3WKJA

The nucleosome containing human tsh2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjA00
1N1JB 3W97C 3AZNA 3X1TB 1HQ3A 3AZNC 2PYOA 1P3OA 1HQ3C 4NFTA 3LELB 4Z5TB 5F99D 1P3AA 4QLCA 4QLCC 3AZIA 2F8NA 3X1SB 3TU4B 4J8UB 4J8WB 4XZQB 1AOID 1H3OB 3UTAB 5B31D 4YS3B 4ZUXD 5B1LA 3V9RB 5B1LC 1TZYD 5B2ID 2CV5B 4H9PB 5AV8C 1KX4A 3AZKA 4Z66A 4Z66C 3C1CA 4NE3A 3KUYC 3MGRD 4WNNB 5CPIC 5JA4B 3REIC 4X23C 5DNNB 3REHB 3AZHC 1F66A 1F66C 1A7WA 1B6WA 3WA9B 4R8PD 4YM6C 4JJND 3UT9B 4Z5TA 3AV1B 1P3KB 5CP6C 4HGAB 5KDMA 3AZJD 3LZ0D 2RVQD 4J8UA 4J8WA 5E5AC 4XZQA 3WTPD 5GT0B 3LZ1D 1H3OA 1P3ID 3MGQB 5B33D 4KHAB 4KGCB 3REJD 3V9RA 3MNNC 2CV5A 5AVBB 2F8NK 4LD9B 5AV5A 2BYKB 1S32A 5AV5C 4XUJC 1S32C 1KX5B 5JA4A 3MGPC 3AZLA 5DNNA 5GT3B 3AZLC 3MGSB 4J8VD 3UTBC 5B1MD 3AV2B 3UT9A 3AV1A 5DNMC 4WU8B 4J8XA 4DRBA 5CPKD 5BT1C 4J8XC 1M19B 4WU9C 3B6GB 4DRAA 5CPJA 5B40D 3W99D 3AZEC 1ID3C 1U35D 3X1UA 3MGQA 5GXQB 3W96A 5B0YA 4KHAA 3X1UC 3C1BD 5B0YC 1M18B 1HTAA 4H9OA 3X1TD 3AFAB 3WKJB 2LY8A 5JRGC 1P34D 3LELD 3REKB 2L5AA 1KX5A 3X1SD 3TU4D 1ZLAD 1P3BA 2NZDA 1P3BC 2NZDC 5AV6D 3A6NB 5GT3A 3UTAD 5BO0A 2HIOB 4YS3D 2FJ7B 5AY8B 3AZGA 3AV2A 5B0ZC 3AZGC 3W97B 3MVDA 5B24D 2NQBD 3MVDC 3AZNB 1HQ3B 2PYOB 1KX3C 4WV4B 5GSUD 3B6GA 3W98D 4QLCB 4UUZA 5F99C 1M1AD 3LJAD 1TAFB 1P3FD 3REHD 2AROA 5B1LB 1AOIC 2AROC 3WA9D 3AZMA 1P3KD 4G92C 3REKA 5B2IC 4Z66B 3WAAD 5AV9D 3KUYB 5GT0D 5CPIB 3VH6A 3REIB 4X23B 4KGCD 4EO5C 3VH5T 3W97A 3KXBD 1F66B 5AVBD 3VH6W 4YM6B 1JFIA 3AN2D 5CP6B 1P3PD 4H9RA 4LD9D 2YFVB 5KDMB 4JJNC 5E5AB 3LZ0C 3R45A 2RVQC 1TAFA 3LZ1C 3WTPC 3MGSD 1P3LA 2F8NH 1P3LC 3MNNB 3X1VA 5B33C 2BYMA 5AV8A 3X1VC 3AZFA 4WU8D 3AZFC 3REJC 1WWIA 1M19D 4XUJB 5AV5B 3KUYA 1S32B 5CPIA 5GXQD 3MGPB 3REIA 4X23A 1M18D 4Z2MH 5G49B 2JSSA 3AZLB 3AZHA 3UTBB 4YM6A 1B67A 5DNMB 3AFAD 5CP6A 3WKJD 4J8XB 2YFVA 4WU9B 3RELA 5B1MC 4H9QB 3RELC 1F1EA 1P3MA 1P3MC 5CHLB 5E5AA 5CPJB 5CPKC 3B6FD 1EQZA 1ID3B 1EQZC 3X1UB 5AVCD 3A6ND 5B32G 5B0YB 3W99C 5B40C 3W96B 2HIOD 3MNNA 3NQUA 4H9OB 5AY8D 1U35C 2FJ7D 3AZND 5JRGB 2PYOD 1P3OD 1R4VA 4XUJA 1P3AD 5B32A 4QLCD 5B32C 1P34C 3AZID 2F8ND 1BH9B 3MGPA 1P3BB 2NZDB 1KU5A 5G49A 1WWSA 5BO0B 5B2JA 1ZLAC 5B2JC 3UTBA 5AV6C 3AZGB 5B1LD 5DNMA 3MVDB 3AYWA 3AYWC 1KX3B 4WU9A 4H9QA 1KX4D 3AZKD 5B24C 4Z66D 2NQBC 3AZEA 3C1CD 4UUZB 3O62A 1ID3A 5F99B 5GSUC 3W98C 3O62C 3B0CW 1F66D 1AOIB 2AROB 5JRGA 1M1AC 3LJAC 3AZMB 4G92B 1P3FC 4Z5TD 5B2IB 3WA9C 4KUDA 4KUDC 4WZSB 1BH9A 4J8UD 4J8WD 1P3GA 4XZQD 1P3GC 3WAAC 5AV9C 3KWQA 3KWQC 4EO5B 5B0ZA 2CV5D 4AWLC 1KX3A 1ULYA 1JFIB 3KXBC 4H9RB 5AV5D 4JJNB 1S32D 5B31G 5BNVB 5F99A 3AN2C 1P3PC 3LZ0B 3B0DC 3R45B 3AZLD 5DNND 3WTPB 3LZ1B 1P3LB 1AOIA 5B31A 5B33B 3X1VB 5B31C 3UT9D 4ZUXA 2BYMB 5AV8B 3AZFB 5BT1D 4ZUXC 5FUGB 2IO5C 4J8XD 1TZYA 5B2IA 3REJB 1TZYC 4H9NB 5CPJD 3X1UD 3MGQD 3MGRA 3W96D 5B0YD 3MGRC 4G91C 3AZHB 5B1MB 2HUEC 4R8PA 4JJNA 3RELB 4R8PC 5BNVA 3AFAC 1P3MB 5CPKB 1KX5D 3AZJA 3LZ0A 3AZJC 1P3BD 1EQZB 2NZDD 5B40B 3LZ1A 3WTPA 3B6FC 5GT3D 3W99B 1U35B 1P3IA 3NQUB 3AZGD 5B33A 1P3IC 5AVCC 3AV2D 3MVDD 3REJA 5FUGA 4H9NA 3B6GD 4CSRB 5B32B 1P34B 2PYOC 1P3OC 5BS7A 4ZBJC 5BS7C 1P3AC 5C3IC 3AZIC 1ZLAB 3VH6T 5B2JB 4Z2MG 5AV6B 2AROD 4J8VA 3AYWB 3AZMD 4J8VC 5B1MA 3REKD 4CAYB 5B24B 2NQBB 5CPKA 1BH8B 3AZEB 1KX4C 5GSUB 3W98B 3O62B 3AZKC 5B40A 3W99A 3C1CC 1U35A 3C1BA 3C1BC 3W97D 1M1AB 3LJAB 1HQ3D 1P3FB 1N1JA 3X1TA 4CSRA 3X1TC 1P34A 4H9SA 3LELA 4KUDB 4H9SC 4Z5TC 3LELC 1P3GB 3WAAB 1Q9CA 3X1SA 3TU4A 5AV9B 3X1SC 3TU4C 1ZLAA 3KWQB 4J8WC 4J8UC 4XZQC 5AV6A 1P3LD 2FJ7A 5B0ZB 3UTAA 1BFMA 3WTPE 3UTAC 4AWLB 4YS3A 3X1VD 5BNXB 4YS3C 5AV8D 3AZFD 4CAYA 3KXBB 5B24A 2NQBA 2CV5C 1BH8A 4H9PA 3KUYD 3AN2B 5GSUA 1P3PB 3W98A 3KSYA 5CPID 3REID 4WNNA 4X23D 3B0DB 2YFWB 3AZHD 3AV1D 1M1AA 3LJAA 4YM6D 5B31B 3REHA 5DNNC 1P3FA 5CP6D 4ZUXB 3REHC 2IO5B 3WA9A 1TZYB 3RELD 1P3KA 3UT9C 3AV1C 1P3KC 1P3MD 5E5AD 4HGAC 3WAAA 1EQZD 5AV9A 5CPJC 3MGRB 5GT0A 5GT0C 4G91B 3MNND 3MGQC 5BNXA 3W96C 4KGCA 4KGCC 3KXBA 5AVBA 5AVBC 2CWEA 2HUEB 4M6BA 4XUJD 3NQJB 4R8PB 3AN2A 4E45A 5B32D 1P3PA 4LD9A 4LD9C 2BYKA 3AZJB 3B0CT 3MGPD 3B0BA 4E44A 2YFWA 3B6FB 1KX5C 5B2JD 3UTBD 1P3IB 3VH5A 5AVCB 5DNMD 3MGSA 5GT3C 3MGSC 3AYWD 4WU9D 3VH5W 4WU8A 3AV2C 4WU8C 1M19A 1P3OB 4ZBJB 3AZED 1M19C 1ID3D 3O62D 1P3AB 3B6GC 5C3IB 3AZIB 2F8NB 5GXQA 1M18A 5GXQC 1M18C 5JRGD 4J8VB 3NQJA 3AFAA 3WKJA 3WKJC 4KUDD 3AZMC 1KX4B 3REKC 3AZKB 1P3GD 3B6FA 4NE5A 3C1CB 3KWQD 5AVCA 5B0ZD 3A6NA 3A6NC 3C1BB 2HIOA 4NE6A 2HIOC 2F8NG 5AY8A 1KX3D 2FJ7C 5AY8C
chains in the Genus database with same CATH superfamily
1N1JB 3W97C 2DQNC 3AZNA 3X1TB 1HQ3A 3AZNC 2PYOA 1P3OA 1HQ3C 4NFTA 3LELB 4Z5TB 3H0MC 5F99D 1P3AA 4QLCA 4QLCC 3AZIA 1T3UA 2F8NA 3X1SB 3TU4B 4J8UB 4J8WB 4XZQB 1AOID 1H3OB 3UTAB 5B31D 4YS3B 2VQRA 4ZUXD 5B1LA 3V9RB 5B1LC 1TZYD 5B2ID 2CV5B 2ZM5A 4H9PB 5AV8C 1KX4A 3AZKA 4Z66A 4Z66C 3C1CA 4NE3A 1W2EA 3MGRD 3KUYC 4WNNB 5CPIC 5JA4B 3REIC 4X23C 5DNNB 3REHB 3AZHC 1F66A 1F66C 1A7WA 1B6WA 3WA9B 4R8PD 4YM6C 3EPKA 4JJND 4Z5TA 3UT9B 3AV1B 1P3KB 5CP6C 4HGAB 5KDMA 3AZJD 3LZ0D 2RVQD 4J8UA 4J8WA 5E5AC 4XZQA 2BG1A 5GT0B 3WTPD 3LZ1D 1H3OA 1P3ID 3MGQB 5B33D 4KHAB 4KGCB 3REJD 3V9RA 3MNNC 2CV5A 5AVBB 2F8NK 4LD9B 5AV5A 2BYKB 1S32A 5AV5C 4XUJC 1S32C 1KX5B 5JA4A 3MGPC 2Y2MA 3AZLA 2ZY4A 3H0LC 5DNNA 5GT3B 3AZLC 3MGSB 4J8VD 3UTBC 5B1MD 3AV2B 3UT9A 3AV1A 5DNMC 4WU8B 4J8XA 4DRBA 5CPKD 5BT1C 4J8XC 1M19B 4WU9C 3B6GB 4DRAA 5CPJA 5B40D 3W99D 3AZEC 1ID3C 1U35D 3X1UA 3KFUG 3MGQA 5GXQB 3W96A 5B0YA 4KHAA 3X1UC 3C1BD 5B0YC 1M18B 1HTAA 4H9OA 3X1TD 3AFAB 3WKJB 2LY8A 5JRGC 1P34D 3LELD 3REKB 2L5AA 1KX5A 3X1SD 3TU4D 3A1IA 1ZLAD 1P3BA 2NZDA 1P3BC 2NZDC 5AV6D 3A6NB 5GT3A 3UTAD 5BO0A 2HIOB 4YS3D 2FJ7B 5AY8B 3AZGA 3AV2A 5B0ZC 3AZGC 3W97B 3MVDA 5B24D 2NQBD 3MVDC 3AZNB 1HQ3B 2PYOB 1KX3C 4WV4B 5GSUD 3B6GA 3W98D 3AL0C 4QLCB 4UUZA 5F99C 1M1AD 3LJAD 1TAFB 1P3FD 3REHD 2AROA 5B1LB 1AOIC 2AROC 3WA9D 3AZMA 1P3KD 4G92C 3REKA 5B2IC 4DQYB 4Z66B 3WAAD 5AV9D 3KUYB 5GT0D 2Y2JA 5CPIB 3VH6A 3REIB 4X23B 4KGCD 4EO5C 3VH5T 3W97A 3KXBD 1F66B 5AVBD 3VH6W 4YM6B 1JFIA 3AN2D 5CP6B 1P3PD 4H9RA 4LD9D 2YFVB 5KDMB 4JJNC 2F2AC 5E5AB 3LZ0C 2G5HC 3R45A 2RVQC 1TAFA 3LZ1C 2ZY5A 3WTPC 3MGSD 1P3LA 2F8NH 1P3LC 3MNNB 3X1VA 5B33C 2BYMA 5AV8A 3X1VC 3AZFA 4WU8D 3AZFC 3REJC 1WWIA 1M19D 4XUJB 5AV5B 3KUYA 1S32B 5CPIA 5GXQD 3MGPB 3REIA 4X23A 1M18D 4Z2MH 5G49B 2JSSA 3AZLB 3AZHA 2Y2HA 3UTBB 4YM6A 1B67A 5DNMB 3AFAD 5CP6A 3WKJD 4J8XB 2YFVA 4WU9B 3RELA 5B1MC 4H9QB 3RELC 1F1EA 1P3MA 1P3MC 5CHLB 5E5AA 5CPJB 5CPKC 3B6FD 2Y2NA 1EQZA 1ID3B 1EQZC 3X1UB 5AVCD 3A6ND 5B32G 5B0YB 3W99C 5B40C 3W96B 2HIOD 3MNNA 3NQUA 4H9OB 5AY8D 1U35C 2FJ7D 3AZND 4WJ3C 5JRGB 2PYOD 1P3OD 1R4VA 4XUJA 1P3AD 5B32A 4QLCD 5B32C 1P34C 3AZID 2F8ND 1BH9B 3MGPA 1P3BB 2NZDB 1KU5A 5G49A 1WWSA 5BO0B 5B2JA 1ZLAC 2JCHA 5B2JC 3UTBA 5AV6C 3AZGB 2Y2OA 5B1LD 5DNMA 3MVDB 3AYWA 3AYWC 1KX3B 4WU9A 4H9QA 1KX4D 3AZKD 3EPJA 5B24C 4Z66D 2NQBC 3AZEA 3C1CD 4UUZB 3O62A 1ID3A 5F99B 5GSUC 3W98C 3O62C 3B0CW 1F66D 1AOIB 2AROB 5JRGA 3F6TA 3LJAC 1M1AC 3AZMB 4G92B 1P3FC 4Z5TD 5B2IB 3WA9C 4KUDA 4KUDC 4WZSB 1BH9A 2Y2GA 1Z2CB 4J8UD 4J8WD 2Y2QA 1P3GA 4XZQD 1P3GC 3WAAC 5AV9C 3KWQA 3KWQC 4EO5B 5B0ZA 2CV5D 4AWLC 1KX3A 1ULYA 2RIQA 1JFIB 3KXBC 4H9RB 5AV5D 4JJNB 1S32D 5B31G 5BNVB 5F99A 3AN2C 1P3PC 3LZ0B 3B0DC 2ZY3A 3P5JB 3R45B 5DNND 3WTPB 3LZ1B 3AZLD 1P3LB 1AOIA 3EPLA 3EPHA 5B31A 5B33B 3X1VB 5B31C 3UT9D 4ZUXA 2BYMB 5AV8B 3AZFB 5BT1D 4ZUXC 5FUGB 2IO5C 4J8XD 1TZYA 5B2IA 3REJB 1TZYC 4H9NB 5CPJD 2DF4C 3X1UD 3MGQD 3MGRA 3W96D 5B0YD 3MGRC 4G91C 3AZHB 5B1MB 2HUEC 4R8PA 4JJNA 3RELB 4R8PC 5BNVA 3AFAC 1P3MB 5CPKB 1KX5D 3AZJA 3LZ0A 3AZJC 1P3BD 1EQZB 2NZDD 5B40B 3LZ1A 3WTPA 3B6FC 5GT3D 3W99B 1U35B 1P3IA 3NQUB 3AZGD 5B33A 1P3IC 5AVCC 3AV2D 3MVDD 3REJA 5FUGA 4H9NA 3B6GD 4CSRB 5B32B 1P34B 2PYOC 4UPKA 1P3OC 5BS7A 4ZBJC 5BS7C 1P3AC 5C3IC 3AZIC 1ZLAB 2W8SA 3VH6T 5B2JB 4Z2MG 5AV6B 2AROD 4J8VA 3AYWB 3AZMD 4J8VC 5B1MA 3REKD 4CAYB 5B24B 2NQBB 5CPKA 1BH8B 3AZEB 1KX4C 5GSUB 3W98B 3O62B 3AZKC 5B40A 3W99A 3C1CC 1U35A 2ZY2A 3C1BA 3C1BC 3W97D 1M1AB 3LJAB 1HQ3D 1P3FB 1N1JA 3X1TA 4CSRA 3X1TC 1P34A 2J8PA 4H9SA 3LELA 4KUDB 2JE5A 4H9SC 4Z5TC 3LELC 2Y2PA 1P3GB 3WAAB 1Q9CA 3X1SA 3TU4A 5AV9B 3X1SC 3TU4C 1ZLAA 1PZRA 3KWQB 4J8WC 4J8UC 4XZQC 5AV6A 1P3LD 2FJ7A 5B0ZB 3UTAA 1BFMA 3WTPE 3UTAC 4AWLB 4YS3A 3X1VD 5BNXB 4YS3C 5AV8D 3AZFD 4CAYA 3KXBB 5B24A 2NQBA 2CV5C 1BH8A 4H9PA 3KUYD 3AN2B 5GSUA 2Y2IA 1P3PB 3W98A 3KSYA 2Y2LA 5CPID 3REID 4WNNA 4X23D 3B0DB 2YFWB 3AZHD 3AV1D 1M1AA 3LJAA 4YM6D 5B31B 3EG5B 5DNNC 3REHA 1P3FA 5CP6D 4ZUXB 3REHC 2IO5B 3WA9A 1TZYB 3RELD 1P3KA 3UT9C 3AV1C 1P3KC 1P3MD 5E5AD 4HGAC 3WAAA 1EQZD 3FDDA 5AV9A 5CPJC 3MGRB 5GT0A 5GT0C 4G91B 3MNND 3MGQC 5BNXA 3W96C 4KGCA 4KGCC 2Y2KA 2FFFB 3KXBA 2XD1A 5AVBA 5AVBC 2CWEA 2HUEB 4M6BA 4XUJD 3NQJB 4R8PB 3AN2A 4E45A 5B32D 1P3PA 4LD9A 4LD9C 2BYKA 3AZJB 3B0CT 3MGPD 3B0BA 4E44A 2YFWA 3B6FB 1KX5C 5B2JD 3UTBD 1P3IB 3VH5A 5AVCB 5DNMD 3MGSA 5GT3C 3MGSC 3AYWD 4WU9D 3VH5W 4WU8A 3AV2C 4WU8C 1M19A 1P3OB 4ZBJB 3AZED 1M19C 1ID3D 3O62D 1P3AB 3B6GC 5C3IB 3AZIB 2F8NB 2G5IC 5GXQA 1M18A 3H0RC 5GXQC 1M18C 5JRGD 4J8VB 3NQJA 3AFAA 3WKJA 3WKJC 4KUDD 3AZMC 1KX4B 3REKC 3AZKB 1P3GD 3B6FA 3A1KA 4NE5A 3C1CB 2XD5A 3KWQD 2UWXA 3IP4C 5AVCA 5B0ZD 3A6NA 3A6NC 3C1BB 2HIOA 4NE6A 2HIOC 2F8NG 5AY8A 1KX3D 2FJ7C 5AY8C
chains in the Genus database with same CATH topology
1N1JB 3W97C 2DQNC 3AZNA 3X1TB 1HQ3A 3AZNC 2PYOA 1P3OA 1HQ3C 4NFTA 3LELB 4Z5TB 3H0MC 5F99D 1P3AA 4QLCA 4QLCC 3AZIA 1T3UA 2F8NA 3X1SB 3TU4B 4J8UB 4J8WB 4XZQB 1AOID 1H3OB 3UTAB 5B31D 4YS3B 2VQRA 4ZUXD 5B1LA 3V9RB 5B1LC 1TZYD 5B2ID 2CV5B 2ZM5A 4H9PB 5AV8C 1KX4A 3AZKA 4Z66A 4Z66C 3C1CA 4NE3A 1W2EA 3MGRD 3KUYC 4WNNB 5CPIC 5JA4B 3REIC 4X23C 5DNNB 3REHB 3AZHC 1F66A 1F66C 1A7WA 1B6WA 3WA9B 4R8PD 4YM6C 3EPKA 4JJND 4Z5TA 3UT9B 3AV1B 1P3KB 5CP6C 4HGAB 5KDMA 3AZJD 3LZ0D 2RVQD 4J8UA 4J8WA 5E5AC 4XZQA 2BG1A 5GT0B 3WTPD 3LZ1D 1H3OA 1P3ID 3MGQB 5B33D 4KHAB 4KGCB 3REJD 3V9RA 3MNNC 2CV5A 5AVBB 2F8NK 4LD9B 5AV5A 2BYKB 1S32A 5AV5C 4XUJC 1S32C 1KX5B 5JA4A 3MGPC 2Y2MA 3AZLA 2ZY4A 3H0LC 5DNNA 5GT3B 3AZLC 3MGSB 4J8VD 3UTBC 5B1MD 3AV2B 3UT9A 3AV1A 5DNMC 4WU8B 4J8XA 4DRBA 5CPKD 5BT1C 4J8XC 1M19B 4WU9C 3B6GB 4DRAA 5CPJA 5B40D 3W99D 3AZEC 1ID3C 1U35D 3X1UA 3KFUG 3MGQA 5GXQB 3W96A 5B0YA 4KHAA 3X1UC 3C1BD 5B0YC 1M18B 1HTAA 4H9OA 3X1TD 3AFAB 3WKJB 2LY8A 5JRGC 1P34D 3LELD 3REKB 2L5AA 1KX5A 3X1SD 3TU4D 3A1IA 1ZLAD 1P3BA 2NZDA 1P3BC 2NZDC 5AV6D 3A6NB 5GT3A 3UTAD 5BO0A 2HIOB 4YS3D 2FJ7B 5AY8B 3AZGA 3AV2A 5B0ZC 3AZGC 3W97B 3MVDA 5B24D 2NQBD 3MVDC 3AZNB 1HQ3B 2PYOB 1KX3C 4WV4B 5GSUD 3B6GA 3W98D 3AL0C 4QLCB 4UUZA 5F99C 1M1AD 3LJAD 1TAFB 1P3FD 3REHD 2AROA 5B1LB 1AOIC 2AROC 3WA9D 3AZMA 1P3KD 4G92C 3REKA 5B2IC 4DQYB 4Z66B 3WAAD 5AV9D 3KUYB 5GT0D 2Y2JA 5CPIB 3VH6A 3REIB 4X23B 4KGCD 4EO5C 3VH5T 3W97A 3KXBD 1F66B 5AVBD 3VH6W 4YM6B 1JFIA 3AN2D 5CP6B 1P3PD 4H9RA 4LD9D 2YFVB 5KDMB 4JJNC 2F2AC 5E5AB 3LZ0C 2G5HC 3R45A 2RVQC 1TAFA 3LZ1C 2ZY5A 3WTPC 3MGSD 1P3LA 2F8NH 1P3LC 3MNNB 3X1VA 5B33C 2BYMA 5AV8A 3X1VC 3AZFA 4WU8D 3AZFC 3REJC 1WWIA 1M19D 4XUJB 5AV5B 3KUYA 1S32B 5CPIA 5GXQD 3MGPB 3REIA 4X23A 1M18D 4Z2MH 5G49B 2JSSA 3AZLB 3AZHA 2Y2HA 3UTBB 4YM6A 1B67A 5DNMB 3AFAD 5CP6A 3WKJD 4J8XB 2YFVA 4WU9B 3RELA 5B1MC 4H9QB 3RELC 1F1EA 1P3MA 1P3MC 5CHLB 5E5AA 5CPJB 5CPKC 3B6FD 2Y2NA 1EQZA 1ID3B 1EQZC 3X1UB 5AVCD 3A6ND 5B32G 5B0YB 3W99C 5B40C 3W96B 2HIOD 3MNNA 3NQUA 4H9OB 5AY8D 1U35C 2FJ7D 3AZND 4WJ3C 5JRGB 2PYOD 1P3OD 1R4VA 4XUJA 1P3AD 5B32A 4QLCD 5B32C 1P34C 3AZID 2F8ND 1BH9B 3MGPA 1P3BB 2NZDB 1KU5A 5G49A 1WWSA 5BO0B 5B2JA 1ZLAC 2JCHA 5B2JC 3UTBA 5AV6C 3AZGB 2Y2OA 5B1LD 5DNMA 3MVDB 3AYWA 3AYWC 1KX3B 4WU9A 4H9QA 1KX4D 3AZKD 3EPJA 5B24C 4Z66D 2NQBC 3AZEA 3C1CD 4UUZB 3O62A 1ID3A 5F99B 5GSUC 3W98C 3O62C 3B0CW 1F66D 1AOIB 2AROB 5JRGA 3F6TA 3LJAC 1M1AC 3AZMB 4G92B 1P3FC 4Z5TD 5B2IB 3WA9C 4KUDA 4KUDC 4WZSB 1BH9A 2Y2GA 1Z2CB 4J8UD 4J8WD 2Y2QA 1P3GA 4XZQD 1P3GC 3WAAC 5AV9C 3KWQA 3KWQC 4EO5B 5B0ZA 2CV5D 4AWLC 1KX3A 1ULYA 2RIQA 1JFIB 3KXBC 4H9RB 5AV5D 4JJNB 1S32D 5B31G 5BNVB 5F99A 3AN2C 1P3PC 3LZ0B 3B0DC 2ZY3A 3P5JB 3R45B 5DNND 3WTPB 3LZ1B 3AZLD 1P3LB 1AOIA 3EPLA 3EPHA 5B31A 5B33B 3X1VB 5B31C 3UT9D 4ZUXA 2BYMB 5AV8B 3AZFB 5BT1D 4ZUXC 5FUGB 2IO5C 4J8XD 1TZYA 5B2IA 3REJB 1TZYC 4H9NB 5CPJD 2DF4C 3X1UD 3MGQD 3MGRA 3W96D 5B0YD 3MGRC 4G91C 3AZHB 5B1MB 2HUEC 4R8PA 4JJNA 3RELB 4R8PC 5BNVA 3AFAC 1P3MB 5CPKB 1KX5D 3AZJA 3LZ0A 3AZJC 1P3BD 1EQZB 2NZDD 5B40B 3LZ1A 3WTPA 3B6FC 5GT3D 3W99B 1U35B 1P3IA 3NQUB 3AZGD 5B33A 1P3IC 5AVCC 3AV2D 3MVDD 3REJA 5FUGA 4H9NA 3B6GD 4CSRB 5B32B 1P34B 2PYOC 4UPKA 1P3OC 5BS7A 4ZBJC 5BS7C 1P3AC 5C3IC 3AZIC 1ZLAB 2W8SA 3VH6T 5B2JB 4Z2MG 5AV6B 2AROD 4J8VA 3AYWB 3AZMD 4J8VC 5B1MA 3REKD 4CAYB 5B24B 2NQBB 5CPKA 1BH8B 3AZEB 1KX4C 5GSUB 3W98B 3O62B 3AZKC 5B40A 3W99A 3C1CC 1U35A 2ZY2A 3C1BA 3C1BC 3W97D 1M1AB 3LJAB 1HQ3D 1P3FB 1N1JA 3X1TA 4CSRA 3X1TC 1P34A 2J8PA 4H9SA 3LELA 4KUDB 2JE5A 4H9SC 4Z5TC 3LELC 2Y2PA 1P3GB 3WAAB 1Q9CA 3X1SA 3TU4A 5AV9B 3X1SC 3TU4C 1ZLAA 1PZRA 3KWQB 4J8WC 4J8UC 4XZQC 5AV6A 1P3LD 2FJ7A 5B0ZB 3UTAA 1BFMA 3WTPE 3UTAC 4AWLB 4YS3A 3X1VD 5BNXB 4YS3C 5AV8D 3AZFD 4CAYA 3KXBB 5B24A 2NQBA 2CV5C 1BH8A 4H9PA 3KUYD 3AN2B 5GSUA 2Y2IA 1P3PB 3W98A 3KSYA 2Y2LA 5CPID 3REID 4WNNA 4X23D 3B0DB 2YFWB 3AZHD 3AV1D 1M1AA 3LJAA 4YM6D 5B31B 3EG5B 5DNNC 3REHA 1P3FA 5CP6D 4ZUXB 3REHC 2IO5B 3WA9A 1TZYB 3RELD 1P3KA 3UT9C 3AV1C 1P3KC 1P3MD 5E5AD 4HGAC 3WAAA 1EQZD 3FDDA 5AV9A 5CPJC 3MGRB 5GT0A 5GT0C 4G91B 3MNND 3MGQC 5BNXA 3W96C 4KGCA 4KGCC 2Y2KA 2FFFB 3KXBA 2XD1A 5AVBA 5AVBC 2CWEA 2HUEB 4M6BA 4XUJD 3NQJB 4R8PB 3AN2A 4E45A 5B32D 1P3PA 4LD9A 4LD9C 2BYKA 3AZJB 3B0CT 3MGPD 3B0BA 4E44A 2YFWA 3B6FB 1KX5C 5B2JD 3UTBD 1P3IB 3VH5A 5AVCB 5DNMD 3MGSA 5GT3C 3MGSC 3AYWD 4WU9D 3VH5W 4WU8A 3AV2C 4WU8C 1M19A 1P3OB 4ZBJB 3AZED 1M19C 1ID3D 3O62D 1P3AB 3B6GC 5C3IB 3AZIB 2F8NB 2G5IC 5GXQA 1M18A 3H0RC 5GXQC 1M18C 5JRGD 4J8VB 3NQJA 3AFAA 3WKJA 3WKJC 4KUDD 3AZMC 1KX4B 3REKC 3AZKB 1P3GD 3B6FA 3A1KA 4NE5A 3C1CB 2XD5A 3KWQD 2UWXA 3IP4C 5AVCA 5B0ZD 3A6NA 3A6NC 3C1BB 2HIOA 4NE6A 2HIOC 2F8NG 5AY8A 1KX3D 2FJ7C 5AY8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J B;  3W97 C;  3AZN A;  3X1T B;  1HQ3 A;  3AZN C;  2PYO A;  1P3O A;  1HQ3 C;  4NFT A;  3LEL B;  4Z5T B;  5F99 D;  1P3A A;  4QLC A;  4QLC C;  3AZI A;  2F8N A;  3X1S B;  3TU4 B;  4J8U B;  4J8W B;  4XZQ B;  1AOI D;  1H3O B;  3UTA B;  5B31 D;  4YS3 B;  4ZUX D;  5B1L A;  3V9R B;  5B1L C;  1TZY D;  5B2I D;  2CV5 B;  4H9P B;  5AV8 C;  1KX4 A;  3AZK A;  4Z66 A;  4Z66 C;  3C1C A;  4NE3 A;  3KUY C;  3MGR D;  4WNN B;  5CPI C;  5JA4 B;  3REI C;  4X23 C;  5DNN B;  3REH B;  3AZH C;  1F66 A;  1F66 C;  1A7W A;  1B6W A;  3WA9 B;  4R8P D;  4YM6 C;  4JJN D;  3UT9 B;  4Z5T A;  3AV1 B;  1P3K B;  5CP6 C;  4HGA B;  5KDM A;  3AZJ D;  3LZ0 D;  2RVQ D;  4J8U A;  4J8W A;  5E5A C;  4XZQ A;  3WTP D;  5GT0 B;  3LZ1 D;  1H3O A;  1P3I D;  3MGQ B;  5B33 D;  4KHA B;  4KGC B;  3REJ D;  3V9R A;  3MNN C;  2CV5 A;  5AVB B;  2F8N K;  4LD9 B;  5AV5 A;  2BYK B;  1S32 A;  5AV5 C;  4XUJ C;  1S32 C;  1KX5 B;  5JA4 A;  3MGP C;  3AZL A;  5DNN A;  5GT3 B;  3AZL C;  3MGS B;  4J8V D;  3UTB C;  5B1M D;  3AV2 B;  3UT9 A;  3AV1 A;  5DNM C;  4WU8 B;  4J8X A;  4DRB A;  5CPK D;  5BT1 C;  4J8X C;  1M19 B;  4WU9 C;  3B6G B;  4DRA A;  5CPJ A;  5B40 D;  3W99 D;  3AZE C;  1ID3 C;  1U35 D;  3X1U A;  3MGQ A;  5GXQ B;  3W96 A;  5B0Y A;  4KHA A;  3X1U C;  3C1B D;  5B0Y C;  1M18 B;  1HTA A;  4H9O A;  3X1T D;  3AFA B;  3WKJ B;  2LY8 A;  5JRG C;  1P34 D;  3LEL D;  3REK B;  2L5A A;  1KX5 A;  3X1S D;  3TU4 D;  1ZLA D;  1P3B A;  2NZD A;  1P3B C;  2NZD C;  5AV6 D;  3A6N B;  5GT3 A;  3UTA D;  5BO0 A;  2HIO B;  4YS3 D;  2FJ7 B;  5AY8 B;  3AZG A;  3AV2 A;  5B0Z C;  3AZG C;  3W97 B;  3MVD A;  5B24 D;  2NQB D;  3MVD C;  3AZN B;  1HQ3 B;  2PYO B;  1KX3 C;  4WV4 B;  5GSU D;  3B6G A;  3W98 D;  4QLC B;  4UUZ A;  5F99 C;  1M1A D;  3LJA D;  1TAF B;  1P3F D;  3REH D;  2ARO A;  5B1L B;  1AOI C;  2ARO C;  3WA9 D;  3AZM A;  1P3K D;  4G92 C;  3REK A;  5B2I C;  4Z66 B;  3WAA D;  5AV9 D;  3KUY B;  5GT0 D;  5CPI B;  3VH6 A;  3REI B;  4X23 B;  4KGC D;  4EO5 C;  3VH5 T;  3W97 A;  3KXB D;  1F66 B;  5AVB D;  3VH6 W;  4YM6 B;  1JFI A;  3AN2 D;  5CP6 B;  1P3P D;  4H9R A;  4LD9 D;  2YFV B;  5KDM B;  4JJN C;  5E5A B;  3LZ0 C;  3R45 A;  2RVQ C;  1TAF A;  3LZ1 C;  3WTP C;  3MGS D;  1P3L A;  2F8N H;  1P3L C;  3MNN B;  3X1V A;  5B33 C;  2BYM A;  5AV8 A;  3X1V C;  3AZF A;  4WU8 D;  3AZF C;  3REJ C;  1WWI A;  1M19 D;  4XUJ B;  5AV5 B;  3KUY A;  1S32 B;  5CPI A;  5GXQ D;  3MGP B;  3REI A;  4X23 A;  1M18 D;  4Z2M H;  5G49 B;  2JSS A;  3AZL B;  3AZH A;  3UTB B;  4YM6 A;  1B67 A;  5DNM B;  3AFA D;  5CP6 A;  3WKJ D;  4J8X B;  2YFV A;  4WU9 B;  3REL A;  5B1M C;  4H9Q B;  3REL C;  1F1E A;  1P3M A;  1P3M C;  5CHL B;  5E5A A;  5CPJ B;  5CPK C;  3B6F D;  1EQZ A;  1ID3 B;  1EQZ C;  3X1U B;  5AVC D;  3A6N D;  5B32 G;  5B0Y B;  3W99 C;  5B40 C;  3W96 B;  2HIO D;  3MNN A;  3NQU A;  4H9O B;  5AY8 D;  1U35 C;  2FJ7 D;  3AZN D;  5JRG B;  2PYO D;  1P3O D;  1R4V A;  4XUJ A;  1P3A D;  5B32 A;  4QLC D;  5B32 C;  1P34 C;  3AZI D;  2F8N D;  1BH9 B;  3MGP A;  1P3B B;  2NZD B;  1KU5 A;  5G49 A;  1WWS A;  5BO0 B;  5B2J A;  1ZLA C;  5B2J C;  3UTB A;  5AV6 C;  3AZG B;  5B1L D;  5DNM A;  3MVD B;  3AYW A;  3AYW C;  1KX3 B;  4WU9 A;  4H9Q A;  1KX4 D;  3AZK D;  5B24 C;  4Z66 D;  2NQB C;  3AZE A;  3C1C D;  4UUZ B;  3O62 A;  1ID3 A;  5F99 B;  5GSU C;  3W98 C;  3O62 C;  3B0C W;  1F66 D;  1AOI B;  2ARO B;  5JRG A;  1M1A C;  3LJA C;  3AZM B;  4G92 B;  1P3F C;  4Z5T D;  5B2I B;  3WA9 C;  4KUD A;  4KUD C;  4WZS B;  1BH9 A;  4J8U D;  4J8W D;  1P3G A;  4XZQ D;  1P3G C;  3WAA C;  5AV9 C;  3KWQ A;  3KWQ C;  4EO5 B;  5B0Z A;  2CV5 D;  4AWL C;  1KX3 A;  1ULY A;  1JFI B;  3KXB C;  4H9R B;  5AV5 D;  4JJN B;  1S32 D;  5B31 G;  5BNV B;  5F99 A;  3AN2 C;  1P3P C;  3LZ0 B;  3B0D C;  3R45 B;  3AZL D;  5DNN D;  3WTP B;  3LZ1 B;  1P3L B;  1AOI A;  5B31 A;  5B33 B;  3X1V B;  5B31 C;  3UT9 D;  4ZUX A;  2BYM B;  5AV8 B;  3AZF B;  5BT1 D;  4ZUX C;  5FUG B;  2IO5 C;  4J8X D;  1TZY A;  5B2I A;  3REJ B;  1TZY C;  4H9N B;  5CPJ D;  3X1U D;  3MGQ D;  3MGR A;  3W96 D;  5B0Y D;  3MGR C;  4G91 C;  3AZH B;  5B1M B;  2HUE C;  4R8P A;  4JJN A;  3REL B;  4R8P C;  5BNV A;  3AFA C;  1P3M B;  5CPK B;  1KX5 D;  3AZJ A;  3LZ0 A;  3AZJ C;  1P3B D;  1EQZ B;  2NZD D;  5B40 B;  3LZ1 A;  3WTP A;  3B6F C;  5GT3 D;  3W99 B;  1U35 B;  1P3I A;  3NQU B;  3AZG D;  5B33 A;  1P3I C;  5AVC C;  3AV2 D;  3MVD D;  3REJ A;  5FUG A;  4H9N A;  3B6G D;  4CSR B;  5B32 B;  1P34 B;  2PYO C;  1P3O C;  5BS7 A;  4ZBJ C;  5BS7 C;  1P3A C;  5C3I C;  3AZI C;  1ZLA B;  3VH6 T;  5B2J B;  4Z2M G;  5AV6 B;  2ARO D;  4J8V A;  3AYW B;  3AZM D;  4J8V C;  5B1M A;  3REK D;  4CAY B;  5B24 B;  2NQB B;  5CPK A;  1BH8 B;  3AZE B;  1KX4 C;  5GSU B;  3W98 B;  3O62 B;  3AZK C;  5B40 A;  3W99 A;  3C1C C;  1U35 A;  3C1B A;  3C1B C;  3W97 D;  1M1A B;  3LJA B;  1HQ3 D;  1P3F B;  1N1J A;  3X1T A;  4CSR A;  3X1T C;  1P34 A;  4H9S A;  3LEL A;  4KUD B;  4H9S C;  4Z5T C;  3LEL C;  1P3G B;  3WAA B;  1Q9C A;  3X1S A;  3TU4 A;  5AV9 B;  3X1S C;  3TU4 C;  1ZLA A;  3KWQ B;  4J8W C;  4J8U C;  4XZQ C;  5AV6 A;  1P3L D;  2FJ7 A;  5B0Z B;  3UTA A;  1BFM A;  3WTP E;  3UTA C;  4AWL B;  4YS3 A;  3X1V D;  5BNX B;  4YS3 C;  5AV8 D;  3AZF D;  4CAY A;  3KXB B;  5B24 A;  2NQB A;  2CV5 C;  1BH8 A;  4H9P A;  3KUY D;  3AN2 B;  5GSU A;  1P3P B;  3W98 A;  3KSY A;  5CPI D;  3REI D;  4WNN A;  4X23 D;  3B0D B;  2YFW B;  3AZH D;  3AV1 D;  1M1A A;  3LJA A;  4YM6 D;  5B31 B;  3REH A;  5DNN C;  1P3F A;  5CP6 D;  4ZUX B;  3REH C;  2IO5 B;  3WA9 A;  1TZY B;  3REL D;  1P3K A;  3UT9 C;  3AV1 C;  1P3K C;  1P3M D;  5E5A D;  4HGA C;  3WAA A;  1EQZ D;  5AV9 A;  5CPJ C;  3MGR B;  5GT0 A;  5GT0 C;  4G91 B;  3MNN D;  3MGQ C;  5BNX A;  3W96 C;  4KGC A;  4KGC C;  3KXB A;  5AVB A;  5AVB C;  2CWE A;  2HUE B;  4M6B A;  4XUJ D;  3NQJ B;  4R8P B;  3AN2 A;  4E45 A;  5B32 D;  1P3P A;  4LD9 A;  4LD9 C;  2BYK A;  3AZJ B;  3B0C T;  3MGP D;  3B0B A;  4E44 A;  2YFW A;  3B6F B;  1KX5 C;  5B2J D;  3UTB D;  1P3I B;  3VH5 A;  5AVC B;  5DNM D;  3MGS A;  5GT3 C;  3MGS C;  3AYW D;  4WU9 D;  3VH5 W;  4WU8 A;  3AV2 C;  4WU8 C;  1M19 A;  1P3O B;  4ZBJ B;  3AZE D;  1M19 C;  1ID3 D;  3O62 D;  1P3A B;  3B6G C;  5C3I B;  3AZI B;  2F8N B;  5GXQ A;  1M18 A;  5GXQ C;  1M18 C;  5JRG D;  4J8V B;  3NQJ A;  3AFA A;  3WKJ A;  3WKJ C;  4KUD D;  3AZM C;  1KX4 B;  3REK C;  3AZK B;  1P3G D;  3B6F A;  4NE5 A;  3C1C B;  3KWQ D;  5AVC A;  5B0Z D;  3A6N A;  3A6N C;  3C1B B;  2HIO A;  4NE6 A;  2HIO C;  2F8N G;  5AY8 A;  1KX3 D;  2FJ7 C;  5AY8 C; 
#chains in the Genus database with same CATH topology
 1N1J B;  3W97 C;  2DQN C;  3AZN A;  3X1T B;  1HQ3 A;  3AZN C;  2PYO A;  1P3O A;  1HQ3 C;  4NFT A;  3LEL B;  4Z5T B;  3H0M C;  5F99 D;  1P3A A;  4QLC A;  4QLC C;  3AZI A;  1T3U A;  2F8N A;  3X1S B;  3TU4 B;  4J8U B;  4J8W B;  4XZQ B;  1AOI D;  1H3O B;  3UTA B;  5B31 D;  4YS3 B;  2VQR A;  4ZUX D;  5B1L A;  3V9R B;  5B1L C;  1TZY D;  5B2I D;  2CV5 B;  2ZM5 A;  4H9P B;  5AV8 C;  1KX4 A;  3AZK A;  4Z66 A;  4Z66 C;  3C1C A;  4NE3 A;  1W2E A;  3MGR D;  3KUY C;  4WNN B;  5CPI C;  5JA4 B;  3REI C;  4X23 C;  5DNN B;  3REH B;  3AZH C;  1F66 A;  1F66 C;  1A7W A;  1B6W A;  3WA9 B;  4R8P D;  4YM6 C;  3EPK A;  4JJN D;  4Z5T A;  3UT9 B;  3AV1 B;  1P3K B;  5CP6 C;  4HGA B;  5KDM A;  3AZJ D;  3LZ0 D;  2RVQ D;  4J8U A;  4J8W A;  5E5A C;  4XZQ A;  2BG1 A;  5GT0 B;  3WTP D;  3LZ1 D;  1H3O A;  1P3I D;  3MGQ B;  5B33 D;  4KHA B;  4KGC B;  3REJ D;  3V9R A;  3MNN C;  2CV5 A;  5AVB B;  2F8N K;  4LD9 B;  5AV5 A;  2BYK B;  1S32 A;  5AV5 C;  4XUJ C;  1S32 C;  1KX5 B;  5JA4 A;  3MGP C;  2Y2M A;  3AZL A;  2ZY4 A;  3H0L C;  5DNN A;  5GT3 B;  3AZL C;  3MGS B;  4J8V D;  3UTB C;  5B1M D;  3AV2 B;  3UT9 A;  3AV1 A;  5DNM C;  4WU8 B;  4J8X A;  4DRB A;  5CPK D;  5BT1 C;  4J8X C;  1M19 B;  4WU9 C;  3B6G B;  4DRA A;  5CPJ A;  5B40 D;  3W99 D;  3AZE C;  1ID3 C;  1U35 D;  3X1U A;  3KFU G;  3MGQ A;  5GXQ B;  3W96 A;  5B0Y A;  4KHA A;  3X1U C;  3C1B D;  5B0Y C;  1M18 B;  1HTA A;  4H9O A;  3X1T D;  3AFA B;  3WKJ B;  2LY8 A;  5JRG C;  1P34 D;  3LEL D;  3REK B;  2L5A A;  1KX5 A;  3X1S D;  3TU4 D;  3A1I A;  1ZLA D;  1P3B A;  2NZD A;  1P3B C;  2NZD C;  5AV6 D;  3A6N B;  5GT3 A;  3UTA D;  5BO0 A;  2HIO B;  4YS3 D;  2FJ7 B;  5AY8 B;  3AZG A;  3AV2 A;  5B0Z C;  3AZG C;  3W97 B;  3MVD A;  5B24 D;  2NQB D;  3MVD C;  3AZN B;  1HQ3 B;  2PYO B;  1KX3 C;  4WV4 B;  5GSU D;  3B6G A;  3W98 D;  3AL0 C;  4QLC B;  4UUZ A;  5F99 C;  1M1A D;  3LJA D;  1TAF B;  1P3F D;  3REH D;  2ARO A;  5B1L B;  1AOI C;  2ARO C;  3WA9 D;  3AZM A;  1P3K D;  4G92 C;  3REK A;  5B2I C;  4DQY B;  4Z66 B;  3WAA D;  5AV9 D;  3KUY B;  5GT0 D;  2Y2J A;  5CPI B;  3VH6 A;  3REI B;  4X23 B;  4KGC D;  4EO5 C;  3VH5 T;  3W97 A;  3KXB D;  1F66 B;  5AVB D;  3VH6 W;  4YM6 B;  1JFI A;  3AN2 D;  5CP6 B;  1P3P D;  4H9R A;  4LD9 D;  2YFV B;  5KDM B;  4JJN C;  2F2A C;  5E5A B;  3LZ0 C;  2G5H C;  3R45 A;  2RVQ C;  1TAF A;  3LZ1 C;  2ZY5 A;  3WTP C;  3MGS D;  1P3L A;  2F8N H;  1P3L C;  3MNN B;  3X1V A;  5B33 C;  2BYM A;  5AV8 A;  3X1V C;  3AZF A;  4WU8 D;  3AZF C;  3REJ C;  1WWI A;  1M19 D;  4XUJ B;  5AV5 B;  3KUY A;  1S32 B;  5CPI A;  5GXQ D;  3MGP B;  3REI A;  4X23 A;  1M18 D;  4Z2M H;  5G49 B;  2JSS A;  3AZL B;  3AZH A;  2Y2H A;  3UTB B;  4YM6 A;  1B67 A;  5DNM B;  3AFA D;  5CP6 A;  3WKJ D;  4J8X B;  2YFV A;  4WU9 B;  3REL A;  5B1M C;  4H9Q B;  3REL C;  1F1E A;  1P3M A;  1P3M C;  5CHL B;  5E5A A;  5CPJ B;  5CPK C;  3B6F D;  2Y2N A;  1EQZ A;  1ID3 B;  1EQZ C;  3X1U B;  5AVC D;  3A6N D;  5B32 G;  5B0Y B;  3W99 C;  5B40 C;  3W96 B;  2HIO D;  3MNN A;  3NQU A;  4H9O B;  5AY8 D;  1U35 C;  2FJ7 D;  3AZN D;  4WJ3 C;  5JRG B;  2PYO D;  1P3O D;  1R4V A;  4XUJ A;  1P3A D;  5B32 A;  4QLC D;  5B32 C;  1P34 C;  3AZI D;  2F8N D;  1BH9 B;  3MGP A;  1P3B B;  2NZD B;  1KU5 A;  5G49 A;  1WWS A;  5BO0 B;  5B2J A;  1ZLA C;  2JCH A;  5B2J C;  3UTB A;  5AV6 C;  3AZG B;  2Y2O A;  5B1L D;  5DNM A;  3MVD B;  3AYW A;  3AYW C;  1KX3 B;  4WU9 A;  4H9Q A;  1KX4 D;  3AZK D;  3EPJ A;  5B24 C;  4Z66 D;  2NQB C;  3AZE A;  3C1C D;  4UUZ B;  3O62 A;  1ID3 A;  5F99 B;  5GSU C;  3W98 C;  3O62 C;  3B0C W;  1F66 D;  1AOI B;  2ARO B;  5JRG A;  3F6T A;  3LJA C;  1M1A C;  3AZM B;  4G92 B;  1P3F C;  4Z5T D;  5B2I B;  3WA9 C;  4KUD A;  4KUD C;  4WZS B;  1BH9 A;  2Y2G A;  1Z2C B;  4J8U D;  4J8W D;  2Y2Q A;  1P3G A;  4XZQ D;  1P3G C;  3WAA C;  5AV9 C;  3KWQ A;  3KWQ C;  4EO5 B;  5B0Z A;  2CV5 D;  4AWL C;  1KX3 A;  1ULY A;  2RIQ A;  1JFI B;  3KXB C;  4H9R B;  5AV5 D;  4JJN B;  1S32 D;  5B31 G;  5BNV B;  5F99 A;  3AN2 C;  1P3P C;  3LZ0 B;  3B0D C;  2ZY3 A;  3P5J B;  3R45 B;  5DNN D;  3WTP B;  3LZ1 B;  3AZL D;  1P3L B;  1AOI A;  3EPL A;  3EPH A;  5B31 A;  5B33 B;  3X1V B;  5B31 C;  3UT9 D;  4ZUX A;  2BYM B;  5AV8 B;  3AZF B;  5BT1 D;  4ZUX C;  5FUG B;  2IO5 C;  4J8X D;  1TZY A;  5B2I A;  3REJ B;  1TZY C;  4H9N B;  5CPJ D;  2DF4 C;  3X1U D;  3MGQ D;  3MGR A;  3W96 D;  5B0Y D;  3MGR C;  4G91 C;  3AZH B;  5B1M B;  2HUE C;  4R8P A;  4JJN A;  3REL B;  4R8P C;  5BNV A;  3AFA C;  1P3M B;  5CPK B;  1KX5 D;  3AZJ A;  3LZ0 A;  3AZJ C;  1P3B D;  1EQZ B;  2NZD D;  5B40 B;  3LZ1 A;  3WTP A;  3B6F C;  5GT3 D;  3W99 B;  1U35 B;  1P3I A;  3NQU B;  3AZG D;  5B33 A;  1P3I C;  5AVC C;  3AV2 D;  3MVD D;  3REJ A;  5FUG A;  4H9N A;  3B6G D;  4CSR B;  5B32 B;  1P34 B;  2PYO C;  4UPK A;  1P3O C;  5BS7 A;  4ZBJ C;  5BS7 C;  1P3A C;  5C3I C;  3AZI C;  1ZLA B;  2W8S A;  3VH6 T;  5B2J B;  4Z2M G;  5AV6 B;  2ARO D;  4J8V A;  3AYW B;  3AZM D;  4J8V C;  5B1M A;  3REK D;  4CAY B;  5B24 B;  2NQB B;  5CPK A;  1BH8 B;  3AZE B;  1KX4 C;  5GSU B;  3W98 B;  3O62 B;  3AZK C;  5B40 A;  3W99 A;  3C1C C;  1U35 A;  2ZY2 A;  3C1B A;  3C1B C;  3W97 D;  1M1A B;  3LJA B;  1HQ3 D;  1P3F B;  1N1J A;  3X1T A;  4CSR A;  3X1T C;  1P34 A;  2J8P A;  4H9S A;  3LEL A;  4KUD B;  2JE5 A;  4H9S C;  4Z5T C;  3LEL C;  2Y2P A;  1P3G B;  3WAA B;  1Q9C A;  3X1S A;  3TU4 A;  5AV9 B;  3X1S C;  3TU4 C;  1ZLA A;  1PZR A;  3KWQ B;  4J8W C;  4J8U C;  4XZQ C;  5AV6 A;  1P3L D;  2FJ7 A;  5B0Z B;  3UTA A;  1BFM A;  3WTP E;  3UTA C;  4AWL B;  4YS3 A;  3X1V D;  5BNX B;  4YS3 C;  5AV8 D;  3AZF D;  4CAY A;  3KXB B;  5B24 A;  2NQB A;  2CV5 C;  1BH8 A;  4H9P A;  3KUY D;  3AN2 B;  5GSU A;  2Y2I A;  1P3P B;  3W98 A;  3KSY A;  2Y2L A;  5CPI D;  3REI D;  4WNN A;  4X23 D;  3B0D B;  2YFW B;  3AZH D;  3AV1 D;  1M1A A;  3LJA A;  4YM6 D;  5B31 B;  3EG5 B;  5DNN C;  3REH A;  1P3F A;  5CP6 D;  4ZUX B;  3REH C;  2IO5 B;  3WA9 A;  1TZY B;  3REL D;  1P3K A;  3UT9 C;  3AV1 C;  1P3K C;  1P3M D;  5E5A D;  4HGA C;  3WAA A;  1EQZ D;  3FDD A;  5AV9 A;  5CPJ C;  3MGR B;  5GT0 A;  5GT0 C;  4G91 B;  3MNN D;  3MGQ C;  5BNX A;  3W96 C;  4KGC A;  4KGC C;  2Y2K A;  2FFF B;  3KXB A;  2XD1 A;  5AVB A;  5AVB C;  2CWE A;  2HUE B;  4M6B A;  4XUJ D;  3NQJ B;  4R8P B;  3AN2 A;  4E45 A;  5B32 D;  1P3P A;  4LD9 A;  4LD9 C;  2BYK A;  3AZJ B;  3B0C T;  3MGP D;  3B0B A;  4E44 A;  2YFW A;  3B6F B;  1KX5 C;  5B2J D;  3UTB D;  1P3I B;  3VH5 A;  5AVC B;  5DNM D;  3MGS A;  5GT3 C;  3MGS C;  3AYW D;  4WU9 D;  3VH5 W;  4WU8 A;  3AV2 C;  4WU8 C;  1M19 A;  1P3O B;  4ZBJ B;  3AZE D;  1M19 C;  1ID3 D;  3O62 D;  1P3A B;  3B6G C;  5C3I B;  3AZI B;  2F8N B;  2G5I C;  5GXQ A;  1M18 A;  3H0R C;  5GXQ C;  1M18 C;  5JRG D;  4J8V B;  3NQJ A;  3AFA A;  3WKJ A;  3WKJ C;  4KUD D;  3AZM C;  1KX4 B;  3REK C;  3AZK B;  1P3G D;  3B6F A;  3A1K A;  4NE5 A;  3C1C B;  2XD5 A;  3KWQ D;  2UWX A;  3IP4 C;  5AVC A;  5B0Z D;  3A6N A;  3A6N C;  3C1B B;  2HIO A;  4NE6 A;  2HIO C;  2F8N G;  5AY8 A;  1KX3 D;  2FJ7 C;  5AY8 C; 
#chains in the Genus database with same CATH homology
 1N1J B;  3W97 C;  2DQN C;  3AZN A;  3X1T B;  1HQ3 A;  3AZN C;  2PYO A;  1P3O A;  1HQ3 C;  4NFT A;  3LEL B;  4Z5T B;  3H0M C;  5F99 D;  1P3A A;  4QLC A;  4QLC C;  3AZI A;  1T3U A;  2F8N A;  3X1S B;  3TU4 B;  4J8U B;  4J8W B;  4XZQ B;  1AOI D;  1H3O B;  3UTA B;  5B31 D;  4YS3 B;  2VQR A;  4ZUX D;  5B1L A;  3V9R B;  5B1L C;  1TZY D;  5B2I D;  2CV5 B;  2ZM5 A;  4H9P B;  5AV8 C;  1KX4 A;  3AZK A;  4Z66 A;  4Z66 C;  3C1C A;  4NE3 A;  1W2E A;  3MGR D;  3KUY C;  4WNN B;  5CPI C;  5JA4 B;  3REI C;  4X23 C;  5DNN B;  3REH B;  3AZH C;  1F66 A;  1F66 C;  1A7W A;  1B6W A;  3WA9 B;  4R8P D;  4YM6 C;  3EPK A;  4JJN D;  4Z5T A;  3UT9 B;  3AV1 B;  1P3K B;  5CP6 C;  4HGA B;  5KDM A;  3AZJ D;  3LZ0 D;  2RVQ D;  4J8U A;  4J8W A;  5E5A C;  4XZQ A;  2BG1 A;  5GT0 B;  3WTP D;  3LZ1 D;  1H3O A;  1P3I D;  3MGQ B;  5B33 D;  4KHA B;  4KGC B;  3REJ D;  3V9R A;  3MNN C;  2CV5 A;  5AVB B;  2F8N K;  4LD9 B;  5AV5 A;  2BYK B;  1S32 A;  5AV5 C;  4XUJ C;  1S32 C;  1KX5 B;  5JA4 A;  3MGP C;  2Y2M A;  3AZL A;  2ZY4 A;  3H0L C;  5DNN A;  5GT3 B;  3AZL C;  3MGS B;  4J8V D;  3UTB C;  5B1M D;  3AV2 B;  3UT9 A;  3AV1 A;  5DNM C;  4WU8 B;  4J8X A;  4DRB A;  5CPK D;  5BT1 C;  4J8X C;  1M19 B;  4WU9 C;  3B6G B;  4DRA A;  5CPJ A;  5B40 D;  3W99 D;  3AZE C;  1ID3 C;  1U35 D;  3X1U A;  3KFU G;  3MGQ A;  5GXQ B;  3W96 A;  5B0Y A;  4KHA A;  3X1U C;  3C1B D;  5B0Y C;  1M18 B;  1HTA A;  4H9O A;  3X1T D;  3AFA B;  3WKJ B;  2LY8 A;  5JRG C;  1P34 D;  3LEL D;  3REK B;  2L5A A;  1KX5 A;  3X1S D;  3TU4 D;  3A1I A;  1ZLA D;  1P3B A;  2NZD A;  1P3B C;  2NZD C;  5AV6 D;  3A6N B;  5GT3 A;  3UTA D;  5BO0 A;  2HIO B;  4YS3 D;  2FJ7 B;  5AY8 B;  3AZG A;  3AV2 A;  5B0Z C;  3AZG C;  3W97 B;  3MVD A;  5B24 D;  2NQB D;  3MVD C;  3AZN B;  1HQ3 B;  2PYO B;  1KX3 C;  4WV4 B;  5GSU D;  3B6G A;  3W98 D;  3AL0 C;  4QLC B;  4UUZ A;  5F99 C;  1M1A D;  3LJA D;  1TAF B;  1P3F D;  3REH D;  2ARO A;  5B1L B;  1AOI C;  2ARO C;  3WA9 D;  3AZM A;  1P3K D;  4G92 C;  3REK A;  5B2I C;  4DQY B;  4Z66 B;  3WAA D;  5AV9 D;  3KUY B;  5GT0 D;  2Y2J A;  5CPI B;  3VH6 A;  3REI B;  4X23 B;  4KGC D;  4EO5 C;  3VH5 T;  3W97 A;  3KXB D;  1F66 B;  5AVB D;  3VH6 W;  4YM6 B;  1JFI A;  3AN2 D;  5CP6 B;  1P3P D;  4H9R A;  4LD9 D;  2YFV B;  5KDM B;  4JJN C;  2F2A C;  5E5A B;  3LZ0 C;  2G5H C;  3R45 A;  2RVQ C;  1TAF A;  3LZ1 C;  2ZY5 A;  3WTP C;  3MGS D;  1P3L A;  2F8N H;  1P3L C;  3MNN B;  3X1V A;  5B33 C;  2BYM A;  5AV8 A;  3X1V C;  3AZF A;  4WU8 D;  3AZF C;  3REJ C;  1WWI A;  1M19 D;  4XUJ B;  5AV5 B;  3KUY A;  1S32 B;  5CPI A;  5GXQ D;  3MGP B;  3REI A;  4X23 A;  1M18 D;  4Z2M H;  5G49 B;  2JSS A;  3AZL B;  3AZH A;  2Y2H A;  3UTB B;  4YM6 A;  1B67 A;  5DNM B;  3AFA D;  5CP6 A;  3WKJ D;  4J8X B;  2YFV A;  4WU9 B;  3REL A;  5B1M C;  4H9Q B;  3REL C;  1F1E A;  1P3M A;  1P3M C;  5CHL B;  5E5A A;  5CPJ B;  5CPK C;  3B6F D;  2Y2N A;  1EQZ A;  1ID3 B;  1EQZ C;  3X1U B;  5AVC D;  3A6N D;  5B32 G;  5B0Y B;  3W99 C;  5B40 C;  3W96 B;  2HIO D;  3MNN A;  3NQU A;  4H9O B;  5AY8 D;  1U35 C;  2FJ7 D;  3AZN D;  4WJ3 C;  5JRG B;  2PYO D;  1P3O D;  1R4V A;  4XUJ A;  1P3A D;  5B32 A;  4QLC D;  5B32 C;  1P34 C;  3AZI D;  2F8N D;  1BH9 B;  3MGP A;  1P3B B;  2NZD B;  1KU5 A;  5G49 A;  1WWS A;  5BO0 B;  5B2J A;  1ZLA C;  2JCH A;  5B2J C;  3UTB A;  5AV6 C;  3AZG B;  2Y2O A;  5B1L D;  5DNM A;  3MVD B;  3AYW A;  3AYW C;  1KX3 B;  4WU9 A;  4H9Q A;  1KX4 D;  3AZK D;  3EPJ A;  5B24 C;  4Z66 D;  2NQB C;  3AZE A;  3C1C D;  4UUZ B;  3O62 A;  1ID3 A;  5F99 B;  5GSU C;  3W98 C;  3O62 C;  3B0C W;  1F66 D;  1AOI B;  2ARO B;  5JRG A;  3F6T A;  3LJA C;  1M1A C;  3AZM B;  4G92 B;  1P3F C;  4Z5T D;  5B2I B;  3WA9 C;  4KUD A;  4KUD C;  4WZS B;  1BH9 A;  2Y2G A;  1Z2C B;  4J8U D;  4J8W D;  2Y2Q A;  1P3G A;  4XZQ D;  1P3G C;  3WAA C;  5AV9 C;  3KWQ A;  3KWQ C;  4EO5 B;  5B0Z A;  2CV5 D;  4AWL C;  1KX3 A;  1ULY A;  2RIQ A;  1JFI B;  3KXB C;  4H9R B;  5AV5 D;  4JJN B;  1S32 D;  5B31 G;  5BNV B;  5F99 A;  3AN2 C;  1P3P C;  3LZ0 B;  3B0D C;  2ZY3 A;  3P5J B;  3R45 B;  5DNN D;  3WTP B;  3LZ1 B;  3AZL D;  1P3L B;  1AOI A;  3EPL A;  3EPH A;  5B31 A;  5B33 B;  3X1V B;  5B31 C;  3UT9 D;  4ZUX A;  2BYM B;  5AV8 B;  3AZF B;  5BT1 D;  4ZUX C;  5FUG B;  2IO5 C;  4J8X D;  1TZY A;  5B2I A;  3REJ B;  1TZY C;  4H9N B;  5CPJ D;  2DF4 C;  3X1U D;  3MGQ D;  3MGR A;  3W96 D;  5B0Y D;  3MGR C;  4G91 C;  3AZH B;  5B1M B;  2HUE C;  4R8P A;  4JJN A;  3REL B;  4R8P C;  5BNV A;  3AFA C;  1P3M B;  5CPK B;  1KX5 D;  3AZJ A;  3LZ0 A;  3AZJ C;  1P3B D;  1EQZ B;  2NZD D;  5B40 B;  3LZ1 A;  3WTP A;  3B6F C;  5GT3 D;  3W99 B;  1U35 B;  1P3I A;  3NQU B;  3AZG D;  5B33 A;  1P3I C;  5AVC C;  3AV2 D;  3MVD D;  3REJ A;  5FUG A;  4H9N A;  3B6G D;  4CSR B;  5B32 B;  1P34 B;  2PYO C;  4UPK A;  1P3O C;  5BS7 A;  4ZBJ C;  5BS7 C;  1P3A C;  5C3I C;  3AZI C;  1ZLA B;  2W8S A;  3VH6 T;  5B2J B;  4Z2M G;  5AV6 B;  2ARO D;  4J8V A;  3AYW B;  3AZM D;  4J8V C;  5B1M A;  3REK D;  4CAY B;  5B24 B;  2NQB B;  5CPK A;  1BH8 B;  3AZE B;  1KX4 C;  5GSU B;  3W98 B;  3O62 B;  3AZK C;  5B40 A;  3W99 A;  3C1C C;  1U35 A;  2ZY2 A;  3C1B A;  3C1B C;  3W97 D;  1M1A B;  3LJA B;  1HQ3 D;  1P3F B;  1N1J A;  3X1T A;  4CSR A;  3X1T C;  1P34 A;  2J8P A;  4H9S A;  3LEL A;  4KUD B;  2JE5 A;  4H9S C;  4Z5T C;  3LEL C;  2Y2P A;  1P3G B;  3WAA B;  1Q9C A;  3X1S A;  3TU4 A;  5AV9 B;  3X1S C;  3TU4 C;  1ZLA A;  1PZR A;  3KWQ B;  4J8W C;  4J8U C;  4XZQ C;  5AV6 A;  1P3L D;  2FJ7 A;  5B0Z B;  3UTA A;  1BFM A;  3WTP E;  3UTA C;  4AWL B;  4YS3 A;  3X1V D;  5BNX B;  4YS3 C;  5AV8 D;  3AZF D;  4CAY A;  3KXB B;  5B24 A;  2NQB A;  2CV5 C;  1BH8 A;  4H9P A;  3KUY D;  3AN2 B;  5GSU A;  2Y2I A;  1P3P B;  3W98 A;  3KSY A;  2Y2L A;  5CPI D;  3REI D;  4WNN A;  4X23 D;  3B0D B;  2YFW B;  3AZH D;  3AV1 D;  1M1A A;  3LJA A;  4YM6 D;  5B31 B;  3EG5 B;  5DNN C;  3REH A;  1P3F A;  5CP6 D;  4ZUX B;  3REH C;  2IO5 B;  3WA9 A;  1TZY B;  3REL D;  1P3K A;  3UT9 C;  3AV1 C;  1P3K C;  1P3M D;  5E5A D;  4HGA C;  3WAA A;  1EQZ D;  3FDD A;  5AV9 A;  5CPJ C;  3MGR B;  5GT0 A;  5GT0 C;  4G91 B;  3MNN D;  3MGQ C;  5BNX A;  3W96 C;  4KGC A;  4KGC C;  2Y2K A;  2FFF B;  3KXB A;  2XD1 A;  5AVB A;  5AVB C;  2CWE A;  2HUE B;  4M6B A;  4XUJ D;  3NQJ B;  4R8P B;  3AN2 A;  4E45 A;  5B32 D;  1P3P A;  4LD9 A;  4LD9 C;  2BYK A;  3AZJ B;  3B0C T;  3MGP D;  3B0B A;  4E44 A;  2YFW A;  3B6F B;  1KX5 C;  5B2J D;  3UTB D;  1P3I B;  3VH5 A;  5AVC B;  5DNM D;  3MGS A;  5GT3 C;  3MGS C;  3AYW D;  4WU9 D;  3VH5 W;  4WU8 A;  3AV2 C;  4WU8 C;  1M19 A;  1P3O B;  4ZBJ B;  3AZE D;  1M19 C;  1ID3 D;  3O62 D;  1P3A B;  3B6G C;  5C3I B;  3AZI B;  2F8N B;  2G5I C;  5GXQ A;  1M18 A;  3H0R C;  5GXQ C;  1M18 C;  5JRG D;  4J8V B;  3NQJ A;  3AFA A;  3WKJ A;  3WKJ C;  4KUD D;  3AZM C;  1KX4 B;  3REK C;  3AZK B;  1P3G D;  3B6F A;  3A1K A;  4NE5 A;  3C1C B;  2XD5 A;  3KWQ D;  2UWX A;  3IP4 C;  5AVC A;  5B0Z D;  3A6N A;  3A6N C;  3C1B B;  2HIO A;  4NE6 A;  2HIO C;  2F8N G;  5AY8 A;  1KX3 D;  2FJ7 C;  5AY8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...