3WAAC

The nucleosome containing human h2a.z.2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaC00
4KHAA 3C1BD 3X1UD 3B6FA 4KGCA 3REKA 3LELD 5B24A 1A7WA 3NQJB 4H9SA 4HGAC 3AFAA 5B40B 5AV5C 4R8PA 3MGSC 1ID3D 5KDMB 1P3ID 2HIOC 3AZLB 4H9RB 5AV5D 5KDMA 5E5AA 3X1SA 2CWEA 5GT0B 2CV5B 5B31A 3W97B 3AZGB 1KX5C 3TU4D 3V9RA 3AZJC 2NZDD 3AZGA 5CPIC 5CPKC 1P3LC 1BH8A 4WU9A 4CAYA 4WU8A 3UTAD 3AZJD 1KX3B 3LZ0C 3AV2C 5CPID 5CPKD 5AVBC 4J8XB 1P3BD 3LZ0D 4YM6B 4QLCB 3AZEC 3WA9A 2PYOD 3MGPC 1AOIC 3WTPA 1ZLAB 3MGRB 4QLCA 5B32D 4XUJB 4G91B 3AZED 1P3OB 3AZMA 1S32B 1ZLAA 5CPJB 3B0DC 1P34C 5GT3C 5CPJA 3C1CC 1M18B 4UUZB 2RVQC 3O62C 5G49B 3AN2C 4X23C 3W96C 2FJ7C 5AV9B 5GT3D 5CHLB 5FUGB 5CP6C 4J8UA 1M18A 3AZIC 3B6GB 2RVQD 3O62D 2FJ7D 3W96D 1KX4B 5CP6D 4NFTA 3B6GA 1M1AB 3B6FC 3LELA 3REIB 3NQUB 3X1TC 5GXQD 3REKC 1TAFB 3REIA 1B6WA 3NQUA 3B6FD 4KGCD 3REKD 5B24D 3VH6A 5AV5A 2HIOB 5B40C 4JJNB 3MGSA 1P3MB 4DRBA 2HIOA 5B40D 5B2IB 3AZLC 4M6BA 5BNXB 5E5AD 5GT0C 2CV5C 3W97C 5B31D 1KX5A 1P3LB 5BNXA 5DNNB 5B0YB 5GT0D 2CV5D 3W97D 5CPKA 1P3LA 3LZ1C 3AZGD 1H3OB 4WU9D 5AVBB 4CSRB 1U35B 3LZ0A 4WU8D 1KX3C 3AV2A 5B33B 5AVBA 1U35A 3LJAB 3MGPB 4J8XC 3AZEA 1P3KC 4YM6C 4KUDC 2LY8A 3MGPA 1AOIA 3WA9D 1P34B 4H9OB 3MGRC 1F66B 4XUJC 4G91C 4QLCD 1P3OC 1S32C 5AY8B 1P34A 1ZLAD 3KXBB 3MGRD 3VH5W 3C1CA 1P3OD 1BH9A 1Q9CA 1HTAA 5CPJD 2FJ7A 3O62A 3AN2A 4X23A 3VH5A 5AV9C 5CP6A 1ULYA 1M18D 3AZIA 5B1LC 4E45A 3X1TB 5AVCB 3B0BA 1KX4C 1P3AC 3B6GD 3KWQB 1M1AC 3X1TA 3REIC 2NQBB 1KX4D 4WZSB 3VH5T 1M1AD 3REID 3NQJA 1TZYB 1B67A 3WKJB 5B40A 5AV6C 4JJNC 2AROC 1WWIA 3MGSD 1TZYA 4WV4B 1P3MC 3AYWC 3AZLA 4H9RA 2HIOD 5B2IC 4JJND 1P3MD 3KUYC 2F8NG 3W97A 5GT0A 2CV5A 1R4VA 3LZ1B 1KX5D 4ZBJC 2BYKB 5DNNC 5B0YC 3LZ1A 1P3LD 1KX3A 1U35C 5DNND 5B0YD 3AZNB 3AV2D 5B33C 1P3KB 4KUDB 4J8XA 3UTBB 5AVBD 3LJAC 1U35D 1P3KA 4YM6A 4KUDA 5B33D 4NE3A 3AZFC 3MGPD 3MGRA 4ZUXB 3REJB 1AOID 1F66C 4XUJA 5GSUB 1P3OA 1S32A 3RELB 2HUEC 5AY8C 3REJA 1P34D 3KXBC 5GSUA 3AV1B 3RELA 4Z5TB 3C1CD 4UUZA 5B1LB 5G49A 3KXBD 3A6NC 5AV9A 3AN2D 4X23D 1HQ3B 2YFVB 5FUGA 5B1LA 2F8NB 1P3AB 3AZID 1KX4A 5AVCC 1P3AA 3VH6W 1M1AA 3KWQC 2NQBC 3X1TD 5AVCD 5B1MB 1TAFA 5AV6B 4H9QB 2AROB 2NQBD 3REHB 1TZYC 1P3FB 3WKJC 5AV6A 3UT9B 3AYWB 4JJNA 5B32G 4H9QA 2AROA 1P3MA 1TZYD 3AYWA 3KUYB 3WKJD 5B2IA 3AZLD 1ID3B 3MNNB 4ZBJB 3KUYA 1P3GB 3VH6T 2L5AA 2IO5B 1EQZB 5DNMB 5DNNA 5B0YA 3AZHB 3TU4B 1H3OA 3LZ1D 5F99B 4CSRA 1KX3D 5JA4B 3MGQB 5B33A 3AZNC 3WTPE 5F99A 1F1EA 5BO0B 3UTAB 3LJAA 3UTBC 3AZFB 3W99B 5JA4A 4J8XD 3AZND 3MVDB 4G92B 1P3KD 4YM6D 4KUDD 3R45B 4E44A 3AZFA 3W99A 2HUEB 2JSSA 1P3BB 4H9OA 5B0ZB 4ZUXC 3REJC 2BYMB 3MVDA 1N1JB 1P3PB 1F66A 5GSUC 4XUJD 2PYOB 5AY8A 3AZKB 1S32D 3RELC 2YFWB 1JFIB 3KXBA 1N1JA 4ZUXD 3REJD 4DRAA 4EO5C 5B32B 3A6NB 3X1VB 5GSUD 3AV1C 1M19C 4LD9B 4Z66B 4Z5TC 3RELD 1JFIA 5B31G 3X1VA 3A6NA 4J8WB 1HQ3C 5AV9D 3AV1D 4Z5TD 5AV8B 5B1LD 4XZQB 5AVCA 4J8VC 1HQ3D 3KWQA 1P3AD 4AWLC 2NQBA 5BNVB 4H9PB 4WNNB 5B1MC 4NE5A 5BNVA 4H9PA 3REHC 3WKJA 3C1BC 5B1MD 1P3FC 3UT9C 5AV6D 2AROD 5B2JB 1P3FD 3UT9D 3AFAB 3AYWD 5C3IB 5B2ID 4R8PB 1ID3C 3MNNC 3KSYA 5B2JA 1P3IC 1P3GC 3KUYD 2IO5C 1EQZC 5JRGB 3MNND 5DNMC 1P3GD 2BYKA 5E5AB 3X1SB 5BS7C 5B31B 5JRGA 3AZHC 1EQZD 3TU4C 5DNMD 5F99C 2NZDC 3V9RB 3AZNA 3AZHD 3MGQC 3WAAB 1BH8B 4WU9B 4YS3B 5F99D 4CAYB 3UTAC 3UTBA 4WU8B 3W99C 3LJAD 3WAAA 3MGQD 3MVDC 4YS3A 4G92C 4Z2MG 1P3BC 3AZFD 4ZUXA 3W99D 2F8NH 5B0ZC 4EO5B 1P3PC 1F66D 3MVDD 1M19B 2F8NK 2PYOC 3WA9B 3AZKC 5AY8D 3WTPB 5B0ZD 3X1VC 5B32C 1P3PD 1M19A 3AV1A 4LD9C 3AZMB 4Z5TA 4Z66C 3AZKD 4H9NB 3X1VD 4J8WC 1HQ3A 2YFVA 3A6ND 4J8VB 3W98B 4LD9D 4Z66D 2F8NA 4H9NA 5AV8C 4XZQC 3B0CW 4AWLB 4J8VA 3W98A 4J8WD 4J8UB 5AV8D 5BT1C 4XZQD 3KWQD 5B1MA 3C1BB 3X1UB 4Z2MH 5BT1D 3LELB 5GXQC 3REHA 3C1BA 3X1UA 1P3FA 3UT9A 4KGCC 1KU5A 1P3IB 1BFMA 5B24C 4HGAB 5B2JC 4H9SC 3B0CT 3AFAC 5AV5B 1ID3A 5C3IC 3MNNA 4R8PC 3MGSB 1P3IA 1P3GA 5B2JD 1EQZA 3AFAD 5JRGC 4R8PD 5DNMA 2NZDB 5E5AC 3X1SC 5BS7A 3AZHA 5B31C 3TU4A 5JRGD 1KX5B 4NE6A 2NZDA 3AZJB 3X1SD 3MGQA 5CPIB 3AZGC 5CPKB 3WAAC 5BO0A 3UTAA 4YS3C 3AZJA 4WU9C 4WU8C 3UTBD 3LZ0B 5CPIA 3AV2B 3WAAD 3R45A 4YS3D 1P3BA 5B0ZA 2BYMA 1P3PA 3AZEB 2PYOA 3AZKA 3WA9C 2YFWA 1AOIB 3WTPC 5B32A 4QLCC 4LD9A 1M19D 4Z66A 3AZMC 3B0DB 1ZLAC 3WTPD 4J8WA 5GT3B 3W98C 3C1CB 3AZMD 1BH9B 5CPJC 5AV8A 4XZQA 2F8ND 2FJ7B 3O62B 3AN2B 4X23B 3W96B 5GT3A 4J8VD 3W98D 5CP6B 1M18C 4J8UC 3AZIB 3W96A 5GXQB 4WNNA 1WWSA 4J8UD 3X1UC 4KHAB 3B6GC 3B6FB 5GXQA 4KGCB 3LELC 3REKB 3REHD 5B24B
chains in the Genus database with same CATH superfamily
4KHAA 3C1BD 3X1UD 3B6FA 4KGCA 3REKA 3LELD 5B24A 1A7WA 3NQJB 4H9SA 4HGAC 3AFAA 5B40B 5AV5C 4R8PA 3MGSC 1ID3D 5KDMB 1P3ID 3H0RC 2HIOC 3AZLB 4H9RB 5AV5D 5KDMA 5E5AA 3X1SA 2CWEA 5GT0B 2CV5B 5B31A 3W97B 3AZGB 1KX5C 3TU4D 3V9RA 3AZJC 2NZDD 4WJ3C 3AZGA 5CPIC 5CPKC 1P3LC 1BH8A 4WU9A 4CAYA 4WU8A 3UTAD 3AZJD 1KX3B 3LZ0C 3AV2C 5CPID 5CPKD 5AVBC 4J8XB 1P3BD 3LZ0D 4YM6B 2Y2GA 4QLCB 3AZEC 3WA9A 2PYOD 3MGPC 1AOIC 3WTPA 1ZLAB 3AL0C 3MGRB 4QLCA 5B32D 4XUJB 4G91B 3AZED 1P3OB 3AZMA 1S32B 1ZLAA 2Y2HA 5CPJB 3B0DC 1P34C 5GT3C 5CPJA 3C1CC 1M18B 2Y2IA 4UUZB 2RVQC 3O62C 5G49B 3AN2C 4X23C 3W96C 2FJ7C 5AV9B 3IP4C 3H0LC 5CHLB 5FUGB 5GT3D 5CP6C 4J8UA 1M18A 3AZIC 3B6GB 3FDDA 2XD5A 2RVQD 3O62D 2FJ7D 3W96D 1KX4B 5CP6D 1Z2CB 4NFTA 3B6GA 1M1AB 3B6FC 3LELA 3REIB 3NQUB 3X1TC 5GXQD 3REKC 2DQNC 1TAFB 3REIA 1B6WA 3NQUA 2JE5A 2Y2NA 3B6FD 4KGCD 3REKD 2DF4C 5B24D 3VH6A 5AV5A 2HIOB 5B40C 4JJNB 3MGSA 1P3MB 4DRBA 2HIOA 5B40D 5B2IB 3AZLC 1T3UA 4M6BA 5BNXB 5E5AD 5GT0C 2CV5C 3W97C 5B31D 1KX5A 1P3LB 5BNXA 5DNNB 5B0YB 5GT0D 2CV5D 3W97D 5CPKA 1P3LA 3LZ1C 3AZGD 1H3OB 4WU9D 5AVBB 4CSRB 1U35B 3LZ0A 4WU8D 1KX3C 2J8PA 3AV2A 5B33B 5AVBA 1U35A 3LJAB 3MGPB 4J8XC 3AZEA 1P3KC 4YM6C 4KUDC 2LY8A 3MGPA 1AOIA 3WA9D 1P34B 4H9OB 3MGRC 1F66B 4XUJC 4G91C 4QLCD 1P3OC 1S32C 5AY8B 1P34A 1ZLAD 3KXBB 3MGRD 3VH5W 3C1CA 1P3OD 1BH9A 1Q9CA 1HTAA 5CPJD 2FJ7A 3O62A 3AN2A 4X23A 3VH5A 5AV9C 5CP6A 1ULYA 1M18D 3AZIA 5B1LC 4E45A 3X1TB 5AVCB 3B0BA 1KX4C 1P3AC 3B6GD 3KWQB 1M1AC 3X1TA 3REIC 2NQBB 1PZRA 1KX4D 4WZSB 3VH5T 1M1AD 3REID 3NQJA 1TZYB 1B67A 3A1KA 3WKJB 5B40A 5AV6C 2Y2LA 4JJNC 2AROC 1WWIA 3MGSD 1TZYA 4WV4B 1P3MC 3AYWC 3AZLA 4H9RA 2HIOD 5B2IC 4JJND 1P3MD 3EPKA 3KUYC 2F8NG 3W97A 5GT0A 2CV5A 1R4VA 3LZ1B 1KX5D 4ZBJC 2XD1A 2BYKB 5DNNC 5B0YC 3LZ1A 3EPHA 1P3LD 1KX3A 1U35C 5DNND 5B0YD 3AZNB 3AV2D 2G5IC 5B33C 1P3KB 4KUDB 4J8XA 3UTBB 5AVBD 3LJAC 1U35D 1P3KA 4YM6A 4KUDA 5B33D 4NE3A 3AZFC 3MGPD 3MGRA 4ZUXB 3REJB 1AOID 1F66C 4XUJA 5GSUB 1P3OA 1S32A 3RELB 2HUEC 5AY8C 3REJA 1P34D 3KXBC 5GSUA 3AV1B 3RELA 4Z5TB 3C1CD 4UUZA 5B1LB 5G49A 3KXBD 3A6NC 5AV9A 3AN2D 4X23D 1HQ3B 2YFVB 5FUGA 5B1LA 2F8NB 1P3AB 3AZID 1KX4A 5AVCC 3KFUG 1P3AA 3VH6W 1M1AA 3KWQC 2NQBC 3X1TD 5AVCD 5B1MB 1TAFA 5AV6B 4H9QB 2AROB 2NQBD 3REHB 1TZYC 1P3FB 3WKJC 5AV6A 3UT9B 3AYWB 4JJNA 5B32G 4H9QA 2AROA 1P3MA 1TZYD 3AYWA 3KUYB 3WKJD 5B2IA 3AZLD 1ID3B 3MNNB 4ZBJB 3KUYA 1P3GB 3VH6T 2L5AA 2IO5B 1EQZB 5DNMB 2JCHA 5DNNA 5B0YA 3AZHB 3TU4B 1H3OA 3LZ1D 5F99B 4CSRA 1KX3D 5JA4B 3MGQB 5B33A 3AZNC 3WTPE 5F99A 1F1EA 5BO0B 3UTAB 3LJAA 3UTBC 3AZFB 3W99B 5JA4A 4J8XD 3AZND 3MVDB 4G92B 1P3KD 4YM6D 4KUDD 3R45B 4E44A 3AZFA 3W99A 2HUEB 2JSSA 2RIQA 1P3BB 4H9OA 5B0ZB 4ZUXC 3REJC 2BYMB 3MVDA 1N1JB 1P3PB 1F66A 5GSUC 4XUJD 2PYOB 5AY8A 3AZKB 1S32D 3RELC 2YFWB 1JFIB 3KXBA 1N1JA 4ZUXD 3REJD 4DRAA 4EO5C 5B32B 3A6NB 3X1VB 5GSUD 3AV1C 1M19C 4LD9B 4Z66B 2W8SA 4Z5TC 3RELD 5B31G 1JFIA 3X1VA 3A6NA 2Y2KA 4J8WB 1HQ3C 5AV9D 3AV1D 4Z5TD 5AV8B 5B1LD 4XZQB 3EPJA 5AVCA 3A1IA 4J8VC 1HQ3D 3KWQA 1P3AD 4AWLC 2NQBA 5BNVB 4H9PB 4WNNB 5B1MC 4NE5A 5BNVA 4H9PA 2ZY3A 3REHC 3WKJA 3C1BC 5B1MD 1P3FC 3UT9C 5AV6D 2AROD 5B2JB 1P3FD 3UT9D 3AFAB 3AYWD 5C3IB 5B2ID 4R8PB 1ID3C 3MNNC 3KSYA 5B2JA 1P3IC 1P3GC 3KUYD 2IO5C 1EQZC 5JRGB 4UPKA 3MNND 5DNMC 1P3GD 2BYKA 5E5AB 3X1SB 5BS7C 5B31B 5JRGA 3AZHC 1EQZD 3TU4C 2UWXA 5DNMD 5F99C 2NZDC 3V9RB 3AZNA 3AZHD 3MGQC 3WAAB 1BH8B 4WU9B 4YS3B 5F99D 4CAYB 3UTAC 3F6TA 4WU8B 3UTBA 3W99C 3LJAD 3WAAA 3MGQD 3MVDC 4YS3A 4G92C 4Z2MG 1P3BC 3AZFD 4ZUXA 3W99D 2F8NH 5B0ZC 4EO5B 1P3PC 1F66D 3MVDD 1M19B 2F8NK 2PYOC 3WA9B 3AZKC 5AY8D 3WTPB 5B0ZD 3X1VC 5B32C 1P3PD 1M19A 3AV1A 4LD9C 3AZMB 4Z5TA 4Z66C 3AZKD 4H9NB 3X1VD 4J8WC 1HQ3A 2YFVA 3A6ND 4J8VB 3W98B 4LD9D 4Z66D 2F8NA 4H9NA 5AV8C 4XZQC 3B0CW 4AWLB 4J8VA 3W98A 4J8WD 4J8UB 5AV8D 4DQYB 5BT1C 4XZQD 3KWQD 5B1MA 3C1BB 3X1UB 3P5JB 4Z2MH 5BT1D 3LELB 5GXQC 3REHA 3C1BA 3X1UA 1P3FA 3UT9A 4KGCC 1KU5A 1P3IB 1BFMA 5B24C 4HGAB 5B2JC 3EG5B 4H9SC 3B0CT 3EPLA 3AFAC 5AV5B 1ID3A 5C3IC 3MNNA 4R8PC 3MGSB 1P3IA 1P3GA 2ZY5A 5B2JD 3H0MC 1EQZA 3AFAD 5JRGC 2G5HC 4R8PD 2BG1A 5DNMA 2NZDB 5E5AC 3X1SC 2Y2MA 5BS7A 3AZHA 5B31C 3TU4A 5JRGD 1KX5B 4NE6A 2NZDA 3AZJB 3X1SD 3MGQA 5CPIB 3AZGC 5CPKB 3WAAC 2F2AC 5BO0A 3UTAA 4YS3C 3AZJA 4WU9C 4WU8C 3UTBD 2FFFB 1W2EA 3LZ0B 5CPIA 3AV2B 2Y2QA 3WAAD 3R45A 4YS3D 2Y2JA 1P3BA 5B0ZA 2BYMA 1P3PA 3AZEB 2PYOA 3AZKA 3WA9C 2YFWA 1AOIB 2ZM5A 3WTPC 5B32A 4QLCC 4LD9A 1M19D 4Z66A 3AZMC 3B0DB 1ZLAC 3WTPD 4J8WA 5GT3B 3W98C 3C1CB 3AZMD 1BH9B 5CPJC 5AV8A 4XZQA 2F8ND 2FJ7B 3O62B 3AN2B 4X23B 3W96B 5GT3A 4J8VD 3W98D 5CP6B 1M18C 4J8UC 2VQRA 3AZIB 3W96A 5GXQB 2ZY4A 4WNNA 1WWSA 4J8UD 3X1UC 4KHAB 2Y2PA 2Y2OA 3B6GC 3B6FB 5GXQA 4KGCB 2ZY2A 3LELC 3REKB 3REHD 5B24B
chains in the Genus database with same CATH topology
4KHAA 3C1BD 3X1UD 3B6FA 4KGCA 3REKA 3LELD 5B24A 1A7WA 3NQJB 4H9SA 4HGAC 3AFAA 5B40B 5AV5C 4R8PA 3MGSC 1ID3D 5KDMB 1P3ID 3H0RC 2HIOC 3AZLB 4H9RB 5AV5D 5KDMA 5E5AA 3X1SA 2CWEA 5GT0B 2CV5B 5B31A 3W97B 3AZGB 1KX5C 3TU4D 3V9RA 3AZJC 2NZDD 4WJ3C 3AZGA 5CPIC 5CPKC 1P3LC 1BH8A 4WU9A 4CAYA 4WU8A 3UTAD 3AZJD 1KX3B 3LZ0C 3AV2C 5CPID 5CPKD 5AVBC 4J8XB 1P3BD 3LZ0D 4YM6B 2Y2GA 4QLCB 3AZEC 3WA9A 2PYOD 3MGPC 1AOIC 3WTPA 1ZLAB 3AL0C 3MGRB 4QLCA 5B32D 4XUJB 4G91B 3AZED 1P3OB 3AZMA 1S32B 1ZLAA 2Y2HA 5CPJB 3B0DC 1P34C 5GT3C 5CPJA 3C1CC 1M18B 2Y2IA 4UUZB 2RVQC 3O62C 5G49B 3AN2C 4X23C 3W96C 2FJ7C 5AV9B 3IP4C 3H0LC 5CHLB 5FUGB 5GT3D 5CP6C 4J8UA 1M18A 3AZIC 3B6GB 3FDDA 2XD5A 2RVQD 3O62D 2FJ7D 3W96D 1KX4B 5CP6D 1Z2CB 4NFTA 3B6GA 1M1AB 3B6FC 3LELA 3REIB 3NQUB 3X1TC 5GXQD 3REKC 2DQNC 1TAFB 3REIA 1B6WA 3NQUA 2JE5A 2Y2NA 3B6FD 4KGCD 3REKD 2DF4C 5B24D 3VH6A 5AV5A 2HIOB 5B40C 4JJNB 3MGSA 1P3MB 4DRBA 2HIOA 5B40D 5B2IB 3AZLC 1T3UA 4M6BA 5BNXB 5E5AD 5GT0C 2CV5C 3W97C 5B31D 1KX5A 1P3LB 5BNXA 5DNNB 5B0YB 5GT0D 2CV5D 3W97D 5CPKA 1P3LA 3LZ1C 3AZGD 1H3OB 4WU9D 5AVBB 4CSRB 1U35B 3LZ0A 4WU8D 1KX3C 2J8PA 3AV2A 5B33B 5AVBA 1U35A 3LJAB 3MGPB 4J8XC 3AZEA 1P3KC 4YM6C 4KUDC 2LY8A 3MGPA 1AOIA 3WA9D 1P34B 4H9OB 3MGRC 1F66B 4XUJC 4G91C 4QLCD 1P3OC 1S32C 5AY8B 1P34A 1ZLAD 3KXBB 3MGRD 3VH5W 3C1CA 1P3OD 1BH9A 1Q9CA 1HTAA 5CPJD 2FJ7A 3O62A 3AN2A 4X23A 3VH5A 5AV9C 5CP6A 1ULYA 1M18D 3AZIA 5B1LC 4E45A 3X1TB 5AVCB 3B0BA 1KX4C 1P3AC 3B6GD 3KWQB 1M1AC 3X1TA 3REIC 2NQBB 1PZRA 1KX4D 4WZSB 3VH5T 1M1AD 3REID 3NQJA 1TZYB 1B67A 3A1KA 3WKJB 5B40A 5AV6C 2Y2LA 4JJNC 2AROC 1WWIA 3MGSD 1TZYA 4WV4B 1P3MC 3AYWC 3AZLA 4H9RA 2HIOD 5B2IC 4JJND 1P3MD 3EPKA 3KUYC 2F8NG 3W97A 5GT0A 2CV5A 1R4VA 3LZ1B 1KX5D 4ZBJC 2XD1A 2BYKB 5DNNC 5B0YC 3LZ1A 3EPHA 1P3LD 1KX3A 1U35C 5DNND 5B0YD 3AZNB 3AV2D 2G5IC 5B33C 1P3KB 4KUDB 4J8XA 3UTBB 5AVBD 3LJAC 1U35D 1P3KA 4YM6A 4KUDA 5B33D 4NE3A 3AZFC 3MGPD 3MGRA 4ZUXB 3REJB 1AOID 1F66C 4XUJA 5GSUB 1P3OA 1S32A 3RELB 2HUEC 5AY8C 3REJA 1P34D 3KXBC 5GSUA 3AV1B 3RELA 4Z5TB 3C1CD 4UUZA 5B1LB 5G49A 3KXBD 3A6NC 5AV9A 3AN2D 4X23D 1HQ3B 2YFVB 5FUGA 5B1LA 2F8NB 1P3AB 3AZID 1KX4A 5AVCC 3KFUG 1P3AA 3VH6W 1M1AA 3KWQC 2NQBC 3X1TD 5AVCD 5B1MB 1TAFA 5AV6B 4H9QB 2AROB 2NQBD 3REHB 1TZYC 1P3FB 3WKJC 5AV6A 3UT9B 3AYWB 4JJNA 5B32G 4H9QA 2AROA 1P3MA 1TZYD 3AYWA 3KUYB 3WKJD 5B2IA 3AZLD 1ID3B 3MNNB 4ZBJB 3KUYA 1P3GB 3VH6T 2L5AA 2IO5B 1EQZB 5DNMB 2JCHA 5DNNA 5B0YA 3AZHB 3TU4B 1H3OA 3LZ1D 5F99B 4CSRA 1KX3D 5JA4B 3MGQB 5B33A 3AZNC 3WTPE 5F99A 1F1EA 5BO0B 3UTAB 3LJAA 3UTBC 3AZFB 3W99B 5JA4A 4J8XD 3AZND 3MVDB 4G92B 1P3KD 4YM6D 4KUDD 3R45B 4E44A 3AZFA 3W99A 2HUEB 2JSSA 2RIQA 1P3BB 4H9OA 5B0ZB 4ZUXC 3REJC 2BYMB 3MVDA 1N1JB 1P3PB 1F66A 5GSUC 4XUJD 2PYOB 5AY8A 3AZKB 1S32D 3RELC 2YFWB 1JFIB 3KXBA 1N1JA 4ZUXD 3REJD 4DRAA 4EO5C 5B32B 3A6NB 3X1VB 5GSUD 3AV1C 1M19C 4LD9B 4Z66B 2W8SA 4Z5TC 3RELD 5B31G 1JFIA 3X1VA 3A6NA 2Y2KA 4J8WB 1HQ3C 5AV9D 3AV1D 4Z5TD 5AV8B 5B1LD 4XZQB 3EPJA 5AVCA 3A1IA 4J8VC 1HQ3D 3KWQA 1P3AD 4AWLC 2NQBA 5BNVB 4H9PB 4WNNB 5B1MC 4NE5A 5BNVA 4H9PA 2ZY3A 3REHC 3WKJA 3C1BC 5B1MD 1P3FC 3UT9C 5AV6D 2AROD 5B2JB 1P3FD 3UT9D 3AFAB 3AYWD 5C3IB 5B2ID 4R8PB 1ID3C 3MNNC 3KSYA 5B2JA 1P3IC 1P3GC 3KUYD 2IO5C 1EQZC 5JRGB 4UPKA 3MNND 5DNMC 1P3GD 2BYKA 5E5AB 3X1SB 5BS7C 5B31B 5JRGA 3AZHC 1EQZD 3TU4C 2UWXA 5DNMD 5F99C 2NZDC 3V9RB 3AZNA 3AZHD 3MGQC 3WAAB 1BH8B 4WU9B 4YS3B 5F99D 4CAYB 3UTAC 3F6TA 4WU8B 3UTBA 3W99C 3LJAD 3WAAA 3MGQD 3MVDC 4YS3A 4G92C 4Z2MG 1P3BC 3AZFD 4ZUXA 3W99D 2F8NH 5B0ZC 4EO5B 1P3PC 1F66D 3MVDD 1M19B 2F8NK 2PYOC 3WA9B 3AZKC 5AY8D 3WTPB 5B0ZD 3X1VC 5B32C 1P3PD 1M19A 3AV1A 4LD9C 3AZMB 4Z5TA 4Z66C 3AZKD 4H9NB 3X1VD 4J8WC 1HQ3A 2YFVA 3A6ND 4J8VB 3W98B 4LD9D 4Z66D 2F8NA 4H9NA 5AV8C 4XZQC 3B0CW 4AWLB 4J8VA 3W98A 4J8WD 4J8UB 5AV8D 4DQYB 5BT1C 4XZQD 3KWQD 5B1MA 3C1BB 3X1UB 3P5JB 4Z2MH 5BT1D 3LELB 5GXQC 3REHA 3C1BA 3X1UA 1P3FA 3UT9A 4KGCC 1KU5A 1P3IB 1BFMA 5B24C 4HGAB 5B2JC 3EG5B 4H9SC 3B0CT 3EPLA 3AFAC 5AV5B 1ID3A 5C3IC 3MNNA 4R8PC 3MGSB 1P3IA 1P3GA 2ZY5A 5B2JD 3H0MC 1EQZA 3AFAD 5JRGC 2G5HC 4R8PD 2BG1A 5DNMA 2NZDB 5E5AC 3X1SC 2Y2MA 5BS7A 3AZHA 5B31C 3TU4A 5JRGD 1KX5B 4NE6A 2NZDA 3AZJB 3X1SD 3MGQA 5CPIB 3AZGC 5CPKB 3WAAC 2F2AC 5BO0A 3UTAA 4YS3C 3AZJA 4WU9C 4WU8C 3UTBD 2FFFB 1W2EA 3LZ0B 5CPIA 3AV2B 2Y2QA 3WAAD 3R45A 4YS3D 2Y2JA 1P3BA 5B0ZA 2BYMA 1P3PA 3AZEB 2PYOA 3AZKA 3WA9C 2YFWA 1AOIB 2ZM5A 3WTPC 5B32A 4QLCC 4LD9A 1M19D 4Z66A 3AZMC 3B0DB 1ZLAC 3WTPD 4J8WA 5GT3B 3W98C 3C1CB 3AZMD 1BH9B 5CPJC 5AV8A 4XZQA 2F8ND 2FJ7B 3O62B 3AN2B 4X23B 3W96B 5GT3A 4J8VD 3W98D 5CP6B 1M18C 4J8UC 2VQRA 3AZIB 3W96A 5GXQB 2ZY4A 4WNNA 1WWSA 4J8UD 3X1UC 4KHAB 2Y2PA 2Y2OA 3B6GC 3B6FB 5GXQA 4KGCB 2ZY2A 3LELC 3REKB 3REHD 5B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  3C1B D;  3X1U D;  3B6F A;  4KGC A;  3REK A;  3LEL D;  5B24 A;  1A7W A;  3NQJ B;  4H9S A;  4HGA C;  3AFA A;  5B40 B;  5AV5 C;  4R8P A;  3MGS C;  1ID3 D;  5KDM B;  1P3I D;  2HIO C;  3AZL B;  4H9R B;  5AV5 D;  5KDM A;  5E5A A;  3X1S A;  2CWE A;  5GT0 B;  2CV5 B;  5B31 A;  3W97 B;  3AZG B;  1KX5 C;  3TU4 D;  3V9R A;  3AZJ C;  2NZD D;  3AZG A;  5CPI C;  5CPK C;  1P3L C;  1BH8 A;  4WU9 A;  4CAY A;  4WU8 A;  3UTA D;  3AZJ D;  1KX3 B;  3LZ0 C;  3AV2 C;  5CPI D;  5CPK D;  5AVB C;  4J8X B;  1P3B D;  3LZ0 D;  4YM6 B;  4QLC B;  3AZE C;  3WA9 A;  2PYO D;  3MGP C;  1AOI C;  3WTP A;  1ZLA B;  3MGR B;  4QLC A;  5B32 D;  4XUJ B;  4G91 B;  3AZE D;  1P3O B;  3AZM A;  1S32 B;  1ZLA A;  5CPJ B;  3B0D C;  1P34 C;  5GT3 C;  5CPJ A;  3C1C C;  1M18 B;  4UUZ B;  2RVQ C;  3O62 C;  5G49 B;  3AN2 C;  4X23 C;  3W96 C;  2FJ7 C;  5AV9 B;  5GT3 D;  5CHL B;  5FUG B;  5CP6 C;  4J8U A;  1M18 A;  3AZI C;  3B6G B;  2RVQ D;  3O62 D;  2FJ7 D;  3W96 D;  1KX4 B;  5CP6 D;  4NFT A;  3B6G A;  1M1A B;  3B6F C;  3LEL A;  3REI B;  3NQU B;  3X1T C;  5GXQ D;  3REK C;  1TAF B;  3REI A;  1B6W A;  3NQU A;  3B6F D;  4KGC D;  3REK D;  5B24 D;  3VH6 A;  5AV5 A;  2HIO B;  5B40 C;  4JJN B;  3MGS A;  1P3M B;  4DRB A;  2HIO A;  5B40 D;  5B2I B;  3AZL C;  4M6B A;  5BNX B;  5E5A D;  5GT0 C;  2CV5 C;  3W97 C;  5B31 D;  1KX5 A;  1P3L B;  5BNX A;  5DNN B;  5B0Y B;  5GT0 D;  2CV5 D;  3W97 D;  5CPK A;  1P3L A;  3LZ1 C;  3AZG D;  1H3O B;  4WU9 D;  5AVB B;  4CSR B;  1U35 B;  3LZ0 A;  4WU8 D;  1KX3 C;  3AV2 A;  5B33 B;  5AVB A;  1U35 A;  3LJA B;  3MGP B;  4J8X C;  3AZE A;  1P3K C;  4YM6 C;  4KUD C;  2LY8 A;  3MGP A;  1AOI A;  3WA9 D;  1P34 B;  4H9O B;  3MGR C;  1F66 B;  4XUJ C;  4G91 C;  4QLC D;  1P3O C;  1S32 C;  5AY8 B;  1P34 A;  1ZLA D;  3KXB B;  3MGR D;  3VH5 W;  3C1C A;  1P3O D;  1BH9 A;  1Q9C A;  1HTA A;  5CPJ D;  2FJ7 A;  3O62 A;  3AN2 A;  4X23 A;  3VH5 A;  5AV9 C;  5CP6 A;  1ULY A;  1M18 D;  3AZI A;  5B1L C;  4E45 A;  3X1T B;  5AVC B;  3B0B A;  1KX4 C;  1P3A C;  3B6G D;  3KWQ B;  1M1A C;  3X1T A;  3REI C;  2NQB B;  1KX4 D;  4WZS B;  3VH5 T;  1M1A D;  3REI D;  3NQJ A;  1TZY B;  1B67 A;  3WKJ B;  5B40 A;  5AV6 C;  4JJN C;  2ARO C;  1WWI A;  3MGS D;  1TZY A;  4WV4 B;  1P3M C;  3AYW C;  3AZL A;  4H9R A;  2HIO D;  5B2I C;  4JJN D;  1P3M D;  3KUY C;  2F8N G;  3W97 A;  5GT0 A;  2CV5 A;  1R4V A;  3LZ1 B;  1KX5 D;  4ZBJ C;  2BYK B;  5DNN C;  5B0Y C;  3LZ1 A;  1P3L D;  1KX3 A;  1U35 C;  5DNN D;  5B0Y D;  3AZN B;  3AV2 D;  5B33 C;  1P3K B;  4KUD B;  4J8X A;  3UTB B;  5AVB D;  3LJA C;  1U35 D;  1P3K A;  4YM6 A;  4KUD A;  5B33 D;  4NE3 A;  3AZF C;  3MGP D;  3MGR A;  4ZUX B;  3REJ B;  1AOI D;  1F66 C;  4XUJ A;  5GSU B;  1P3O A;  1S32 A;  3REL B;  2HUE C;  5AY8 C;  3REJ A;  1P34 D;  3KXB C;  5GSU A;  3AV1 B;  3REL A;  4Z5T B;  3C1C D;  4UUZ A;  5B1L B;  5G49 A;  3KXB D;  3A6N C;  5AV9 A;  3AN2 D;  4X23 D;  1HQ3 B;  2YFV B;  5FUG A;  5B1L A;  2F8N B;  1P3A B;  3AZI D;  1KX4 A;  5AVC C;  1P3A A;  3VH6 W;  1M1A A;  3KWQ C;  2NQB C;  3X1T D;  5AVC D;  5B1M B;  1TAF A;  5AV6 B;  4H9Q B;  2ARO B;  2NQB D;  3REH B;  1TZY C;  1P3F B;  3WKJ C;  5AV6 A;  3UT9 B;  3AYW B;  4JJN A;  5B32 G;  4H9Q A;  2ARO A;  1P3M A;  1TZY D;  3AYW A;  3KUY B;  3WKJ D;  5B2I A;  3AZL D;  1ID3 B;  3MNN B;  4ZBJ B;  3KUY A;  1P3G B;  3VH6 T;  2L5A A;  2IO5 B;  1EQZ B;  5DNM B;  5DNN A;  5B0Y A;  3AZH B;  3TU4 B;  1H3O A;  3LZ1 D;  5F99 B;  4CSR A;  1KX3 D;  5JA4 B;  3MGQ B;  5B33 A;  3AZN C;  3WTP E;  5F99 A;  1F1E A;  5BO0 B;  3UTA B;  3LJA A;  3UTB C;  3AZF B;  3W99 B;  5JA4 A;  4J8X D;  3AZN D;  3MVD B;  4G92 B;  1P3K D;  4YM6 D;  4KUD D;  3R45 B;  4E44 A;  3AZF A;  3W99 A;  2HUE B;  2JSS A;  1P3B B;  4H9O A;  5B0Z B;  4ZUX C;  3REJ C;  2BYM B;  3MVD A;  1N1J B;  1P3P B;  1F66 A;  5GSU C;  4XUJ D;  2PYO B;  5AY8 A;  3AZK B;  1S32 D;  3REL C;  2YFW B;  1JFI B;  3KXB A;  1N1J A;  4ZUX D;  3REJ D;  4DRA A;  4EO5 C;  5B32 B;  3A6N B;  3X1V B;  5GSU D;  3AV1 C;  1M19 C;  4LD9 B;  4Z66 B;  4Z5T C;  3REL D;  1JFI A;  5B31 G;  3X1V A;  3A6N A;  4J8W B;  1HQ3 C;  5AV9 D;  3AV1 D;  4Z5T D;  5AV8 B;  5B1L D;  4XZQ B;  5AVC A;  4J8V C;  1HQ3 D;  3KWQ A;  1P3A D;  4AWL C;  2NQB A;  5BNV B;  4H9P B;  4WNN B;  5B1M C;  4NE5 A;  5BNV A;  4H9P A;  3REH C;  3WKJ A;  3C1B C;  5B1M D;  1P3F C;  3UT9 C;  5AV6 D;  2ARO D;  5B2J B;  1P3F D;  3UT9 D;  3AFA B;  3AYW D;  5C3I B;  5B2I D;  4R8P B;  1ID3 C;  3MNN C;  3KSY A;  5B2J A;  1P3I C;  1P3G C;  3KUY D;  2IO5 C;  1EQZ C;  5JRG B;  3MNN D;  5DNM C;  1P3G D;  2BYK A;  5E5A B;  3X1S B;  5BS7 C;  5B31 B;  5JRG A;  3AZH C;  1EQZ D;  3TU4 C;  5DNM D;  5F99 C;  2NZD C;  3V9R B;  3AZN A;  3AZH D;  3MGQ C;  3WAA B;  1BH8 B;  4WU9 B;  4YS3 B;  5F99 D;  4CAY B;  3UTA C;  3UTB A;  4WU8 B;  3W99 C;  3LJA D;  3WAA A;  3MGQ D;  3MVD C;  4YS3 A;  4G92 C;  4Z2M G;  1P3B C;  3AZF D;  4ZUX A;  3W99 D;  2F8N H;  5B0Z C;  4EO5 B;  1P3P C;  1F66 D;  3MVD D;  1M19 B;  2F8N K;  2PYO C;  3WA9 B;  3AZK C;  5AY8 D;  3WTP B;  5B0Z D;  3X1V C;  5B32 C;  1P3P D;  1M19 A;  3AV1 A;  4LD9 C;  3AZM B;  4Z5T A;  4Z66 C;  3AZK D;  4H9N B;  3X1V D;  4J8W C;  1HQ3 A;  2YFV A;  3A6N D;  4J8V B;  3W98 B;  4LD9 D;  4Z66 D;  2F8N A;  4H9N A;  5AV8 C;  4XZQ C;  3B0C W;  4AWL B;  4J8V A;  3W98 A;  4J8W D;  4J8U B;  5AV8 D;  5BT1 C;  4XZQ D;  3KWQ D;  5B1M A;  3C1B B;  3X1U B;  4Z2M H;  5BT1 D;  3LEL B;  5GXQ C;  3REH A;  3C1B A;  3X1U A;  1P3F A;  3UT9 A;  4KGC C;  1KU5 A;  1P3I B;  1BFM A;  5B24 C;  4HGA B;  5B2J C;  4H9S C;  3B0C T;  3AFA C;  5AV5 B;  1ID3 A;  5C3I C;  3MNN A;  4R8P C;  3MGS B;  1P3I A;  1P3G A;  5B2J D;  1EQZ A;  3AFA D;  5JRG C;  4R8P D;  5DNM A;  2NZD B;  5E5A C;  3X1S C;  5BS7 A;  3AZH A;  5B31 C;  3TU4 A;  5JRG D;  1KX5 B;  4NE6 A;  2NZD A;  3AZJ B;  3X1S D;  3MGQ A;  5CPI B;  3AZG C;  5CPK B;  3WAA C;  5BO0 A;  3UTA A;  4YS3 C;  3AZJ A;  4WU9 C;  4WU8 C;  3UTB D;  3LZ0 B;  5CPI A;  3AV2 B;  3WAA D;  3R45 A;  4YS3 D;  1P3B A;  5B0Z A;  2BYM A;  1P3P A;  3AZE B;  2PYO A;  3AZK A;  3WA9 C;  2YFW A;  1AOI B;  3WTP C;  5B32 A;  4QLC C;  4LD9 A;  1M19 D;  4Z66 A;  3AZM C;  3B0D B;  1ZLA C;  3WTP D;  4J8W A;  5GT3 B;  3W98 C;  3C1C B;  3AZM D;  1BH9 B;  5CPJ C;  5AV8 A;  4XZQ A;  2F8N D;  2FJ7 B;  3O62 B;  3AN2 B;  4X23 B;  3W96 B;  5GT3 A;  4J8V D;  3W98 D;  5CP6 B;  1M18 C;  4J8U C;  3AZI B;  3W96 A;  5GXQ B;  4WNN A;  1WWS A;  4J8U D;  3X1U C;  4KHA B;  3B6G C;  3B6F B;  5GXQ A;  4KGC B;  3LEL C;  3REK B;  3REH D;  5B24 B; 
#chains in the Genus database with same CATH topology
 4KHA A;  3C1B D;  3X1U D;  3B6F A;  4KGC A;  3REK A;  3LEL D;  5B24 A;  1A7W A;  3NQJ B;  4H9S A;  4HGA C;  3AFA A;  5B40 B;  5AV5 C;  4R8P A;  3MGS C;  1ID3 D;  5KDM B;  1P3I D;  3H0R C;  2HIO C;  3AZL B;  4H9R B;  5AV5 D;  5KDM A;  5E5A A;  3X1S A;  2CWE A;  5GT0 B;  2CV5 B;  5B31 A;  3W97 B;  3AZG B;  1KX5 C;  3TU4 D;  3V9R A;  3AZJ C;  2NZD D;  4WJ3 C;  3AZG A;  5CPI C;  5CPK C;  1P3L C;  1BH8 A;  4WU9 A;  4CAY A;  4WU8 A;  3UTA D;  3AZJ D;  1KX3 B;  3LZ0 C;  3AV2 C;  5CPI D;  5CPK D;  5AVB C;  4J8X B;  1P3B D;  3LZ0 D;  4YM6 B;  2Y2G A;  4QLC B;  3AZE C;  3WA9 A;  2PYO D;  3MGP C;  1AOI C;  3WTP A;  1ZLA B;  3AL0 C;  3MGR B;  4QLC A;  5B32 D;  4XUJ B;  4G91 B;  3AZE D;  1P3O B;  3AZM A;  1S32 B;  1ZLA A;  2Y2H A;  5CPJ B;  3B0D C;  1P34 C;  5GT3 C;  5CPJ A;  3C1C C;  1M18 B;  2Y2I A;  4UUZ B;  2RVQ C;  3O62 C;  5G49 B;  3AN2 C;  4X23 C;  3W96 C;  2FJ7 C;  5AV9 B;  3IP4 C;  3H0L C;  5CHL B;  5FUG B;  5GT3 D;  5CP6 C;  4J8U A;  1M18 A;  3AZI C;  3B6G B;  3FDD A;  2XD5 A;  2RVQ D;  3O62 D;  2FJ7 D;  3W96 D;  1KX4 B;  5CP6 D;  1Z2C B;  4NFT A;  3B6G A;  1M1A B;  3B6F C;  3LEL A;  3REI B;  3NQU B;  3X1T C;  5GXQ D;  3REK C;  2DQN C;  1TAF B;  3REI A;  1B6W A;  3NQU A;  2JE5 A;  2Y2N A;  3B6F D;  4KGC D;  3REK D;  2DF4 C;  5B24 D;  3VH6 A;  5AV5 A;  2HIO B;  5B40 C;  4JJN B;  3MGS A;  1P3M B;  4DRB A;  2HIO A;  5B40 D;  5B2I B;  3AZL C;  1T3U A;  4M6B A;  5BNX B;  5E5A D;  5GT0 C;  2CV5 C;  3W97 C;  5B31 D;  1KX5 A;  1P3L B;  5BNX A;  5DNN B;  5B0Y B;  5GT0 D;  2CV5 D;  3W97 D;  5CPK A;  1P3L A;  3LZ1 C;  3AZG D;  1H3O B;  4WU9 D;  5AVB B;  4CSR B;  1U35 B;  3LZ0 A;  4WU8 D;  1KX3 C;  2J8P A;  3AV2 A;  5B33 B;  5AVB A;  1U35 A;  3LJA B;  3MGP B;  4J8X C;  3AZE A;  1P3K C;  4YM6 C;  4KUD C;  2LY8 A;  3MGP A;  1AOI A;  3WA9 D;  1P34 B;  4H9O B;  3MGR C;  1F66 B;  4XUJ C;  4G91 C;  4QLC D;  1P3O C;  1S32 C;  5AY8 B;  1P34 A;  1ZLA D;  3KXB B;  3MGR D;  3VH5 W;  3C1C A;  1P3O D;  1BH9 A;  1Q9C A;  1HTA A;  5CPJ D;  2FJ7 A;  3O62 A;  3AN2 A;  4X23 A;  3VH5 A;  5AV9 C;  5CP6 A;  1ULY A;  1M18 D;  3AZI A;  5B1L C;  4E45 A;  3X1T B;  5AVC B;  3B0B A;  1KX4 C;  1P3A C;  3B6G D;  3KWQ B;  1M1A C;  3X1T A;  3REI C;  2NQB B;  1PZR A;  1KX4 D;  4WZS B;  3VH5 T;  1M1A D;  3REI D;  3NQJ A;  1TZY B;  1B67 A;  3A1K A;  3WKJ B;  5B40 A;  5AV6 C;  2Y2L A;  4JJN C;  2ARO C;  1WWI A;  3MGS D;  1TZY A;  4WV4 B;  1P3M C;  3AYW C;  3AZL A;  4H9R A;  2HIO D;  5B2I C;  4JJN D;  1P3M D;  3EPK A;  3KUY C;  2F8N G;  3W97 A;  5GT0 A;  2CV5 A;  1R4V A;  3LZ1 B;  1KX5 D;  4ZBJ C;  2XD1 A;  2BYK B;  5DNN C;  5B0Y C;  3LZ1 A;  3EPH A;  1P3L D;  1KX3 A;  1U35 C;  5DNN D;  5B0Y D;  3AZN B;  3AV2 D;  2G5I C;  5B33 C;  1P3K B;  4KUD B;  4J8X A;  3UTB B;  5AVB D;  3LJA C;  1U35 D;  1P3K A;  4YM6 A;  4KUD A;  5B33 D;  4NE3 A;  3AZF C;  3MGP D;  3MGR A;  4ZUX B;  3REJ B;  1AOI D;  1F66 C;  4XUJ A;  5GSU B;  1P3O A;  1S32 A;  3REL B;  2HUE C;  5AY8 C;  3REJ A;  1P34 D;  3KXB C;  5GSU A;  3AV1 B;  3REL A;  4Z5T B;  3C1C D;  4UUZ A;  5B1L B;  5G49 A;  3KXB D;  3A6N C;  5AV9 A;  3AN2 D;  4X23 D;  1HQ3 B;  2YFV B;  5FUG A;  5B1L A;  2F8N B;  1P3A B;  3AZI D;  1KX4 A;  5AVC C;  3KFU G;  1P3A A;  3VH6 W;  1M1A A;  3KWQ C;  2NQB C;  3X1T D;  5AVC D;  5B1M B;  1TAF A;  5AV6 B;  4H9Q B;  2ARO B;  2NQB D;  3REH B;  1TZY C;  1P3F B;  3WKJ C;  5AV6 A;  3UT9 B;  3AYW B;  4JJN A;  5B32 G;  4H9Q A;  2ARO A;  1P3M A;  1TZY D;  3AYW A;  3KUY B;  3WKJ D;  5B2I A;  3AZL D;  1ID3 B;  3MNN B;  4ZBJ B;  3KUY A;  1P3G B;  3VH6 T;  2L5A A;  2IO5 B;  1EQZ B;  5DNM B;  2JCH A;  5DNN A;  5B0Y A;  3AZH B;  3TU4 B;  1H3O A;  3LZ1 D;  5F99 B;  4CSR A;  1KX3 D;  5JA4 B;  3MGQ B;  5B33 A;  3AZN C;  3WTP E;  5F99 A;  1F1E A;  5BO0 B;  3UTA B;  3LJA A;  3UTB C;  3AZF B;  3W99 B;  5JA4 A;  4J8X D;  3AZN D;  3MVD B;  4G92 B;  1P3K D;  4YM6 D;  4KUD D;  3R45 B;  4E44 A;  3AZF A;  3W99 A;  2HUE B;  2JSS A;  2RIQ A;  1P3B B;  4H9O A;  5B0Z B;  4ZUX C;  3REJ C;  2BYM B;  3MVD A;  1N1J B;  1P3P B;  1F66 A;  5GSU C;  4XUJ D;  2PYO B;  5AY8 A;  3AZK B;  1S32 D;  3REL C;  2YFW B;  1JFI B;  3KXB A;  1N1J A;  4ZUX D;  3REJ D;  4DRA A;  4EO5 C;  5B32 B;  3A6N B;  3X1V B;  5GSU D;  3AV1 C;  1M19 C;  4LD9 B;  4Z66 B;  2W8S A;  4Z5T C;  3REL D;  5B31 G;  1JFI A;  3X1V A;  3A6N A;  2Y2K A;  4J8W B;  1HQ3 C;  5AV9 D;  3AV1 D;  4Z5T D;  5AV8 B;  5B1L D;  4XZQ B;  3EPJ A;  5AVC A;  3A1I A;  4J8V C;  1HQ3 D;  3KWQ A;  1P3A D;  4AWL C;  2NQB A;  5BNV B;  4H9P B;  4WNN B;  5B1M C;  4NE5 A;  5BNV A;  4H9P A;  2ZY3 A;  3REH C;  3WKJ A;  3C1B C;  5B1M D;  1P3F C;  3UT9 C;  5AV6 D;  2ARO D;  5B2J B;  1P3F D;  3UT9 D;  3AFA B;  3AYW D;  5C3I B;  5B2I D;  4R8P B;  1ID3 C;  3MNN C;  3KSY A;  5B2J A;  1P3I C;  1P3G C;  3KUY D;  2IO5 C;  1EQZ C;  5JRG B;  4UPK A;  3MNN D;  5DNM C;  1P3G D;  2BYK A;  5E5A B;  3X1S B;  5BS7 C;  5B31 B;  5JRG A;  3AZH C;  1EQZ D;  3TU4 C;  2UWX A;  5DNM D;  5F99 C;  2NZD C;  3V9R B;  3AZN A;  3AZH D;  3MGQ C;  3WAA B;  1BH8 B;  4WU9 B;  4YS3 B;  5F99 D;  4CAY B;  3UTA C;  3F6T A;  4WU8 B;  3UTB A;  3W99 C;  3LJA D;  3WAA A;  3MGQ D;  3MVD C;  4YS3 A;  4G92 C;  4Z2M G;  1P3B C;  3AZF D;  4ZUX A;  3W99 D;  2F8N H;  5B0Z C;  4EO5 B;  1P3P C;  1F66 D;  3MVD D;  1M19 B;  2F8N K;  2PYO C;  3WA9 B;  3AZK C;  5AY8 D;  3WTP B;  5B0Z D;  3X1V C;  5B32 C;  1P3P D;  1M19 A;  3AV1 A;  4LD9 C;  3AZM B;  4Z5T A;  4Z66 C;  3AZK D;  4H9N B;  3X1V D;  4J8W C;  1HQ3 A;  2YFV A;  3A6N D;  4J8V B;  3W98 B;  4LD9 D;  4Z66 D;  2F8N A;  4H9N A;  5AV8 C;  4XZQ C;  3B0C W;  4AWL B;  4J8V A;  3W98 A;  4J8W D;  4J8U B;  5AV8 D;  4DQY B;  5BT1 C;  4XZQ D;  3KWQ D;  5B1M A;  3C1B B;  3X1U B;  3P5J B;  4Z2M H;  5BT1 D;  3LEL B;  5GXQ C;  3REH A;  3C1B A;  3X1U A;  1P3F A;  3UT9 A;  4KGC C;  1KU5 A;  1P3I B;  1BFM A;  5B24 C;  4HGA B;  5B2J C;  3EG5 B;  4H9S C;  3B0C T;  3EPL A;  3AFA C;  5AV5 B;  1ID3 A;  5C3I C;  3MNN A;  4R8P C;  3MGS B;  1P3I A;  1P3G A;  2ZY5 A;  5B2J D;  3H0M C;  1EQZ A;  3AFA D;  5JRG C;  2G5H C;  4R8P D;  2BG1 A;  5DNM A;  2NZD B;  5E5A C;  3X1S C;  2Y2M A;  5BS7 A;  3AZH A;  5B31 C;  3TU4 A;  5JRG D;  1KX5 B;  4NE6 A;  2NZD A;  3AZJ B;  3X1S D;  3MGQ A;  5CPI B;  3AZG C;  5CPK B;  3WAA C;  2F2A C;  5BO0 A;  3UTA A;  4YS3 C;  3AZJ A;  4WU9 C;  4WU8 C;  3UTB D;  2FFF B;  1W2E A;  3LZ0 B;  5CPI A;  3AV2 B;  2Y2Q A;  3WAA D;  3R45 A;  4YS3 D;  2Y2J A;  1P3B A;  5B0Z A;  2BYM A;  1P3P A;  3AZE B;  2PYO A;  3AZK A;  3WA9 C;  2YFW A;  1AOI B;  2ZM5 A;  3WTP C;  5B32 A;  4QLC C;  4LD9 A;  1M19 D;  4Z66 A;  3AZM C;  3B0D B;  1ZLA C;  3WTP D;  4J8W A;  5GT3 B;  3W98 C;  3C1C B;  3AZM D;  1BH9 B;  5CPJ C;  5AV8 A;  4XZQ A;  2F8N D;  2FJ7 B;  3O62 B;  3AN2 B;  4X23 B;  3W96 B;  5GT3 A;  4J8V D;  3W98 D;  5CP6 B;  1M18 C;  4J8U C;  2VQR A;  3AZI B;  3W96 A;  5GXQ B;  2ZY4 A;  4WNN A;  1WWS A;  4J8U D;  3X1U C;  4KHA B;  2Y2P A;  2Y2O A;  3B6G C;  3B6F B;  5GXQ A;  4KGC B;  2ZY2 A;  3LEL C;  3REK B;  3REH D;  5B24 B; 
#chains in the Genus database with same CATH homology
 4KHA A;  3C1B D;  3X1U D;  3B6F A;  4KGC A;  3REK A;  3LEL D;  5B24 A;  1A7W A;  3NQJ B;  4H9S A;  4HGA C;  3AFA A;  5B40 B;  5AV5 C;  4R8P A;  3MGS C;  1ID3 D;  5KDM B;  1P3I D;  3H0R C;  2HIO C;  3AZL B;  4H9R B;  5AV5 D;  5KDM A;  5E5A A;  3X1S A;  2CWE A;  5GT0 B;  2CV5 B;  5B31 A;  3W97 B;  3AZG B;  1KX5 C;  3TU4 D;  3V9R A;  3AZJ C;  2NZD D;  4WJ3 C;  3AZG A;  5CPI C;  5CPK C;  1P3L C;  1BH8 A;  4WU9 A;  4CAY A;  4WU8 A;  3UTA D;  3AZJ D;  1KX3 B;  3LZ0 C;  3AV2 C;  5CPI D;  5CPK D;  5AVB C;  4J8X B;  1P3B D;  3LZ0 D;  4YM6 B;  2Y2G A;  4QLC B;  3AZE C;  3WA9 A;  2PYO D;  3MGP C;  1AOI C;  3WTP A;  1ZLA B;  3AL0 C;  3MGR B;  4QLC A;  5B32 D;  4XUJ B;  4G91 B;  3AZE D;  1P3O B;  3AZM A;  1S32 B;  1ZLA A;  2Y2H A;  5CPJ B;  3B0D C;  1P34 C;  5GT3 C;  5CPJ A;  3C1C C;  1M18 B;  2Y2I A;  4UUZ B;  2RVQ C;  3O62 C;  5G49 B;  3AN2 C;  4X23 C;  3W96 C;  2FJ7 C;  5AV9 B;  3IP4 C;  3H0L C;  5CHL B;  5FUG B;  5GT3 D;  5CP6 C;  4J8U A;  1M18 A;  3AZI C;  3B6G B;  3FDD A;  2XD5 A;  2RVQ D;  3O62 D;  2FJ7 D;  3W96 D;  1KX4 B;  5CP6 D;  1Z2C B;  4NFT A;  3B6G A;  1M1A B;  3B6F C;  3LEL A;  3REI B;  3NQU B;  3X1T C;  5GXQ D;  3REK C;  2DQN C;  1TAF B;  3REI A;  1B6W A;  3NQU A;  2JE5 A;  2Y2N A;  3B6F D;  4KGC D;  3REK D;  2DF4 C;  5B24 D;  3VH6 A;  5AV5 A;  2HIO B;  5B40 C;  4JJN B;  3MGS A;  1P3M B;  4DRB A;  2HIO A;  5B40 D;  5B2I B;  3AZL C;  1T3U A;  4M6B A;  5BNX B;  5E5A D;  5GT0 C;  2CV5 C;  3W97 C;  5B31 D;  1KX5 A;  1P3L B;  5BNX A;  5DNN B;  5B0Y B;  5GT0 D;  2CV5 D;  3W97 D;  5CPK A;  1P3L A;  3LZ1 C;  3AZG D;  1H3O B;  4WU9 D;  5AVB B;  4CSR B;  1U35 B;  3LZ0 A;  4WU8 D;  1KX3 C;  2J8P A;  3AV2 A;  5B33 B;  5AVB A;  1U35 A;  3LJA B;  3MGP B;  4J8X C;  3AZE A;  1P3K C;  4YM6 C;  4KUD C;  2LY8 A;  3MGP A;  1AOI A;  3WA9 D;  1P34 B;  4H9O B;  3MGR C;  1F66 B;  4XUJ C;  4G91 C;  4QLC D;  1P3O C;  1S32 C;  5AY8 B;  1P34 A;  1ZLA D;  3KXB B;  3MGR D;  3VH5 W;  3C1C A;  1P3O D;  1BH9 A;  1Q9C A;  1HTA A;  5CPJ D;  2FJ7 A;  3O62 A;  3AN2 A;  4X23 A;  3VH5 A;  5AV9 C;  5CP6 A;  1ULY A;  1M18 D;  3AZI A;  5B1L C;  4E45 A;  3X1T B;  5AVC B;  3B0B A;  1KX4 C;  1P3A C;  3B6G D;  3KWQ B;  1M1A C;  3X1T A;  3REI C;  2NQB B;  1PZR A;  1KX4 D;  4WZS B;  3VH5 T;  1M1A D;  3REI D;  3NQJ A;  1TZY B;  1B67 A;  3A1K A;  3WKJ B;  5B40 A;  5AV6 C;  2Y2L A;  4JJN C;  2ARO C;  1WWI A;  3MGS D;  1TZY A;  4WV4 B;  1P3M C;  3AYW C;  3AZL A;  4H9R A;  2HIO D;  5B2I C;  4JJN D;  1P3M D;  3EPK A;  3KUY C;  2F8N G;  3W97 A;  5GT0 A;  2CV5 A;  1R4V A;  3LZ1 B;  1KX5 D;  4ZBJ C;  2XD1 A;  2BYK B;  5DNN C;  5B0Y C;  3LZ1 A;  3EPH A;  1P3L D;  1KX3 A;  1U35 C;  5DNN D;  5B0Y D;  3AZN B;  3AV2 D;  2G5I C;  5B33 C;  1P3K B;  4KUD B;  4J8X A;  3UTB B;  5AVB D;  3LJA C;  1U35 D;  1P3K A;  4YM6 A;  4KUD A;  5B33 D;  4NE3 A;  3AZF C;  3MGP D;  3MGR A;  4ZUX B;  3REJ B;  1AOI D;  1F66 C;  4XUJ A;  5GSU B;  1P3O A;  1S32 A;  3REL B;  2HUE C;  5AY8 C;  3REJ A;  1P34 D;  3KXB C;  5GSU A;  3AV1 B;  3REL A;  4Z5T B;  3C1C D;  4UUZ A;  5B1L B;  5G49 A;  3KXB D;  3A6N C;  5AV9 A;  3AN2 D;  4X23 D;  1HQ3 B;  2YFV B;  5FUG A;  5B1L A;  2F8N B;  1P3A B;  3AZI D;  1KX4 A;  5AVC C;  3KFU G;  1P3A A;  3VH6 W;  1M1A A;  3KWQ C;  2NQB C;  3X1T D;  5AVC D;  5B1M B;  1TAF A;  5AV6 B;  4H9Q B;  2ARO B;  2NQB D;  3REH B;  1TZY C;  1P3F B;  3WKJ C;  5AV6 A;  3UT9 B;  3AYW B;  4JJN A;  5B32 G;  4H9Q A;  2ARO A;  1P3M A;  1TZY D;  3AYW A;  3KUY B;  3WKJ D;  5B2I A;  3AZL D;  1ID3 B;  3MNN B;  4ZBJ B;  3KUY A;  1P3G B;  3VH6 T;  2L5A A;  2IO5 B;  1EQZ B;  5DNM B;  2JCH A;  5DNN A;  5B0Y A;  3AZH B;  3TU4 B;  1H3O A;  3LZ1 D;  5F99 B;  4CSR A;  1KX3 D;  5JA4 B;  3MGQ B;  5B33 A;  3AZN C;  3WTP E;  5F99 A;  1F1E A;  5BO0 B;  3UTA B;  3LJA A;  3UTB C;  3AZF B;  3W99 B;  5JA4 A;  4J8X D;  3AZN D;  3MVD B;  4G92 B;  1P3K D;  4YM6 D;  4KUD D;  3R45 B;  4E44 A;  3AZF A;  3W99 A;  2HUE B;  2JSS A;  2RIQ A;  1P3B B;  4H9O A;  5B0Z B;  4ZUX C;  3REJ C;  2BYM B;  3MVD A;  1N1J B;  1P3P B;  1F66 A;  5GSU C;  4XUJ D;  2PYO B;  5AY8 A;  3AZK B;  1S32 D;  3REL C;  2YFW B;  1JFI B;  3KXB A;  1N1J A;  4ZUX D;  3REJ D;  4DRA A;  4EO5 C;  5B32 B;  3A6N B;  3X1V B;  5GSU D;  3AV1 C;  1M19 C;  4LD9 B;  4Z66 B;  2W8S A;  4Z5T C;  3REL D;  5B31 G;  1JFI A;  3X1V A;  3A6N A;  2Y2K A;  4J8W B;  1HQ3 C;  5AV9 D;  3AV1 D;  4Z5T D;  5AV8 B;  5B1L D;  4XZQ B;  3EPJ A;  5AVC A;  3A1I A;  4J8V C;  1HQ3 D;  3KWQ A;  1P3A D;  4AWL C;  2NQB A;  5BNV B;  4H9P B;  4WNN B;  5B1M C;  4NE5 A;  5BNV A;  4H9P A;  2ZY3 A;  3REH C;  3WKJ A;  3C1B C;  5B1M D;  1P3F C;  3UT9 C;  5AV6 D;  2ARO D;  5B2J B;  1P3F D;  3UT9 D;  3AFA B;  3AYW D;  5C3I B;  5B2I D;  4R8P B;  1ID3 C;  3MNN C;  3KSY A;  5B2J A;  1P3I C;  1P3G C;  3KUY D;  2IO5 C;  1EQZ C;  5JRG B;  4UPK A;  3MNN D;  5DNM C;  1P3G D;  2BYK A;  5E5A B;  3X1S B;  5BS7 C;  5B31 B;  5JRG A;  3AZH C;  1EQZ D;  3TU4 C;  2UWX A;  5DNM D;  5F99 C;  2NZD C;  3V9R B;  3AZN A;  3AZH D;  3MGQ C;  3WAA B;  1BH8 B;  4WU9 B;  4YS3 B;  5F99 D;  4CAY B;  3UTA C;  3F6T A;  4WU8 B;  3UTB A;  3W99 C;  3LJA D;  3WAA A;  3MGQ D;  3MVD C;  4YS3 A;  4G92 C;  4Z2M G;  1P3B C;  3AZF D;  4ZUX A;  3W99 D;  2F8N H;  5B0Z C;  4EO5 B;  1P3P C;  1F66 D;  3MVD D;  1M19 B;  2F8N K;  2PYO C;  3WA9 B;  3AZK C;  5AY8 D;  3WTP B;  5B0Z D;  3X1V C;  5B32 C;  1P3P D;  1M19 A;  3AV1 A;  4LD9 C;  3AZM B;  4Z5T A;  4Z66 C;  3AZK D;  4H9N B;  3X1V D;  4J8W C;  1HQ3 A;  2YFV A;  3A6N D;  4J8V B;  3W98 B;  4LD9 D;  4Z66 D;  2F8N A;  4H9N A;  5AV8 C;  4XZQ C;  3B0C W;  4AWL B;  4J8V A;  3W98 A;  4J8W D;  4J8U B;  5AV8 D;  4DQY B;  5BT1 C;  4XZQ D;  3KWQ D;  5B1M A;  3C1B B;  3X1U B;  3P5J B;  4Z2M H;  5BT1 D;  3LEL B;  5GXQ C;  3REH A;  3C1B A;  3X1U A;  1P3F A;  3UT9 A;  4KGC C;  1KU5 A;  1P3I B;  1BFM A;  5B24 C;  4HGA B;  5B2J C;  3EG5 B;  4H9S C;  3B0C T;  3EPL A;  3AFA C;  5AV5 B;  1ID3 A;  5C3I C;  3MNN A;  4R8P C;  3MGS B;  1P3I A;  1P3G A;  2ZY5 A;  5B2J D;  3H0M C;  1EQZ A;  3AFA D;  5JRG C;  2G5H C;  4R8P D;  2BG1 A;  5DNM A;  2NZD B;  5E5A C;  3X1S C;  2Y2M A;  5BS7 A;  3AZH A;  5B31 C;  3TU4 A;  5JRG D;  1KX5 B;  4NE6 A;  2NZD A;  3AZJ B;  3X1S D;  3MGQ A;  5CPI B;  3AZG C;  5CPK B;  3WAA C;  2F2A C;  5BO0 A;  3UTA A;  4YS3 C;  3AZJ A;  4WU9 C;  4WU8 C;  3UTB D;  2FFF B;  1W2E A;  3LZ0 B;  5CPI A;  3AV2 B;  2Y2Q A;  3WAA D;  3R45 A;  4YS3 D;  2Y2J A;  1P3B A;  5B0Z A;  2BYM A;  1P3P A;  3AZE B;  2PYO A;  3AZK A;  3WA9 C;  2YFW A;  1AOI B;  2ZM5 A;  3WTP C;  5B32 A;  4QLC C;  4LD9 A;  1M19 D;  4Z66 A;  3AZM C;  3B0D B;  1ZLA C;  3WTP D;  4J8W A;  5GT3 B;  3W98 C;  3C1C B;  3AZM D;  1BH9 B;  5CPJ C;  5AV8 A;  4XZQ A;  2F8N D;  2FJ7 B;  3O62 B;  3AN2 B;  4X23 B;  3W96 B;  5GT3 A;  4J8V D;  3W98 D;  5CP6 B;  1M18 C;  4J8U C;  2VQR A;  3AZI B;  3W96 A;  5GXQ B;  2ZY4 A;  4WNN A;  1WWS A;  4J8U D;  3X1U C;  4KHA B;  2Y2P A;  2Y2O A;  3B6G C;  3B6F B;  5GXQ A;  4KGC B;  2ZY2 A;  3LEL C;  3REK B;  3REH D;  5B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...