;  3AZM D;  3AV2 A;  5B40 A;  3AZF D;  5BS7 A;  3X1T B;  4LD9 B;  2CV5 C;  3REJ B;  3AZN B;  2NZD A;  3O62 B;  1P3O A;  1P3G A;  5JRG D;  3MGQ A;  4X23 D;  4J8W D;  4AWL B;  1BH8 A;  3AZI B;  2ARO A;  2RVQ C;  3X1V B;  1U35 B;  4H9P B;  5AVB D;  1EQZ C;  3AZL C;  5AV5 B;  1HQ3 B;  3TU4 C;  5AVC A;  5CPK A;  3C1C C;  4WZS B;  4QLC A;  5GT3 D;  3LZ0 A;  5B1M B;  4J8X C;  1P3M D;  5AY8 C;  4Z5T C;  3W99 D;  4YM6 D;  3W97 C;  3KUY B;  3AZG B;  3MGS B;  1M19 D;  3X1U C;  4XUJ D;  5AV9 A;  5KDM A;  4J8V B;  4G92 B;  5C3I C;  3UT9 C;  3LZ1 B;  5AV8 B;  1P3K D;  4WNN A;  4H9R B;  2HUE C;  5B2J A;  1P3L C;  5B33 A;  2F8N B;  4WU9 B;  2PYO A;  5GSU B;  1TAF B;  3X1T A;  3AZE A;  1JFI B;  3AZJ B;  1P3B D;  4LD9 A;  3AZM C;  1KX5 B;  5AV6 C;  3AV2 D;  2HIO D;  5CPJ D;  3AZN A;  5B1L D;  3O62 A;  3REI B;  1M1A A;  1A7W A;  4JJN B;  1U35 A;  4H9P A;  3AFA C;  1P3I D;  3KXB D;  1P3G D;  5AV5 A;  1HQ3 A;  2ARO D;  3REH C;  5B1M A;  5CPI D;  5CPK D;  1ID3 D;  2FJ7 B;  3AN2 C;  4QLC D;  5CP6 D;  3LZ0 D;  1P34 C;  3KWQ D;  3AZG A;  3MGS A;  5DNM C; 
#chains in the Genus database with same CATH topology
 3WA9 B;  2YFV A;  4H9R A;  5BNV A;  2F8N A;  3WAA D;  4Z66 B;  1KX3 C;  1P3A C;  3UTB B;  3A1I A;  1JFI A;  5B2I B;  3AZJ A;  1P3F D;  3REK D;  5B31 G;  5AY8 A;  4KUD C;  3AZE D;  3REL B;  1P3B C;  2FFF B;  3AV1 D;  4JJN A;  4CAY A;  5B40 C;  5BS7 C;  5B31 C;  3LJA D;  5B0Z A;  3MGR C;  3UT9 A;  2Y2L A;  3V9R B;  1M1A D;  3AYW D;  3B0B A;  2ZM5 A;  2Y2P A;  4H9N A;  2NZD C;  1N1J B;  1P3O C;  1P3G C;  3MGQ C;  4KGC D;  2JSS A;  5AV6 A;  5G49 B;  3W98 B;  5B0Y B;  3X1S B;  5AVC C;  1KX4 B;  5CPK C;  5GXQ B;  4QLC C;  2CV5 D;  1TZY B;  4KHA B;  5F99 B;  3LEL B;  2RVQ D;  2Y2Q A;  1EQZ D;  2UWX A;  4Z66 A;  3TU4 D;  4J8U A;  5B32 B;  5B2I A;  3W96 C;  3C1C D;  5AV9 C;  4J8X D;  1AOI A;  5B2J C;  5B33 C;  2PYO C;  5AY8 D;  3UTA B;  4Z5T D;  3W97 D;  3X1T C;  4LD9 C;  3V9R A;  3VH5 T;  3X1U D;  3REJ C;  5B0Z D;  3UT9 D;  4NE3 A;  3AZN C;  1N1J A;  3O62 C;  3X1V C;  1P3L D;  3AZI C;  1U35 C;  4ZUX B;  4CSR B;  5AV5 C;  1HQ3 C;  5B0Y A;  5DNN A;  3W98 A;  2LY8 A;  2ZY5 A;  1KX4 A;  5AV6 D;  5GXQ A;  5B31 A;  3H0R C;  3MGR A;  5B1M C;  1TZY A;  4NE6 A;  3VH6 W;  4KHA A;  3AZH B;  4YS3 A;  1P3P B;  3AFA D;  2F8N G;  3KUY C;  4WU8 A;  3MGS C;  3C1B B;  4H9O B;  3AZG C;  5B24 B;  4J8V C;  3REH D;  4EO5 B;  3LZ1 C;  1F66 B;  2DQN C;  4J8U D;  1KU5 A;  4WU9 C;  3AN2 D;  3UTA A;  5GSU C;  3MGP B;  1P34 D;  1AOI D;  3AZJ C;  1KX5 C;  2NQB B;  3R45 A;  5DNM D;  3REI C;  4JJN C;  3W96 A;  4ZUX A;  5B0Z C;  1KX3 D;  2BYK A;  1P3A D;  4CSR A;  3B6F B;  3A6N B;  3AZK B;  3NQU B;  4KUD D;  5DNN D;  3AZH A;  1HTA A;  2FJ7 C;  5B40 D;  2W8S A;  5B31 D;  3REJ A;  3MGR D;  3WKJ B;  2Y2N A;  3EPJ A;  4YS3 D;  4H9S C;  3X1V A;  4R8P B;  3AZI A;  3C1B A;  4H9O A;  3FDD A;  2NZD D;  1P3O D;  1ZLA B;  3MGQ D;  1F66 A;  4WU8 D;  3AZL B;  2ZY2 A;  3VH6 A;  1M18 B;  4Z66 C;  3B6G B;  5AVC D;  3UTB C;  3MGP A;  4J8U C;  2Y2M A;  5B2I C;  5GT0 B;  4HGA B;  1R4V A;  2NQB A;  4WV4 B;  3KFU G;  5E5A B;  1AOI C;  4G91 B;  2Y2G A;  3REL C;  5JA4 B;  3KUY A;  4J8V A;  3LZ1 A;  1S32 B;  5AV8 A;  3WTP B;  3AZK A;  3W96 D;  4XZQ B;  5AV9 D;  4WU9 A;  5GSU A;  1TAF A;  5B2J D;  5B33 D;  3MNN B;  5BNX B;  4UUZ B;  2XD5 A;  1KX5 A;  2PYO D;  3MVD B;  3X1T D;  3W98 C;  5B0Y C;  5DNN C;  3AZM B;  3X1S C;  4LD9 D;  1KX4 C;  3AZF B;  3REI A;  5GXQ C;  3EPL A;  3REJ D;  2IO5 B;  3AZN D;  2L5A A;  1TZY C;  3O62 D;  5B32 G;  1ZLA A;  5F99 C;  3LEL C;  3A1K A;  4YS3 C;  4DQY B;  2ZY3 A;  3AZI D;  3X1V D;  1U35 D;  5JRG B;  4J8W B;  4X23 B;  1M18 A;  5AV5 D;  1HQ3 D;  3B6G A;  5AVB B;  2J8P A;  5B32 C;  3B0C W;  4WU8 C;  2FJ7 A;  2Y2I A;  5B1M D;  4E45 A;  5GT3 B;  4H9S A;  5JA4 A;  5BT1 C;  3UTA C;  1H3O B;  1P3M B;  3WA9 A;  3KUY D;  1S32 A;  4YM6 B;  3W99 B;  3AZG D;  3MGS D;  3NQJ B;  4XZQ A;  4J8V D;  2F8N H;  3LZ1 D;  5AV8 D;  4XUJ B;  3UTB A;  1M19 B;  2F8N D;  3MNN A;  5BNX A;  4UUZ A;  2BYM B;  4ZUX C;  4WU9 D;  1P3K B;  5GSU D;  3AZJ D;  3F6T A;  3REL A;  3AZF A;  1KX5 D;  1WWI A;  1P3B B;  3AV2 B;  3AZH C;  3REI D;  2HIO B;  4JJN D;  5CPJ B;  5B1L B;  5JRG A;  4J8W A;  4X23 A;  4AWL C;  5AVB A;  5BO0 B;  3C1B C;  1P3I B;  3KXB B;  5B24 C;  1P3G B;  4H9Q B;  5G49 A;  3KSY A;  2RIQ A;  2ARO B;  4EO5 C;  3X1S A;  1F66 C;  5GT3 A;  2FJ7 D;  2JCH A;  1ULY A;  1H3O A;  5CPI B;  1B67 A;  5CPK B;  3MGP C;  1ID3 B;  4NE5 A;  4ZBJ B;  5F99 A;  4QLC B;  5CP6 B;  3LEL A;  3W99 A;  4YM6 A;  1Q9C A;  3LZ0 B;  3KWQ B;  3NQJ A;  2NQB C;  2Y2J A;  3EPK A;  3WA9 D;  5B32 A;  4G92 C;  4Z66 D;  5AV8 C;  3UTB D;  3A6N C;  3AZK C;  5B2I D;  3WAA B;  2JE5 A;  4WNN B;  1P3F B;  3REK B;  3REL D;  4Z2M H;  4NFT A;  2HIO A;  3AZE B;  5CPJ A;  5B1L A;  3AV1 B;  3WKJ C;  3LJA B;  4R8P C;  5BO0 A;  3B0D B;  1P3I A;  3KXB A;  1M1A B;  4H9Q A;  1ZLA C;  3AYW B;  1M18 C;  4KGC B;  5CPI A;  3W98 D;  5B0Y D;  3X1S D;  3B6G C;  1ID3 A;  1KX4 D;  5GT0 C;  5CP6 A;  5GXQ D;  4HGA C;  3IP4 C;  1P3P A;  3KWQ A;  1TZY D;  5E5A C;  4G91 C;  5F99 D;  3LEL D;  2CV5 B;  4M6B A;  3H0M C;  5B24 A;  2Y2K A;  3WA9 C;  1S32 C;  2YFW B;  3VH6 T;  5B32 D;  3WTP C;  1EQZ B;  3WAA A;  2Y2O A;  4XZQ C;  2VQR A;  3WTP E;  3TU4 B;  5FUG B;  2YFV B;  5BNV B;  2G5H C;  3C1C B;  3REK A;  1P3F A;  3MNN C;  4Z2M G;  5BT1 D;  4J8X B;  3UTA D;  4WJ3 C;  3MVD C;  1BFM A;  3AV1 A;  4DRB A;  5AY8 B;  4Z5T B;  3AZF C;  3W97 B;  3LJA A;  2IO5 C;  4CAY B;  3X1U B;  3AYW A;  3A6N A;  3B6F A;  5C3I B;  5B0Z B;  3UT9 B;  1Z2C B;  4ZUX D;  1T3U A;  5JRG C;  3NQU A;  2HUE B;  4X23 C;  4J8W C;  1P3L B;  4KGC A;  4H9N B;  5AVB C;  5AV6 B;  1B6W A;  3AZH D;  3WKJ A;  5GT3 C;  2CV5 A;  1WWS A;  4R8P A;  1P3P D;  1P3M C;  3W99 C;  2YFW A;  4YM6 C;  3AFA B;  3C1B D;  3AZL A;  1EQZ A;  5B24 D;  3TU4 A;  5CHL B;  5FUG A;  1F66 D;  3C1C A;  4XUJ C;  2F2A C;  1M19 C;  5GT0 A;  3REH B;  4J8X A;  4J8U B;  1P3K C;  3VH5 W;  3MGP D;  5E5A A;  3AN2 B;  1F1E A;  4Z5T A;  3W97 A;  1P34 B;  1AOI B;  2NQB D;  3AV2 C;  3X1U A;  2HIO C;  3WTP A;  5CPJ C;  5DNM B;  5B1L C;  1P3L A;  3B6F D;  3A6N D;  3AZK D;  1KX3 B;  1P3A B;  2F8N K;  1P3I C;  4E44 A;  3KXB C;  3MVD A;  2ARO C;  3AZM A;  3AL0 C;  1BH9 B;  4KUD B;  5DNN B;  5CPI C;  1ID3 C;  5B40 B;  3WKJ D;  4ZBJ C;  5B31 B;  5CP6 C;  4R8P D;  3LZ0 C;  3AFA A;  3MGR B;  1P3P C;  3KWQ C;  4YS3 B;  1ZLA D;  3H0L C;  2NZD B;  3AZL D;  1P3O B;  3REH A;  3MGQ B;  1M18 D;  1BH8 B;  4WU8 B;  3B6G D;  2ZY4 A;  3WAA C;  3AN2 A;  2CWE A;  4UPK A;  5GT0 D;  5AVC B;  1P34 A;  1P3M A;  1P3F C;  3REK C;  5E5A D;  3B0C T;  3AZE C;  5DNM A;  2BG1 A;  3AV1 C;  1S32 D;  1M19 A;  4XUJ A;  3WTP D;  3VH5 A;  4XZQ D;  3LJA C;  3R45 B;  1P3A A;  1KX3 A;  2BYM A;  3B0D C;  1P3K A;  1M1A C;  3W96 B;  3AYW C;  5AV9 B;  3B6F C;  5KDM B;  4DRA A;  3MNN D;  2BYK B;  1BH9 A;  4KUD A;  4KGC C;  5B2J B;  3MVD D;  1P3B A;  5B33 B;  2PYO B;  3AZM D;  3AV2 A;  5B40 A;  3AZF D;  5BS7 A;  3X1T B;  4LD9 B;  2CV5 C;  3REJ B;  1W2E A;  3AZN B;  2NZD A;  3O62 B;  1P3O A;  1P3G A;  5JRG D;  3MGQ A;  4X23 D;  4J8W D;  4AWL B;  1BH8 A;  3AZI B;  2ARO A;  2RVQ C;  3X1V B;  2G5I C;  4H9P B;  1U35 B;  5AVB D;  1EQZ C;  3AZL C;  5AV5 B;  1HQ3 B;  3TU4 C;  5AVC A;  3EPH A;  5CPK A;  3C1C C;  4WZS B;  4QLC A;  5GT3 D;  3LZ0 A;  5B1M B;  4J8X C;  1P3M D;  5AY8 C;  4Z5T C;  3W99 D;  4YM6 D;  3W97 C;  3P5J B;  3KUY B;  3AZG B;  3MGS B;  1M19 D;  4XUJ D;  5AV9 A;  3X1U C;  5KDM A;  4J8V B;  4G92 B;  5C3I C;  3UT9 C;  3LZ1 B;  5AV8 B;  1P3K D;  4WNN A;  4H9R B;  2HUE C;  5B2J A;  1P3L C;  5B33 A;  2F8N B;  4WU9 B;  2PYO A;  5GSU B;  1TAF B;  3EG5 B;  3AZE A;  3X1T A;  1JFI B;  3AZJ B;  1P3B D;  4LD9 A;  3AZM C;  1KX5 B;  5AV6 C;  3AV2 D;  2HIO D;  5CPJ D;  3AZN A;  5B1L D;  3O62 A;  3REI B;  1M1A A;  1A7W A;  4JJN B;  1U35 A;  4H9P A;  2DF4 C;  3AFA C;  2XD1 A;  1P3I D;  3KXB D;  1P3G D;  1PZR A;  1HQ3 A;  5AV5 A;  2ARO D;  3REH C;  5B1M A;  2Y2H A;  5CPI D;  5CPK D;  1ID3 D;  2FJ7 B;  3AN2 C;  4QLC D;  5CP6 D;  3LZ0 D;  1P34 C;  3KWQ D;  3AZG A;  3MGS A;  5DNM C; 
#chains in the Genus database with same CATH homology
 3WA9 B;  2YFV A;  4H9R A;  5BNV A;  2F8N A;  3WAA D;  4Z66 B;  1KX3 C;  1P3A C;  3UTB B;  3A1I A;  1JFI A;  5B2I B;  3AZJ A;  1P3F D;  3REK D;  5B31 G;  5AY8 A;  4KUD C;  3AZE D;  3REL B;  1P3B C;  2FFF B;  3AV1 D;  4JJN A;  4CAY A;  5B40 C;  5BS7 C;  5B31 C;  3LJA D;  5B0Z A;  3MGR C;  3UT9 A;  2Y2L A;  3V9R B;  1M1A D;  3AYW D;  3B0B A;  2ZM5 A;  2Y2P A;  4H9N A;  2NZD C;  1N1J B;  1P3O C;  1P3G C;  3MGQ C;  4KGC D;  2JSS A;  5AV6 A;  5G49 B;  3W98 B;  5B0Y B;  3X1S B;  5AVC C;  1KX4 B;  5CPK C;  5GXQ B;  4QLC C;  2CV5 D;  1TZY B;  4KHA B;  5F99 B;  3LEL B;  2RVQ D;  2Y2Q A;  1EQZ D;  2UWX A;  4Z66 A;  3TU4 D;  4J8U A;  5B32 B;  5B2I A;  3W96 C;  3C1C D;  5AV9 C;  4J8X D;  1AOI A;  5B2J C;  5B33 C;  2PYO C;  5AY8 D;  3UTA B;  4Z5T D;  3W97 D;  3X1T C;  4LD9 C;  3V9R A;  3VH5 T;  3X1U D;  3REJ C;  5B0Z D;  3UT9 D;  4NE3 A;  3AZN C;  1N1J A;  3O62 C;  3X1V C;  1P3L D;  3AZI C;  1U35 C;  4ZUX B;  4CSR B;  5AV5 C;  1HQ3 C;  5B0Y A;  5DNN A;  3W98 A;  2LY8 A;  2ZY5 A;  1KX4 A;  5AV6 D;  5GXQ A;  5B31 A;  3H0R C;  3MGR A;  5B1M C;  1TZY A;  4NE6 A;  3VH6 W;  4KHA A;  3AZH B;  4YS3 A;  1P3P B;  3AFA D;  2F8N G;  3KUY C;  4WU8 A;  3MGS C;  3C1B B;  4H9O B;  3AZG C;  5B24 B;  4J8V C;  3REH D;  4EO5 B;  3LZ1 C;  1F66 B;  2DQN C;  4J8U D;  1KU5 A;  4WU9 C;  3AN2 D;  3UTA A;  5GSU C;  3MGP B;  1P34 D;  1AOI D;  3AZJ C;  1KX5 C;  2NQB B;  3R45 A;  5DNM D;  3REI C;  4JJN C;  3W96 A;  4ZUX A;  5B0Z C;  1KX3 D;  2BYK A;  1P3A D;  4CSR A;  3B6F B;  3A6N B;  3AZK B;  3NQU B;  4KUD D;  5DNN D;  3AZH A;  1HTA A;  2FJ7 C;  5B40 D;  2W8S A;  5B31 D;  3REJ A;  3MGR D;  3WKJ B;  2Y2N A;  3EPJ A;  4YS3 D;  4H9S C;  3X1V A;  4R8P B;  3AZI A;  3C1B A;  4H9O A;  3FDD A;  2NZD D;  1P3O D;  1ZLA B;  3MGQ D;  1F66 A;  4WU8 D;  3AZL B;  2ZY2 A;  3VH6 A;  1M18 B;  4Z66 C;  3B6G B;  5AVC D;  3UTB C;  3MGP A;  4J8U C;  2Y2M A;  5B2I C;  5GT0 B;  4HGA B;  1R4V A;  2NQB A;  4WV4 B;  3KFU G;  5E5A B;  1AOI C;  4G91 B;  2Y2G A;  3REL C;  5JA4 B;  3KUY A;  4J8V A;  3LZ1 A;  1S32 B;  5AV8 A;  3WTP B;  3AZK A;  3W96 D;  4XZQ B;  5AV9 D;  4WU9 A;  5GSU A;  1TAF A;  5B2J D;  5B33 D;  3MNN B;  5BNX B;  4UUZ B;  2XD5 A;  1KX5 A;  2PYO D;  3MVD B;  3X1T D;  3W98 C;  5B0Y C;  5DNN C;  3AZM B;  3X1S C;  4LD9 D;  1KX4 C;  3AZF B;  3REI A;  5GXQ C;  3EPL A;  3REJ D;  2IO5 B;  3AZN D;  2L5A A;  1TZY C;  3O62 D;  5B32 G;  1ZLA A;  5F99 C;  3LEL C;  3A1K A;  4YS3 C;  4DQY B;  2ZY3 A;  3AZI D;  3X1V D;  1U35 D;  5JRG B;  4J8W B;  4X23 B;  1M18 A;  5AV5 D;  1HQ3 D;  3B6G A;  5AVB B;  2J8P A;  5B32 C;  3B0C W;  4WU8 C;  2FJ7 A;  2Y2I A;  5B1M D;  4E45 A;  5GT3 B;  4H9S A;  5JA4 A;  5BT1 C;  3UTA C;  1H3O B;  1P3M B;  3WA9 A;  3KUY D;  1S32 A;  4YM6 B;  3W99 B;  3AZG D;  3MGS D;  3NQJ B;  4XZQ A;  4J8V D;  2F8N H;  3LZ1 D;  5AV8 D;  4XUJ B;  3UTB A;  1M19 B;  2F8N D;  3MNN A;  5BNX A;  4UUZ A;  2BYM B;  4ZUX C;  4WU9 D;  1P3K B;  5GSU D;  3AZJ D;  3F6T A;  3REL A;  3AZF A;  1KX5 D;  1WWI A;  1P3B B;  3AV2 B;  3AZH C;  3REI D;  2HIO B;  4JJN D;  5CPJ B;  5B1L B;  5JRG A;  4J8W A;  4X23 A;  4AWL C;  5AVB A;  5BO0 B;  3C1B C;  1P3I B;  3KXB B;  5B24 C;  1P3G B;  4H9Q B;  5G49 A;  3KSY A;  2RIQ A;  2ARO B;  4EO5 C;  3X1S A;  1F66 C;  5GT3 A;  2FJ7 D;  2JCH A;  1ULY A;  1H3O A;  5CPI B;  1B67 A;  5CPK B;  3MGP C;  1ID3 B;  4NE5 A;  4ZBJ B;  5F99 A;  4QLC B;  5CP6 B;  3LEL A;  3W99 A;  4YM6 A;  1Q9C A;  3LZ0 B;  3KWQ B;  3NQJ A;  2NQB C;  2Y2J A;  3EPK A;  3WA9 D;  5B32 A;  4G92 C;  4Z66 D;  5AV8 C;  3UTB D;  3A6N C;  3AZK C;  5B2I D;  3WAA B;  2JE5 A;  4WNN B;  1P3F B;  3REK B;  3REL D;  4Z2M H;  4NFT A;  2HIO A;  3AZE B;  5CPJ A;  5B1L A;  3AV1 B;  3WKJ C;  3LJA B;  4R8P C;  5BO0 A;  3B0D B;  1P3I A;  3KXB A;  1M1A B;  4H9Q A;  1ZLA C;  3AYW B;  1M18 C;  4KGC B;  5CPI A;  3W98 D;  5B0Y D;  3X1S D;  3B6G C;  1ID3 A;  1KX4 D;  5GT0 C;  5CP6 A;  5GXQ D;  4HGA C;  3IP4 C;  1P3P A;  3KWQ A;  1TZY D;  5E5A C;  4G91 C;  5F99 D;  3LEL D;  2CV5 B;  4M6B A;  3H0M C;  5B24 A;  2Y2K A;  3WA9 C;  1S32 C;  2YFW B;  3VH6 T;  5B32 D;  3WTP C;  1EQZ B;  3WAA A;  2Y2O A;  4XZQ C;  2VQR A;  3WTP E;  3TU4 B;  5FUG B;  2YFV B;  5BNV B;  2G5H C;  3C1C B;  3REK A;  1P3F A;  3MNN C;  4Z2M G;  5BT1 D;  4J8X B;  3UTA D;  4WJ3 C;  3MVD C;  1BFM A;  3AV1 A;  4DRB A;  5AY8 B;  4Z5T B;  3AZF C;  3W97 B;  3LJA A;  2IO5 C;  4CAY B;  3X1U B;  3AYW A;  3A6N A;  3B6F A;  5C3I B;  5B0Z B;  3UT9 B;  1Z2C B;  4ZUX D;  1T3U A;  5JRG C;  3NQU A;  2HUE B;  4X23 C;  4J8W C;  1P3L B;  4KGC A;  4H9N B;  5AVB C;  5AV6 B;  1B6W A;  3AZH D;  3WKJ A;  5GT3 C;  2CV5 A;  1WWS A;  4R8P A;  1P3P D;  1P3M C;  3W99 C;  2YFW A;  4YM6 C;  3AFA B;  3C1B D;  3AZL A;  1EQZ A;  5B24 D;  3TU4 A;  5CHL B;  5FUG A;  1F66 D;  3C1C A;  4XUJ C;  2F2A C;  1M19 C;  5GT0 A;  3REH B;  4J8X A;  4J8U B;  1P3K C;  3VH5 W;  3MGP D;  5E5A A;  3AN2 B;  1F1E A;  4Z5T A;  3W97 A;  1P34 B;  1AOI B;  2NQB D;  3AV2 C;  3X1U A;  2HIO C;  3WTP A;  5CPJ C;  5DNM B;  5B1L C;  1P3L A;  3B6F D;  3A6N D;  3AZK D;  1KX3 B;  1P3A B;  2F8N K;  1P3I C;  4E44 A;  3KXB C;  3MVD A;  2ARO C;  3AZM A;  3AL0 C;  1BH9 B;  4KUD B;  5DNN B;  5CPI C;  1ID3 C;  5B40 B;  3WKJ D;  4ZBJ C;  5B31 B;  5CP6 C;  4R8P D;  3LZ0 C;  3AFA A;  3MGR B;  1P3P C;  3KWQ C;  4YS3 B;  1ZLA D;  3H0L C;  2NZD B;  3AZL D;  1P3O B;  3REH A;  3MGQ B;  1M18 D;  1BH8 B;  4WU8 B;  3B6G D;  2ZY4 A;  3WAA C;  3AN2 A;  2CWE A;  4UPK A;  5GT0 D;  5AVC B;  1P34 A;  1P3M A;  1P3F C;  3REK C;  5E5A D;  3B0C T;  3AZE C;  5DNM A;  2BG1 A;  3AV1 C;  1S32 D;  1M19 A;  4XUJ A;  3WTP D;  3VH5 A;  4XZQ D;  3LJA C;  3R45 B;  1P3A A;  1KX3 A;  2BYM A;  3B0D C;  1P3K A;  1M1A C;  3W96 B;  3AYW C;  5AV9 B;  3B6F C;  5KDM B;  4DRA A;  3MNN D;  2BYK B;  1BH9 A;  4KUD A;  4KGC C;  5B2J B;  3MVD D;  1P3B A;  5B33 B;  2PYO B;  3AZM D;  3AV2 A;  5B40 A;  3AZF D;  5BS7 A;  3X1T B;  4LD9 B;  2CV5 C;  3REJ B;  1W2E A;  3AZN B;  2NZD A;  3O62 B;  1P3O A;  1P3G A;  5JRG D;  3MGQ A;  4X23 D;  4J8W D;  4AWL B;  1BH8 A;  3AZI B;  2ARO A;  2RVQ C;  3X1V B;  2G5I C;  4H9P B;  1U35 B;  5AVB D;  1EQZ C;  3AZL C;  5AV5 B;  1HQ3 B;  3TU4 C;  5AVC A;  3EPH A;  5CPK A;  3C1C C;  4WZS B;  4QLC A;  5GT3 D;  3LZ0 A;  5B1M B;  4J8X C;  1P3M D;  5AY8 C;  4Z5T C;  3W99 D;  4YM6 D;  3W97 C;  3P5J B;  3KUY B;  3AZG B;  3MGS B;  1M19 D;  4XUJ D;  5AV9 A;  3X1U C;  5KDM A;  4J8V B;  4G92 B;  5C3I C;  3UT9 C;  3LZ1 B;  5AV8 B;  1P3K D;  4WNN A;  4H9R B;  2HUE C;  5B2J A;  1P3L C;  5B33 A;  2F8N B;  4WU9 B;  2PYO A;  5GSU B;  1TAF B;  3EG5 B;  3AZE A;  3X1T A;  1JFI B;  3AZJ B;  1P3B D;  4LD9 A;  3AZM C;  1KX5 B;  5AV6 C;  3AV2 D;  2HIO D;  5CPJ D;  3AZN A;  5B1L D;  3O62 A;  3REI B;  1M1A A;  1A7W A;  4JJN B;  1U35 A;  4H9P A;  2DF4 C;  3AFA C;  2XD1 A;  1P3I D;  3KXB D;  1P3G D;  1PZR A;  1HQ3 A;  5AV5 A;  2ARO D;  3REH C;  5B1M A;  2Y2H A;  5CPI D;  5CPK D;  1ID3 D;  2FJ7 B;  3AN2 C;  4QLC D;  5CP6 D;  3LZ0 D;  1P34 C;  3KWQ D;  3AZG A;  3MGS A;  5DNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...