1P3GD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gD00
3AN2C 2HUEB 5AV8B 5B0YB 1JFIB 4R8PA 3UT9D 3X1SB 4UUZB 3O62B 1M18B 1P3PB 4KUDC 1P3BD 1ZLAB 5GT3C 3X1VC 3A6ND 4J8WA 4J8XB 2CV5D 4ZBJC 3AZND 4J8UD 1P3MD 3W96D 4XZQA 5C3IB 5B2JB 3WAAC 3W98A 5CPID 1EQZD 5AV8A 5B0YA 5G49B 1JFIA 2HIOB 3AZIA 1KX4D 3X1SA 4UUZA 1P3GB 4X23D 4E44A 3O62A 5B1MC 3WKJA 3NQJB 1M18A 2FJ7D 5B40C 1P3PA 2F8ND 4KGCD 1ZLAA 1F66A 5GT3B 3UTBD 4J8XA 5E5AD 4CAYB 5B2JA 2NZDA 3LZ1D 3KWQD 1KX3C 3VH6W 1KX5D 5G49A 2HIOA 5AV5B 3X1UB 4ZUXB 4YM6D 3AZLD 2PYOC 2JSSA 3NQUB 1P3GA 3MNNB 3MGQD 5CP6B 3C1BD 3NQJA 5BT1D 3MGSB 1AOIC 3W97C 2NQBC 5BNVA 5GT3A 3UT9B 1M19D 5DNMB 5F99C 5GSUC 3AV1D 1P34D 1HQ3B 4CAYA 4H9NB 4JJNC 3C1CD 3WTPD 5B31D 5AV5A 3KUYC 4R8PD 4ZUXA 4XUJC 2CV5B 3UTAC 1N1JA 4G92C 3NQUA 1P3MB 2PYOB 3MGSA 3B0CT 3AZJD 1S32B 1P3FD 5B40A 4NE5A 3X1TD 3UT9A 5DNMA 3LZ0B 3B0BA 1HQ3A 5F99B 5GSUB 4H9NA 4NFTA 4X23B 3LELC 3AZMB 4XZQD 5AY8B 2FJ7B 5AV8D 5B0YD 1M1AC 1P3ID 5JRGC 3AZID 1KX3A 3UTBB 2AROC 5E5AB 3O62D 2PYOA 5AV9C 1M18D 3WKJD 3LZ1B 3VH5T 1P3PD 1BH9B 1S32A 1KX5B 1ZLAD 3B6GC 1F66D 3W97A 1AOIA 1TZYB 3LJAC 3LZ0A 4J8XD 5F99A 5GSUA 3AZMA 3C1BB 5B2JD 5AY8A 2NZDD 2BYMB 4Z2MG 1U35C 2HIOD 5BS7A 3MVDC 3KUYA 4H9QB 4XUJA 1P3GD 5B0ZC 3LZ1A 4AWLC 3WA9C 5FUGB 3WTPB 5B31B 1BH9A 1KX5A 2BYKA 5B1LC 1P3LC 1TZYA 5GT3D 3MGRB 4KHAB 3AZFC 1BH8A 3AZJB 1P3FB 2BYMA 3X1TB 1P3KB 2RVQC 5AV5D 5CPKB 1U35B 4ZUXD 4NE6A 4NE3A 4J8VB 3V9RB 2AROA 2YFWA 4XZQB 3MVDB 5FUGA 3WTPA 5B31A 3MGSD 1P3IB 3AZIB 5B40D 3MGRA 1R4VA 5B1LB 5DNMD 5GT0B 4KHAA 1HQ3D 3REHC 4WU9B 3WKJB 4WU8C 3AZJA 1F66B 1P3FA 1TAFB 3X1TA 1P3KA 5AVCB 1KX3D 5CPKA 1U35A 4J8VA 3B0DC 3V9RA 3VH5A 2PYOD 3MVDA 2NZDB 5B24B 1S32D 3AN2B 1P3IA 3WA9A 1AOID 3W97D 5B1LA 5GT0A 3LZ0D 1P3LA 5F99D 5GSUD 3AZMD 4WU9A 3AZFA 5AY8D 4JJND 5AV6C 3B6FC 1TAFA 4KUDB 5BNVB 5AVCA 3X1VB 4LD9C 3KUYD 4XUJD 5CPJC 3W99C 1BFMA 4ZBJB 4YS3C 5B32G 3B0DB 3AFAC 3UTAD 5B24A 2YFVB 3WAAB 3AN2A 5AVBC 1TZYD 5CHLB 1A7WA 1N1JB 4Z2MH 4Z66C 5B1MB 3TU4C 1WWSA 5B40B 4KUDA 1P3AC 4HGAC 3B6FB 3X1VA 5GXQC 2AROD 3AZEC 2YFVA 3WAAA 1KX3B 3B6GD 3MGRD 5AVBB 4J8UC 3W96C 5CPIC 1EQZC 5B1MA 5B33C 1AOIB 3W97B 2NQBB 1P3KD 3B6FA 5CPKD 1U35D 1P3AB 4J8VD 3MVDD 4KGCC 4JJNB 5CPJA 4DRAA 4YS3A 3WA9D 3AZKC 5B1LD 3VH6T 5AVBA 5GT0D 1P3LD 3KUYB 4XUJB 4WU9D 4G92B 3UTAB 1ID3C 3AZFD 5B32C 4Z66A 2BYKB 5DNNC 2NQBA 5AVCD 3RELC 3MGQC 1P3AA 5BO0B 1BH8B 2LY8A 5GXQA 3LELB 4JJNA 5B24D 3AN2D 1M1AB 5JRGB 3MGPC 3AZKB 3REIC 1P34C 3C1CC 2AROB 4QLCC 5BNXB 2YFWB 3UTAA 3AZGC 3REHD 1ID3B 5AV9B 5B32B 1H3OA 4R8PC 3B6GB 4KUDD 3X1VD 2IO5C 3LJAB 3RELB 3AZHC 5BO0A 4E45A 3LELA 1KU5A 3WAAD 4J8WC 4G91C 1M1AA 5JRGA 3AZKA 3MGPB 5BNXA 3W98C 4QLCB 2HUEC 5AV8C 5B0YC 1ID3A 5B1MD 5AV9A 5B0ZB 5B32A 4AWLB 3WA9B 5AV6D 3B6GA 4EO5C 1F1EA 3B6FD 1P3LB 3X1SC 5DNNA 3REJC 3LJAA 3RELA 4Z5TC 3KSYA 3AZFB 4WV4B 1P3PC 5CPJD 1ZLAC 3W99D 5B2IC 4YS3D 3AFAD 3VH6A 5KDMB 4J8XC 5AVBD 1P3OC 5C3IC 5B2JC 3MGPA 4QLCA 4Z66D 3AZGA 5B0ZA 2HIOC 2NQBD 3TU4D 4EO5B 1P3GC 2L5AA 1P3AD 2F8NK 2F8NG 3REJB 3AZHA 5GXQD 4Z5TB 3REHB 3AV2C 4WU8B 5KDMA 3AZED 5B2IB 4H9OB 1P3OB 4WZSB 4WNNB 4H9RB 5AV5C 3X1UC 4ZUXC 3AYWC 4CSRB 5B33D 3REKC 3KXBC 3MNNC 5CP6C 3B0CW 3REJA 4Z5TA 3MGSC 3LELD 3REHA 4WU8A 5AV6B 3UT9C 5B2IA 5DNMC 3AV2B 1M1AD 5JRGD 3AZKD 1HQ3C 4H9OA 4LD9B 1P3OA 5B31G 1P3BC 5CPJB 3W99B 1ID3D 4WNNA 4YS3B 3AFAB 5AV9D 4H9RA 3A6NC 1ULYA 4M6BA 5B32D 2CV5C 4CSRA 3AZNC 3AYWB 4H9PB 5DNND 1P3MC 3LJAD 3REKB 3RELD 3VH5W 3KXBB 4Z66B 1S32C 4H9SC 5AV6A 1KX4C 3TU4B 3AV2A 3LZ0C 2CWEA 4X23C 4HGAB 3AZMC 3MGPD 4LD9A 5AY8C 5GXQB 3REID 2FJ7C 4QLCD 3AZGD 3W99A 3AFAA 5B0ZD 1P3BB 3AZEB 5BS7C 3UTBC 3A6NB 3X1UA 5E5AC 3AYWA 4H9PA 3REKA 3AZNB 4J8UB 3KXBA 3LZ1C 3MNNA 3KWQC 4DRBA 5CP6A 3AZHD 1KX5C 3W96B 5CPIB 1EQZB 1H3OB 1TZYC 3AZLC 4YM6C 3TU4A 5B33B 4J8WD 1KX4B 2RVQD 1B6WA 3C1BC 1WWIA 5BT1C 3W98D 2F8NB 4KGCB 1P3BA 2F8NH 3AZEA 1M19C 3AV1C 3A6NA 3MNND 2CV5A 3AZNA 4J8UA 3X1SD 3REJD 1P3MA 3W96A 4Z5TD 5B31C 3WTPC 5CPIA 3KWQB 1EQZA 4WU8D 4H9SA 3MGRC 5B2ID 3WTPE 5B33A 1KX4A 3AZLB 5DNNB 4YM6B 5JA4B 1Q9CA 4X23A 3MGQB 1P3OD 3AZJC 1P3FC 2FJ7A 2F8NA 4KGCA 3X1TC 1P3KC 5CPKC 1M19B 4J8VC 3UTBA 3AV1B 4XZQC 3R45B 5E5AA 3REIB 1P34B 3C1CB 3AZGB 3KWQA 3C1CA 3AZIC 1P3IC 1HTAA 3AV2D 5GT0C 4R8PB 3AZLA 4YM6A 3O62C 4WU9C 5JA4A 1M18C 2IO5B 3WKJC 4LD9D 3MGQA 3AZHB 3C1BA 1F66C 5AVCC 1B67A 4J8WB 4G91B 1M19A 3X1UD 3AYWD 3AV1A 3REKD 3R45A 4H9QA 3KXBD 3REIA 1P34A 2NZDC 5B24C 5CP6D 3W98B
chains in the Genus database with same CATH superfamily
4DQYB 3AN2C 2HUEB 5AV8B 5B0YB 3H0RC 1JFIB 4R8PA 3UT9D 3EG5B 3X1SB 4UUZB 3O62B 1M18B 2ZY5A 1P3PB 4KUDC 1P3BD 1ZLAB 5GT3C 3EPHA 3X1VC 3A6ND 4J8WA 4J8XB 2CV5D 4ZBJC 3AZND 4J8UD 1P3MD 3W96D 4XZQA 5C3IB 5B2JB 3WAAC 3W98A 5CPID 2Y2PA 5AV8A 5B0YA 1EQZD 5G49B 1JFIA 2HIOB 3AZIA 1KX4D 3X1SA 4UUZA 1P3GB 4X23D 4E44A 3O62A 5B1MC 3WKJA 3NQJB 1M18A 2FJ7D 5B40C 1P3PA 2F8ND 4KGCD 1ZLAA 1F66A 5GT3B 3UTBD 4J8XA 5E5AD 4CAYB 5B2JA 2NZDA 4UPKA 3LZ1D 3KWQD 2JE5A 1KX3C 3VH6W 1KX5D 5G49A 2HIOA 5AV5B 3X1UB 4ZUXB 4YM6D 3AZLD 2PYOC 2JSSA 3NQUB 1P3GA 3MNNB 3MGQD 5CP6B 3C1BD 3NQJA 5BT1D 3MGSB 1AOIC 3W97C 2NQBC 5BNVA 5GT3A 3UT9B 1M19D 5DNMB 5F99C 5GSUC 3AV1D 1P34D 1HQ3B 4CAYA 4H9NB 4JJNC 3C1CD 3WTPD 5B31D 5AV5A 3KUYC 4R8PD 4ZUXA 4XUJC 2CV5B 3UTAC 1N1JA 4G92C 3NQUA 1P3MB 2PYOB 3MGSA 3B0CT 3AZJD 1S32B 1P3FD 5B40A 4NE5A 3X1TD 3UT9A 5DNMA 3LZ0B 3B0BA 1HQ3A 5F99B 5GSUB 4H9NA 4NFTA 4X23B 3LELC 3AZMB 4XZQD 5AY8B 2FJ7B 5AV8D 5B0YD 1M1AC 1P3ID 5JRGC 3AZID 1KX3A 3UTBB 2AROC 5E5AB 2G5IC 3O62D 2PYOA 5AV9C 1M18D 3WKJD 3LZ1B 3VH5T 1P3PD 1BH9B 1S32A 1KX5B 1ZLAD 3B6GC 2UWXA 1F66D 3W97A 1AOIA 1TZYB 3LJAC 3LZ0A 4J8XD 5F99A 5GSUA 3AZMA 3C1BB 5B2JD 5AY8A 2NZDD 2BYMB 4Z2MG 1U35C 2HIOD 5BS7A 3MVDC 3KUYA 2VQRA 4H9QB 4XUJA 1P3GD 5B0ZC 3LZ1A 4AWLC 3WA9C 5FUGB 3WTPB 5B31B 1BH9A 3A1IA 1KX5A 2BYKA 5B1LC 1P3LC 1TZYA 5GT3D 3MGRB 4KHAB 3AZFC 1BH8A 2Y2GA 3AZJB 1P3FB 2BYMA 3X1TB 1P3KB 2RVQC 5AV5D 5CPKB 1U35B 4ZUXD 2DQNC 4NE6A 4NE3A 4J8VB 3V9RB 2AROA 2YFWA 4XZQB 3MVDB 2J8PA 5FUGA 3WTPA 5B31A 3MGSD 3IP4C 1P3IB 3AZIB 5B40D 3MGRA 1R4VA 5B1LB 5DNMD 5GT0B 4KHAA 1HQ3D 3REHC 4WU9B 3WKJB 2FFFB 4WU8C 3AZJA 1F66B 1P3FA 1TAFB 3X1TA 1P3KA 5AVCB 1KX3D 5CPKA 1U35A 4J8VA 3B0DC 2Y2OA 3V9RA 3VH5A 2PYOD 3MVDA 2NZDB 5B24B 1S32D 3AN2B 1P3IA 3WA9A 1AOID 3W97D 5B1LA 5GT0A 3LZ0D 1P3LA 3AL0C 5F99D 5GSUD 3AZMD 4WU9A 3AZFA 5AY8D 4JJND 5AV6C 2XD1A 2Y2NA 3B6FC 1TAFA 4KUDB 5BNVB 5AVCA 2RIQA 2ZM5A 3X1VB 4LD9C 3KUYD 3FDDA 4XUJD 5CPJC 3W99C 1BFMA 4ZBJB 5B32G 4YS3C 3B0DB 3AFAC 3UTAD 5B24A 2YFVB 3WAAB 3AN2A 5AVBC 1TZYD 5CHLB 1A7WA 1N1JB 4Z2MH 4Z66C 5B1MB 3TU4C 1WWSA 5B40B 4KUDA 1P3AC 4HGAC 3B6FB 3X1VA 5GXQC 2AROD 2Y2QA 3AZEC 2YFVA 3WAAA 1KX3B 3B6GD 3MGRD 5AVBB 4J8UC 2BG1A 3W96C 5CPIC 3A1KA 1EQZC 2F2AC 5B1MA 5B33C 1AOIB 3W97B 2NQBB 1P3KD 2Y2MA 5CPKD 3B6FA 1U35D 2ZY4A 1P3AB 4J8VD 3MVDD 4KGCC 4JJNB 5CPJA 4DRAA 4YS3A 3WA9D 2ZY2A 3AZKC 5B1LD 3VH6T 5AVBA 5GT0D 1P3LD 3KUYB 4XUJB 4WU9D 4G92B 3UTAB 1ID3C 3AZFD 5B32C 4Z66A 2BYKB 5DNNC 2NQBA 5AVCD 3RELC 3MGQC 1P3AA 5BO0B 1BH8B 2LY8A 5GXQA 3LELB 4JJNA 5B24D 3AN2D 1M1AB 5JRGB 3MGPC 3AZKB 3REIC 1P34C 3C1CC 2AROB 4QLCC 5BNXB 2YFWB 3UTAA 3AZGC 3REHD 1ID3B 5AV9B 5B32B 1H3OA 4R8PC 3B6GB 4KUDD 3X1VD 2IO5C 3LJAB 3RELB 3AZHC 5BO0A 4E45A 3LELA 1KU5A 3WAAD 4J8WC 4G91C 1M1AA 5JRGA 3AZKA 1PZRA 2ZY3A 3MGPB 5BNXA 3W98C 4QLCB 2HUEC 5AV8C 5B0YC 3H0LC 1ID3A 5B1MD 5AV9A 5B0ZB 5B32A 4AWLB 3WA9B 5AV6D 3B6GA 3KFUG 4EO5C 1F1EA 3B6FD 1P3LB 3X1SC 5DNNA 3REJC 3LJAA 3RELA 4Z5TC 3KSYA 3AZFB 4WV4B 1P3PC 5CPJD 1ZLAC 3W99D 5B2IC 4YS3D 3AFAD 3VH6A 5KDMB 4J8XC 5AVBD 1P3OC 5C3IC 5B2JC 3MGPA 4QLCA 4Z66D 1W2EA 3AZGA 2Y2LA 5B0ZA 2HIOC 2NQBD 3TU4D 4EO5B 1P3GC 2L5AA 1P3AD 2F8NK 2F8NG 3REJB 3AZHA 5GXQD 4Z5TB 3REHB 3EPJA 3AV2C 4WU8B 5KDMA 3AZED 5B2IB 4H9OB 1P3OB 4WZSB 3EPLA 4WNNB 4H9RB 5AV5C 3X1UC 4ZUXC 3AYWC 3F6TA 4CSRB 5B33D 3REKC 2JCHA 3KXBC 3MNNC 5CP6C 3B0CW 3EPKA 3REJA 4Z5TA 3MGSC 3LELD 3REHA 2Y2KA 4WU8A 5AV6B 2Y2HA 5B2IA 3UT9C 5DNMC 3AV2B 1M1AD 5JRGD 3AZKD 1HQ3C 4H9OA 1Z2CB 4LD9B 1P3OA 5B31G 1P3BC 5CPJB 3W99B 1ID3D 4WNNA 4YS3B 3AFAB 5AV9D 4H9RA 3A6NC 1ULYA 4M6BA 5B32D 2W8SA 2CV5C 4CSRA 3AZNC 3AYWB 4H9PB 5DNND 1P3MC 3LJAD 3REKB 3RELD 3VH5W 3KXBB 4Z66B 1S32C 4H9SC 5AV6A 1KX4C 3TU4B 3AV2A 3LZ0C 2CWEA 4X23C 4HGAB 3AZMC 3MGPD 4LD9A 5AY8C 5GXQB 3REID 2FJ7C 4QLCD 3AZGD 3W99A 3AFAA 5B0ZD 1P3BB 3AZEB 5BS7C 3UTBC 3A6NB 3X1UA 5E5AC 3AYWA 4H9PA 3REKA 3AZNB 4J8UB 3KXBA 3LZ1C 2Y2JA 3MNNA 4DRBA 5CP6A 3KWQC 3AZHD 1KX5C 3W96B 5CPIB 1EQZB 1H3OB 1T3UA 1TZYC 3AZLC 4YM6C 3TU4A 5B33B 4J8WD 1KX4B 2RVQD 1B6WA 3C1BC 1WWIA 5BT1C 3W98D 2F8NB 4KGCB 1P3BA 2DF4C 2F8NH 3AZEA 1M19C 3AV1C 3A6NA 3MNND 2CV5A 3AZNA 4J8UA 3X1SD 3REJD 1P3MA 3W96A 4Z5TD 5B31C 3WTPC 5CPIA 3KWQB 1EQZA 4WU8D 4H9SA 3MGRC 5B2ID 3WTPE 5B33A 1KX4A 3AZLB 5DNNB 4YM6B 5JA4B 2Y2IA 1Q9CA 4X23A 3MGQB 1P3OD 3AZJC 1P3FC 2FJ7A 2F8NA 4KGCA 3X1TC 1P3KC 2G5HC 5CPKC 3H0MC 1M19B 4J8VC 3UTBA 3AV1B 4XZQC 3R45B 5E5AA 3REIB 1P34B 3C1CB 3AZGB 3KWQA 3C1CA 3AZIC 1P3IC 1HTAA 3AV2D 5GT0C 4R8PB 3AZLA 4YM6A 2XD5A 3O62C 4WU9C 5JA4A 1M18C 2IO5B 3WKJC 4LD9D 3MGQA 3AZHB 3C1BA 1F66C 5AVCC 4WJ3C 1B67A 4J8WB 4G91B 1M19A 3X1UD 3AYWD 3AV1A 3P5JB 3REKD 3R45A 4H9QA 3KXBD 3REIA 1P34A 2NZDC 5B24C 5CP6D 3W98B
chains in the Genus database with same CATH topology
4DQYB 3AN2C 2HUEB 5AV8B 5B0YB 3H0RC 1JFIB 4R8PA 3UT9D 3EG5B 3X1SB 4UUZB 3O62B 1M18B 2ZY5A 1P3PB 4KUDC 1P3BD 1ZLAB 5GT3C 3EPHA 3X1VC 3A6ND 4J8WA 4J8XB 2CV5D 4ZBJC 3AZND 4J8UD 1P3MD 3W96D 4XZQA 5C3IB 5B2JB 3WAAC 3W98A 5CPID 2Y2PA 5AV8A 5B0YA 1EQZD 5G49B 1JFIA 2HIOB 3AZIA 1KX4D 3X1SA 4UUZA 1P3GB 4X23D 4E44A 3O62A 5B1MC 3WKJA 3NQJB 1M18A 2FJ7D 5B40C 1P3PA 2F8ND 4KGCD 1ZLAA 1F66A 5GT3B 3UTBD 4J8XA 5E5AD 4CAYB 5B2JA 2NZDA 4UPKA 3LZ1D 3KWQD 2JE5A 1KX3C 3VH6W 1KX5D 5G49A 2HIOA 5AV5B 3X1UB 4ZUXB 4YM6D 3AZLD 2PYOC 2JSSA 3NQUB 1P3GA 3MNNB 3MGQD 5CP6B 3C1BD 3NQJA 5BT1D 3MGSB 1AOIC 3W97C 2NQBC 5BNVA 5GT3A 3UT9B 1M19D 5DNMB 5F99C 5GSUC 3AV1D 1P34D 1HQ3B 4CAYA 4H9NB 4JJNC 3C1CD 3WTPD 5B31D 5AV5A 3KUYC 4R8PD 4ZUXA 4XUJC 2CV5B 3UTAC 1N1JA 4G92C 3NQUA 1P3MB 2PYOB 3MGSA 3B0CT 3AZJD 1S32B 1P3FD 5B40A 4NE5A 3X1TD 3UT9A 5DNMA 3LZ0B 3B0BA 1HQ3A 5F99B 5GSUB 4H9NA 4NFTA 4X23B 3LELC 3AZMB 4XZQD 5AY8B 2FJ7B 5AV8D 5B0YD 1M1AC 1P3ID 5JRGC 3AZID 1KX3A 3UTBB 2AROC 5E5AB 2G5IC 3O62D 2PYOA 5AV9C 1M18D 3WKJD 3LZ1B 3VH5T 1P3PD 1BH9B 1S32A 1KX5B 1ZLAD 3B6GC 2UWXA 1F66D 3W97A 1AOIA 1TZYB 3LJAC 3LZ0A 4J8XD 5F99A 5GSUA 3AZMA 3C1BB 5B2JD 5AY8A 2NZDD 2BYMB 4Z2MG 1U35C 2HIOD 5BS7A 3MVDC 3KUYA 2VQRA 4H9QB 4XUJA 1P3GD 5B0ZC 3LZ1A 4AWLC 3WA9C 5FUGB 3WTPB 5B31B 1BH9A 3A1IA 1KX5A 2BYKA 5B1LC 1P3LC 1TZYA 5GT3D 3MGRB 4KHAB 3AZFC 1BH8A 2Y2GA 3AZJB 1P3FB 2BYMA 3X1TB 1P3KB 2RVQC 5AV5D 5CPKB 1U35B 4ZUXD 2DQNC 4NE6A 4NE3A 4J8VB 3V9RB 2AROA 2YFWA 4XZQB 3MVDB 2J8PA 5FUGA 3WTPA 5B31A 3MGSD 3IP4C 1P3IB 3AZIB 5B40D 3MGRA 1R4VA 5B1LB 5DNMD 5GT0B 4KHAA 1HQ3D 3REHC 4WU9B 3WKJB 2FFFB 4WU8C 3AZJA 1F66B 1P3FA 1TAFB 3X1TA 1P3KA 5AVCB 1KX3D 5CPKA 1U35A 4J8VA 3B0DC 2Y2OA 3V9RA 3VH5A 2PYOD 3MVDA 2NZDB 5B24B 1S32D 3AN2B 1P3IA 3WA9A 1AOID 3W97D 5B1LA 5GT0A 3LZ0D 1P3LA 3AL0C 5F99D 5GSUD 3AZMD 4WU9A 3AZFA 5AY8D 4JJND 5AV6C 2XD1A 2Y2NA 3B6FC 1TAFA 4KUDB 5BNVB 5AVCA 2RIQA 2ZM5A 3X1VB 4LD9C 3KUYD 3FDDA 4XUJD 5CPJC 3W99C 1BFMA 4ZBJB 5B32G 4YS3C 3B0DB 3AFAC 3UTAD 5B24A 2YFVB 3WAAB 3AN2A 5AVBC 1TZYD 5CHLB 1A7WA 1N1JB 4Z2MH 4Z66C 5B1MB 3TU4C 1WWSA 5B40B 4KUDA 1P3AC 4HGAC 3B6FB 3X1VA 5GXQC 2AROD 2Y2QA 3AZEC 2YFVA 3WAAA 1KX3B 3B6GD 3MGRD 5AVBB 4J8UC 2BG1A 3W96C 5CPIC 3A1KA 1EQZC 2F2AC 5B1MA 5B33C 1AOIB 3W97B 2NQBB 1P3KD 2Y2MA 5CPKD 3B6FA 1U35D 2ZY4A 1P3AB 4J8VD 3MVDD 4KGCC 4JJNB 5CPJA 4DRAA 4YS3A 3WA9D 2ZY2A 3AZKC 5B1LD 3VH6T 5AVBA 5GT0D 1P3LD 3KUYB 4XUJB 4WU9D 4G92B 3UTAB 1ID3C 3AZFD 5B32C 4Z66A 2BYKB 5DNNC 2NQBA 5AVCD 3RELC 3MGQC 1P3AA 5BO0B 1BH8B 2LY8A 5GXQA 3LELB 4JJNA 5B24D 3AN2D 1M1AB 5JRGB 3MGPC 3AZKB 3REIC 1P34C 3C1CC 2AROB 4QLCC 5BNXB 2YFWB 3UTAA 3AZGC 3REHD 1ID3B 5AV9B 5B32B 1H3OA 4R8PC 3B6GB 4KUDD 3X1VD 2IO5C 3LJAB 3RELB 3AZHC 5BO0A 4E45A 3LELA 1KU5A 3WAAD 4J8WC 4G91C 1M1AA 5JRGA 3AZKA 1PZRA 2ZY3A 3MGPB 5BNXA 3W98C 4QLCB 2HUEC 5AV8C 5B0YC 3H0LC 1ID3A 5B1MD 5AV9A 5B0ZB 5B32A 4AWLB 3WA9B 5AV6D 3B6GA 3KFUG 4EO5C 1F1EA 3B6FD 1P3LB 3X1SC 5DNNA 3REJC 3LJAA 3RELA 4Z5TC 3KSYA 3AZFB 4WV4B 1P3PC 5CPJD 1ZLAC 3W99D 5B2IC 4YS3D 3AFAD 3VH6A 5KDMB 4J8XC 5AVBD 1P3OC 5C3IC 5B2JC 3MGPA 4QLCA 4Z66D 1W2EA 3AZGA 2Y2LA 5B0ZA 2HIOC 2NQBD 3TU4D 4EO5B 1P3GC 2L5AA 1P3AD 2F8NK 2F8NG 3REJB 3AZHA 5GXQD 4Z5TB 3REHB 3EPJA 3AV2C 4WU8B 5KDMA 3AZED 5B2IB 4H9OB 1P3OB 4WZSB 3EPLA 4WNNB 4H9RB 5AV5C 3X1UC 4ZUXC 3AYWC 3F6TA 4CSRB 5B33D 3REKC 2JCHA 3KXBC 3MNNC 5CP6C 3B0CW 3EPKA 3REJA 4Z5TA 3MGSC 3LELD 3REHA 2Y2KA 4WU8A 5AV6B 2Y2HA 5B2IA 3UT9C 5DNMC 3AV2B 1M1AD 5JRGD 3AZKD 1HQ3C 4H9OA 1Z2CB 4LD9B 1P3OA 5B31G 1P3BC 5CPJB 3W99B 1ID3D 4WNNA 4YS3B 3AFAB 5AV9D 4H9RA 3A6NC 1ULYA 4M6BA 5B32D 2W8SA 2CV5C 4CSRA 3AZNC 3AYWB 4H9PB 5DNND 1P3MC 3LJAD 3REKB 3RELD 3VH5W 3KXBB 4Z66B 1S32C 4H9SC 5AV6A 1KX4C 3TU4B 3AV2A 3LZ0C 2CWEA 4X23C 4HGAB 3AZMC 3MGPD 4LD9A 5AY8C 5GXQB 3REID 2FJ7C 4QLCD 3AZGD 3W99A 3AFAA 5B0ZD 1P3BB 3AZEB 5BS7C 3UTBC 3A6NB 3X1UA 5E5AC 3AYWA 4H9PA 3REKA 3AZNB 4J8UB 3KXBA 3LZ1C 2Y2JA 3MNNA 4DRBA 5CP6A 3KWQC 3AZHD 1KX5C 3W96B 5CPIB 1EQZB 1H3OB 1T3UA 1TZYC 3AZLC 4YM6C 3TU4A 5B33B 4J8WD 1KX4B 2RVQD 1B6WA 3C1BC 1WWIA 5BT1C 3W98D 2F8NB 4KGCB 1P3BA 2DF4C 2F8NH 3AZEA 1M19C 3AV1C 3A6NA 3MNND 2CV5A 3AZNA 4J8UA 3X1SD 3REJD 1P3MA 3W96A 4Z5TD 5B31C 3WTPC 5CPIA 3KWQB 1EQZA 4WU8D 4H9SA 3MGRC 5B2ID 3WTPE 5B33A 1KX4A 3AZLB 5DNNB 4YM6B 5JA4B 2Y2IA 1Q9CA 4X23A 3MGQB 1P3OD 3AZJC 1P3FC 2FJ7A 2F8NA 4KGCA 3X1TC 1P3KC 2G5HC 5CPKC 3H0MC 1M19B 4J8VC 3UTBA 3AV1B 4XZQC 3R45B 5E5AA 3REIB 1P34B 3C1CB 3AZGB 3KWQA 3C1CA 3AZIC 1P3IC 1HTAA 3AV2D 5GT0C 4R8PB 3AZLA 4YM6A 2XD5A 3O62C 4WU9C 5JA4A 1M18C 2IO5B 3WKJC 4LD9D 3MGQA 3AZHB 3C1BA 1F66C 5AVCC 4WJ3C 1B67A 4J8WB 4G91B 1M19A 3X1UD 3AYWD 3AV1A 3P5JB 3REKD 3R45A 4H9QA 3KXBD 3REIA 1P34A 2NZDC 5B24C 5CP6D 3W98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 C;  2HUE B;  5AV8 B;  5B0Y B;  1JFI B;  4R8P A;  3UT9 D;  3X1S B;  4UUZ B;  3O62 B;  1M18 B;  1P3P B;  4KUD C;  1P3B D;  1ZLA B;  5GT3 C;  3X1V C;  3A6N D;  4J8W A;  4J8X B;  2CV5 D;  4ZBJ C;  3AZN D;  4J8U D;  1P3M D;  3W96 D;  4XZQ A;  5C3I B;  5B2J B;  3WAA C;  3W98 A;  5CPI D;  1EQZ D;  5AV8 A;  5B0Y A;  5G49 B;  1JFI A;  2HIO B;  3AZI A;  1KX4 D;  3X1S A;  4UUZ A;  1P3G B;  4X23 D;  4E44 A;  3O62 A;  5B1M C;  3WKJ A;  3NQJ B;  1M18 A;  2FJ7 D;  5B40 C;  1P3P A;  2F8N D;  4KGC D;  1ZLA A;  1F66 A;  5GT3 B;  3UTB D;  4J8X A;  5E5A D;  4CAY B;  5B2J A;  2NZD A;  3LZ1 D;  3KWQ D;  1KX3 C;  3VH6 W;  1KX5 D;  5G49 A;  2HIO A;  5AV5 B;  3X1U B;  4ZUX B;  4YM6 D;  3AZL D;  2PYO C;  2JSS A;  3NQU B;  1P3G A;  3MNN B;  3MGQ D;  5CP6 B;  3C1B D;  3NQJ A;  5BT1 D;  3MGS B;  1AOI C;  3W97 C;  2NQB C;  5BNV A;  5GT3 A;  3UT9 B;  1M19 D;  5DNM B;  5F99 C;  5GSU C;  3AV1 D;  1P34 D;  1HQ3 B;  4CAY A;  4H9N B;  4JJN C;  3C1C D;  3WTP D;  5B31 D;  5AV5 A;  3KUY C;  4R8P D;  4ZUX A;  4XUJ C;  2CV5 B;  3UTA C;  1N1J A;  4G92 C;  3NQU A;  1P3M B;  2PYO B;  3MGS A;  3B0C T;  3AZJ D;  1S32 B;  1P3F D;  5B40 A;  4NE5 A;  3X1T D;  3UT9 A;  5DNM A;  3LZ0 B;  3B0B A;  1HQ3 A;  5F99 B;  5GSU B;  4H9N A;  4NFT A;  4X23 B;  3LEL C;  3AZM B;  4XZQ D;  5AY8 B;  2FJ7 B;  5AV8 D;  5B0Y D;  1M1A C;  1P3I D;  5JRG C;  3AZI D;  1KX3 A;  3UTB B;  2ARO C;  5E5A B;  3O62 D;  2PYO A;  5AV9 C;  1M18 D;  3WKJ D;  3LZ1 B;  3VH5 T;  1P3P D;  1BH9 B;  1S32 A;  1KX5 B;  1ZLA D;  3B6G C;  1F66 D;  3W97 A;  1AOI A;  1TZY B;  3LJA C;  3LZ0 A;  4J8X D;  5F99 A;  5GSU A;  3AZM A;  3C1B B;  5B2J D;  5AY8 A;  2NZD D;  2BYM B;  4Z2M G;  1U35 C;  2HIO D;  5BS7 A;  3MVD C;  3KUY A;  4H9Q B;  4XUJ A;  1P3G D;  5B0Z C;  3LZ1 A;  4AWL C;  3WA9 C;  5FUG B;  3WTP B;  5B31 B;  1BH9 A;  1KX5 A;  2BYK A;  5B1L C;  1P3L C;  1TZY A;  5GT3 D;  3MGR B;  4KHA B;  3AZF C;  1BH8 A;  3AZJ B;  1P3F B;  2BYM A;  3X1T B;  1P3K B;  2RVQ C;  5AV5 D;  5CPK B;  1U35 B;  4ZUX D;  4NE6 A;  4NE3 A;  4J8V B;  3V9R B;  2ARO A;  2YFW A;  4XZQ B;  3MVD B;  5FUG A;  3WTP A;  5B31 A;  3MGS D;  1P3I B;  3AZI B;  5B40 D;  3MGR A;  1R4V A;  5B1L B;  5DNM D;  5GT0 B;  4KHA A;  1HQ3 D;  3REH C;  4WU9 B;  3WKJ B;  4WU8 C;  3AZJ A;  1F66 B;  1P3F A;  1TAF B;  3X1T A;  1P3K A;  5AVC B;  1KX3 D;  5CPK A;  1U35 A;  4J8V A;  3B0D C;  3V9R A;  3VH5 A;  2PYO D;  3MVD A;  2NZD B;  5B24 B;  1S32 D;  3AN2 B;  1P3I A;  3WA9 A;  1AOI D;  3W97 D;  5B1L A;  5GT0 A;  3LZ0 D;  1P3L A;  5F99 D;  5GSU D;  3AZM D;  4WU9 A;  3AZF A;  5AY8 D;  4JJN D;  5AV6 C;  3B6F C;  1TAF A;  4KUD B;  5BNV B;  5AVC A;  3X1V B;  4LD9 C;  3KUY D;  4XUJ D;  5CPJ C;  3W99 C;  1BFM A;  4ZBJ B;  4YS3 C;  5B32 G;  3B0D B;  3AFA C;  3UTA D;  5B24 A;  2YFV B;  3WAA B;  3AN2 A;  5AVB C;  1TZY D;  5CHL B;  1A7W A;  1N1J B;  4Z2M H;  4Z66 C;  5B1M B;  3TU4 C;  1WWS A;  5B40 B;  4KUD A;  1P3A C;  4HGA C;  3B6F B;  3X1V A;  5GXQ C;  2ARO D;  3AZE C;  2YFV A;  3WAA A;  1KX3 B;  3B6G D;  3MGR D;  5AVB B;  4J8U C;  3W96 C;  5CPI C;  1EQZ C;  5B1M A;  5B33 C;  1AOI B;  3W97 B;  2NQB B;  1P3K D;  3B6F A;  5CPK D;  1U35 D;  1P3A B;  4J8V D;  3MVD D;  4KGC C;  4JJN B;  5CPJ A;  4DRA A;  4YS3 A;  3WA9 D;  3AZK C;  5B1L D;  3VH6 T;  5AVB A;  5GT0 D;  1P3L D;  3KUY B;  4XUJ B;  4WU9 D;  4G92 B;  3UTA B;  1ID3 C;  3AZF D;  5B32 C;  4Z66 A;  2BYK B;  5DNN C;  2NQB A;  5AVC D;  3REL C;  3MGQ C;  1P3A A;  5BO0 B;  1BH8 B;  2LY8 A;  5GXQ A;  3LEL B;  4JJN A;  5B24 D;  3AN2 D;  1M1A B;  5JRG B;  3MGP C;  3AZK B;  3REI C;  1P34 C;  3C1C C;  2ARO B;  4QLC C;  5BNX B;  2YFW B;  3UTA A;  3AZG C;  3REH D;  1ID3 B;  5AV9 B;  5B32 B;  1H3O A;  4R8P C;  3B6G B;  4KUD D;  3X1V D;  2IO5 C;  3LJA B;  3REL B;  3AZH C;  5BO0 A;  4E45 A;  3LEL A;  1KU5 A;  3WAA D;  4J8W C;  4G91 C;  1M1A A;  5JRG A;  3AZK A;  3MGP B;  5BNX A;  3W98 C;  4QLC B;  2HUE C;  5AV8 C;  5B0Y C;  1ID3 A;  5B1M D;  5AV9 A;  5B0Z B;  5B32 A;  4AWL B;  3WA9 B;  5AV6 D;  3B6G A;  4EO5 C;  1F1E A;  3B6F D;  1P3L B;  3X1S C;  5DNN A;  3REJ C;  3LJA A;  3REL A;  4Z5T C;  3KSY A;  3AZF B;  4WV4 B;  1P3P C;  5CPJ D;  1ZLA C;  3W99 D;  5B2I C;  4YS3 D;  3AFA D;  3VH6 A;  5KDM B;  4J8X C;  5AVB D;  1P3O C;  5C3I C;  5B2J C;  3MGP A;  4QLC A;  4Z66 D;  3AZG A;  5B0Z A;  2HIO C;  2NQB D;  3TU4 D;  4EO5 B;  1P3G C;  2L5A A;  1P3A D;  2F8N K;  2F8N G;  3REJ B;  3AZH A;  5GXQ D;  4Z5T B;  3REH B;  3AV2 C;  4WU8 B;  5KDM A;  3AZE D;  5B2I B;  4H9O B;  1P3O B;  4WZS B;  4WNN B;  4H9R B;  5AV5 C;  3X1U C;  4ZUX C;  3AYW C;  4CSR B;  5B33 D;  3REK C;  3KXB C;  3MNN C;  5CP6 C;  3B0C W;  3REJ A;  4Z5T A;  3MGS C;  3LEL D;  3REH A;  4WU8 A;  5AV6 B;  3UT9 C;  5B2I A;  5DNM C;  3AV2 B;  1M1A D;  5JRG D;  3AZK D;  1HQ3 C;  4H9O A;  4LD9 B;  1P3O A;  5B31 G;  1P3B C;  5CPJ B;  3W99 B;  1ID3 D;  4WNN A;  4YS3 B;  3AFA B;  5AV9 D;  4H9R A;  3A6N C;  1ULY A;  4M6B A;  5B32 D;  2CV5 C;  4CSR A;  3AZN C;  3AYW B;  4H9P B;  5DNN D;  1P3M C;  3LJA D;  3REK B;  3REL D;  3VH5 W;  3KXB B;  4Z66 B;  1S32 C;  4H9S C;  5AV6 A;  1KX4 C;  3TU4 B;  3AV2 A;  3LZ0 C;  2CWE A;  4X23 C;  4HGA B;  3AZM C;  3MGP D;  4LD9 A;  5AY8 C;  5GXQ B;  3REI D;  2FJ7 C;  4QLC D;  3AZG D;  3W99 A;  3AFA A;  5B0Z D;  1P3B B;  3AZE B;  5BS7 C;  3UTB C;  3A6N B;  3X1U A;  5E5A C;  3AYW A;  4H9P A;  3REK A;  3AZN B;  4J8U B;  3KXB A;  3LZ1 C;  3MNN A;  3KWQ C;  4DRB A;  5CP6 A;  3AZH D;  1KX5 C;  3W96 B;  5CPI B;  1EQZ B;  1H3O B;  1TZY C;  3AZL C;  4YM6 C;  3TU4 A;  5B33 B;  4J8W D;  1KX4 B;  2RVQ D;  1B6W A;  3C1B C;  1WWI A;  5BT1 C;  3W98 D;  2F8N B;  4KGC B;  1P3B A;  2F8N H;  3AZE A;  1M19 C;  3AV1 C;  3A6N A;  3MNN D;  2CV5 A;  3AZN A;  4J8U A;  3X1S D;  3REJ D;  1P3M A;  3W96 A;  4Z5T D;  5B31 C;  3WTP C;  5CPI A;  3KWQ B;  1EQZ A;  4WU8 D;  4H9S A;  3MGR C;  5B2I D;  3WTP E;  5B33 A;  1KX4 A;  3AZL B;  5DNN B;  4YM6 B;  5JA4 B;  1Q9C A;  4X23 A;  3MGQ B;  1P3O D;  3AZJ C;  1P3F C;  2FJ7 A;  2F8N A;  4KGC A;  3X1T C;  1P3K C;  5CPK C;  1M19 B;  4J8V C;  3UTB A;  3AV1 B;  4XZQ C;  3R45 B;  5E5A A;  3REI B;  1P34 B;  3C1C B;  3AZG B;  3KWQ A;  3C1C A;  3AZI C;  1P3I C;  1HTA A;  3AV2 D;  5GT0 C;  4R8P B;  3AZL A;  4YM6 A;  3O62 C;  4WU9 C;  5JA4 A;  1M18 C;  2IO5 B;  3WKJ C;  4LD9 D;  3MGQ A;  3AZH B;  3C1B A;  1F66 C;  5AVC C;  1B67 A;  4J8W B;  4G91 B;  1M19 A;  3X1U D;  3AYW D;  3AV1 A;  3REK D;  3R45 A;  4H9Q A;  3KXB D;  3REI A;  1P34 A;  2NZD C;  5B24 C;  5CP6 D;  3W98 B; 
#chains in the Genus database with same CATH topology
 4DQY B;  3AN2 C;  2HUE B;  5AV8 B;  5B0Y B;  3H0R C;  1JFI B;  4R8P A;  3UT9 D;  3EG5 B;  3X1S B;  4UUZ B;  3O62 B;  1M18 B;  2ZY5 A;  1P3P B;  4KUD C;  1P3B D;  1ZLA B;  5GT3 C;  3EPH A;  3X1V C;  3A6N D;  4J8W A;  4J8X B;  2CV5 D;  4ZBJ C;  3AZN D;  4J8U D;  1P3M D;  3W96 D;  4XZQ A;  5C3I B;  5B2J B;  3WAA C;  3W98 A;  5CPI D;  2Y2P A;  5AV8 A;  5B0Y A;  1EQZ D;  5G49 B;  1JFI A;  2HIO B;  3AZI A;  1KX4 D;  3X1S A;  4UUZ A;  1P3G B;  4X23 D;  4E44 A;  3O62 A;  5B1M C;  3WKJ A;  3NQJ B;  1M18 A;  2FJ7 D;  5B40 C;  1P3P A;  2F8N D;  4KGC D;  1ZLA A;  1F66 A;  5GT3 B;  3UTB D;  4J8X A;  5E5A D;  4CAY B;  5B2J A;  2NZD A;  4UPK A;  3LZ1 D;  3KWQ D;  2JE5 A;  1KX3 C;  3VH6 W;  1KX5 D;  5G49 A;  2HIO A;  5AV5 B;  3X1U B;  4ZUX B;  4YM6 D;  3AZL D;  2PYO C;  2JSS A;  3NQU B;  1P3G A;  3MNN B;  3MGQ D;  5CP6 B;  3C1B D;  3NQJ A;  5BT1 D;  3MGS B;  1AOI C;  3W97 C;  2NQB C;  5BNV A;  5GT3 A;  3UT9 B;  1M19 D;  5DNM B;  5F99 C;  5GSU C;  3AV1 D;  1P34 D;  1HQ3 B;  4CAY A;  4H9N B;  4JJN C;  3C1C D;  3WTP D;  5B31 D;  5AV5 A;  3KUY C;  4R8P D;  4ZUX A;  4XUJ C;  2CV5 B;  3UTA C;  1N1J A;  4G92 C;  3NQU A;  1P3M B;  2PYO B;  3MGS A;  3B0C T;  3AZJ D;  1S32 B;  1P3F D;  5B40 A;  4NE5 A;  3X1T D;  3UT9 A;  5DNM A;  3LZ0 B;  3B0B A;  1HQ3 A;  5F99 B;  5GSU B;  4H9N A;  4NFT A;  4X23 B;  3LEL C;  3AZM B;  4XZQ D;  5AY8 B;  2FJ7 B;  5AV8 D;  5B0Y D;  1M1A C;  1P3I D;  5JRG C;  3AZI D;  1KX3 A;  3UTB B;  2ARO C;  5E5A B;  2G5I C;  3O62 D;  2PYO A;  5AV9 C;  1M18 D;  3WKJ D;  3LZ1 B;  3VH5 T;  1P3P D;  1BH9 B;  1S32 A;  1KX5 B;  1ZLA D;  3B6G C;  2UWX A;  1F66 D;  3W97 A;  1AOI A;  1TZY B;  3LJA C;  3LZ0 A;  4J8X D;  5F99 A;  5GSU A;  3AZM A;  3C1B B;  5B2J D;  5AY8 A;  2NZD D;  2BYM B;  4Z2M G;  1U35 C;  2HIO D;  5BS7 A;  3MVD C;  3KUY A;  2VQR A;  4H9Q B;  4XUJ A;  1P3G D;  5B0Z C;  3LZ1 A;  4AWL C;  3WA9 C;  5FUG B;  3WTP B;  5B31 B;  1BH9 A;  3A1I A;  1KX5 A;  2BYK A;  5B1L C;  1P3L C;  1TZY A;  5GT3 D;  3MGR B;  4KHA B;  3AZF C;  1BH8 A;  2Y2G A;  3AZJ B;  1P3F B;  2BYM A;  3X1T B;  1P3K B;  2RVQ C;  5AV5 D;  5CPK B;  1U35 B;  4ZUX D;  2DQN C;  4NE6 A;  4NE3 A;  4J8V B;  3V9R B;  2ARO A;  2YFW A;  4XZQ B;  3MVD B;  2J8P A;  5FUG A;  3WTP A;  5B31 A;  3MGS D;  3IP4 C;  1P3I B;  3AZI B;  5B40 D;  3MGR A;  1R4V A;  5B1L B;  5DNM D;  5GT0 B;  4KHA A;  1HQ3 D;  3REH C;  4WU9 B;  3WKJ B;  2FFF B;  4WU8 C;  3AZJ A;  1F66 B;  1P3F A;  1TAF B;  3X1T A;  1P3K A;  5AVC B;  1KX3 D;  5CPK A;  1U35 A;  4J8V A;  3B0D C;  2Y2O A;  3V9R A;  3VH5 A;  2PYO D;  3MVD A;  2NZD B;  5B24 B;  1S32 D;  3AN2 B;  1P3I A;  3WA9 A;  1AOI D;  3W97 D;  5B1L A;  5GT0 A;  3LZ0 D;  1P3L A;  3AL0 C;  5F99 D;  5GSU D;  3AZM D;  4WU9 A;  3AZF A;  5AY8 D;  4JJN D;  5AV6 C;  2XD1 A;  2Y2N A;  3B6F C;  1TAF A;  4KUD B;  5BNV B;  5AVC A;  2RIQ A;  2ZM5 A;  3X1V B;  4LD9 C;  3KUY D;  3FDD A;  4XUJ D;  5CPJ C;  3W99 C;  1BFM A;  4ZBJ B;  5B32 G;  4YS3 C;  3B0D B;  3AFA C;  3UTA D;  5B24 A;  2YFV B;  3WAA B;  3AN2 A;  5AVB C;  1TZY D;  5CHL B;  1A7W A;  1N1J B;  4Z2M H;  4Z66 C;  5B1M B;  3TU4 C;  1WWS A;  5B40 B;  4KUD A;  1P3A C;  4HGA C;  3B6F B;  3X1V A;  5GXQ C;  2ARO D;  2Y2Q A;  3AZE C;  2YFV A;  3WAA A;  1KX3 B;  3B6G D;  3MGR D;  5AVB B;  4J8U C;  2BG1 A;  3W96 C;  5CPI C;  3A1K A;  1EQZ C;  2F2A C;  5B1M A;  5B33 C;  1AOI B;  3W97 B;  2NQB B;  1P3K D;  2Y2M A;  5CPK D;  3B6F A;  1U35 D;  2ZY4 A;  1P3A B;  4J8V D;  3MVD D;  4KGC C;  4JJN B;  5CPJ A;  4DRA A;  4YS3 A;  3WA9 D;  2ZY2 A;  3AZK C;  5B1L D;  3VH6 T;  5AVB A;  5GT0 D;  1P3L D;  3KUY B;  4XUJ B;  4WU9 D;  4G92 B;  3UTA B;  1ID3 C;  3AZF D;  5B32 C;  4Z66 A;  2BYK B;  5DNN C;  2NQB A;  5AVC D;  3REL C;  3MGQ C;  1P3A A;  5BO0 B;  1BH8 B;  2LY8 A;  5GXQ A;  3LEL B;  4JJN A;  5B24 D;  3AN2 D;  1M1A B;  5JRG B;  3MGP C;  3AZK B;  3REI C;  1P34 C;  3C1C C;  2ARO B;  4QLC C;  5BNX B;  2YFW B;  3UTA A;  3AZG C;  3REH D;  1ID3 B;  5AV9 B;  5B32 B;  1H3O A;  4R8P C;  3B6G B;  4KUD D;  3X1V D;  2IO5 C;  3LJA B;  3REL B;  3AZH C;  5BO0 A;  4E45 A;  3LEL A;  1KU5 A;  3WAA D;  4J8W C;  4G91 C;  1M1A A;  5JRG A;  3AZK A;  1PZR A;  2ZY3 A;  3MGP B;  5BNX A;  3W98 C;  4QLC B;  2HUE C;  5AV8 C;  5B0Y C;  3H0L C;  1ID3 A;  5B1M D;  5AV9 A;  5B0Z B;  5B32 A;  4AWL B;  3WA9 B;  5AV6 D;  3B6G A;  3KFU G;  4EO5 C;  1F1E A;  3B6F D;  1P3L B;  3X1S C;  5DNN A;  3REJ C;  3LJA A;  3REL A;  4Z5T C;  3KSY A;  3AZF B;  4WV4 B;  1P3P C;  5CPJ D;  1ZLA C;  3W99 D;  5B2I C;  4YS3 D;  3AFA D;  3VH6 A;  5KDM B;  4J8X C;  5AVB D;  1P3O C;  5C3I C;  5B2J C;  3MGP A;  4QLC A;  4Z66 D;  1W2E A;  3AZG A;  2Y2L A;  5B0Z A;  2HIO C;  2NQB D;  3TU4 D;  4EO5 B;  1P3G C;  2L5A A;  1P3A D;  2F8N K;  2F8N G;  3REJ B;  3AZH A;  5GXQ D;  4Z5T B;  3REH B;  3EPJ A;  3AV2 C;  4WU8 B;  5KDM A;  3AZE D;  5B2I B;  4H9O B;  1P3O B;  4WZS B;  3EPL A;  4WNN B;  4H9R B;  5AV5 C;  3X1U C;  4ZUX C;  3AYW C;  3F6T A;  4CSR B;  5B33 D;  3REK C;  2JCH A;  3KXB C;  3MNN C;  5CP6 C;  3B0C W;  3EPK A;  3REJ A;  4Z5T A;  3MGS C;  3LEL D;  3REH A;  2Y2K A;  4WU8 A;  5AV6 B;  2Y2H A;  5B2I A;  3UT9 C;  5DNM C;  3AV2 B;  1M1A D;  5JRG D;  3AZK D;  1HQ3 C;  4H9O A;  1Z2C B;  4LD9 B;  1P3O A;  5B31 G;  1P3B C;  5CPJ B;  3W99 B;  1ID3 D;  4WNN A;  4YS3 B;  3AFA B;  5AV9 D;  4H9R A;  3A6N C;  1ULY A;  4M6B A;  5B32 D;  2W8S A;  2CV5 C;  4CSR A;  3AZN C;  3AYW B;  4H9P B;  5DNN D;  1P3M C;  3LJA D;  3REK B;  3REL D;  3VH5 W;  3KXB B;  4Z66 B;  1S32 C;  4H9S C;  5AV6 A;  1KX4 C;  3TU4 B;  3AV2 A;  3LZ0 C;  2CWE A;  4X23 C;  4HGA B;  3AZM C;  3MGP D;  4LD9 A;  5AY8 C;  5GXQ B;  3REI D;  2FJ7 C;  4QLC D;  3AZG D;  3W99 A;  3AFA A;  5B0Z D;  1P3B B;  3AZE B;  5BS7 C;  3UTB C;  3A6N B;  3X1U A;  5E5A C;  3AYW A;  4H9P A;  3REK A;  3AZN B;  4J8U B;  3KXB A;  3LZ1 C;  2Y2J A;  3MNN A;  4DRB A;  5CP6 A;  3KWQ C;  3AZH D;  1KX5 C;  3W96 B;  5CPI B;  1EQZ B;  1H3O B;  1T3U A;  1TZY C;  3AZL C;  4YM6 C;  3TU4 A;  5B33 B;  4J8W D;  1KX4 B;  2RVQ D;  1B6W A;  3C1B C;  1WWI A;  5BT1 C;  3W98 D;  2F8N B;  4KGC B;  1P3B A;  2DF4 C;  2F8N H;  3AZE A;  1M19 C;  3AV1 C;  3A6N A;  3MNN D;  2CV5 A;  3AZN A;  4J8U A;  3X1S D;  3REJ D;  1P3M A;  3W96 A;  4Z5T D;  5B31 C;  3WTP C;  5CPI A;  3KWQ B;  1EQZ A;  4WU8 D;  4H9S A;  3MGR C;  5B2I D;  3WTP E;  5B33 A;  1KX4 A;  3AZL B;  5DNN B;  4YM6 B;  5JA4 B;  2Y2I A;  1Q9C A;  4X23 A;  3MGQ B;  1P3O D;  3AZJ C;  1P3F C;  2FJ7 A;  2F8N A;  4KGC A;  3X1T C;  1P3K C;  2G5H C;  5CPK C;  3H0M C;  1M19 B;  4J8V C;  3UTB A;  3AV1 B;  4XZQ C;  3R45 B;  5E5A A;  3REI B;  1P34 B;  3C1C B;  3AZG B;  3KWQ A;  3C1C A;  3AZI C;  1P3I C;  1HTA A;  3AV2 D;  5GT0 C;  4R8P B;  3AZL A;  4YM6 A;  2XD5 A;  3O62 C;  4WU9 C;  5JA4 A;  1M18 C;  2IO5 B;  3WKJ C;  4LD9 D;  3MGQ A;  3AZH B;  3C1B A;  1F66 C;  5AVC C;  4WJ3 C;  1B67 A;  4J8W B;  4G91 B;  1M19 A;  3X1U D;  3AYW D;  3AV1 A;  3P5J B;  3REK D;  3R45 A;  4H9Q A;  3KXB D;  3REI A;  1P34 A;  2NZD C;  5B24 C;  5CP6 D;  3W98 B; 
#chains in the Genus database with same CATH homology
 4DQY B;  3AN2 C;  2HUE B;  5AV8 B;  5B0Y B;  3H0R C;  1JFI B;  4R8P A;  3UT9 D;  3EG5 B;  3X1S B;  4UUZ B;  3O62 B;  1M18 B;  2ZY5 A;  1P3P B;  4KUD C;  1P3B D;  1ZLA B;  5GT3 C;  3EPH A;  3X1V C;  3A6N D;  4J8W A;  4J8X B;  2CV5 D;  4ZBJ C;  3AZN D;  4J8U D;  1P3M D;  3W96 D;  4XZQ A;  5C3I B;  5B2J B;  3WAA C;  3W98 A;  5CPI D;  2Y2P A;  5AV8 A;  5B0Y A;  1EQZ D;  5G49 B;  1JFI A;  2HIO B;  3AZI A;  1KX4 D;  3X1S A;  4UUZ A;  1P3G B;  4X23 D;  4E44 A;  3O62 A;  5B1M C;  3WKJ A;  3NQJ B;  1M18 A;  2FJ7 D;  5B40 C;  1P3P A;  2F8N D;  4KGC D;  1ZLA A;  1F66 A;  5GT3 B;  3UTB D;  4J8X A;  5E5A D;  4CAY B;  5B2J A;  2NZD A;  4UPK A;  3LZ1 D;  3KWQ D;  2JE5 A;  1KX3 C;  3VH6 W;  1KX5 D;  5G49 A;  2HIO A;  5AV5 B;  3X1U B;  4ZUX B;  4YM6 D;  3AZL D;  2PYO C;  2JSS A;  3NQU B;  1P3G A;  3MNN B;  3MGQ D;  5CP6 B;  3C1B D;  3NQJ A;  5BT1 D;  3MGS B;  1AOI C;  3W97 C;  2NQB C;  5BNV A;  5GT3 A;  3UT9 B;  1M19 D;  5DNM B;  5F99 C;  5GSU C;  3AV1 D;  1P34 D;  1HQ3 B;  4CAY A;  4H9N B;  4JJN C;  3C1C D;  3WTP D;  5B31 D;  5AV5 A;  3KUY C;  4R8P D;  4ZUX A;  4XUJ C;  2CV5 B;  3UTA C;  1N1J A;  4G92 C;  3NQU A;  1P3M B;  2PYO B;  3MGS A;  3B0C T;  3AZJ D;  1S32 B;  1P3F D;  5B40 A;  4NE5 A;  3X1T D;  3UT9 A;  5DNM A;  3LZ0 B;  3B0B A;  1HQ3 A;  5F99 B;  5GSU B;  4H9N A;  4NFT A;  4X23 B;  3LEL C;  3AZM B;  4XZQ D;  5AY8 B;  2FJ7 B;  5AV8 D;  5B0Y D;  1M1A C;  1P3I D;  5JRG C;  3AZI D;  1KX3 A;  3UTB B;  2ARO C;  5E5A B;  2G5I C;  3O62 D;  2PYO A;  5AV9 C;  1M18 D;  3WKJ D;  3LZ1 B;  3VH5 T;  1P3P D;  1BH9 B;  1S32 A;  1KX5 B;  1ZLA D;  3B6G C;  2UWX A;  1F66 D;  3W97 A;  1AOI A;  1TZY B;  3LJA C;  3LZ0 A;  4J8X D;  5F99 A;  5GSU A;  3AZM A;  3C1B B;  5B2J D;  5AY8 A;  2NZD D;  2BYM B;  4Z2M G;  1U35 C;  2HIO D;  5BS7 A;  3MVD C;  3KUY A;  2VQR A;  4H9Q B;  4XUJ A;  1P3G D;  5B0Z C;  3LZ1 A;  4AWL C;  3WA9 C;  5FUG B;  3WTP B;  5B31 B;  1BH9 A;  3A1I A;  1KX5 A;  2BYK A;  5B1L C;  1P3L C;  1TZY A;  5GT3 D;  3MGR B;  4KHA B;  3AZF C;  1BH8 A;  2Y2G A;  3AZJ B;  1P3F B;  2BYM A;  3X1T B;  1P3K B;  2RVQ C;  5AV5 D;  5CPK B;  1U35 B;  4ZUX D;  2DQN C;  4NE6 A;  4NE3 A;  4J8V B;  3V9R B;  2ARO A;  2YFW A;  4XZQ B;  3MVD B;  2J8P A;  5FUG A;  3WTP A;  5B31 A;  3MGS D;  3IP4 C;  1P3I B;  3AZI B;  5B40 D;  3MGR A;  1R4V A;  5B1L B;  5DNM D;  5GT0 B;  4KHA A;  1HQ3 D;  3REH C;  4WU9 B;  3WKJ B;  2FFF B;  4WU8 C;  3AZJ A;  1F66 B;  1P3F A;  1TAF B;  3X1T A;  1P3K A;  5AVC B;  1KX3 D;  5CPK A;  1U35 A;  4J8V A;  3B0D C;  2Y2O A;  3V9R A;  3VH5 A;  2PYO D;  3MVD A;  2NZD B;  5B24 B;  1S32 D;  3AN2 B;  1P3I A;  3WA9 A;  1AOI D;  3W97 D;  5B1L A;  5GT0 A;  3LZ0 D;  1P3L A;  3AL0 C;  5F99 D;  5GSU D;  3AZM D;  4WU9 A;  3AZF A;  5AY8 D;  4JJN D;  5AV6 C;  2XD1 A;  2Y2N A;  3B6F C;  1TAF A;  4KUD B;  5BNV B;  5AVC A;  2RIQ A;  2ZM5 A;  3X1V B;  4LD9 C;  3KUY D;  3FDD A;  4XUJ D;  5CPJ C;  3W99 C;  1BFM A;  4ZBJ B;  5B32 G;  4YS3 C;  3B0D B;  3AFA C;  3UTA D;  5B24 A;  2YFV B;  3WAA B;  3AN2 A;  5AVB C;  1TZY D;  5CHL B;  1A7W A;  1N1J B;  4Z2M H;  4Z66 C;  5B1M B;  3TU4 C;  1WWS A;  5B40 B;  4KUD A;  1P3A C;  4HGA C;  3B6F B;  3X1V A;  5GXQ C;  2ARO D;  2Y2Q A;  3AZE C;  2YFV A;  3WAA A;  1KX3 B;  3B6G D;  3MGR D;  5AVB B;  4J8U C;  2BG1 A;  3W96 C;  5CPI C;  3A1K A;  1EQZ C;  2F2A C;  5B1M A;  5B33 C;  1AOI B;  3W97 B;  2NQB B;  1P3K D;  2Y2M A;  5CPK D;  3B6F A;  1U35 D;  2ZY4 A;  1P3A B;  4J8V D;  3MVD D;  4KGC C;  4JJN B;  5CPJ A;  4DRA A;  4YS3 A;  3WA9 D;  2ZY2 A;  3AZK C;  5B1L D;  3VH6 T;  5AVB A;  5GT0 D;  1P3L D;  3KUY B;  4XUJ B;  4WU9 D;  4G92 B;  3UTA B;  1ID3 C;  3AZF D;  5B32 C;  4Z66 A;  2BYK B;  5DNN C;  2NQB A;  5AVC D;  3REL C;  3MGQ C;  1P3A A;  5BO0 B;  1BH8 B;  2LY8 A;  5GXQ A;  3LEL B;  4JJN A;  5B24 D;  3AN2 D;  1M1A B;  5JRG B;  3MGP C;  3AZK B;  3REI C;  1P34 C;  3C1C C;  2ARO B;  4QLC C;  5BNX B;  2YFW B;  3UTA A;  3AZG C;  3REH D;  1ID3 B;  5AV9 B;  5B32 B;  1H3O A;  4R8P C;  3B6G B;  4KUD D;  3X1V D;  2IO5 C;  3LJA B;  3REL B;  3AZH C;  5BO0 A;  4E45 A;  3LEL A;  1KU5 A;  3WAA D;  4J8W C;  4G91 C;  1M1A A;  5JRG A;  3AZK A;  1PZR A;  2ZY3 A;  3MGP B;  5BNX A;  3W98 C;  4QLC B;  2HUE C;  5AV8 C;  5B0Y C;  3H0L C;  1ID3 A;  5B1M D;  5AV9 A;  5B0Z B;  5B32 A;  4AWL B;  3WA9 B;  5AV6 D;  3B6G A;  3KFU G;  4EO5 C;  1F1E A;  3B6F D;  1P3L B;  3X1S C;  5DNN A;  3REJ C;  3LJA A;  3REL A;  4Z5T C;  3KSY A;  3AZF B;  4WV4 B;  1P3P C;  5CPJ D;  1ZLA C;  3W99 D;  5B2I C;  4YS3 D;  3AFA D;  3VH6 A;  5KDM B;  4J8X C;  5AVB D;  1P3O C;  5C3I C;  5B2J C;  3MGP A;  4QLC A;  4Z66 D;  1W2E A;  3AZG A;  2Y2L A;  5B0Z A;  2HIO C;  2NQB D;  3TU4 D;  4EO5 B;  1P3G C;  2L5A A;  1P3A D;  2F8N K;  2F8N G;  3REJ B;  3AZH A;  5GXQ D;  4Z5T B;  3REH B;  3EPJ A;  3AV2 C;  4WU8 B;  5KDM A;  3AZE D;  5B2I B;  4H9O B;  1P3O B;  4WZS B;  3EPL A;  4WNN B;  4H9R B;  5AV5 C;  3X1U C;  4ZUX C;  3AYW C;  3F6T A;  4CSR B;  5B33 D;  3REK C;  2JCH A;  3KXB C;  3MNN C;  5CP6 C;  3B0C W;  3EPK A;  3REJ A;  4Z5T A;  3MGS C;  3LEL D;  3REH A;  2Y2K A;  4WU8 A;  5AV6 B;  2Y2H A;  5B2I A;  3UT9 C;  5DNM C;  3AV2 B;  1M1A D;  5JRG D;  3AZK D;  1HQ3 C;  4H9O A;  1Z2C B;  4LD9 B;  1P3O A;  5B31 G;  1P3B C;  5CPJ B;  3W99 B;  1ID3 D;  4WNN A;  4YS3 B;  3AFA B;  5AV9 D;  4H9R A;  3A6N C;  1ULY A;  4M6B A;  5B32 D;  2W8S A;  2CV5 C;  4CSR A;  3AZN C;  3AYW B;  4H9P B;  5DNN D;  1P3M C;  3LJA D;  3REK B;  3REL D;  3VH5 W;  3KXB B;  4Z66 B;  1S32 C;  4H9S C;  5AV6 A;  1KX4 C;  3TU4 B;  3AV2 A;  3LZ0 C;  2CWE A;  4X23 C;  4HGA B;  3AZM C;  3MGP D;  4LD9 A;  5AY8 C;  5GXQ B;  3REI D;  2FJ7 C;  4QLC D;  3AZG D;  3W99 A;  3AFA A;  5B0Z D;  1P3B B;  3AZE B;  5BS7 C;  3UTB C;  3A6N B;  3X1U A;  5E5A C;  3AYW A;  4H9P A;  3REK A;  3AZN B;  4J8U B;  3KXB A;  3LZ1 C;  2Y2J A;  3MNN A;  4DRB A;  5CP6 A;  3KWQ C;  3AZH D;  1KX5 C;  3W96 B;  5CPI B;  1EQZ B;  1H3O B;  1T3U A;  1TZY C;  3AZL C;  4YM6 C;  3TU4 A;  5B33 B;  4J8W D;  1KX4 B;  2RVQ D;  1B6W A;  3C1B C;  1WWI A;  5BT1 C;  3W98 D;  2F8N B;  4KGC B;  1P3B A;  2DF4 C;  2F8N H;  3AZE A;  1M19 C;  3AV1 C;  3A6N A;  3MNN D;  2CV5 A;  3AZN A;  4J8U A;  3X1S D;  3REJ D;  1P3M A;  3W96 A;  4Z5T D;  5B31 C;  3WTP C;  5CPI A;  3KWQ B;  1EQZ A;  4WU8 D;  4H9S A;  3MGR C;  5B2I D;  3WTP E;  5B33 A;  1KX4 A;  3AZL B;  5DNN B;  4YM6 B;  5JA4 B;  2Y2I A;  1Q9C A;  4X23 A;  3MGQ B;  1P3O D;  3AZJ C;  1P3F C;  2FJ7 A;  2F8N A;  4KGC A;  3X1T C;  1P3K C;  2G5H C;  5CPK C;  3H0M C;  1M19 B;  4J8V C;  3UTB A;  3AV1 B;  4XZQ C;  3R45 B;  5E5A A;  3REI B;  1P34 B;  3C1C B;  3AZG B;  3KWQ A;  3C1C A;  3AZI C;  1P3I C;  1HTA A;  3AV2 D;  5GT0 C;  4R8P B;  3AZL A;  4YM6 A;  2XD5 A;  3O62 C;  4WU9 C;  5JA4 A;  1M18 C;  2IO5 B;  3WKJ C;  4LD9 D;  3MGQ A;  3AZH B;  3C1B A;  1F66 C;  5AVC C;  4WJ3 C;  1B67 A;  4J8W B;  4G91 B;  1M19 A;  3X1U D;  3AYW D;  3AV1 A;  3P5J B;  3REK D;  3R45 A;  4H9Q A;  3KXB D;  3REI A;  1P34 A;  2NZD C;  5B24 C;  5CP6 D;  3W98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...