1P3GD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gD00
4J8VC 2CV5C 2PYOC 4NE6A 2FJ7C 4WU8B 1P3BC 4J8UB 4WU8D 4J8UD 1TAFB 3UTBC 3LJAC 3NQJB 5GT3B 3MVDC 5AY8A 4XUJC 3B0CT 3REHA 3WTPA 5B0ZA 5E5AA 4ZUXB 5B1LA 4ZUXD 1ZLAD 4G92C 4QLCA 4J8WA 5F99C 1JFIB 4WZSB 4WU9A 3X1SA 3KXBC 3AV1A 4R8PA 1P3PC 1TZYC 4H9NA 5B40D 1P34C 3AZHA 2F8NH 4Z5TA 5CP6A 3REJA 4LD9B 5CPKB 4LD9D 3WA9A 3AZMA 1P3LC 1KX3A 4H9QB 5BNVA 2AROB 4KHAB 1B67A 1F66A 4DRBA 3KWQA 1S32A 5DNMA 1P3MA 5B31A 5BO0A 3W99A 3AN2B 2LY8A 3AN2D 5DNNA 3B6FA 2HIOB 2HIOD 5AY8C 3UTAC 3REHC 3WTPC 3A6NB 3B0DB 3A6ND 3KUYB 3AFAB 3AZNB 5B0ZC 3AZND 5E5AC 4WU8A 3AFAD 3MGRB 2YFVB 5GXQB 4J8UA 3MGRD 5GXQD 5B1LC 4J8XB 5F99D 5B2JB 4J8XD 2HUEB 5B2JD 4QLCC 3AZIB 3NQJA 3AZID 4J8WC 5GT3A 1P3PD 4WU9C 3C1BB 3X1SC 3C1BD 3AV1C 4R8PC 5AV5B 4ZUXA 4H9OB 4HGAC 3AV2B 3AZHC 3AV2D 5CP6C 3REJC 3LZ0B 3LZ0D 1JFIA 4G91B 3WA9C 3W96B 3AZMC 1KX3C 5B40A 2RVQD 1BH8B 4AWLC 4UUZB 1F66C 4LD9A 1S32C 5DNMC 3REIB 1P3MC 3V9RB 5B31C 1U35B 3AZLB 3W99C 1U35D 4ZBJC 3AZLD 4H9QA 5DNNC 3B6FC 3WAAB 4KHAA 3WAAD 3AYWB 3AZGB 3AYWD 4WU8C 4J8UC 3AN2A 2F8NB 2F8ND 4WU9D 2HIOA 5GT3C 3AV1D 1P3FB 3A6NA 1P3FD 3VH6T 3KUYA 3AZNA 3AFAA 4Z5TD 2YFVA 3VH6A 4ZUXC 5AV6B 5AV6D 5GXQA 3MGRA 4J8XA 5B2JA 3AZIA 3RELD 5AV8B 3MNNB 2JSSA 5AV8D 3MNND 3MGQB 4Z2MG 3MGQD 5G49B 3C1BA 5AV5A 4H9OA 5B40C 3KWQD 1S32D 1R4VA 5DNMD 3AV2A 5BT1D 3LZ0A 4LD9C 3W96A 4KUDB 5DNND 3WKJB 3B6FD 1B6WA 3B0CW 3AZJB 3AZJD 1BH8A 2F8NK 4UUZA 3REIA 3V9RA 1U35A 3AZLA 5AVCB 5AVCD 1HTAA 3B6GB 3AN2C 2BYKB 1AOIB 5GT3D 5BNXB 5KDMB 4JJNB 2HIOC 3WAAA 3A6NC 3B0DC 3AYWA 3AZGA 3AZNC 3AFAC 3MGRC 5GXQC 2F8NA 4J8XC 5B2JC 2HUEC 4H9RB 3AZIC 1P3FA 5BS7A 3C1BC 5AV6A 5AV5C 5AV9B 4Z2MH 5GT0B 5AV9D 5B0YB 5CPKD 5B0YD 3AV2C 4H9PB 2CWEA 3RELA 5CHLB 3LZ0C 5AV8A 3MNNA 4G91C 3MGQA 4NE3A 3W96C 3X1UB 3X1UD 5G49A 5JRGB 2AROD 3UT9B 5JRGD 2RVQC 3LZ1B 3LZ1D 1U35C 2YFWB 3AZLC 5B32G 3C1CB 3C1CD 4KUDA 3WKJA 2NQBB 2NQBD 3O62B 1H3OB 3W98B 3TU4B 5CPJB 3AZJA 3W98D 5B33B 5CPJD 5B33D 4Z66B 3KUYD 3WAAC 1TAFA 3X1VB 3AZKB 5AVCA 2IO5B 3AZGC 1N1JB 3AYWC 3X1VD 1M18B 2PYOB 3B6GA 2FJ7B 2BYKA 1AOIA 1P3GB 4YS3B 1P3GD 5C3IB 5BNXA 5AVBB 5AVBD 5KDMA 4JJNA 5B1MB 5B1MD 5AV5D 1P3FC 5BS7C 4Z5TC 5AV6C 4CAYB 3R45B 5CPIB 3RELC 5CPID 3W96D 5GSUB 5GSUD 5AV8C 3MNNC 1Q9CA 3MGQC 2L5AA 3AZFB 3MGPB 3AZFD 1P3OB 3MGPD 1P3OD 5AV9A 3KWQC 5CPKA 5B0YA 3REID 1TZYB 4H9PA 5BT1C 4EO5C 3AZEB 4X23B 4X23D 3X1UA 2AROA 3UT9A 5JRGA 3AZJC 3VH6W 3AZGD 3LZ1A 2YFWA 5AVCC 3C1CA 2NQBA 3O62A 1AOIC 1H3OA 3W98A 3TU4A 5CPJA 5B33A 4JJNC 4Z66A 1P3IB 5JA4B 3X1VA 3UTAB 3AZKA 1P3ID 1M18A 1N1JA 3LELB 3LELD 1P3GA 1M1AB 4YS3A 1M1AD 5AVBA 5B1MA 4J8WB 3X1SB 5AV9C 4CAYA 3R45A 5CPKC 5B0YC 4NE5A 4KGCB 4KGCD 5CPIA 5GSUA 1HQ3B 4KUDD 1HQ3D 3WKJD 3X1UC 2AROC 5JRGC 3AZFA 3MGPA 1P3OA 1KX3B 4WV4B 3AZEA 3B0BA 3MGSB 1M19B 4X23A 3LZ1C 3MGSD 4WNNB 1M19D 3B6GD 1AOID 1KX5B 3C1CC 2NQBC 4JJND 4YM6B 3O62C 4DRAA 4YM6D 3W98C 3TU4C 5CPJC 5B33C 3KUYC 3W97B 4Z66C 3W97D 1ID3B 1ID3D 2NZDB 5FUGB 3X1VC 4E45A 3AZKC 1M18C 2IO5C 1EQZB 1EQZD 2NZDD 5B2IB 5B2ID 2BYMB 1P3GC 4YS3C 5B31G 5C3IC 5AVBC 3X1TB 3X1TD 3WTPE 5B1MC 1P3IA 5JA4A 5GT0D 3UTAA 1ULYA 1KX4B 1KX4D 3LELA 5B32B 5B32D 1M1AA 5CPIC 1ZLAB 1F1EA 3REKB 3UT9D 5GSUC 3REKD 3AZFC 3MGPC 1P3OC 5B24B 4KGCA 5B24D 3REIC 3NQUB 3AZEC 5B40B 4X23C 1HQ3A 1P3KB 1BFMA 1P3KD 3O62D 3TU4D 1P3AB 1P3AD 4Z66D 4XZQB 4XZQD 4J8VB 4J8VD 2CV5B 3AZKD 3MGSA 2CV5D 1M19A 1M18D 4WNNA 2PYOD 1P3BB 2FJ7D 1P3BD 4YS3D 1KX5A 3UTBB 3UTBD 3LJAB 4M6BA 4YM6A 3LJAD 4E44A 3MVDB 4XUJB 3MVDD 3W97A 4XUJD 3KSYA 1ID3A 2NZDA 5FUGA 1P3IC 1EQZA 4H9SA 4H9RA 5B2IA 3LELC 4G92B 4CSRB 2BYMA 1A7WA 1M1AC 5F99B 1KU5A 3X1TA 3KXBB 5GT0A 1P3PB 3KXBD 1KX4A 1TZYD 3AZED 1P34B 4KGCC 5B32A 1P34D 1ZLAA 1BH9B 3REKA 4KUDC 1HQ3C 3WKJC 1P3LB 1P3LD 5B24A 3NQUA 3MGSC 1M19C 3B6GC 1P3KA 1KX5C 1P3AA 4XZQA 4YM6C 4J8VA 5AY8B 2CV5A 5AY8D 3REHB 3UTAD 3WTPB 3W97C 3REHD 2PYOA 3WTPD 1ID3C 2FJ7A 5B0ZB 5E5AB 1P3BA 5B0ZD 2NZDC 5E5AD 1EQZC 1WWIA 5B1LB 4H9SC 5B1LD 5B2IC 3UTBA 4QLCB 4QLCD 3LJAA 3MVDA 4J8WD 4XUJA 3X1TC 4WU9B 5GT0C 3X1SD 4R8PB 4NFTA 3AV1B 4R8PD 4HGAB 4H9NB 1KX4C 3AZHB 5B32C 3AZHD 5CP6B 4Z5TB 4CSRA 3REJB 5CP6D 3REJD 3VH5W 5F99A 1ZLAC 3UT9C 3REKC 3WA9B 3WA9D 3RELB 3AZMB 3AZMD 2F8NG 3KXBA 1P3PA 1WWSA 5BNVB 1TZYA 1KX3D 1P34A 5B24C 4AWLB 1F66B 3KWQB 1S32B 5DNMB 3VH5T 1BH9A 1P3MB 5B31B 1F66D 5BO0B 1P3MD 5B31D 1KX5D 4ZBJB 3VH5A 3W99D 4EO5B 3W99B 1P3KC 1P3LA 1P3AC 4XZQC 5DNNB 3B6FB
chains in the Genus database with same CATH superfamily
4J8VC 2CV5C 2PYOC 4NE6A 2FJ7C 4WU8B 1P3BC 4J8UB 4WU8D 4J8UD 1TAFB 3AL0C 3UTBC 3LJAC 3NQJB 5GT3B 3MVDC 5AY8A 4XUJC 3B0CT 3REHA 3WTPA 5B0ZA 5E5AA 4ZUXB 3P5JB 5B1LA 4ZUXD 1ZLAD 2Y2HA 4G92C 4QLCA 4J8WA 5F99C 1JFIB 4WZSB 4WU9A 3X1SA 3KXBC 3AV1A 4R8PA 1P3PC 1TZYC 4H9NA 5B40D 1P34C 3AZHA 2F8NH 4Z5TA 5CP6A 3REJA 4LD9B 5CPKB 4LD9D 3WA9A 3AZMA 1P3LC 1KX3A 4H9QB 5BNVA 2AROB 4KHAB 1B67A 1F66A 4DRBA 3KWQA 1S32A 5DNMA 2XD1A 1P3MA 5B31A 5BO0A 3W99A 2G5HC 3AN2B 2LY8A 3AN2D 5DNNA 3B6FA 2HIOB 3EPLA 2HIOD 5AY8C 3UTAC 3REHC 3WTPC 3A6NB 3B0DB 3A6ND 3KUYB 3AFAB 3AZNB 5B0ZC 3AZND 5E5AC 4WU8A 3AFAD 3MGRB 2YFVB 5GXQB 4J8UA 3MGRD 2Y2MA 5GXQD 5B1LC 4J8XB 5F99D 5B2JB 4J8XD 2HUEB 5B2JD 4QLCC 3AZIB 3NQJA 3AZID 2Y2JA 4J8WC 5GT3A 1P3PD 4WU9C 3C1BB 3X1SC 2XD5A 3C1BD 3AV1C 4R8PC 5AV5B 4ZUXA 4H9OB 4HGAC 3AV2B 3AZHC 3AV2D 5CP6C 3REJC 4DQYB 3LZ0B 3LZ0D 1JFIA 4G91B 3WA9C 3W96B 3AZMC 1W2EA 1KX3C 5B40A 2RVQD 1BH8B 4AWLC 4UUZB 1F66C 4LD9A 1S32C 5DNMC 3REIB 1P3MC 3V9RB 5B31C 1U35B 3AZLB 3W99C 1U35D 4ZBJC 3AZLD 4H9QA 5DNNC 3B6FC 2Y2GA 3WAAB 4KHAA 3WAAD 3AYWB 3AZGB 3AYWD 4WU8C 4J8UC 3AN2A 2F8NB 2F8ND 4WU9D 2HIOA 5GT3C 3AV1D 1P3FB 3A6NA 1P3FD 3VH6T 3KUYA 3AZNA 3AFAA 4Z5TD 2YFVA 3VH6A 4ZUXC 5AV6B 5AV6D 5GXQA 3MGRA 4J8XA 5B2JA 3AZIA 3RELD 5AV8B 3MNNB 2JSSA 5AV8D 3MNND 3MGQB 4Z2MG 2FFFB 3MGQD 5G49B 3C1BA 5AV5A 4H9OA 5B40C 3KWQD 1S32D 1R4VA 5DNMD 3AV2A 5BT1D 3LZ0A 4LD9C 3F6TA 3W96A 2Y2PA 2Y2IA 4KUDB 5DNND 3WKJB 3B6FD 3EPKA 1B6WA 3B0CW 3AZJB 2DQNC 3AZJD 3H0MC 1BH8A 2F8NK 4UUZA 2ZY2A 3REIA 3V9RA 1U35A 3AZLA 5AVCB 5AVCD 1HTAA 3B6GB 3AN2C 2BYKB 1AOIB 5GT3D 5BNXB 5KDMB 4JJNB 2HIOC 3WAAA 3A6NC 3B0DC 3AYWA 3AZGA 3AZNC 3AFAC 3MGRC 5GXQC 2F8NA 4J8XC 5B2JC 2HUEC 4H9RB 3AZIC 1P3FA 5BS7A 3C1BC 5AV6A 5AV5C 5AV9B 3H0RC 4Z2MH 5GT0B 5AV9D 5B0YB 5CPKD 5B0YD 3AV2C 4H9PB 2CWEA 3RELA 5CHLB 3LZ0C 5AV8A 3MNNA 4G91C 3MGQA 4NE3A 3W96C 3X1UB 3X1UD 5G49A 5JRGB 2AROD 3UT9B 5JRGD 2RVQC 2UWXA 3LZ1B 3LZ1D 1U35C 2YFWB 3AZLC 5B32G 3C1CB 4WJ3C 3C1CD 2ZM5A 3WKJA 4KUDA 2NQBB 2NQBD 3O62B 2ZY5A 1H3OB 3W98B 3TU4B 5CPJB 3AZJA 3W98D 5B33B 5CPJD 5B33D 4Z66B 3KUYD 3WAAC 1TAFA 3X1VB 3AZKB 5AVCA 2IO5B 3AZGC 1N1JB 3AYWC 3X1VD 1M18B 2PYOB 3B6GA 2FJ7B 2BYKA 1AOIA 1P3GB 2Y2KA 4YS3B 1P3GD 5C3IB 5BNXA 5AVBB 5AVBD 5KDMA 4JJNA 5B1MB 5B1MD 5AV5D 1P3FC 5BS7C 3A1IA 4Z5TC 5AV6C 4CAYB 3R45B 5CPIB 3RELC 5CPID 3W96D 5GSUB 5GSUD 5AV8C 3MNNC 1Q9CA 3MGQC 2ZY4A 2L5AA 3AZFB 3MGPB 3AZFD 1P3OB 3MGPD 1P3OD 5AV9A 3KWQC 5CPKA 5B0YA 3REID 2ZY3A 1TZYB 2DF4C 4H9PA 4EO5C 5BT1C 3AZEB 4X23B 4X23D 3X1UA 2AROA 3UT9A 5JRGA 3AZJC 3VH6W 3AZGD 3LZ1A 2YFWA 5AVCC 3H0LC 3C1CA 3FDDA 2JE5A 2NQBA 3O62A 1AOIC 1H3OA 3W98A 3TU4A 5CPJA 5B33A 2RIQA 4JJNC 4Z66A 1P3IB 5JA4B 3X1VA 3UTAB 3AZKA 1P3ID 1M18A 1N1JA 3LELB 3LELD 1P3GA 1M1AB 4YS3A 1M1AD 5AVBA 1PZRA 5B1MA 4J8WB 3EG5B 2G5IC 5AV9C 4CAYA 3R45A 3X1SB 5B0YC 4NE5A 2F2AC 5CPKC 4KGCB 4KGCD 5CPIA 5GSUA 1HQ3B 4KUDD 1HQ3D 3WKJD 3X1UC 2AROC 5JRGC 3AZFA 3MGPA 1P3OA 1KX3B 4WV4B 3AZEA 3B0BA 3MGSB 1M19B 4X23A 3LZ1C 3MGSD 2W8SA 4WNNB 1M19D 3B6GD 1AOID 1KX5B 3C1CC 2NQBC 4JJND 4YM6B 3O62C 4DRAA 4YM6D 3W98C 3TU4C 5CPJC 5B33C 3KUYC 3W97B 4Z66C 3W97D 1ID3B 1ID3D 2NZDB 5FUGB 3X1VC 4E45A 3AZKC 1M18C 2IO5C 1EQZB 1EQZD 3KFUG 2NZDD 3EPHA 5B2IB 5B2ID 2BYMB 1P3GC 5B31G 4YS3C 5C3IC 5AVBC 3X1TB 3X1TD 3WTPE 5B1MC 1P3IA 5JA4A 5GT0D 3UTAA 1ULYA 1KX4B 1KX4D 3LELA 5B32B 5B32D 1M1AA 5CPIC 1ZLAB 1F1EA 3REKB 3UT9D 5GSUC 2VQRA 3REKD 3AZFC 3MGPC 1P3OC 5B24B 4KGCA 5B24D 3REIC 3NQUB 3AZEC 5B40B 4X23C 3A1KA 1HQ3A 1P3KB 1BFMA 1P3KD 3O62D 3EPJA 3TU4D 1P3AB 1P3AD 4Z66D 4XZQB 4XZQD 4J8VB 4J8VD 2CV5B 3AZKD 3MGSA 2CV5D 1M19A 1M18D 4WNNA 2PYOD 1P3BB 2FJ7D 2Y2LA 1P3BD 4YS3D 1KX5A 3UTBB 3UTBD 3LJAB 4M6BA 2Y2OA 4YM6A 3LJAD 4E44A 3MVDB 4XUJB 3MVDD 3W97A 4XUJD 3KSYA 1ID3A 2NZDA 5FUGA 1P3IC 1EQZA 4H9SA 4H9RA 5B2IA 3LELC 4G92B 2BG1A 4CSRB 2BYMA 1A7WA 1M1AC 5F99B 1KU5A 3X1TA 3IP4C 3KXBB 5GT0A 1P3PB 3KXBD 1KX4A 1TZYD 3AZED 1P34B 2JCHA 5B32A 1P34D 4KGCC 1ZLAA 1BH9B 3REKA 4KUDC 1HQ3C 3WKJC 1P3LB 1P3LD 5B24A 3NQUA 2Y2QA 3MGSC 1M19C 3B6GC 1P3KA 2Y2NA 1KX5C 1P3AA 4XZQA 4UPKA 4YM6C 4J8VA 5AY8B 2CV5A 5AY8D 3REHB 3UTAD 3WTPB 3W97C 3REHD 2PYOA 3WTPD 1ID3C 2FJ7A 5B0ZB 5E5AB 1P3BA 5B0ZD 2NZDC 5E5AD 1EQZC 1WWIA 5B1LB 4H9SC 5B1LD 5B2IC 3UTBA 4QLCB 4QLCD 3LJAA 3MVDA 4J8WD 4XUJA 3X1TC 1Z2CB 4WU9B 5GT0C 3X1SD 4R8PB 4NFTA 3AV1B 4R8PD 4HGAB 4H9NB 1KX4C 3AZHB 5B32C 3AZHD 5CP6B 4Z5TB 4CSRA 3REJB 5CP6D 3REJD 3VH5W 2J8PA 5F99A 1ZLAC 3UT9C 3REKC 3WA9B 3WA9D 3RELB 3AZMB 3AZMD 2F8NG 3KXBA 1P3PA 1T3UA 1WWSA 5BNVB 1TZYA 1KX3D 1P34A 5B24C 4AWLB 1F66B 3KWQB 1S32B 5DNMB 3VH5T 1BH9A 1P3MB 5B31B 1F66D 5BO0B 1P3MD 5B31D 1KX5D 4ZBJB 3VH5A 3W99D 4EO5B 3W99B 1P3KC 1P3LA 1P3AC 4XZQC 5DNNB 3B6FB
chains in the Genus database with same CATH topology
4J8VC 2CV5C 2PYOC 4NE6A 2FJ7C 4WU8B 1P3BC 4J8UB 4WU8D 4J8UD 1TAFB 3AL0C 3UTBC 3LJAC 3NQJB 5GT3B 3MVDC 5AY8A 4XUJC 3B0CT 3REHA 3WTPA 5B0ZA 5E5AA 4ZUXB 3P5JB 5B1LA 4ZUXD 1ZLAD 2Y2HA 4G92C 4QLCA 4J8WA 5F99C 1JFIB 4WZSB 4WU9A 3X1SA 3KXBC 3AV1A 4R8PA 1P3PC 1TZYC 4H9NA 5B40D 1P34C 3AZHA 2F8NH 4Z5TA 5CP6A 3REJA 4LD9B 5CPKB 4LD9D 3WA9A 3AZMA 1P3LC 1KX3A 4H9QB 5BNVA 2AROB 4KHAB 1B67A 1F66A 4DRBA 3KWQA 1S32A 5DNMA 2XD1A 1P3MA 5B31A 5BO0A 3W99A 2G5HC 3AN2B 2LY8A 3AN2D 5DNNA 3B6FA 2HIOB 3EPLA 2HIOD 5AY8C 3UTAC 3REHC 3WTPC 3A6NB 3B0DB 3A6ND 3KUYB 3AFAB 3AZNB 5B0ZC 3AZND 5E5AC 4WU8A 3AFAD 3MGRB 2YFVB 5GXQB 4J8UA 3MGRD 2Y2MA 5GXQD 5B1LC 4J8XB 5F99D 5B2JB 4J8XD 2HUEB 5B2JD 4QLCC 3AZIB 3NQJA 3AZID 2Y2JA 4J8WC 5GT3A 1P3PD 4WU9C 3C1BB 3X1SC 2XD5A 3C1BD 3AV1C 4R8PC 5AV5B 4ZUXA 4H9OB 4HGAC 3AV2B 3AZHC 3AV2D 5CP6C 3REJC 4DQYB 3LZ0B 3LZ0D 1JFIA 4G91B 3WA9C 3W96B 3AZMC 1W2EA 1KX3C 5B40A 2RVQD 1BH8B 4AWLC 4UUZB 1F66C 4LD9A 1S32C 5DNMC 3REIB 1P3MC 3V9RB 5B31C 1U35B 3AZLB 3W99C 1U35D 4ZBJC 3AZLD 4H9QA 5DNNC 3B6FC 2Y2GA 3WAAB 4KHAA 3WAAD 3AYWB 3AZGB 3AYWD 4WU8C 4J8UC 3AN2A 2F8NB 2F8ND 4WU9D 2HIOA 5GT3C 3AV1D 1P3FB 3A6NA 1P3FD 3VH6T 3KUYA 3AZNA 3AFAA 4Z5TD 2YFVA 3VH6A 4ZUXC 5AV6B 5AV6D 5GXQA 3MGRA 4J8XA 5B2JA 3AZIA 3RELD 5AV8B 3MNNB 2JSSA 5AV8D 3MNND 3MGQB 4Z2MG 2FFFB 3MGQD 5G49B 3C1BA 5AV5A 4H9OA 5B40C 3KWQD 1S32D 1R4VA 5DNMD 3AV2A 5BT1D 3LZ0A 4LD9C 3F6TA 3W96A 2Y2PA 2Y2IA 4KUDB 5DNND 3WKJB 3B6FD 3EPKA 1B6WA 3B0CW 3AZJB 2DQNC 3AZJD 3H0MC 1BH8A 2F8NK 4UUZA 2ZY2A 3REIA 3V9RA 1U35A 3AZLA 5AVCB 5AVCD 1HTAA 3B6GB 3AN2C 2BYKB 1AOIB 5GT3D 5BNXB 5KDMB 4JJNB 2HIOC 3WAAA 3A6NC 3B0DC 3AYWA 3AZGA 3AZNC 3AFAC 3MGRC 5GXQC 2F8NA 4J8XC 5B2JC 2HUEC 4H9RB 3AZIC 1P3FA 5BS7A 3C1BC 5AV6A 5AV5C 5AV9B 3H0RC 4Z2MH 5GT0B 5AV9D 5B0YB 5CPKD 5B0YD 3AV2C 4H9PB 2CWEA 3RELA 5CHLB 3LZ0C 5AV8A 3MNNA 4G91C 3MGQA 4NE3A 3W96C 3X1UB 3X1UD 5G49A 5JRGB 2AROD 3UT9B 5JRGD 2RVQC 2UWXA 3LZ1B 3LZ1D 1U35C 2YFWB 3AZLC 5B32G 3C1CB 4WJ3C 3C1CD 2ZM5A 3WKJA 4KUDA 2NQBB 2NQBD 3O62B 2ZY5A 1H3OB 3W98B 3TU4B 5CPJB 3AZJA 3W98D 5B33B 5CPJD 5B33D 4Z66B 3KUYD 3WAAC 1TAFA 3X1VB 3AZKB 5AVCA 2IO5B 3AZGC 1N1JB 3AYWC 3X1VD 1M18B 2PYOB 3B6GA 2FJ7B 2BYKA 1AOIA 1P3GB 2Y2KA 4YS3B 1P3GD 5C3IB 5BNXA 5AVBB 5AVBD 5KDMA 4JJNA 5B1MB 5B1MD 5AV5D 1P3FC 5BS7C 3A1IA 4Z5TC 5AV6C 4CAYB 3R45B 5CPIB 3RELC 5CPID 3W96D 5GSUB 5GSUD 5AV8C 3MNNC 1Q9CA 3MGQC 2ZY4A 2L5AA 3AZFB 3MGPB 3AZFD 1P3OB 3MGPD 1P3OD 5AV9A 3KWQC 5CPKA 5B0YA 3REID 2ZY3A 1TZYB 2DF4C 4H9PA 4EO5C 5BT1C 3AZEB 4X23B 4X23D 3X1UA 2AROA 3UT9A 5JRGA 3AZJC 3VH6W 3AZGD 3LZ1A 2YFWA 5AVCC 3H0LC 3C1CA 3FDDA 2JE5A 2NQBA 3O62A 1AOIC 1H3OA 3W98A 3TU4A 5CPJA 5B33A 2RIQA 4JJNC 4Z66A 1P3IB 5JA4B 3X1VA 3UTAB 3AZKA 1P3ID 1M18A 1N1JA 3LELB 3LELD 1P3GA 1M1AB 4YS3A 1M1AD 5AVBA 1PZRA 5B1MA 4J8WB 3EG5B 2G5IC 5AV9C 4CAYA 3R45A 3X1SB 5B0YC 4NE5A 2F2AC 5CPKC 4KGCB 4KGCD 5CPIA 5GSUA 1HQ3B 4KUDD 1HQ3D 3WKJD 3X1UC 2AROC 5JRGC 3AZFA 3MGPA 1P3OA 1KX3B 4WV4B 3AZEA 3B0BA 3MGSB 1M19B 4X23A 3LZ1C 3MGSD 2W8SA 4WNNB 1M19D 3B6GD 1AOID 1KX5B 3C1CC 2NQBC 4JJND 4YM6B 3O62C 4DRAA 4YM6D 3W98C 3TU4C 5CPJC 5B33C 3KUYC 3W97B 4Z66C 3W97D 1ID3B 1ID3D 2NZDB 5FUGB 3X1VC 4E45A 3AZKC 1M18C 2IO5C 1EQZB 1EQZD 3KFUG 2NZDD 3EPHA 5B2IB 5B2ID 2BYMB 1P3GC 5B31G 4YS3C 5C3IC 5AVBC 3X1TB 3X1TD 3WTPE 5B1MC 1P3IA 5JA4A 5GT0D 3UTAA 1ULYA 1KX4B 1KX4D 3LELA 5B32B 5B32D 1M1AA 5CPIC 1ZLAB 1F1EA 3REKB 3UT9D 5GSUC 2VQRA 3REKD 3AZFC 3MGPC 1P3OC 5B24B 4KGCA 5B24D 3REIC 3NQUB 3AZEC 5B40B 4X23C 3A1KA 1HQ3A 1P3KB 1BFMA 1P3KD 3O62D 3EPJA 3TU4D 1P3AB 1P3AD 4Z66D 4XZQB 4XZQD 4J8VB 4J8VD 2CV5B 3AZKD 3MGSA 2CV5D 1M19A 1M18D 4WNNA 2PYOD 1P3BB 2FJ7D 2Y2LA 1P3BD 4YS3D 1KX5A 3UTBB 3UTBD 3LJAB 4M6BA 2Y2OA 4YM6A 3LJAD 4E44A 3MVDB 4XUJB 3MVDD 3W97A 4XUJD 3KSYA 1ID3A 2NZDA 5FUGA 1P3IC 1EQZA 4H9SA 4H9RA 5B2IA 3LELC 4G92B 2BG1A 4CSRB 2BYMA 1A7WA 1M1AC 5F99B 1KU5A 3X1TA 3IP4C 3KXBB 5GT0A 1P3PB 3KXBD 1KX4A 1TZYD 3AZED 1P34B 2JCHA 5B32A 1P34D 4KGCC 1ZLAA 1BH9B 3REKA 4KUDC 1HQ3C 3WKJC 1P3LB 1P3LD 5B24A 3NQUA 2Y2QA 3MGSC 1M19C 3B6GC 1P3KA 2Y2NA 1KX5C 1P3AA 4XZQA 4UPKA 4YM6C 4J8VA 5AY8B 2CV5A 5AY8D 3REHB 3UTAD 3WTPB 3W97C 3REHD 2PYOA 3WTPD 1ID3C 2FJ7A 5B0ZB 5E5AB 1P3BA 5B0ZD 2NZDC 5E5AD 1EQZC 1WWIA 5B1LB 4H9SC 5B1LD 5B2IC 3UTBA 4QLCB 4QLCD 3LJAA 3MVDA 4J8WD 4XUJA 3X1TC 1Z2CB 4WU9B 5GT0C 3X1SD 4R8PB 4NFTA 3AV1B 4R8PD 4HGAB 4H9NB 1KX4C 3AZHB 5B32C 3AZHD 5CP6B 4Z5TB 4CSRA 3REJB 5CP6D 3REJD 3VH5W 2J8PA 5F99A 1ZLAC 3UT9C 3REKC 3WA9B 3WA9D 3RELB 3AZMB 3AZMD 2F8NG 3KXBA 1P3PA 1T3UA 1WWSA 5BNVB 1TZYA 1KX3D 1P34A 5B24C 4AWLB 1F66B 3KWQB 1S32B 5DNMB 3VH5T 1BH9A 1P3MB 5B31B 1F66D 5BO0B 1P3MD 5B31D 1KX5D 4ZBJB 3VH5A 3W99D 4EO5B 3W99B 1P3KC 1P3LA 1P3AC 4XZQC 5DNNB 3B6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V C;  2CV5 C;  2PYO C;  4NE6 A;  2FJ7 C;  4WU8 B;  1P3B C;  4J8U B;  4WU8 D;  4J8U D;  1TAF B;  3UTB C;  3LJA C;  3NQJ B;  5GT3 B;  3MVD C;  5AY8 A;  4XUJ C;  3B0C T;  3REH A;  3WTP A;  5B0Z A;  5E5A A;  4ZUX B;  5B1L A;  4ZUX D;  1ZLA D;  4G92 C;  4QLC A;  4J8W A;  5F99 C;  1JFI B;  4WZS B;  4WU9 A;  3X1S A;  3KXB C;  3AV1 A;  4R8P A;  1P3P C;  1TZY C;  4H9N A;  5B40 D;  1P34 C;  3AZH A;  2F8N H;  4Z5T A;  5CP6 A;  3REJ A;  4LD9 B;  5CPK B;  4LD9 D;  3WA9 A;  3AZM A;  1P3L C;  1KX3 A;  4H9Q B;  5BNV A;  2ARO B;  4KHA B;  1B67 A;  1F66 A;  4DRB A;  3KWQ A;  1S32 A;  5DNM A;  1P3M A;  5B31 A;  5BO0 A;  3W99 A;  3AN2 B;  2LY8 A;  3AN2 D;  5DNN A;  3B6F A;  2HIO B;  2HIO D;  5AY8 C;  3UTA C;  3REH C;  3WTP C;  3A6N B;  3B0D B;  3A6N D;  3KUY B;  3AFA B;  3AZN B;  5B0Z C;  3AZN D;  5E5A C;  4WU8 A;  3AFA D;  3MGR B;  2YFV B;  5GXQ B;  4J8U A;  3MGR D;  5GXQ D;  5B1L C;  4J8X B;  5F99 D;  5B2J B;  4J8X D;  2HUE B;  5B2J D;  4QLC C;  3AZI B;  3NQJ A;  3AZI D;  4J8W C;  5GT3 A;  1P3P D;  4WU9 C;  3C1B B;  3X1S C;  3C1B D;  3AV1 C;  4R8P C;  5AV5 B;  4ZUX A;  4H9O B;  4HGA C;  3AV2 B;  3AZH C;  3AV2 D;  5CP6 C;  3REJ C;  3LZ0 B;  3LZ0 D;  1JFI A;  4G91 B;  3WA9 C;  3W96 B;  3AZM C;  1KX3 C;  5B40 A;  2RVQ D;  1BH8 B;  4AWL C;  4UUZ B;  1F66 C;  4LD9 A;  1S32 C;  5DNM C;  3REI B;  1P3M C;  3V9R B;  5B31 C;  1U35 B;  3AZL B;  3W99 C;  1U35 D;  4ZBJ C;  3AZL D;  4H9Q A;  5DNN C;  3B6F C;  3WAA B;  4KHA A;  3WAA D;  3AYW B;  3AZG B;  3AYW D;  4WU8 C;  4J8U C;  3AN2 A;  2F8N B;  2F8N D;  4WU9 D;  2HIO A;  5GT3 C;  3AV1 D;  1P3F B;  3A6N A;  1P3F D;  3VH6 T;  3KUY A;  3AZN A;  3AFA A;  4Z5T D;  2YFV A;  3VH6 A;  4ZUX C;  5AV6 B;  5AV6 D;  5GXQ A;  3MGR A;  4J8X A;  5B2J A;  3AZI A;  3REL D;  5AV8 B;  3MNN B;  2JSS A;  5AV8 D;  3MNN D;  3MGQ B;  4Z2M G;  3MGQ D;  5G49 B;  3C1B A;  5AV5 A;  4H9O A;  5B40 C;  3KWQ D;  1S32 D;  1R4V A;  5DNM D;  3AV2 A;  5BT1 D;  3LZ0 A;  4LD9 C;  3W96 A;  4KUD B;  5DNN D;  3WKJ B;  3B6F D;  1B6W A;  3B0C W;  3AZJ B;  3AZJ D;  1BH8 A;  2F8N K;  4UUZ A;  3REI A;  3V9R A;  1U35 A;  3AZL A;  5AVC B;  5AVC D;  1HTA A;  3B6G B;  3AN2 C;  2BYK B;  1AOI B;  5GT3 D;  5BNX B;  5KDM B;  4JJN B;  2HIO C;  3WAA A;  3A6N C;  3B0D C;  3AYW A;  3AZG A;  3AZN C;  3AFA C;  3MGR C;  5GXQ C;  2F8N A;  4J8X C;  5B2J C;  2HUE C;  4H9R B;  3AZI C;  1P3F A;  5BS7 A;  3C1B C;  5AV6 A;  5AV5 C;  5AV9 B;  4Z2M H;  5GT0 B;  5AV9 D;  5B0Y B;  5CPK D;  5B0Y D;  3AV2 C;  4H9P B;  2CWE A;  3REL A;  5CHL B;  3LZ0 C;  5AV8 A;  3MNN A;  4G91 C;  3MGQ A;  4NE3 A;  3W96 C;  3X1U B;  3X1U D;  5G49 A;  5JRG B;  2ARO D;  3UT9 B;  5JRG D;  2RVQ C;  3LZ1 B;  3LZ1 D;  1U35 C;  2YFW B;  3AZL C;  5B32 G;  3C1C B;  3C1C D;  4KUD A;  3WKJ A;  2NQB B;  2NQB D;  3O62 B;  1H3O B;  3W98 B;  3TU4 B;  5CPJ B;  3AZJ A;  3W98 D;  5B33 B;  5CPJ D;  5B33 D;  4Z66 B;  3KUY D;  3WAA C;  1TAF A;  3X1V B;  3AZK B;  5AVC A;  2IO5 B;  3AZG C;  1N1J B;  3AYW C;  3X1V D;  1M18 B;  2PYO B;  3B6G A;  2FJ7 B;  2BYK A;  1AOI A;  1P3G B;  4YS3 B;  1P3G D;  5C3I B;  5BNX A;  5AVB B;  5AVB D;  5KDM A;  4JJN A;  5B1M B;  5B1M D;  5AV5 D;  1P3F C;  5BS7 C;  4Z5T C;  5AV6 C;  4CAY B;  3R45 B;  5CPI B;  3REL C;  5CPI D;  3W96 D;  5GSU B;  5GSU D;  5AV8 C;  3MNN C;  1Q9C A;  3MGQ C;  2L5A A;  3AZF B;  3MGP B;  3AZF D;  1P3O B;  3MGP D;  1P3O D;  5AV9 A;  3KWQ C;  5CPK A;  5B0Y A;  3REI D;  1TZY B;  4H9P A;  5BT1 C;  4EO5 C;  3AZE B;  4X23 B;  4X23 D;  3X1U A;  2ARO A;  3UT9 A;  5JRG A;  3AZJ C;  3VH6 W;  3AZG D;  3LZ1 A;  2YFW A;  5AVC C;  3C1C A;  2NQB A;  3O62 A;  1AOI C;  1H3O A;  3W98 A;  3TU4 A;  5CPJ A;  5B33 A;  4JJN C;  4Z66 A;  1P3I B;  5JA4 B;  3X1V A;  3UTA B;  3AZK A;  1P3I D;  1M18 A;  1N1J A;  3LEL B;  3LEL D;  1P3G A;  1M1A B;  4YS3 A;  1M1A D;  5AVB A;  5B1M A;  4J8W B;  3X1S B;  5AV9 C;  4CAY A;  3R45 A;  5CPK C;  5B0Y C;  4NE5 A;  4KGC B;  4KGC D;  5CPI A;  5GSU A;  1HQ3 B;  4KUD D;  1HQ3 D;  3WKJ D;  3X1U C;  2ARO C;  5JRG C;  3AZF A;  3MGP A;  1P3O A;  1KX3 B;  4WV4 B;  3AZE A;  3B0B A;  3MGS B;  1M19 B;  4X23 A;  3LZ1 C;  3MGS D;  4WNN B;  1M19 D;  3B6G D;  1AOI D;  1KX5 B;  3C1C C;  2NQB C;  4JJN D;  4YM6 B;  3O62 C;  4DRA A;  4YM6 D;  3W98 C;  3TU4 C;  5CPJ C;  5B33 C;  3KUY C;  3W97 B;  4Z66 C;  3W97 D;  1ID3 B;  1ID3 D;  2NZD B;  5FUG B;  3X1V C;  4E45 A;  3AZK C;  1M18 C;  2IO5 C;  1EQZ B;  1EQZ D;  2NZD D;  5B2I B;  5B2I D;  2BYM B;  1P3G C;  4YS3 C;  5B31 G;  5C3I C;  5AVB C;  3X1T B;  3X1T D;  3WTP E;  5B1M C;  1P3I A;  5JA4 A;  5GT0 D;  3UTA A;  1ULY A;  1KX4 B;  1KX4 D;  3LEL A;  5B32 B;  5B32 D;  1M1A A;  5CPI C;  1ZLA B;  1F1E A;  3REK B;  3UT9 D;  5GSU C;  3REK D;  3AZF C;  3MGP C;  1P3O C;  5B24 B;  4KGC A;  5B24 D;  3REI C;  3NQU B;  3AZE C;  5B40 B;  4X23 C;  1HQ3 A;  1P3K B;  1BFM A;  1P3K D;  3O62 D;  3TU4 D;  1P3A B;  1P3A D;  4Z66 D;  4XZQ B;  4XZQ D;  4J8V B;  4J8V D;  2CV5 B;  3AZK D;  3MGS A;  2CV5 D;  1M19 A;  1M18 D;  4WNN A;  2PYO D;  1P3B B;  2FJ7 D;  1P3B D;  4YS3 D;  1KX5 A;  3UTB B;  3UTB D;  3LJA B;  4M6B A;  4YM6 A;  3LJA D;  4E44 A;  3MVD B;  4XUJ B;  3MVD D;  3W97 A;  4XUJ D;  3KSY A;  1ID3 A;  2NZD A;  5FUG A;  1P3I C;  1EQZ A;  4H9S A;  4H9R A;  5B2I A;  3LEL C;  4G92 B;  4CSR B;  2BYM A;  1A7W A;  1M1A C;  5F99 B;  1KU5 A;  3X1T A;  3KXB B;  5GT0 A;  1P3P B;  3KXB D;  1KX4 A;  1TZY D;  3AZE D;  1P34 B;  4KGC C;  5B32 A;  1P34 D;  1ZLA A;  1BH9 B;  3REK A;  4KUD C;  1HQ3 C;  3WKJ C;  1P3L B;  1P3L D;  5B24 A;  3NQU A;  3MGS C;  1M19 C;  3B6G C;  1P3K A;  1KX5 C;  1P3A A;  4XZQ A;  4YM6 C;  4J8V A;  5AY8 B;  2CV5 A;  5AY8 D;  3REH B;  3UTA D;  3WTP B;  3W97 C;  3REH D;  2PYO A;  3WTP D;  1ID3 C;  2FJ7 A;  5B0Z B;  5E5A B;  1P3B A;  5B0Z D;  2NZD C;  5E5A D;  1EQZ C;  1WWI A;  5B1L B;  4H9S C;  5B1L D;  5B2I C;  3UTB A;  4QLC B;  4QLC D;  3LJA A;  3MVD A;  4J8W D;  4XUJ A;  3X1T C;  4WU9 B;  5GT0 C;  3X1S D;  4R8P B;  4NFT A;  3AV1 B;  4R8P D;  4HGA B;  4H9N B;  1KX4 C;  3AZH B;  5B32 C;  3AZH D;  5CP6 B;  4Z5T B;  4CSR A;  3REJ B;  5CP6 D;  3REJ D;  3VH5 W;  5F99 A;  1ZLA C;  3UT9 C;  3REK C;  3WA9 B;  3WA9 D;  3REL B;  3AZM B;  3AZM D;  2F8N G;  3KXB A;  1P3P A;  1WWS A;  5BNV B;  1TZY A;  1KX3 D;  1P34 A;  5B24 C;  4AWL B;  1F66 B;  3KWQ B;  1S32 B;  5DNM B;  3VH5 T;  1BH9 A;  1P3M B;  5B31 B;  1F66 D;  5BO0 B;  1P3M D;  5B31 D;  1KX5 D;  4ZBJ B;  3VH5 A;  3W99 D;  4EO5 B;  3W99 B;  1P3K C;  1P3L A;  1P3A C;  4XZQ C;  5DNN B;  3B6F B; 
#chains in the Genus database with same CATH topology
 4J8V C;  2CV5 C;  2PYO C;  4NE6 A;  2FJ7 C;  4WU8 B;  1P3B C;  4J8U B;  4WU8 D;  4J8U D;  1TAF B;  3AL0 C;  3UTB C;  3LJA C;  3NQJ B;  5GT3 B;  3MVD C;  5AY8 A;  4XUJ C;  3B0C T;  3REH A;  3WTP A;  5B0Z A;  5E5A A;  4ZUX B;  3P5J B;  5B1L A;  4ZUX D;  1ZLA D;  2Y2H A;  4G92 C;  4QLC A;  4J8W A;  5F99 C;  1JFI B;  4WZS B;  4WU9 A;  3X1S A;  3KXB C;  3AV1 A;  4R8P A;  1P3P C;  1TZY C;  4H9N A;  5B40 D;  1P34 C;  3AZH A;  2F8N H;  4Z5T A;  5CP6 A;  3REJ A;  4LD9 B;  5CPK B;  4LD9 D;  3WA9 A;  3AZM A;  1P3L C;  1KX3 A;  4H9Q B;  5BNV A;  2ARO B;  4KHA B;  1B67 A;  1F66 A;  4DRB A;  3KWQ A;  1S32 A;  5DNM A;  2XD1 A;  1P3M A;  5B31 A;  5BO0 A;  3W99 A;  2G5H C;  3AN2 B;  2LY8 A;  3AN2 D;  5DNN A;  3B6F A;  2HIO B;  3EPL A;  2HIO D;  5AY8 C;  3UTA C;  3REH C;  3WTP C;  3A6N B;  3B0D B;  3A6N D;  3KUY B;  3AFA B;  3AZN B;  5B0Z C;  3AZN D;  5E5A C;  4WU8 A;  3AFA D;  3MGR B;  2YFV B;  5GXQ B;  4J8U A;  3MGR D;  2Y2M A;  5GXQ D;  5B1L C;  4J8X B;  5F99 D;  5B2J B;  4J8X D;  2HUE B;  5B2J D;  4QLC C;  3AZI B;  3NQJ A;  3AZI D;  2Y2J A;  4J8W C;  5GT3 A;  1P3P D;  4WU9 C;  3C1B B;  3X1S C;  2XD5 A;  3C1B D;  3AV1 C;  4R8P C;  5AV5 B;  4ZUX A;  4H9O B;  4HGA C;  3AV2 B;  3AZH C;  3AV2 D;  5CP6 C;  3REJ C;  4DQY B;  3LZ0 B;  3LZ0 D;  1JFI A;  4G91 B;  3WA9 C;  3W96 B;  3AZM C;  1W2E A;  1KX3 C;  5B40 A;  2RVQ D;  1BH8 B;  4AWL C;  4UUZ B;  1F66 C;  4LD9 A;  1S32 C;  5DNM C;  3REI B;  1P3M C;  3V9R B;  5B31 C;  1U35 B;  3AZL B;  3W99 C;  1U35 D;  4ZBJ C;  3AZL D;  4H9Q A;  5DNN C;  3B6F C;  2Y2G A;  3WAA B;  4KHA A;  3WAA D;  3AYW B;  3AZG B;  3AYW D;  4WU8 C;  4J8U C;  3AN2 A;  2F8N B;  2F8N D;  4WU9 D;  2HIO A;  5GT3 C;  3AV1 D;  1P3F B;  3A6N A;  1P3F D;  3VH6 T;  3KUY A;  3AZN A;  3AFA A;  4Z5T D;  2YFV A;  3VH6 A;  4ZUX C;  5AV6 B;  5AV6 D;  5GXQ A;  3MGR A;  4J8X A;  5B2J A;  3AZI A;  3REL D;  5AV8 B;  3MNN B;  2JSS A;  5AV8 D;  3MNN D;  3MGQ B;  4Z2M G;  2FFF B;  3MGQ D;  5G49 B;  3C1B A;  5AV5 A;  4H9O A;  5B40 C;  3KWQ D;  1S32 D;  1R4V A;  5DNM D;  3AV2 A;  5BT1 D;  3LZ0 A;  4LD9 C;  3F6T A;  3W96 A;  2Y2P A;  2Y2I A;  4KUD B;  5DNN D;  3WKJ B;  3B6F D;  3EPK A;  1B6W A;  3B0C W;  3AZJ B;  2DQN C;  3AZJ D;  3H0M C;  1BH8 A;  2F8N K;  4UUZ A;  2ZY2 A;  3REI A;  3V9R A;  1U35 A;  3AZL A;  5AVC B;  5AVC D;  1HTA A;  3B6G B;  3AN2 C;  2BYK B;  1AOI B;  5GT3 D;  5BNX B;  5KDM B;  4JJN B;  2HIO C;  3WAA A;  3A6N C;  3B0D C;  3AYW A;  3AZG A;  3AZN C;  3AFA C;  3MGR C;  5GXQ C;  2F8N A;  4J8X C;  5B2J C;  2HUE C;  4H9R B;  3AZI C;  1P3F A;  5BS7 A;  3C1B C;  5AV6 A;  5AV5 C;  5AV9 B;  3H0R C;  4Z2M H;  5GT0 B;  5AV9 D;  5B0Y B;  5CPK D;  5B0Y D;  3AV2 C;  4H9P B;  2CWE A;  3REL A;  5CHL B;  3LZ0 C;  5AV8 A;  3MNN A;  4G91 C;  3MGQ A;  4NE3 A;  3W96 C;  3X1U B;  3X1U D;  5G49 A;  5JRG B;  2ARO D;  3UT9 B;  5JRG D;  2RVQ C;  2UWX A;  3LZ1 B;  3LZ1 D;  1U35 C;  2YFW B;  3AZL C;  5B32 G;  3C1C B;  4WJ3 C;  3C1C D;  2ZM5 A;  3WKJ A;  4KUD A;  2NQB B;  2NQB D;  3O62 B;  2ZY5 A;  1H3O B;  3W98 B;  3TU4 B;  5CPJ B;  3AZJ A;  3W98 D;  5B33 B;  5CPJ D;  5B33 D;  4Z66 B;  3KUY D;  3WAA C;  1TAF A;  3X1V B;  3AZK B;  5AVC A;  2IO5 B;  3AZG C;  1N1J B;  3AYW C;  3X1V D;  1M18 B;  2PYO B;  3B6G A;  2FJ7 B;  2BYK A;  1AOI A;  1P3G B;  2Y2K A;  4YS3 B;  1P3G D;  5C3I B;  5BNX A;  5AVB B;  5AVB D;  5KDM A;  4JJN A;  5B1M B;  5B1M D;  5AV5 D;  1P3F C;  5BS7 C;  3A1I A;  4Z5T C;  5AV6 C;  4CAY B;  3R45 B;  5CPI B;  3REL C;  5CPI D;  3W96 D;  5GSU B;  5GSU D;  5AV8 C;  3MNN C;  1Q9C A;  3MGQ C;  2ZY4 A;  2L5A A;  3AZF B;  3MGP B;  3AZF D;  1P3O B;  3MGP D;  1P3O D;  5AV9 A;  3KWQ C;  5CPK A;  5B0Y A;  3REI D;  2ZY3 A;  1TZY B;  2DF4 C;  4H9P A;  4EO5 C;  5BT1 C;  3AZE B;  4X23 B;  4X23 D;  3X1U A;  2ARO A;  3UT9 A;  5JRG A;  3AZJ C;  3VH6 W;  3AZG D;  3LZ1 A;  2YFW A;  5AVC C;  3H0L C;  3C1C A;  3FDD A;  2JE5 A;  2NQB A;  3O62 A;  1AOI C;  1H3O A;  3W98 A;  3TU4 A;  5CPJ A;  5B33 A;  2RIQ A;  4JJN C;  4Z66 A;  1P3I B;  5JA4 B;  3X1V A;  3UTA B;  3AZK A;  1P3I D;  1M18 A;  1N1J A;  3LEL B;  3LEL D;  1P3G A;  1M1A B;  4YS3 A;  1M1A D;  5AVB A;  1PZR A;  5B1M A;  4J8W B;  3EG5 B;  2G5I C;  5AV9 C;  4CAY A;  3R45 A;  3X1S B;  5B0Y C;  4NE5 A;  2F2A C;  5CPK C;  4KGC B;  4KGC D;  5CPI A;  5GSU A;  1HQ3 B;  4KUD D;  1HQ3 D;  3WKJ D;  3X1U C;  2ARO C;  5JRG C;  3AZF A;  3MGP A;  1P3O A;  1KX3 B;  4WV4 B;  3AZE A;  3B0B A;  3MGS B;  1M19 B;  4X23 A;  3LZ1 C;  3MGS D;  2W8S A;  4WNN B;  1M19 D;  3B6G D;  1AOI D;  1KX5 B;  3C1C C;  2NQB C;  4JJN D;  4YM6 B;  3O62 C;  4DRA A;  4YM6 D;  3W98 C;  3TU4 C;  5CPJ C;  5B33 C;  3KUY C;  3W97 B;  4Z66 C;  3W97 D;  1ID3 B;  1ID3 D;  2NZD B;  5FUG B;  3X1V C;  4E45 A;  3AZK C;  1M18 C;  2IO5 C;  1EQZ B;  1EQZ D;  3KFU G;  2NZD D;  3EPH A;  5B2I B;  5B2I D;  2BYM B;  1P3G C;  5B31 G;  4YS3 C;  5C3I C;  5AVB C;  3X1T B;  3X1T D;  3WTP E;  5B1M C;  1P3I A;  5JA4 A;  5GT0 D;  3UTA A;  1ULY A;  1KX4 B;  1KX4 D;  3LEL A;  5B32 B;  5B32 D;  1M1A A;  5CPI C;  1ZLA B;  1F1E A;  3REK B;  3UT9 D;  5GSU C;  2VQR A;  3REK D;  3AZF C;  3MGP C;  1P3O C;  5B24 B;  4KGC A;  5B24 D;  3REI C;  3NQU B;  3AZE C;  5B40 B;  4X23 C;  3A1K A;  1HQ3 A;  1P3K B;  1BFM A;  1P3K D;  3O62 D;  3EPJ A;  3TU4 D;  1P3A B;  1P3A D;  4Z66 D;  4XZQ B;  4XZQ D;  4J8V B;  4J8V D;  2CV5 B;  3AZK D;  3MGS A;  2CV5 D;  1M19 A;  1M18 D;  4WNN A;  2PYO D;  1P3B B;  2FJ7 D;  2Y2L A;  1P3B D;  4YS3 D;  1KX5 A;  3UTB B;  3UTB D;  3LJA B;  4M6B A;  2Y2O A;  4YM6 A;  3LJA D;  4E44 A;  3MVD B;  4XUJ B;  3MVD D;  3W97 A;  4XUJ D;  3KSY A;  1ID3 A;  2NZD A;  5FUG A;  1P3I C;  1EQZ A;  4H9S A;  4H9R A;  5B2I A;  3LEL C;  4G92 B;  2BG1 A;  4CSR B;  2BYM A;  1A7W A;  1M1A C;  5F99 B;  1KU5 A;  3X1T A;  3IP4 C;  3KXB B;  5GT0 A;  1P3P B;  3KXB D;  1KX4 A;  1TZY D;  3AZE D;  1P34 B;  2JCH A;  5B32 A;  1P34 D;  4KGC C;  1ZLA A;  1BH9 B;  3REK A;  4KUD C;  1HQ3 C;  3WKJ C;  1P3L B;  1P3L D;  5B24 A;  3NQU A;  2Y2Q A;  3MGS C;  1M19 C;  3B6G C;  1P3K A;  2Y2N A;  1KX5 C;  1P3A A;  4XZQ A;  4UPK A;  4YM6 C;  4J8V A;  5AY8 B;  2CV5 A;  5AY8 D;  3REH B;  3UTA D;  3WTP B;  3W97 C;  3REH D;  2PYO A;  3WTP D;  1ID3 C;  2FJ7 A;  5B0Z B;  5E5A B;  1P3B A;  5B0Z D;  2NZD C;  5E5A D;  1EQZ C;  1WWI A;  5B1L B;  4H9S C;  5B1L D;  5B2I C;  3UTB A;  4QLC B;  4QLC D;  3LJA A;  3MVD A;  4J8W D;  4XUJ A;  3X1T C;  1Z2C B;  4WU9 B;  5GT0 C;  3X1S D;  4R8P B;  4NFT A;  3AV1 B;  4R8P D;  4HGA B;  4H9N B;  1KX4 C;  3AZH B;  5B32 C;  3AZH D;  5CP6 B;  4Z5T B;  4CSR A;  3REJ B;  5CP6 D;  3REJ D;  3VH5 W;  2J8P A;  5F99 A;  1ZLA C;  3UT9 C;  3REK C;  3WA9 B;  3WA9 D;  3REL B;  3AZM B;  3AZM D;  2F8N G;  3KXB A;  1P3P A;  1T3U A;  1WWS A;  5BNV B;  1TZY A;  1KX3 D;  1P34 A;  5B24 C;  4AWL B;  1F66 B;  3KWQ B;  1S32 B;  5DNM B;  3VH5 T;  1BH9 A;  1P3M B;  5B31 B;  1F66 D;  5BO0 B;  1P3M D;  5B31 D;  1KX5 D;  4ZBJ B;  3VH5 A;  3W99 D;  4EO5 B;  3W99 B;  1P3K C;  1P3L A;  1P3A C;  4XZQ C;  5DNN B;  3B6F B; 
#chains in the Genus database with same CATH homology
 4J8V C;  2CV5 C;  2PYO C;  4NE6 A;  2FJ7 C;  4WU8 B;  1P3B C;  4J8U B;  4WU8 D;  4J8U D;  1TAF B;  3AL0 C;  3UTB C;  3LJA C;  3NQJ B;  5GT3 B;  3MVD C;  5AY8 A;  4XUJ C;  3B0C T;  3REH A;  3WTP A;  5B0Z A;  5E5A A;  4ZUX B;  3P5J B;  5B1L A;  4ZUX D;  1ZLA D;  2Y2H A;  4G92 C;  4QLC A;  4J8W A;  5F99 C;  1JFI B;  4WZS B;  4WU9 A;  3X1S A;  3KXB C;  3AV1 A;  4R8P A;  1P3P C;  1TZY C;  4H9N A;  5B40 D;  1P34 C;  3AZH A;  2F8N H;  4Z5T A;  5CP6 A;  3REJ A;  4LD9 B;  5CPK B;  4LD9 D;  3WA9 A;  3AZM A;  1P3L C;  1KX3 A;  4H9Q B;  5BNV A;  2ARO B;  4KHA B;  1B67 A;  1F66 A;  4DRB A;  3KWQ A;  1S32 A;  5DNM A;  2XD1 A;  1P3M A;  5B31 A;  5BO0 A;  3W99 A;  2G5H C;  3AN2 B;  2LY8 A;  3AN2 D;  5DNN A;  3B6F A;  2HIO B;  3EPL A;  2HIO D;  5AY8 C;  3UTA C;  3REH C;  3WTP C;  3A6N B;  3B0D B;  3A6N D;  3KUY B;  3AFA B;  3AZN B;  5B0Z C;  3AZN D;  5E5A C;  4WU8 A;  3AFA D;  3MGR B;  2YFV B;  5GXQ B;  4J8U A;  3MGR D;  2Y2M A;  5GXQ D;  5B1L C;  4J8X B;  5F99 D;  5B2J B;  4J8X D;  2HUE B;  5B2J D;  4QLC C;  3AZI B;  3NQJ A;  3AZI D;  2Y2J A;  4J8W C;  5GT3 A;  1P3P D;  4WU9 C;  3C1B B;  3X1S C;  2XD5 A;  3C1B D;  3AV1 C;  4R8P C;  5AV5 B;  4ZUX A;  4H9O B;  4HGA C;  3AV2 B;  3AZH C;  3AV2 D;  5CP6 C;  3REJ C;  4DQY B;  3LZ0 B;  3LZ0 D;  1JFI A;  4G91 B;  3WA9 C;  3W96 B;  3AZM C;  1W2E A;  1KX3 C;  5B40 A;  2RVQ D;  1BH8 B;  4AWL C;  4UUZ B;  1F66 C;  4LD9 A;  1S32 C;  5DNM C;  3REI B;  1P3M C;  3V9R B;  5B31 C;  1U35 B;  3AZL B;  3W99 C;  1U35 D;  4ZBJ C;  3AZL D;  4H9Q A;  5DNN C;  3B6F C;  2Y2G A;  3WAA B;  4KHA A;  3WAA D;  3AYW B;  3AZG B;  3AYW D;  4WU8 C;  4J8U C;  3AN2 A;  2F8N B;  2F8N D;  4WU9 D;  2HIO A;  5GT3 C;  3AV1 D;  1P3F B;  3A6N A;  1P3F D;  3VH6 T;  3KUY A;  3AZN A;  3AFA A;  4Z5T D;  2YFV A;  3VH6 A;  4ZUX C;  5AV6 B;  5AV6 D;  5GXQ A;  3MGR A;  4J8X A;  5B2J A;  3AZI A;  3REL D;  5AV8 B;  3MNN B;  2JSS A;  5AV8 D;  3MNN D;  3MGQ B;  4Z2M G;  2FFF B;  3MGQ D;  5G49 B;  3C1B A;  5AV5 A;  4H9O A;  5B40 C;  3KWQ D;  1S32 D;  1R4V A;  5DNM D;  3AV2 A;  5BT1 D;  3LZ0 A;  4LD9 C;  3F6T A;  3W96 A;  2Y2P A;  2Y2I A;  4KUD B;  5DNN D;  3WKJ B;  3B6F D;  3EPK A;  1B6W A;  3B0C W;  3AZJ B;  2DQN C;  3AZJ D;  3H0M C;  1BH8 A;  2F8N K;  4UUZ A;  2ZY2 A;  3REI A;  3V9R A;  1U35 A;  3AZL A;  5AVC B;  5AVC D;  1HTA A;  3B6G B;  3AN2 C;  2BYK B;  1AOI B;  5GT3 D;  5BNX B;  5KDM B;  4JJN B;  2HIO C;  3WAA A;  3A6N C;  3B0D C;  3AYW A;  3AZG A;  3AZN C;  3AFA C;  3MGR C;  5GXQ C;  2F8N A;  4J8X C;  5B2J C;  2HUE C;  4H9R B;  3AZI C;  1P3F A;  5BS7 A;  3C1B C;  5AV6 A;  5AV5 C;  5AV9 B;  3H0R C;  4Z2M H;  5GT0 B;  5AV9 D;  5B0Y B;  5CPK D;  5B0Y D;  3AV2 C;  4H9P B;  2CWE A;  3REL A;  5CHL B;  3LZ0 C;  5AV8 A;  3MNN A;  4G91 C;  3MGQ A;  4NE3 A;  3W96 C;  3X1U B;  3X1U D;  5G49 A;  5JRG B;  2ARO D;  3UT9 B;  5JRG D;  2RVQ C;  2UWX A;  3LZ1 B;  3LZ1 D;  1U35 C;  2YFW B;  3AZL C;  5B32 G;  3C1C B;  4WJ3 C;  3C1C D;  2ZM5 A;  3WKJ A;  4KUD A;  2NQB B;  2NQB D;  3O62 B;  2ZY5 A;  1H3O B;  3W98 B;  3TU4 B;  5CPJ B;  3AZJ A;  3W98 D;  5B33 B;  5CPJ D;  5B33 D;  4Z66 B;  3KUY D;  3WAA C;  1TAF A;  3X1V B;  3AZK B;  5AVC A;  2IO5 B;  3AZG C;  1N1J B;  3AYW C;  3X1V D;  1M18 B;  2PYO B;  3B6G A;  2FJ7 B;  2BYK A;  1AOI A;  1P3G B;  2Y2K A;  4YS3 B;  1P3G D;  5C3I B;  5BNX A;  5AVB B;  5AVB D;  5KDM A;  4JJN A;  5B1M B;  5B1M D;  5AV5 D;  1P3F C;  5BS7 C;  3A1I A;  4Z5T C;  5AV6 C;  4CAY B;  3R45 B;  5CPI B;  3REL C;  5CPI D;  3W96 D;  5GSU B;  5GSU D;  5AV8 C;  3MNN C;  1Q9C A;  3MGQ C;  2ZY4 A;  2L5A A;  3AZF B;  3MGP B;  3AZF D;  1P3O B;  3MGP D;  1P3O D;  5AV9 A;  3KWQ C;  5CPK A;  5B0Y A;  3REI D;  2ZY3 A;  1TZY B;  2DF4 C;  4H9P A;  4EO5 C;  5BT1 C;  3AZE B;  4X23 B;  4X23 D;  3X1U A;  2ARO A;  3UT9 A;  5JRG A;  3AZJ C;  3VH6 W;  3AZG D;  3LZ1 A;  2YFW A;  5AVC C;  3H0L C;  3C1C A;  3FDD A;  2JE5 A;  2NQB A;  3O62 A;  1AOI C;  1H3O A;  3W98 A;  3TU4 A;  5CPJ A;  5B33 A;  2RIQ A;  4JJN C;  4Z66 A;  1P3I B;  5JA4 B;  3X1V A;  3UTA B;  3AZK A;  1P3I D;  1M18 A;  1N1J A;  3LEL B;  3LEL D;  1P3G A;  1M1A B;  4YS3 A;  1M1A D;  5AVB A;  1PZR A;  5B1M A;  4J8W B;  3EG5 B;  2G5I C;  5AV9 C;  4CAY A;  3R45 A;  3X1S B;  5B0Y C;  4NE5 A;  2F2A C;  5CPK C;  4KGC B;  4KGC D;  5CPI A;  5GSU A;  1HQ3 B;  4KUD D;  1HQ3 D;  3WKJ D;  3X1U C;  2ARO C;  5JRG C;  3AZF A;  3MGP A;  1P3O A;  1KX3 B;  4WV4 B;  3AZE A;  3B0B A;  3MGS B;  1M19 B;  4X23 A;  3LZ1 C;  3MGS D;  2W8S A;  4WNN B;  1M19 D;  3B6G D;  1AOI D;  1KX5 B;  3C1C C;  2NQB C;  4JJN D;  4YM6 B;  3O62 C;  4DRA A;  4YM6 D;  3W98 C;  3TU4 C;  5CPJ C;  5B33 C;  3KUY C;  3W97 B;  4Z66 C;  3W97 D;  1ID3 B;  1ID3 D;  2NZD B;  5FUG B;  3X1V C;  4E45 A;  3AZK C;  1M18 C;  2IO5 C;  1EQZ B;  1EQZ D;  3KFU G;  2NZD D;  3EPH A;  5B2I B;  5B2I D;  2BYM B;  1P3G C;  5B31 G;  4YS3 C;  5C3I C;  5AVB C;  3X1T B;  3X1T D;  3WTP E;  5B1M C;  1P3I A;  5JA4 A;  5GT0 D;  3UTA A;  1ULY A;  1KX4 B;  1KX4 D;  3LEL A;  5B32 B;  5B32 D;  1M1A A;  5CPI C;  1ZLA B;  1F1E A;  3REK B;  3UT9 D;  5GSU C;  2VQR A;  3REK D;  3AZF C;  3MGP C;  1P3O C;  5B24 B;  4KGC A;  5B24 D;  3REI C;  3NQU B;  3AZE C;  5B40 B;  4X23 C;  3A1K A;  1HQ3 A;  1P3K B;  1BFM A;  1P3K D;  3O62 D;  3EPJ A;  3TU4 D;  1P3A B;  1P3A D;  4Z66 D;  4XZQ B;  4XZQ D;  4J8V B;  4J8V D;  2CV5 B;  3AZK D;  3MGS A;  2CV5 D;  1M19 A;  1M18 D;  4WNN A;  2PYO D;  1P3B B;  2FJ7 D;  2Y2L A;  1P3B D;  4YS3 D;  1KX5 A;  3UTB B;  3UTB D;  3LJA B;  4M6B A;  2Y2O A;  4YM6 A;  3LJA D;  4E44 A;  3MVD B;  4XUJ B;  3MVD D;  3W97 A;  4XUJ D;  3KSY A;  1ID3 A;  2NZD A;  5FUG A;  1P3I C;  1EQZ A;  4H9S A;  4H9R A;  5B2I A;  3LEL C;  4G92 B;  2BG1 A;  4CSR B;  2BYM A;  1A7W A;  1M1A C;  5F99 B;  1KU5 A;  3X1T A;  3IP4 C;  3KXB B;  5GT0 A;  1P3P B;  3KXB D;  1KX4 A;  1TZY D;  3AZE D;  1P34 B;  2JCH A;  5B32 A;  1P34 D;  4KGC C;  1ZLA A;  1BH9 B;  3REK A;  4KUD C;  1HQ3 C;  3WKJ C;  1P3L B;  1P3L D;  5B24 A;  3NQU A;  2Y2Q A;  3MGS C;  1M19 C;  3B6G C;  1P3K A;  2Y2N A;  1KX5 C;  1P3A A;  4XZQ A;  4UPK A;  4YM6 C;  4J8V A;  5AY8 B;  2CV5 A;  5AY8 D;  3REH B;  3UTA D;  3WTP B;  3W97 C;  3REH D;  2PYO A;  3WTP D;  1ID3 C;  2FJ7 A;  5B0Z B;  5E5A B;  1P3B A;  5B0Z D;  2NZD C;  5E5A D;  1EQZ C;  1WWI A;  5B1L B;  4H9S C;  5B1L D;  5B2I C;  3UTB A;  4QLC B;  4QLC D;  3LJA A;  3MVD A;  4J8W D;  4XUJ A;  3X1T C;  1Z2C B;  4WU9 B;  5GT0 C;  3X1S D;  4R8P B;  4NFT A;  3AV1 B;  4R8P D;  4HGA B;  4H9N B;  1KX4 C;  3AZH B;  5B32 C;  3AZH D;  5CP6 B;  4Z5T B;  4CSR A;  3REJ B;  5CP6 D;  3REJ D;  3VH5 W;  2J8P A;  5F99 A;  1ZLA C;  3UT9 C;  3REK C;  3WA9 B;  3WA9 D;  3REL B;  3AZM B;  3AZM D;  2F8N G;  3KXB A;  1P3P A;  1T3U A;  1WWS A;  5BNV B;  1TZY A;  1KX3 D;  1P34 A;  5B24 C;  4AWL B;  1F66 B;  3KWQ B;  1S32 B;  5DNM B;  3VH5 T;  1BH9 A;  1P3M B;  5B31 B;  1F66 D;  5BO0 B;  1P3M D;  5B31 D;  1KX5 D;  4ZBJ B;  3VH5 A;  3W99 D;  4EO5 B;  3W99 B;  1P3K C;  1P3L A;  1P3A C;  4XZQ C;  5DNN B;  3B6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...