3WKJA

The nucleosome containing human tsh2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjA00
5AV6D 5B31D 1KX5D 1P3AA 3LZ1B 5DNMC 1P3PC 1F66D 5JRGD 5GT3D 1U35D 3KSYA 3LELC 1M1AB 1JFIB 3B6FB 3AZGB 5AVCD 2RVQD 5B2IC 4YS3D 2AROB 3X1UB 4XZQC 3WTPD 5GT0C 3UTBB 3AZJD 3WKJA 5B33D 3LZ0A 4QLCD 5F99D 5CPKB 5AV8C 4J8XA 3X1SA 3B0BA 4WV4B 3W98D 4H9PB 3TU4D 1M18D 5B32D 4H9SC 4CAYA 4J8VB 1P3KD 1B6WA 3B0DC 3AZLB 1N1JA 5B24C 4J8WC 5E5AB 1KX3A 2JSSA 1AOIC 4WU9A 3AV1A 1P3AD 5B31B 1KX5B 1F66B 3LZ1C 5CPJA 3W97A 5KDMA 3NQUA 5GT3B 5JRGB 5DNMA 2FJ7B 3MNNA 1R4VA 3REIC 3O62B 2IO5C 4KUDA 4G91B 1ID3C 1P3MB 3UT9A 3REHA 5AVCB 3AZKA 1P3BB 3WTPB 4KHAB 3LZ0D 3AZGC 4R8PB 4QLCB 5B2IA 1EQZB 4XZQA 5GT0A 1P3IC 3X1SD 5AV5B 5CPKC 1P3GA 1Q9CA 3TU4B 3MVDA 5B32B 3WA9D 1ZLAA 3VH5W 4HGAB 3AYWC 1P3KB 4H9SA 3UTAA 3VH6A 1KX4C 3REJA 4ZBJB 4AWLC 3W96D 4Z66C 1KX3D 3X1TC 1TAFA 5B24A 3MGPB 2BYKA 5CPJD 5B40B 1P3OC 1AOIA 3W97D 5BT1D 3B6GC 3AZMD 4YM6C 3MNND 3A6NB 3RELD 4LD9C 1P3LC 4KUDD 2FJ7C 3UT9D 3REHD 4XUJA 5GSUC 5G49A 3O62C 5AY8C 3REIA 5JA4B 3AZKD 1P3MC 5B31G 1ID3A 3R45A 3REKD 4JJNC 2NZDD 3AZHA 3LJAB 4R8PC 2HIOC 1P3GD 5CHLB 5B0ZD 5E5AD 4H9QB 3MVDD 5AVBC 1P3IA 5AV5C 1ZLAD 5BNVB 4WZSB 2YFVB 3WA9B 4H9RB 3AZID 3UTAD 3REJD 3AZFB 5B0YB 3W96B 3AZNC 3V9RB 3KXBA 3MGSB 4UUZA 5B1MB 2NQBA 4Z5TC 3W97B 5B32G 1H3OB 3AZMB 3MNNB 3MGPC 3RELB 5B40C 3KUYC 1P3OA 3A6NC 3B6GA 4XUJD 4YM6A 3UT9B 5DNNA 3B0CW 3AFAA 4LD9A 1P3LA 3AZKB 3MGRD 3C1CC 5GXQC 5BS7C 5GSUA 5AV9C 5AY8A 1M19D 2CWEA 3AZHD 5CP6D 3REKB 4X23D 1TZYA 2NZDB 4J8UC 3AN2A 1P3GB 4ZUXC 3LJAC 5B0ZB 4JJNA 3KWQB 3C1BB 3MVDB 3AV2D 1BH9B 1P3FB 2HIOA 3MGQD 3WAAB 5BO0B 5AVBA 3AZIB 3REJB 3KXBD 1BH8B 3AZFC 1HQ3D 3X1VC 2CV5D 2NQBD 2BYMA 4EO5B 5B1MC 2YFWA 2F8ND 4Z5TA 1S32B 5DNND 5CPID 3W99B 3AFAD 3AZED 4LD9D 1P34C 3KUYA 2PYOD 4WU8B 3MGRB 4CSRA 1M19B 4KGCC 1TZYD 5CP6B 3AN2D 4X23B 5C3IB 3C1CA 5GXQA 5BS7A 5AV9A 5AV6B 5B1LA 5B2JA 3AV2B 1KU5A 2HIOD 4J8UA 5FUGA 5BNXB 3KWQC 3MGQB 4ZUXA 5AVBD 1P3PA 1U35B 3VH6T 3WAAC 1M1AC 3LELA 4YS3B 3B6FC 1HQ3B 3WKJD 2CV5B 3AZJB 5B33B 2AROC 4WNNB 3X1UC 5F99B 3UTBC 4J8XD 3X1VA 2F8NB 4Z5TD 3W98B 5CPIB 3AZEB 1M18B 5AV8A 4E44A 1S32C 2PYOB 3W99C 3VH5A 4H9OB 4WU8C 1P34A 4J8VC 4H9NA 4WU9D 5AV9D 4Z2MG 3AZLC 5B1LD 3AV1D 1P3AB 4KGCA 5B2JD 3NQJA 5E5AC 4J8WA 5C3IC 1A7WA 5AV6C 5B31C 1KX5C 5DNMD 1P3PD 1F66C 5JRGC 5GT3C 3LZ1A 1U35C 3LELD 4G91C 3WKJB 3LZ0B 1M1AA 5AVCC 2RVQC 5B2ID 4YS3C 1JFIA 3X1VD 4XZQD 2YFWB 5GT0D 3WTPC 1P3BC 3B6FA 4J8XB 3AZGA 5B33C 3AZJC 4QLCC 3X1SB 2AROA 5F99C 3X1UA 1EQZC 1WWIA 3UTBA 5AV8D 4CAYB 3W98C 5CPKA 3TU4C 1M18C 5B32C 4CSRB 1N1JB 4HGAC 1KX3B 1P3KC 3AYWA 2HUEB 4WU9B 3AV1B 2F8NG 1KX4A 4ZBJC 5B24D 4J8WD 4Z66A 1AOID 5CPJB 5KDMB 3NQUB 5DNMB 3X1TA 3LZ1D 5B31A 4KUDB 4E45A 3REHB 3REID 3LELB 1F66A 1ID3D 5JRGA 5GT3A 2FJ7A 1M1AD 3O62A 5B2IB 1P3MA 1F1EA 4XZQB 5GT0B 4G92B 3AZGD 5AVCA 3X1UD 1P3BA 4DRAA 1P3ID 5AV8B 4R8PA 5CPKD 2LY8A 1ZLAB 1EQZA 3UTAB 5AV5A 3WA9C 3AYWD 3WTPE 3TU4A 5B32A 1KX4D 5B0YC 3W96C 1TAFB 5B24B 4Z66D 4J8WB 1KX3C 3MGSC 3AZNA 2BYKB 1P3KA 1HTAA 1AOIB 3X1TD 4NE3A 2L5AA 1P3OD 5CPJC 3W97C 3B6GD 5BT1C 4YM6D 3AZMC 3MNNC 4XUJB 3RELC 3MGPA 5G49B 3REIB 1P3LD 5B40A 4KUDC 2FJ7D 2IO5B 1ID3B 3UT9C 3A6NA 3REHC 5GSUD 3R45B 3O62D 5AY8D 3AZKC 1P3MD 3AZHB 5JA4A 1P3BD 4JJND 4G92C 3REKC 2NZDC 4R8PD 1P3IB 3VH5T 1P3GC 1EQZD 4Z2MH 1P3FC 5B0ZC 3C1BC 3MVDC 3LJAA 5AV5D 1ZLAC 2F8NK 3KXBB 4H9QA 3AYWB 3AZIC 3UTAC 4UUZB 3REJC 5BNVA 1KX4B 2YFVA 3WA9A 4AWLB 3AZND 4Z66B 4H9RA 2NQBB 3AZFA 5B0YA 3W96A 3X1TB 3V9RA 3MGSA 4EO5C 1P3OB 5B1MA 3B6GB 4YM6B 3MGPD 5DNNB 5B40D 1B67A 3AFAB 3KUYD 4LD9B 1P3LB 4NFTA 3A6ND 1H3OA 3AZMA 4XUJC 4NE5A 3RELA 5GSUB 5AY8B 1TZYB 3C1CD 3MGRC 3AN2B 5GXQD 1M19C 3AZHC 5CP6C 4JJNB 4X23C 4J8UD 2HIOB 4ZUXD 3LJAD 3REKA 2F8NH 2NZDA 3AV2C 5AVBB 3MGQC 4M6BA 1P3FA 5B0ZA 3KWQA 3C1BA 1BH9A 4DRBA 3KXBC 3AZNB 2BYMB 3WAAA 5BO0A 3AZIA 3AZFD 5B0YD 3VH6W 1HQ3C 3MGSD 1BH8A 2CV5C 2NQBC 1ULYA 5B1MD 4Z5TB 3B0CT 4NE6A 3KUYB 1BFMA 5CPIC 5DNNC 3AFAC 3AZEC 1P34D 2PYOC 1S32A 3W99A 4H9PA 3C1CB 5GXQB 5AV9B 4KGCD 4WU8A 5B1LB 4J8VA 1TZYC 5B2JB 3AN2C 3MGRA 4J8UB 3AZLA 1P3AC 1M19A 5FUGB 1P3PB 5CP6A 5E5AA 4ZUXB 4X23A 5AV6A 1P3FD 1KX5A 3KWQD 3C1BD 3AV2A 3MGQA 5BNXA 3WAAD 1U35A 3B6FD 3X1VB 3WKJC 3LZ0C 2AROD 4YS3A 1HQ3A 3UTBD 3WTPA 4KHAA 4J8XC 2CV5A 3X1SC 3AZJA 5B33A 4QLCA 4WNNA 5F99A 2F8NA 1P34B 1S32D 3W99D 4H9NB 5CPIA 3W98A 3AZEA 4WU8D 1M18A 3B0DB 4J8VD 2PYOA 4KGCB 3NQJB 3AZLD 2HUEC 4H9OA 3AV1C 4WU9C 1WWSA 5B1LC 5B2JC
chains in the Genus database with same CATH superfamily
5AV6D 5B31D 1KX5D 1P3AA 3LZ1B 5DNMC 1P3PC 1F66D 5JRGD 5GT3D 1U35D 3KSYA 3LELC 1M1AB 1JFIB 3B6FB 3AZGB 5AVCD 2RVQD 2ZY4A 5B2IC 4YS3D 2AROB 3X1UB 4XZQC 3WTPD 5GT0C 3UTBB 3AZJD 3WKJA 5B33D 3LZ0A 4QLCD 5F99D 5CPKB 5AV8C 4J8XA 3X1SA 3B0BA 4WV4B 3W98D 4H9PB 3TU4D 1M18D 5B32D 4H9SC 4CAYA 4J8VB 1P3KD 1B6WA 3B0DC 3AZLB 1N1JA 5B24C 4J8WC 5E5AB 1KX3A 1PZRA 2JSSA 1AOIC 4WU9A 3AV1A 1P3AD 5B31B 1KX5B 3A1KA 1Z2CB 2Y2MA 2RIQA 3LZ1C 5CPJA 5JRGB 3W97A 2J8PA 3NQUA 5KDMA 5GT3B 5DNMA 3MNNA 1R4VA 2FJ7B 3REIC 3O62B 2IO5C 4KUDA 4G91B 1ID3C 1P3MB 3UT9A 3REHA 5AVCB 3AZKA 1P3BB 3WTPB 4KHAB 3LZ0D 3AZGC 4R8PB 4QLCB 5B2IA 1EQZB 3A1IA 4XZQA 5GT0A 4DQYB 3X1SD 1P3IC 5AV5B 5CPKC 1P3GA 1Q9CA 3TU4B 3MVDA 5B32B 3WA9D 2G5IC 1ZLAA 3VH5W 3H0LC 4HGAB 3AYWC 1P3KB 4H9SA 3UTAA 3VH6A 1KX4C 3REJA 4ZBJB 4AWLC 3W96D 4Z66C 1KX3D 3X1TC 1TAFA 5B24A 3AL0C 3MGPB 2BYKA 5CPJD 5B40B 1P3OC 1AOIA 3W97D 5BT1D 3B6GC 3AZMD 4YM6C 3MNND 3A6NB 3RELD 4LD9C 1P3LC 4KUDD 2FJ7C 3UT9D 3REHD 4XUJA 5GSUC 5G49A 3O62C 5AY8C 3REIA 5JA4B 3AZKD 1P3MC 5B31G 1ID3A 2Y2QA 3R45A 3REKD 4JJNC 2NZDD 3AZHA 3LJAB 4R8PC 2HIOC 2Y2IA 1P3GD 3EPKA 5CHLB 5E5AD 5B0ZD 4H9QB 3MVDD 5AVBC 1P3IA 5AV5C 1ZLAD 5BNVB 2YFVB 4WZSB 3WA9B 4H9RB 3AZID 3UTAD 3REJD 3AZFB 5B0YB 3W96B 3AZNC 3V9RB 3KXBA 3MGSB 4UUZA 5B1MB 2NQBA 4Z5TC 3W97B 2ZY2A 5B32G 1H3OB 3AZMB 3MNNB 3MGPC 3RELB 5B40C 3KUYC 1T3UA 1P3OA 3A6NC 3B6GA 4XUJD 4YM6A 3UT9B 5DNNA 3B0CW 3AFAA 4LD9A 1P3LA 3AZKB 3MGRD 3C1CC 5GXQC 5BS7C 5GSUA 5AV9C 5AY8A 1M19D 2CWEA 3AZHD 5CP6D 3REKB 4X23D 1TZYA 2NZDB 4J8UC 3AN2A 1P3GB 4ZUXC 3LJAC 5B0ZB 4JJNA 3KWQB 3C1BB 3MVDB 3AV2D 1BH9B 1P3FB 2HIOA 3MGQD 3WAAB 5BO0B 5AVBA 3AZIB 3REJB 3KXBD 1BH8B 3AZFC 1HQ3D 3X1VC 2CV5D 2NQBD 2BYMA 4EO5B 5B1MC 2YFWA 2F8ND 4Z5TA 1S32B 5DNND 5CPID 3W99B 3AFAD 3AZED 4LD9D 3P5JB 1P34C 3KUYA 2PYOD 4WU8B 3MGRB 2XD1A 4CSRA 1M19B 4KGCC 2G5HC 1TZYD 5CP6B 3AN2D 4X23B 5C3IB 3C1CA 5GXQA 5BS7A 5AV9A 5AV6B 5B1LA 5B2JA 3AV2B 2JCHA 1KU5A 2HIOD 2Y2PA 4J8UA 5FUGA 5BNXB 3KWQC 3MGQB 4ZUXA 5AVBD 1P3PA 1U35B 3VH6T 2Y2GA 3WAAC 1M1AC 3LELA 4YS3B 3B6FC 1HQ3B 3WKJD 2CV5B 3AZJB 5B33B 2AROC 4WNNB 3X1UC 5F99B 3UTBC 4J8XD 3X1VA 2F8NB 4Z5TD 3W98B 5CPIB 3AZEB 1M18B 5AV8A 2F2AC 2W8SA 4E44A 1S32C 3W99C 2PYOB 3VH5A 4H9OB 4WU8C 1P34A 4J8VC 3FDDA 4H9NA 5AV9D 4WU9D 4Z2MG 3AZLC 5B1LD 3AV1D 1P3AB 4KGCA 5B2JD 3NQJA 5E5AC 4J8WA 5C3IC 1A7WA 3EPLA 5AV6C 5B31C 1KX5C 5DNMD 1P3PD 1F66C 5JRGC 5GT3C 3EPJA 3LZ1A 1U35C 3LELD 4G91C 3WKJB 3LZ0B 1M1AA 5AVCC 2RVQC 5B2ID 4YS3C 1JFIA 3X1VD 2YFWB 4XZQD 5GT0D 3WTPC 1P3BC 3B6FA 4J8XB 3AZGA 5B33C 3AZJC 4QLCC 3X1SB 2AROA 5F99C 3X1UA 1EQZC 1WWIA 3UTBA 5AV8D 4CAYB 3W98C 5CPKA 3TU4C 1M18C 5B32C 2FFFB 4CSRB 1N1JB 2DQNC 4HGAC 1KX3B 1P3KC 3AYWA 2HUEB 4WU9B 3AV1B 2F8NG 1KX4A 4ZBJC 5B24D 4J8WD 4Z66A 1AOID 5CPJB 5KDMB 3NQUB 5DNMB 3X1TA 2Y2JA 3LZ1D 5B31A 4KUDB 4E45A 3REHB 3REID 3LELB 1F66A 1ID3D 5JRGA 2ZY3A 5GT3A 2FJ7A 1M1AD 2ZY5A 3O62A 5B2IB 2JE5A 1P3MA 1F1EA 4XZQB 5GT0B 4G92B 3AZGD 2VQRA 5AVCA 3X1UD 1P3BA 4DRAA 1P3ID 5AV8B 4R8PA 5CPKD 2LY8A 1ZLAB 1EQZA 3UTAB 5AV5A 3WA9C 3AYWD 3WTPE 3TU4A 5B32A 1KX4D 5B0YC 3W96C 1TAFB 5B24B 4Z66D 4J8WB 1KX3C 3MGSC 3AZNA 2BYKB 1P3KA 1HTAA 1AOIB 3X1TD 4NE3A 2L5AA 1P3OD 5CPJC 3W97C 3B6GD 5BT1C 4YM6D 3AZMC 3MNNC 4WJ3C 4XUJB 3RELC 3MGPA 2Y2KA 3IP4C 5G49B 5B40A 3REIB 1P3LD 4KUDC 2FJ7D 2IO5B 1ID3B 3UT9C 3A6NA 3REHC 5GSUD 3R45B 3O62D 5AY8D 1F66B 3AZKC 1P3MD 3AZHB 5JA4A 2Y2NA 1P3BD 4JJND 4G92C 3REKC 2NZDC 4R8PD 1P3IB 3H0RC 3VH5T 1P3GC 1EQZD 4Z2MH 1P3FC 5B0ZC 3C1BC 3MVDC 3LJAA 5AV5D 1ZLAC 2F8NK 3KXBB 4H9QA 3AYWB 3AZIC 3UTAC 4UUZB 3REJC 5BNVA 1KX4B 2YFVA 3WA9A 4AWLB 3AZND 4Z66B 4H9RA 2Y2HA 2NQBB 2DF4C 3AZFA 5B0YA 3W96A 3X1TB 3V9RA 3MGSA 4EO5C 1P3OB 5B1MA 3B6GB 4YM6B 3MGPD 5DNNB 5B40D 1B67A 3AFAB 3KUYD 4LD9B 1P3LB 4NFTA 3A6ND 1H3OA 3AZMA 4XUJC 2Y2LA 4NE5A 3RELA 5GSUB 5AY8B 1TZYB 3C1CD 3MGRC 3AN2B 5GXQD 1M19C 3AZHC 5CP6C 4JJNB 4X23C 4J8UD 2HIOB 4ZUXD 3LJAD 3REKA 2F8NH 2NZDA 3AV2C 5AVBB 3MGQC 4M6BA 1P3FA 5B0ZA 3KWQA 2ZM5A 3C1BA 1BH9A 4DRBA 3KXBC 3AZNB 2BYMB 3WAAA 5BO0A 3AZIA 3AZFD 5B0YD 3VH6W 1HQ3C 3MGSD 2UWXA 1BH8A 2CV5C 2NQBC 1ULYA 4UPKA 5B1MD 4Z5TB 3H0MC 3B0CT 4NE6A 3KUYB 1BFMA 5CPIC 5DNNC 3AFAC 3AZEC 1P34D 2PYOC 1S32A 2Y2OA 3W99A 4H9PA 3C1CB 5GXQB 5AV9B 4KGCD 4WU8A 5B1LB 4J8VA 1TZYC 3F6TA 5B2JB 3AN2C 3MGRA 4J8UB 3KFUG 3AZLA 1P3AC 1M19A 5FUGB 1P3PB 5CP6A 5E5AA 2BG1A 4ZUXB 4X23A 5AV6A 2XD5A 1P3FD 1KX5A 3KWQD 3C1BD 3AV2A 1W2EA 3MGQA 5BNXA 3WAAD 1U35A 3B6FD 3X1VB 3WKJC 3LZ0C 2AROD 4YS3A 1HQ3A 3UTBD 3WTPA 4KHAA 4J8XC 2CV5A 3X1SC 3AZJA 5B33A 4QLCA 4WNNA 3EG5B 5F99A 2F8NA 1P34B 1S32D 3W99D 3EPHA 4H9NB 5CPIA 3W98A 3AZEA 4WU8D 1M18A 3B0DB 4J8VD 2PYOA 4KGCB 3NQJB 3AZLD 2HUEC 4H9OA 3AV1C 4WU9C 1WWSA 5B1LC 5B2JC
chains in the Genus database with same CATH topology
5AV6D 5B31D 1KX5D 1P3AA 3LZ1B 5DNMC 1P3PC 1F66D 5JRGD 5GT3D 1U35D 3KSYA 3LELC 1M1AB 1JFIB 3B6FB 3AZGB 5AVCD 2RVQD 2ZY4A 5B2IC 4YS3D 2AROB 3X1UB 4XZQC 3WTPD 5GT0C 3UTBB 3AZJD 3WKJA 5B33D 3LZ0A 4QLCD 5F99D 5CPKB 5AV8C 4J8XA 3X1SA 3B0BA 4WV4B 3W98D 4H9PB 3TU4D 1M18D 5B32D 4H9SC 4CAYA 4J8VB 1P3KD 1B6WA 3B0DC 3AZLB 1N1JA 5B24C 4J8WC 5E5AB 1KX3A 1PZRA 2JSSA 1AOIC 4WU9A 3AV1A 1P3AD 5B31B 1KX5B 3A1KA 1Z2CB 2Y2MA 2RIQA 3LZ1C 5CPJA 5JRGB 3W97A 2J8PA 3NQUA 5KDMA 5GT3B 5DNMA 3MNNA 1R4VA 2FJ7B 3REIC 3O62B 2IO5C 4KUDA 4G91B 1ID3C 1P3MB 3UT9A 3REHA 5AVCB 3AZKA 1P3BB 3WTPB 4KHAB 3LZ0D 3AZGC 4R8PB 4QLCB 5B2IA 1EQZB 3A1IA 4XZQA 5GT0A 4DQYB 3X1SD 1P3IC 5AV5B 5CPKC 1P3GA 1Q9CA 3TU4B 3MVDA 5B32B 3WA9D 2G5IC 1ZLAA 3VH5W 3H0LC 4HGAB 3AYWC 1P3KB 4H9SA 3UTAA 3VH6A 1KX4C 3REJA 4ZBJB 4AWLC 3W96D 4Z66C 1KX3D 3X1TC 1TAFA 5B24A 3AL0C 3MGPB 2BYKA 5CPJD 5B40B 1P3OC 1AOIA 3W97D 5BT1D 3B6GC 3AZMD 4YM6C 3MNND 3A6NB 3RELD 4LD9C 1P3LC 4KUDD 2FJ7C 3UT9D 3REHD 4XUJA 5GSUC 5G49A 3O62C 5AY8C 3REIA 5JA4B 3AZKD 1P3MC 5B31G 1ID3A 2Y2QA 3R45A 3REKD 4JJNC 2NZDD 3AZHA 3LJAB 4R8PC 2HIOC 2Y2IA 1P3GD 3EPKA 5CHLB 5E5AD 5B0ZD 4H9QB 3MVDD 5AVBC 1P3IA 5AV5C 1ZLAD 5BNVB 2YFVB 4WZSB 3WA9B 4H9RB 3AZID 3UTAD 3REJD 3AZFB 5B0YB 3W96B 3AZNC 3V9RB 3KXBA 3MGSB 4UUZA 5B1MB 2NQBA 4Z5TC 3W97B 2ZY2A 5B32G 1H3OB 3AZMB 3MNNB 3MGPC 3RELB 5B40C 3KUYC 1T3UA 1P3OA 3A6NC 3B6GA 4XUJD 4YM6A 3UT9B 5DNNA 3B0CW 3AFAA 4LD9A 1P3LA 3AZKB 3MGRD 3C1CC 5GXQC 5BS7C 5GSUA 5AV9C 5AY8A 1M19D 2CWEA 3AZHD 5CP6D 3REKB 4X23D 1TZYA 2NZDB 4J8UC 3AN2A 1P3GB 4ZUXC 3LJAC 5B0ZB 4JJNA 3KWQB 3C1BB 3MVDB 3AV2D 1BH9B 1P3FB 2HIOA 3MGQD 3WAAB 5BO0B 5AVBA 3AZIB 3REJB 3KXBD 1BH8B 3AZFC 1HQ3D 3X1VC 2CV5D 2NQBD 2BYMA 4EO5B 5B1MC 2YFWA 2F8ND 4Z5TA 1S32B 5DNND 5CPID 3W99B 3AFAD 3AZED 4LD9D 3P5JB 1P34C 3KUYA 2PYOD 4WU8B 3MGRB 2XD1A 4CSRA 1M19B 4KGCC 2G5HC 1TZYD 5CP6B 3AN2D 4X23B 5C3IB 3C1CA 5GXQA 5BS7A 5AV9A 5AV6B 5B1LA 5B2JA 3AV2B 2JCHA 1KU5A 2HIOD 2Y2PA 4J8UA 5FUGA 5BNXB 3KWQC 3MGQB 4ZUXA 5AVBD 1P3PA 1U35B 3VH6T 2Y2GA 3WAAC 1M1AC 3LELA 4YS3B 3B6FC 1HQ3B 3WKJD 2CV5B 3AZJB 5B33B 2AROC 4WNNB 3X1UC 5F99B 3UTBC 4J8XD 3X1VA 2F8NB 4Z5TD 3W98B 5CPIB 3AZEB 1M18B 5AV8A 2F2AC 2W8SA 4E44A 1S32C 3W99C 2PYOB 3VH5A 4H9OB 4WU8C 1P34A 4J8VC 3FDDA 4H9NA 5AV9D 4WU9D 4Z2MG 3AZLC 5B1LD 3AV1D 1P3AB 4KGCA 5B2JD 3NQJA 5E5AC 4J8WA 5C3IC 1A7WA 3EPLA 5AV6C 5B31C 1KX5C 5DNMD 1P3PD 1F66C 5JRGC 5GT3C 3EPJA 3LZ1A 1U35C 3LELD 4G91C 3WKJB 3LZ0B 1M1AA 5AVCC 2RVQC 5B2ID 4YS3C 1JFIA 3X1VD 2YFWB 4XZQD 5GT0D 3WTPC 1P3BC 3B6FA 4J8XB 3AZGA 5B33C 3AZJC 4QLCC 3X1SB 2AROA 5F99C 3X1UA 1EQZC 1WWIA 3UTBA 5AV8D 4CAYB 3W98C 5CPKA 3TU4C 1M18C 5B32C 2FFFB 4CSRB 1N1JB 2DQNC 4HGAC 1KX3B 1P3KC 3AYWA 2HUEB 4WU9B 3AV1B 2F8NG 1KX4A 4ZBJC 5B24D 4J8WD 4Z66A 1AOID 5CPJB 5KDMB 3NQUB 5DNMB 3X1TA 2Y2JA 3LZ1D 5B31A 4KUDB 4E45A 3REHB 3REID 3LELB 1F66A 1ID3D 5JRGA 2ZY3A 5GT3A 2FJ7A 1M1AD 2ZY5A 3O62A 5B2IB 2JE5A 1P3MA 1F1EA 4XZQB 5GT0B 4G92B 3AZGD 2VQRA 5AVCA 3X1UD 1P3BA 4DRAA 1P3ID 5AV8B 4R8PA 5CPKD 2LY8A 1ZLAB 1EQZA 3UTAB 5AV5A 3WA9C 3AYWD 3WTPE 3TU4A 5B32A 1KX4D 5B0YC 3W96C 1TAFB 5B24B 4Z66D 4J8WB 1KX3C 3MGSC 3AZNA 2BYKB 1P3KA 1HTAA 1AOIB 3X1TD 4NE3A 2L5AA 1P3OD 5CPJC 3W97C 3B6GD 5BT1C 4YM6D 3AZMC 3MNNC 4WJ3C 4XUJB 3RELC 3MGPA 2Y2KA 3IP4C 5G49B 5B40A 3REIB 1P3LD 4KUDC 2FJ7D 2IO5B 1ID3B 3UT9C 3A6NA 3REHC 5GSUD 3R45B 3O62D 5AY8D 1F66B 3AZKC 1P3MD 3AZHB 5JA4A 2Y2NA 1P3BD 4JJND 4G92C 3REKC 2NZDC 4R8PD 1P3IB 3H0RC 3VH5T 1P3GC 1EQZD 4Z2MH 1P3FC 5B0ZC 3C1BC 3MVDC 3LJAA 5AV5D 1ZLAC 2F8NK 3KXBB 4H9QA 3AYWB 3AZIC 3UTAC 4UUZB 3REJC 5BNVA 1KX4B 2YFVA 3WA9A 4AWLB 3AZND 4Z66B 4H9RA 2Y2HA 2NQBB 2DF4C 3AZFA 5B0YA 3W96A 3X1TB 3V9RA 3MGSA 4EO5C 1P3OB 5B1MA 3B6GB 4YM6B 3MGPD 5DNNB 5B40D 1B67A 3AFAB 3KUYD 4LD9B 1P3LB 4NFTA 3A6ND 1H3OA 3AZMA 4XUJC 2Y2LA 4NE5A 3RELA 5GSUB 5AY8B 1TZYB 3C1CD 3MGRC 3AN2B 5GXQD 1M19C 3AZHC 5CP6C 4JJNB 4X23C 4J8UD 2HIOB 4ZUXD 3LJAD 3REKA 2F8NH 2NZDA 3AV2C 5AVBB 3MGQC 4M6BA 1P3FA 5B0ZA 3KWQA 2ZM5A 3C1BA 1BH9A 4DRBA 3KXBC 3AZNB 2BYMB 3WAAA 5BO0A 3AZIA 3AZFD 5B0YD 3VH6W 1HQ3C 3MGSD 2UWXA 1BH8A 2CV5C 2NQBC 1ULYA 4UPKA 5B1MD 4Z5TB 3H0MC 3B0CT 4NE6A 3KUYB 1BFMA 5CPIC 5DNNC 3AFAC 3AZEC 1P34D 2PYOC 1S32A 2Y2OA 3W99A 4H9PA 3C1CB 5GXQB 5AV9B 4KGCD 4WU8A 5B1LB 4J8VA 1TZYC 3F6TA 5B2JB 3AN2C 3MGRA 4J8UB 3KFUG 3AZLA 1P3AC 1M19A 5FUGB 1P3PB 5CP6A 5E5AA 2BG1A 4ZUXB 4X23A 5AV6A 2XD5A 1P3FD 1KX5A 3KWQD 3C1BD 3AV2A 1W2EA 3MGQA 5BNXA 3WAAD 1U35A 3B6FD 3X1VB 3WKJC 3LZ0C 2AROD 4YS3A 1HQ3A 3UTBD 3WTPA 4KHAA 4J8XC 2CV5A 3X1SC 3AZJA 5B33A 4QLCA 4WNNA 3EG5B 5F99A 2F8NA 1P34B 1S32D 3W99D 3EPHA 4H9NB 5CPIA 3W98A 3AZEA 4WU8D 1M18A 3B0DB 4J8VD 2PYOA 4KGCB 3NQJB 3AZLD 2HUEC 4H9OA 3AV1C 4WU9C 1WWSA 5B1LC 5B2JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 D;  5B31 D;  1KX5 D;  1P3A A;  3LZ1 B;  5DNM C;  1P3P C;  1F66 D;  5JRG D;  5GT3 D;  1U35 D;  3KSY A;  3LEL C;  1M1A B;  1JFI B;  3B6F B;  3AZG B;  5AVC D;  2RVQ D;  5B2I C;  4YS3 D;  2ARO B;  3X1U B;  4XZQ C;  3WTP D;  5GT0 C;  3UTB B;  3AZJ D;  3WKJ A;  5B33 D;  3LZ0 A;  4QLC D;  5F99 D;  5CPK B;  5AV8 C;  4J8X A;  3X1S A;  3B0B A;  4WV4 B;  3W98 D;  4H9P B;  3TU4 D;  1M18 D;  5B32 D;  4H9S C;  4CAY A;  4J8V B;  1P3K D;  1B6W A;  3B0D C;  3AZL B;  1N1J A;  5B24 C;  4J8W C;  5E5A B;  1KX3 A;  2JSS A;  1AOI C;  4WU9 A;  3AV1 A;  1P3A D;  5B31 B;  1KX5 B;  1F66 B;  3LZ1 C;  5CPJ A;  3W97 A;  5KDM A;  3NQU A;  5GT3 B;  5JRG B;  5DNM A;  2FJ7 B;  3MNN A;  1R4V A;  3REI C;  3O62 B;  2IO5 C;  4KUD A;  4G91 B;  1ID3 C;  1P3M B;  3UT9 A;  3REH A;  5AVC B;  3AZK A;  1P3B B;  3WTP B;  4KHA B;  3LZ0 D;  3AZG C;  4R8P B;  4QLC B;  5B2I A;  1EQZ B;  4XZQ A;  5GT0 A;  1P3I C;  3X1S D;  5AV5 B;  5CPK C;  1P3G A;  1Q9C A;  3TU4 B;  3MVD A;  5B32 B;  3WA9 D;  1ZLA A;  3VH5 W;  4HGA B;  3AYW C;  1P3K B;  4H9S A;  3UTA A;  3VH6 A;  1KX4 C;  3REJ A;  4ZBJ B;  4AWL C;  3W96 D;  4Z66 C;  1KX3 D;  3X1T C;  1TAF A;  5B24 A;  3MGP B;  2BYK A;  5CPJ D;  5B40 B;  1P3O C;  1AOI A;  3W97 D;  5BT1 D;  3B6G C;  3AZM D;  4YM6 C;  3MNN D;  3A6N B;  3REL D;  4LD9 C;  1P3L C;  4KUD D;  2FJ7 C;  3UT9 D;  3REH D;  4XUJ A;  5GSU C;  5G49 A;  3O62 C;  5AY8 C;  3REI A;  5JA4 B;  3AZK D;  1P3M C;  5B31 G;  1ID3 A;  3R45 A;  3REK D;  4JJN C;  2NZD D;  3AZH A;  3LJA B;  4R8P C;  2HIO C;  1P3G D;  5CHL B;  5B0Z D;  5E5A D;  4H9Q B;  3MVD D;  5AVB C;  1P3I A;  5AV5 C;  1ZLA D;  5BNV B;  4WZS B;  2YFV B;  3WA9 B;  4H9R B;  3AZI D;  3UTA D;  3REJ D;  3AZF B;  5B0Y B;  3W96 B;  3AZN C;  3V9R B;  3KXB A;  3MGS B;  4UUZ A;  5B1M B;  2NQB A;  4Z5T C;  3W97 B;  5B32 G;  1H3O B;  3AZM B;  3MNN B;  3MGP C;  3REL B;  5B40 C;  3KUY C;  1P3O A;  3A6N C;  3B6G A;  4XUJ D;  4YM6 A;  3UT9 B;  5DNN A;  3B0C W;  3AFA A;  4LD9 A;  1P3L A;  3AZK B;  3MGR D;  3C1C C;  5GXQ C;  5BS7 C;  5GSU A;  5AV9 C;  5AY8 A;  1M19 D;  2CWE A;  3AZH D;  5CP6 D;  3REK B;  4X23 D;  1TZY A;  2NZD B;  4J8U C;  3AN2 A;  1P3G B;  4ZUX C;  3LJA C;  5B0Z B;  4JJN A;  3KWQ B;  3C1B B;  3MVD B;  3AV2 D;  1BH9 B;  1P3F B;  2HIO A;  3MGQ D;  3WAA B;  5BO0 B;  5AVB A;  3AZI B;  3REJ B;  3KXB D;  1BH8 B;  3AZF C;  1HQ3 D;  3X1V C;  2CV5 D;  2NQB D;  2BYM A;  4EO5 B;  5B1M C;  2YFW A;  2F8N D;  4Z5T A;  1S32 B;  5DNN D;  5CPI D;  3W99 B;  3AFA D;  3AZE D;  4LD9 D;  1P34 C;  3KUY A;  2PYO D;  4WU8 B;  3MGR B;  4CSR A;  1M19 B;  4KGC C;  1TZY D;  5CP6 B;  3AN2 D;  4X23 B;  5C3I B;  3C1C A;  5GXQ A;  5BS7 A;  5AV9 A;  5AV6 B;  5B1L A;  5B2J A;  3AV2 B;  1KU5 A;  2HIO D;  4J8U A;  5FUG A;  5BNX B;  3KWQ C;  3MGQ B;  4ZUX A;  5AVB D;  1P3P A;  1U35 B;  3VH6 T;  3WAA C;  1M1A C;  3LEL A;  4YS3 B;  3B6F C;  1HQ3 B;  3WKJ D;  2CV5 B;  3AZJ B;  5B33 B;  2ARO C;  4WNN B;  3X1U C;  5F99 B;  3UTB C;  4J8X D;  3X1V A;  2F8N B;  4Z5T D;  3W98 B;  5CPI B;  3AZE B;  1M18 B;  5AV8 A;  4E44 A;  1S32 C;  2PYO B;  3W99 C;  3VH5 A;  4H9O B;  4WU8 C;  1P34 A;  4J8V C;  4H9N A;  4WU9 D;  5AV9 D;  4Z2M G;  3AZL C;  5B1L D;  3AV1 D;  1P3A B;  4KGC A;  5B2J D;  3NQJ A;  5E5A C;  4J8W A;  5C3I C;  1A7W A;  5AV6 C;  5B31 C;  1KX5 C;  5DNM D;  1P3P D;  1F66 C;  5JRG C;  5GT3 C;  3LZ1 A;  1U35 C;  3LEL D;  4G91 C;  3WKJ B;  3LZ0 B;  1M1A A;  5AVC C;  2RVQ C;  5B2I D;  4YS3 C;  1JFI A;  3X1V D;  4XZQ D;  2YFW B;  5GT0 D;  3WTP C;  1P3B C;  3B6F A;  4J8X B;  3AZG A;  5B33 C;  3AZJ C;  4QLC C;  3X1S B;  2ARO A;  5F99 C;  3X1U A;  1EQZ C;  1WWI A;  3UTB A;  5AV8 D;  4CAY B;  3W98 C;  5CPK A;  3TU4 C;  1M18 C;  5B32 C;  4CSR B;  1N1J B;  4HGA C;  1KX3 B;  1P3K C;  3AYW A;  2HUE B;  4WU9 B;  3AV1 B;  2F8N G;  1KX4 A;  4ZBJ C;  5B24 D;  4J8W D;  4Z66 A;  1AOI D;  5CPJ B;  5KDM B;  3NQU B;  5DNM B;  3X1T A;  3LZ1 D;  5B31 A;  4KUD B;  4E45 A;  3REH B;  3REI D;  3LEL B;  1F66 A;  1ID3 D;  5JRG A;  5GT3 A;  2FJ7 A;  1M1A D;  3O62 A;  5B2I B;  1P3M A;  1F1E A;  4XZQ B;  5GT0 B;  4G92 B;  3AZG D;  5AVC A;  3X1U D;  1P3B A;  4DRA A;  1P3I D;  5AV8 B;  4R8P A;  5CPK D;  2LY8 A;  1ZLA B;  1EQZ A;  3UTA B;  5AV5 A;  3WA9 C;  3AYW D;  3WTP E;  3TU4 A;  5B32 A;  1KX4 D;  5B0Y C;  3W96 C;  1TAF B;  5B24 B;  4Z66 D;  4J8W B;  1KX3 C;  3MGS C;  3AZN A;  2BYK B;  1P3K A;  1HTA A;  1AOI B;  3X1T D;  4NE3 A;  2L5A A;  1P3O D;  5CPJ C;  3W97 C;  3B6G D;  5BT1 C;  4YM6 D;  3AZM C;  3MNN C;  4XUJ B;  3REL C;  3MGP A;  5G49 B;  3REI B;  1P3L D;  5B40 A;  4KUD C;  2FJ7 D;  2IO5 B;  1ID3 B;  3UT9 C;  3A6N A;  3REH C;  5GSU D;  3R45 B;  3O62 D;  5AY8 D;  3AZK C;  1P3M D;  3AZH B;  5JA4 A;  1P3B D;  4JJN D;  4G92 C;  3REK C;  2NZD C;  4R8P D;  1P3I B;  3VH5 T;  1P3G C;  1EQZ D;  4Z2M H;  1P3F C;  5B0Z C;  3C1B C;  3MVD C;  3LJA A;  5AV5 D;  1ZLA C;  2F8N K;  3KXB B;  4H9Q A;  3AYW B;  3AZI C;  3UTA C;  4UUZ B;  3REJ C;  5BNV A;  1KX4 B;  2YFV A;  3WA9 A;  4AWL B;  3AZN D;  4Z66 B;  4H9R A;  2NQB B;  3AZF A;  5B0Y A;  3W96 A;  3X1T B;  3V9R A;  3MGS A;  4EO5 C;  1P3O B;  5B1M A;  3B6G B;  4YM6 B;  3MGP D;  5DNN B;  5B40 D;  1B67 A;  3AFA B;  3KUY D;  4LD9 B;  1P3L B;  4NFT A;  3A6N D;  1H3O A;  3AZM A;  4XUJ C;  4NE5 A;  3REL A;  5GSU B;  5AY8 B;  1TZY B;  3C1C D;  3MGR C;  3AN2 B;  5GXQ D;  1M19 C;  3AZH C;  5CP6 C;  4JJN B;  4X23 C;  4J8U D;  2HIO B;  4ZUX D;  3LJA D;  3REK A;  2F8N H;  2NZD A;  3AV2 C;  5AVB B;  3MGQ C;  4M6B A;  1P3F A;  5B0Z A;  3KWQ A;  3C1B A;  1BH9 A;  4DRB A;  3KXB C;  3AZN B;  2BYM B;  3WAA A;  5BO0 A;  3AZI A;  3AZF D;  5B0Y D;  3VH6 W;  1HQ3 C;  3MGS D;  1BH8 A;  2CV5 C;  2NQB C;  1ULY A;  5B1M D;  4Z5T B;  3B0C T;  4NE6 A;  3KUY B;  1BFM A;  5CPI C;  5DNN C;  3AFA C;  3AZE C;  1P34 D;  2PYO C;  1S32 A;  3W99 A;  4H9P A;  3C1C B;  5GXQ B;  5AV9 B;  4KGC D;  4WU8 A;  5B1L B;  4J8V A;  1TZY C;  5B2J B;  3AN2 C;  3MGR A;  4J8U B;  3AZL A;  1P3A C;  1M19 A;  5FUG B;  1P3P B;  5CP6 A;  5E5A A;  4ZUX B;  4X23 A;  5AV6 A;  1P3F D;  1KX5 A;  3KWQ D;  3C1B D;  3AV2 A;  3MGQ A;  5BNX A;  3WAA D;  1U35 A;  3B6F D;  3X1V B;  3WKJ C;  3LZ0 C;  2ARO D;  4YS3 A;  1HQ3 A;  3UTB D;  3WTP A;  4KHA A;  4J8X C;  2CV5 A;  3X1S C;  3AZJ A;  5B33 A;  4QLC A;  4WNN A;  5F99 A;  2F8N A;  1P34 B;  1S32 D;  3W99 D;  4H9N B;  5CPI A;  3W98 A;  3AZE A;  4WU8 D;  1M18 A;  3B0D B;  4J8V D;  2PYO A;  4KGC B;  3NQJ B;  3AZL D;  2HUE C;  4H9O A;  3AV1 C;  4WU9 C;  1WWS A;  5B1L C;  5B2J C; 
#chains in the Genus database with same CATH topology
 5AV6 D;  5B31 D;  1KX5 D;  1P3A A;  3LZ1 B;  5DNM C;  1P3P C;  1F66 D;  5JRG D;  5GT3 D;  1U35 D;  3KSY A;  3LEL C;  1M1A B;  1JFI B;  3B6F B;  3AZG B;  5AVC D;  2RVQ D;  2ZY4 A;  5B2I C;  4YS3 D;  2ARO B;  3X1U B;  4XZQ C;  3WTP D;  5GT0 C;  3UTB B;  3AZJ D;  3WKJ A;  5B33 D;  3LZ0 A;  4QLC D;  5F99 D;  5CPK B;  5AV8 C;  4J8X A;  3X1S A;  3B0B A;  4WV4 B;  3W98 D;  4H9P B;  3TU4 D;  1M18 D;  5B32 D;  4H9S C;  4CAY A;  4J8V B;  1P3K D;  1B6W A;  3B0D C;  3AZL B;  1N1J A;  5B24 C;  4J8W C;  5E5A B;  1KX3 A;  1PZR A;  2JSS A;  1AOI C;  4WU9 A;  3AV1 A;  1P3A D;  5B31 B;  1KX5 B;  3A1K A;  1Z2C B;  2Y2M A;  2RIQ A;  3LZ1 C;  5CPJ A;  5JRG B;  3W97 A;  2J8P A;  3NQU A;  5KDM A;  5GT3 B;  5DNM A;  3MNN A;  1R4V A;  2FJ7 B;  3REI C;  3O62 B;  2IO5 C;  4KUD A;  4G91 B;  1ID3 C;  1P3M B;  3UT9 A;  3REH A;  5AVC B;  3AZK A;  1P3B B;  3WTP B;  4KHA B;  3LZ0 D;  3AZG C;  4R8P B;  4QLC B;  5B2I A;  1EQZ B;  3A1I A;  4XZQ A;  5GT0 A;  4DQY B;  3X1S D;  1P3I C;  5AV5 B;  5CPK C;  1P3G A;  1Q9C A;  3TU4 B;  3MVD A;  5B32 B;  3WA9 D;  2G5I C;  1ZLA A;  3VH5 W;  3H0L C;  4HGA B;  3AYW C;  1P3K B;  4H9S A;  3UTA A;  3VH6 A;  1KX4 C;  3REJ A;  4ZBJ B;  4AWL C;  3W96 D;  4Z66 C;  1KX3 D;  3X1T C;  1TAF A;  5B24 A;  3AL0 C;  3MGP B;  2BYK A;  5CPJ D;  5B40 B;  1P3O C;  1AOI A;  3W97 D;  5BT1 D;  3B6G C;  3AZM D;  4YM6 C;  3MNN D;  3A6N B;  3REL D;  4LD9 C;  1P3L C;  4KUD D;  2FJ7 C;  3UT9 D;  3REH D;  4XUJ A;  5GSU C;  5G49 A;  3O62 C;  5AY8 C;  3REI A;  5JA4 B;  3AZK D;  1P3M C;  5B31 G;  1ID3 A;  2Y2Q A;  3R45 A;  3REK D;  4JJN C;  2NZD D;  3AZH A;  3LJA B;  4R8P C;  2HIO C;  2Y2I A;  1P3G D;  3EPK A;  5CHL B;  5E5A D;  5B0Z D;  4H9Q B;  3MVD D;  5AVB C;  1P3I A;  5AV5 C;  1ZLA D;  5BNV B;  2YFV B;  4WZS B;  3WA9 B;  4H9R B;  3AZI D;  3UTA D;  3REJ D;  3AZF B;  5B0Y B;  3W96 B;  3AZN C;  3V9R B;  3KXB A;  3MGS B;  4UUZ A;  5B1M B;  2NQB A;  4Z5T C;  3W97 B;  2ZY2 A;  5B32 G;  1H3O B;  3AZM B;  3MNN B;  3MGP C;  3REL B;  5B40 C;  3KUY C;  1T3U A;  1P3O A;  3A6N C;  3B6G A;  4XUJ D;  4YM6 A;  3UT9 B;  5DNN A;  3B0C W;  3AFA A;  4LD9 A;  1P3L A;  3AZK B;  3MGR D;  3C1C C;  5GXQ C;  5BS7 C;  5GSU A;  5AV9 C;  5AY8 A;  1M19 D;  2CWE A;  3AZH D;  5CP6 D;  3REK B;  4X23 D;  1TZY A;  2NZD B;  4J8U C;  3AN2 A;  1P3G B;  4ZUX C;  3LJA C;  5B0Z B;  4JJN A;  3KWQ B;  3C1B B;  3MVD B;  3AV2 D;  1BH9 B;  1P3F B;  2HIO A;  3MGQ D;  3WAA B;  5BO0 B;  5AVB A;  3AZI B;  3REJ B;  3KXB D;  1BH8 B;  3AZF C;  1HQ3 D;  3X1V C;  2CV5 D;  2NQB D;  2BYM A;  4EO5 B;  5B1M C;  2YFW A;  2F8N D;  4Z5T A;  1S32 B;  5DNN D;  5CPI D;  3W99 B;  3AFA D;  3AZE D;  4LD9 D;  3P5J B;  1P34 C;  3KUY A;  2PYO D;  4WU8 B;  3MGR B;  2XD1 A;  4CSR A;  1M19 B;  4KGC C;  2G5H C;  1TZY D;  5CP6 B;  3AN2 D;  4X23 B;  5C3I B;  3C1C A;  5GXQ A;  5BS7 A;  5AV9 A;  5AV6 B;  5B1L A;  5B2J A;  3AV2 B;  2JCH A;  1KU5 A;  2HIO D;  2Y2P A;  4J8U A;  5FUG A;  5BNX B;  3KWQ C;  3MGQ B;  4ZUX A;  5AVB D;  1P3P A;  1U35 B;  3VH6 T;  2Y2G A;  3WAA C;  1M1A C;  3LEL A;  4YS3 B;  3B6F C;  1HQ3 B;  3WKJ D;  2CV5 B;  3AZJ B;  5B33 B;  2ARO C;  4WNN B;  3X1U C;  5F99 B;  3UTB C;  4J8X D;  3X1V A;  2F8N B;  4Z5T D;  3W98 B;  5CPI B;  3AZE B;  1M18 B;  5AV8 A;  2F2A C;  2W8S A;  4E44 A;  1S32 C;  3W99 C;  2PYO B;  3VH5 A;  4H9O B;  4WU8 C;  1P34 A;  4J8V C;  3FDD A;  4H9N A;  5AV9 D;  4WU9 D;  4Z2M G;  3AZL C;  5B1L D;  3AV1 D;  1P3A B;  4KGC A;  5B2J D;  3NQJ A;  5E5A C;  4J8W A;  5C3I C;  1A7W A;  3EPL A;  5AV6 C;  5B31 C;  1KX5 C;  5DNM D;  1P3P D;  1F66 C;  5JRG C;  5GT3 C;  3EPJ A;  3LZ1 A;  1U35 C;  3LEL D;  4G91 C;  3WKJ B;  3LZ0 B;  1M1A A;  5AVC C;  2RVQ C;  5B2I D;  4YS3 C;  1JFI A;  3X1V D;  2YFW B;  4XZQ D;  5GT0 D;  3WTP C;  1P3B C;  3B6F A;  4J8X B;  3AZG A;  5B33 C;  3AZJ C;  4QLC C;  3X1S B;  2ARO A;  5F99 C;  3X1U A;  1EQZ C;  1WWI A;  3UTB A;  5AV8 D;  4CAY B;  3W98 C;  5CPK A;  3TU4 C;  1M18 C;  5B32 C;  2FFF B;  4CSR B;  1N1J B;  2DQN C;  4HGA C;  1KX3 B;  1P3K C;  3AYW A;  2HUE B;  4WU9 B;  3AV1 B;  2F8N G;  1KX4 A;  4ZBJ C;  5B24 D;  4J8W D;  4Z66 A;  1AOI D;  5CPJ B;  5KDM B;  3NQU B;  5DNM B;  3X1T A;  2Y2J A;  3LZ1 D;  5B31 A;  4KUD B;  4E45 A;  3REH B;  3REI D;  3LEL B;  1F66 A;  1ID3 D;  5JRG A;  2ZY3 A;  5GT3 A;  2FJ7 A;  1M1A D;  2ZY5 A;  3O62 A;  5B2I B;  2JE5 A;  1P3M A;  1F1E A;  4XZQ B;  5GT0 B;  4G92 B;  3AZG D;  2VQR A;  5AVC A;  3X1U D;  1P3B A;  4DRA A;  1P3I D;  5AV8 B;  4R8P A;  5CPK D;  2LY8 A;  1ZLA B;  1EQZ A;  3UTA B;  5AV5 A;  3WA9 C;  3AYW D;  3WTP E;  3TU4 A;  5B32 A;  1KX4 D;  5B0Y C;  3W96 C;  1TAF B;  5B24 B;  4Z66 D;  4J8W B;  1KX3 C;  3MGS C;  3AZN A;  2BYK B;  1P3K A;  1HTA A;  1AOI B;  3X1T D;  4NE3 A;  2L5A A;  1P3O D;  5CPJ C;  3W97 C;  3B6G D;  5BT1 C;  4YM6 D;  3AZM C;  3MNN C;  4WJ3 C;  4XUJ B;  3REL C;  3MGP A;  2Y2K A;  3IP4 C;  5G49 B;  5B40 A;  3REI B;  1P3L D;  4KUD C;  2FJ7 D;  2IO5 B;  1ID3 B;  3UT9 C;  3A6N A;  3REH C;  5GSU D;  3R45 B;  3O62 D;  5AY8 D;  1F66 B;  3AZK C;  1P3M D;  3AZH B;  5JA4 A;  2Y2N A;  1P3B D;  4JJN D;  4G92 C;  3REK C;  2NZD C;  4R8P D;  1P3I B;  3H0R C;  3VH5 T;  1P3G C;  1EQZ D;  4Z2M H;  1P3F C;  5B0Z C;  3C1B C;  3MVD C;  3LJA A;  5AV5 D;  1ZLA C;  2F8N K;  3KXB B;  4H9Q A;  3AYW B;  3AZI C;  3UTA C;  4UUZ B;  3REJ C;  5BNV A;  1KX4 B;  2YFV A;  3WA9 A;  4AWL B;  3AZN D;  4Z66 B;  4H9R A;  2Y2H A;  2NQB B;  2DF4 C;  3AZF A;  5B0Y A;  3W96 A;  3X1T B;  3V9R A;  3MGS A;  4EO5 C;  1P3O B;  5B1M A;  3B6G B;  4YM6 B;  3MGP D;  5DNN B;  5B40 D;  1B67 A;  3AFA B;  3KUY D;  4LD9 B;  1P3L B;  4NFT A;  3A6N D;  1H3O A;  3AZM A;  4XUJ C;  2Y2L A;  4NE5 A;  3REL A;  5GSU B;  5AY8 B;  1TZY B;  3C1C D;  3MGR C;  3AN2 B;  5GXQ D;  1M19 C;  3AZH C;  5CP6 C;  4JJN B;  4X23 C;  4J8U D;  2HIO B;  4ZUX D;  3LJA D;  3REK A;  2F8N H;  2NZD A;  3AV2 C;  5AVB B;  3MGQ C;  4M6B A;  1P3F A;  5B0Z A;  3KWQ A;  2ZM5 A;  3C1B A;  1BH9 A;  4DRB A;  3KXB C;  3AZN B;  2BYM B;  3WAA A;  5BO0 A;  3AZI A;  3AZF D;  5B0Y D;  3VH6 W;  1HQ3 C;  3MGS D;  2UWX A;  1BH8 A;  2CV5 C;  2NQB C;  1ULY A;  4UPK A;  5B1M D;  4Z5T B;  3H0M C;  3B0C T;  4NE6 A;  3KUY B;  1BFM A;  5CPI C;  5DNN C;  3AFA C;  3AZE C;  1P34 D;  2PYO C;  1S32 A;  2Y2O A;  3W99 A;  4H9P A;  3C1C B;  5GXQ B;  5AV9 B;  4KGC D;  4WU8 A;  5B1L B;  4J8V A;  1TZY C;  3F6T A;  5B2J B;  3AN2 C;  3MGR A;  4J8U B;  3KFU G;  3AZL A;  1P3A C;  1M19 A;  5FUG B;  1P3P B;  5CP6 A;  5E5A A;  2BG1 A;  4ZUX B;  4X23 A;  5AV6 A;  2XD5 A;  1P3F D;  1KX5 A;  3KWQ D;  3C1B D;  3AV2 A;  1W2E A;  3MGQ A;  5BNX A;  3WAA D;  1U35 A;  3B6F D;  3X1V B;  3WKJ C;  3LZ0 C;  2ARO D;  4YS3 A;  1HQ3 A;  3UTB D;  3WTP A;  4KHA A;  4J8X C;  2CV5 A;  3X1S C;  3AZJ A;  5B33 A;  4QLC A;  4WNN A;  3EG5 B;  5F99 A;  2F8N A;  1P34 B;  1S32 D;  3W99 D;  3EPH A;  4H9N B;  5CPI A;  3W98 A;  3AZE A;  4WU8 D;  1M18 A;  3B0D B;  4J8V D;  2PYO A;  4KGC B;  3NQJ B;  3AZL D;  2HUE C;  4H9O A;  3AV1 C;  4WU9 C;  1WWS A;  5B1L C;  5B2J C; 
#chains in the Genus database with same CATH homology
 5AV6 D;  5B31 D;  1KX5 D;  1P3A A;  3LZ1 B;  5DNM C;  1P3P C;  1F66 D;  5JRG D;  5GT3 D;  1U35 D;  3KSY A;  3LEL C;  1M1A B;  1JFI B;  3B6F B;  3AZG B;  5AVC D;  2RVQ D;  2ZY4 A;  5B2I C;  4YS3 D;  2ARO B;  3X1U B;  4XZQ C;  3WTP D;  5GT0 C;  3UTB B;  3AZJ D;  3WKJ A;  5B33 D;  3LZ0 A;  4QLC D;  5F99 D;  5CPK B;  5AV8 C;  4J8X A;  3X1S A;  3B0B A;  4WV4 B;  3W98 D;  4H9P B;  3TU4 D;  1M18 D;  5B32 D;  4H9S C;  4CAY A;  4J8V B;  1P3K D;  1B6W A;  3B0D C;  3AZL B;  1N1J A;  5B24 C;  4J8W C;  5E5A B;  1KX3 A;  1PZR A;  2JSS A;  1AOI C;  4WU9 A;  3AV1 A;  1P3A D;  5B31 B;  1KX5 B;  3A1K A;  1Z2C B;  2Y2M A;  2RIQ A;  3LZ1 C;  5CPJ A;  5JRG B;  3W97 A;  2J8P A;  3NQU A;  5KDM A;  5GT3 B;  5DNM A;  3MNN A;  1R4V A;  2FJ7 B;  3REI C;  3O62 B;  2IO5 C;  4KUD A;  4G91 B;  1ID3 C;  1P3M B;  3UT9 A;  3REH A;  5AVC B;  3AZK A;  1P3B B;  3WTP B;  4KHA B;  3LZ0 D;  3AZG C;  4R8P B;  4QLC B;  5B2I A;  1EQZ B;  3A1I A;  4XZQ A;  5GT0 A;  4DQY B;  3X1S D;  1P3I C;  5AV5 B;  5CPK C;  1P3G A;  1Q9C A;  3TU4 B;  3MVD A;  5B32 B;  3WA9 D;  2G5I C;  1ZLA A;  3VH5 W;  3H0L C;  4HGA B;  3AYW C;  1P3K B;  4H9S A;  3UTA A;  3VH6 A;  1KX4 C;  3REJ A;  4ZBJ B;  4AWL C;  3W96 D;  4Z66 C;  1KX3 D;  3X1T C;  1TAF A;  5B24 A;  3AL0 C;  3MGP B;  2BYK A;  5CPJ D;  5B40 B;  1P3O C;  1AOI A;  3W97 D;  5BT1 D;  3B6G C;  3AZM D;  4YM6 C;  3MNN D;  3A6N B;  3REL D;  4LD9 C;  1P3L C;  4KUD D;  2FJ7 C;  3UT9 D;  3REH D;  4XUJ A;  5GSU C;  5G49 A;  3O62 C;  5AY8 C;  3REI A;  5JA4 B;  3AZK D;  1P3M C;  5B31 G;  1ID3 A;  2Y2Q A;  3R45 A;  3REK D;  4JJN C;  2NZD D;  3AZH A;  3LJA B;  4R8P C;  2HIO C;  2Y2I A;  1P3G D;  3EPK A;  5CHL B;  5E5A D;  5B0Z D;  4H9Q B;  3MVD D;  5AVB C;  1P3I A;  5AV5 C;  1ZLA D;  5BNV B;  2YFV B;  4WZS B;  3WA9 B;  4H9R B;  3AZI D;  3UTA D;  3REJ D;  3AZF B;  5B0Y B;  3W96 B;  3AZN C;  3V9R B;  3KXB A;  3MGS B;  4UUZ A;  5B1M B;  2NQB A;  4Z5T C;  3W97 B;  2ZY2 A;  5B32 G;  1H3O B;  3AZM B;  3MNN B;  3MGP C;  3REL B;  5B40 C;  3KUY C;  1T3U A;  1P3O A;  3A6N C;  3B6G A;  4XUJ D;  4YM6 A;  3UT9 B;  5DNN A;  3B0C W;  3AFA A;  4LD9 A;  1P3L A;  3AZK B;  3MGR D;  3C1C C;  5GXQ C;  5BS7 C;  5GSU A;  5AV9 C;  5AY8 A;  1M19 D;  2CWE A;  3AZH D;  5CP6 D;  3REK B;  4X23 D;  1TZY A;  2NZD B;  4J8U C;  3AN2 A;  1P3G B;  4ZUX C;  3LJA C;  5B0Z B;  4JJN A;  3KWQ B;  3C1B B;  3MVD B;  3AV2 D;  1BH9 B;  1P3F B;  2HIO A;  3MGQ D;  3WAA B;  5BO0 B;  5AVB A;  3AZI B;  3REJ B;  3KXB D;  1BH8 B;  3AZF C;  1HQ3 D;  3X1V C;  2CV5 D;  2NQB D;  2BYM A;  4EO5 B;  5B1M C;  2YFW A;  2F8N D;  4Z5T A;  1S32 B;  5DNN D;  5CPI D;  3W99 B;  3AFA D;  3AZE D;  4LD9 D;  3P5J B;  1P34 C;  3KUY A;  2PYO D;  4WU8 B;  3MGR B;  2XD1 A;  4CSR A;  1M19 B;  4KGC C;  2G5H C;  1TZY D;  5CP6 B;  3AN2 D;  4X23 B;  5C3I B;  3C1C A;  5GXQ A;  5BS7 A;  5AV9 A;  5AV6 B;  5B1L A;  5B2J A;  3AV2 B;  2JCH A;  1KU5 A;  2HIO D;  2Y2P A;  4J8U A;  5FUG A;  5BNX B;  3KWQ C;  3MGQ B;  4ZUX A;  5AVB D;  1P3P A;  1U35 B;  3VH6 T;  2Y2G A;  3WAA C;  1M1A C;  3LEL A;  4YS3 B;  3B6F C;  1HQ3 B;  3WKJ D;  2CV5 B;  3AZJ B;  5B33 B;  2ARO C;  4WNN B;  3X1U C;  5F99 B;  3UTB C;  4J8X D;  3X1V A;  2F8N B;  4Z5T D;  3W98 B;  5CPI B;  3AZE B;  1M18 B;  5AV8 A;  2F2A C;  2W8S A;  4E44 A;  1S32 C;  3W99 C;  2PYO B;  3VH5 A;  4H9O B;  4WU8 C;  1P34 A;  4J8V C;  3FDD A;  4H9N A;  5AV9 D;  4WU9 D;  4Z2M G;  3AZL C;  5B1L D;  3AV1 D;  1P3A B;  4KGC A;  5B2J D;  3NQJ A;  5E5A C;  4J8W A;  5C3I C;  1A7W A;  3EPL A;  5AV6 C;  5B31 C;  1KX5 C;  5DNM D;  1P3P D;  1F66 C;  5JRG C;  5GT3 C;  3EPJ A;  3LZ1 A;  1U35 C;  3LEL D;  4G91 C;  3WKJ B;  3LZ0 B;  1M1A A;  5AVC C;  2RVQ C;  5B2I D;  4YS3 C;  1JFI A;  3X1V D;  2YFW B;  4XZQ D;  5GT0 D;  3WTP C;  1P3B C;  3B6F A;  4J8X B;  3AZG A;  5B33 C;  3AZJ C;  4QLC C;  3X1S B;  2ARO A;  5F99 C;  3X1U A;  1EQZ C;  1WWI A;  3UTB A;  5AV8 D;  4CAY B;  3W98 C;  5CPK A;  3TU4 C;  1M18 C;  5B32 C;  2FFF B;  4CSR B;  1N1J B;  2DQN C;  4HGA C;  1KX3 B;  1P3K C;  3AYW A;  2HUE B;  4WU9 B;  3AV1 B;  2F8N G;  1KX4 A;  4ZBJ C;  5B24 D;  4J8W D;  4Z66 A;  1AOI D;  5CPJ B;  5KDM B;  3NQU B;  5DNM B;  3X1T A;  2Y2J A;  3LZ1 D;  5B31 A;  4KUD B;  4E45 A;  3REH B;  3REI D;  3LEL B;  1F66 A;  1ID3 D;  5JRG A;  2ZY3 A;  5GT3 A;  2FJ7 A;  1M1A D;  2ZY5 A;  3O62 A;  5B2I B;  2JE5 A;  1P3M A;  1F1E A;  4XZQ B;  5GT0 B;  4G92 B;  3AZG D;  2VQR A;  5AVC A;  3X1U D;  1P3B A;  4DRA A;  1P3I D;  5AV8 B;  4R8P A;  5CPK D;  2LY8 A;  1ZLA B;  1EQZ A;  3UTA B;  5AV5 A;  3WA9 C;  3AYW D;  3WTP E;  3TU4 A;  5B32 A;  1KX4 D;  5B0Y C;  3W96 C;  1TAF B;  5B24 B;  4Z66 D;  4J8W B;  1KX3 C;  3MGS C;  3AZN A;  2BYK B;  1P3K A;  1HTA A;  1AOI B;  3X1T D;  4NE3 A;  2L5A A;  1P3O D;  5CPJ C;  3W97 C;  3B6G D;  5BT1 C;  4YM6 D;  3AZM C;  3MNN C;  4WJ3 C;  4XUJ B;  3REL C;  3MGP A;  2Y2K A;  3IP4 C;  5G49 B;  5B40 A;  3REI B;  1P3L D;  4KUD C;  2FJ7 D;  2IO5 B;  1ID3 B;  3UT9 C;  3A6N A;  3REH C;  5GSU D;  3R45 B;  3O62 D;  5AY8 D;  1F66 B;  3AZK C;  1P3M D;  3AZH B;  5JA4 A;  2Y2N A;  1P3B D;  4JJN D;  4G92 C;  3REK C;  2NZD C;  4R8P D;  1P3I B;  3H0R C;  3VH5 T;  1P3G C;  1EQZ D;  4Z2M H;  1P3F C;  5B0Z C;  3C1B C;  3MVD C;  3LJA A;  5AV5 D;  1ZLA C;  2F8N K;  3KXB B;  4H9Q A;  3AYW B;  3AZI C;  3UTA C;  4UUZ B;  3REJ C;  5BNV A;  1KX4 B;  2YFV A;  3WA9 A;  4AWL B;  3AZN D;  4Z66 B;  4H9R A;  2Y2H A;  2NQB B;  2DF4 C;  3AZF A;  5B0Y A;  3W96 A;  3X1T B;  3V9R A;  3MGS A;  4EO5 C;  1P3O B;  5B1M A;  3B6G B;  4YM6 B;  3MGP D;  5DNN B;  5B40 D;  1B67 A;  3AFA B;  3KUY D;  4LD9 B;  1P3L B;  4NFT A;  3A6N D;  1H3O A;  3AZM A;  4XUJ C;  2Y2L A;  4NE5 A;  3REL A;  5GSU B;  5AY8 B;  1TZY B;  3C1C D;  3MGR C;  3AN2 B;  5GXQ D;  1M19 C;  3AZH C;  5CP6 C;  4JJN B;  4X23 C;  4J8U D;  2HIO B;  4ZUX D;  3LJA D;  3REK A;  2F8N H;  2NZD A;  3AV2 C;  5AVB B;  3MGQ C;  4M6B A;  1P3F A;  5B0Z A;  3KWQ A;  2ZM5 A;  3C1B A;  1BH9 A;  4DRB A;  3KXB C;  3AZN B;  2BYM B;  3WAA A;  5BO0 A;  3AZI A;  3AZF D;  5B0Y D;  3VH6 W;  1HQ3 C;  3MGS D;  2UWX A;  1BH8 A;  2CV5 C;  2NQB C;  1ULY A;  4UPK A;  5B1M D;  4Z5T B;  3H0M C;  3B0C T;  4NE6 A;  3KUY B;  1BFM A;  5CPI C;  5DNN C;  3AFA C;  3AZE C;  1P34 D;  2PYO C;  1S32 A;  2Y2O A;  3W99 A;  4H9P A;  3C1C B;  5GXQ B;  5AV9 B;  4KGC D;  4WU8 A;  5B1L B;  4J8V A;  1TZY C;  3F6T A;  5B2J B;  3AN2 C;  3MGR A;  4J8U B;  3KFU G;  3AZL A;  1P3A C;  1M19 A;  5FUG B;  1P3P B;  5CP6 A;  5E5A A;  2BG1 A;  4ZUX B;  4X23 A;  5AV6 A;  2XD5 A;  1P3F D;  1KX5 A;  3KWQ D;  3C1B D;  3AV2 A;  1W2E A;  3MGQ A;  5BNX A;  3WAA D;  1U35 A;  3B6F D;  3X1V B;  3WKJ C;  3LZ0 C;  2ARO D;  4YS3 A;  1HQ3 A;  3UTB D;  3WTP A;  4KHA A;  4J8X C;  2CV5 A;  3X1S C;  3AZJ A;  5B33 A;  4QLC A;  4WNN A;  3EG5 B;  5F99 A;  2F8N A;  1P34 B;  1S32 D;  3W99 D;  3EPH A;  4H9N B;  5CPI A;  3W98 A;  3AZE A;  4WU8 D;  1M18 A;  3B0D B;  4J8V D;  2PYO A;  4KGC B;  3NQJ B;  3AZL D;  2HUE C;  4H9O A;  3AV1 C;  4WU9 C;  1WWS A;  5B1L C;  5B2J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...