1P3GD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gD00
4H9OB 4ZUXD 3AV2D 1BFMA 5B2JB 5BNVA 3AZJD 1F66B 5B1MB 3KWQC 2PYOB 4YM6C 5AVCA 1P3PC 5CPIB 2YFVB 3LZ1D 1HQ3D 3WKJC 3MGSC 5AV5B 1ID3A 3C1BA 3W97C 1S32B 3REIB 2F8NB 4KGCB 2NQBB 3REJC 3AZGB 4G92C 3X1UA 2HUEC 5B31D 4R8PD 3MGQD 2FJ7A 3UT9B 3W98B 1R4VA 1M19B 3AZKC 4E45A 4Z2MH 2NZDD 5B32B 4YS3D 4X23C 4H9NB 1P3OB 3VH5A 3MGPC 1P3IC 5DNMB 3B6GC 3WAAB 2IO5B 3AZHC 3RELC 5AV8B 3KXBD 2RVQC 5F99B 3KUYA 4KUDB 5G49B 1ID3D 3C1BD 3WTPC 3AZMB 1P3AA 4H9RA 4JJNC 3LJAC 3LZ0B 4LD9A 5AVBC 5GXQB 1U35B 2F8NG 5B1LA 4J8UC 1P3FB 3V9RB 4NE3A 4XZQC 3REHD 3AZEA 3TU4B 3AFAA 3AZIB 1TZYB 4XUJD 4H9SA 5AV9B 3NQJB 5B32G 4QLCB 2LY8A 3REJA 1P34C 1KX5C 3O62B 2AROB 1P3KB 3REKB 5CP6B 3VH5W 3UTBB 4DRAA 5GT3C 5BS7C 1P3AD 4X23A 5B33D 1N1JB 3MGPA 5BO0A 1EQZA 4J8VB 1ULYA 1M1AC 4ZBJB 5B1LD 5B0ZC 5E5AC 3KWQD 4YM6D 1P3PD 3W96B 3AZHA 3X1VB 3AN2C 3WKJD 3MGSD 1AOIA 4Z66B 1P3LB 5B24C 3MGRC 3WTPA 5CPJA 1BH8A 4Z2MG 5AVCC 3C1CB 3REJD 1KX3C 2HIOB 5AVBA 4UUZA 5BNXB 5JRGB 2F8NK 3AZFB 5B0YC 3C1BC 3AZKD 4H9PA 1BH9A 4X23D 5B2JC 3WA9B 5B1MC 3X1UC 2CV5A 3MGPD 3AZLB 5CPIC 2FJ7C 1P3ID 4J8WC 5DNNA 1P34A 3B6GD 1KX5A 5AV5C 3AZHD 4ZUXB 3RELD 4G91C 3AYWA 3AV2B 2RVQD 1AOID 1S32C 3AZJB 1KX4B 1P3MA 5AY8B 3WTPD 5GT3A 5BS7A 3LZ1B 3VH6A 1B6WA 1P3GB 1ZLAA 3LJAD 5AVBD 1M1AA 3KUYC 3MVDA 4CAYB 3R45A 4J8UD 1M18A 4WNNA 3AN2A 5B31B 4R8PB 3MGQB 2L5AA 4LD9C 5AV6A 3UTAA 5B24A 3MGRA 4NFTA 5B1LC 5AV8C 1P34D 1KX3A 3W99B 1KX5D 2NZDB 4J8XA 1TAFB 4WU8A 3AZEC 3AYWD 3MNNA 5B0YA 3AFAC 3A6NA 4H9QA 4H9OA 4H9SC 5GT3D 5BT1C 5B2JA 1F66A 3KXBB 5B1MA 5CPKB 2PYOA 5CPIA 2YFVA 1M1AD 4J8WA 5B0ZD 5E5AD 1B67A 2BYKA 5AV5A 2JSSA 3AN2D 1S32A 3REIA 2F8NA 4KGCA 2NQBA 3AZGA 1EQZC 3X1TB 5JA4B 3O62C 5B24D 3MGRD 1JFIB 5B31G 3REHB 4DRBA 5AVCD 1KX3D 3W98A 3AV1B 5C3IB 1M19A 3B0DB 3MNND 1AOIC 4XUJB 3UTBC 1A7WA 5B0YD 5B32A 1P3OA 5CPJC 5GSUB 5B2JD 1WWIA 5B1MD 5B2IB 3X1UD 5CPID 3WAAA 4KHAB 4AWLC 2FJ7D 3B0CW 4J8WD 5AV8A 5F99A 4KUDA 1P3AB 5G49A 5AV5D 5B33B 3AZNB 1S32D 4KGCD 3AZMA 2CV5C 3KWQB 4YM6B 3LZ0A 1P3PB 5GXQA 5DNNC 3LELC 1U35A 3WKJB 3MGSB 1H3OB 3AYWC 1P3FA 3V9RA 3NQUB 3KUYD 3W97B 3TU4A 1P3MC 1P3OD 3REJB 4EO5C 4G92B 3AZIA 4WU9C 1ZLAC 4Z5TC 4QLCA 5AV9A 4LD9D 3O62A 3AZKB 3MVDC 5AV8D 2AROA 1M18C 1P3KA 4HGAC 3AZED 3REKA 1P3BB 5AY8C 3UTBA 5AV6C 5KDMB 3AFAD 3X1SC 1P3GC 3UTAC 1P3IB 3B6GB 1N1JA 4NE6A 4M6BA 3AZHB 1Q9CA 5GXQD 4J8VA 5BT1D 1U35D 3RELB 5B40B 4J8XC 4WU8C 3W96A 5GT0C 3MNNC 3X1VA 3B6FB 3A6NC 3TU4D 4Z66A 4JJNB 3LJAB 2BYMA 1F66C 2PYOC 1EQZD 3C1CA 4J8UB 3O62D 2HIOA 4XZQB 3LELA 5BNXA 5JRGA 3AZFA 3REKD 4KGCC 3REIC 3UTBD 2NQBC 3AZGC 3WA9A 1KX5B 4WZSB 4WU9A 5CPJD 4CSRB 3AZLA 4Z5TA 3UT9C 1HQ3B 3W98C 1M19C 2YFWB 4ZUXA 3X1VD 5B32C 3AV2A 1P3OC 3B0CT 3AZJA 1KX4A 5AY8A 5DNMC 3LZ1A 3X1SA 2CV5D 1P3GA 5B0ZB 5E5AB 3WAAC 5FUGA 3AV1C 5C3IC 2IO5C 5DNND 3LELD 5F99C 4KUDC 4YS3B 3AZFD 3KSYA 5GT0A 3AZMC 5BNVB 5GSUC 5B31A 3MGQA 1P3MD 5AVCB 3LZ0C 1KX3B 4WU9D 5GXQC 1ZLAD 1U35C 4Z5TD 3VH5T 1ID3B 5B0YB 3C1BB 3W99A 2NZDA 1P3FC 1TAFA 3MVDD 3AZNC 3TU4C 1M18D 1WWSA 3AZIC 3X1UB 1KX4D 1TZYC 5AY8D 2FJ7B 3VH6W 4QLCC 5AV9C 5AV6D 3X1SD 1P3GD 4J8WB 3UTAD 3KXBA 2BYKB 5CPKA 3UT9A 4G91B 2AROC 4J8XD 1P3KC 4WU8D 5GT0D 5CP6C 3REKC 3B0BA 3A6ND 4H9NA 3X1TA 5JA4A 4J8VC 3WTPE 4ZBJC 1JFIA 1F66D 5DNMA 3KUYB 3REHA 2PYOD 3W99D 3W96C 3AV1A 3X1VC 1P3BC 4XUJA 4H9RB 4Z66C 4LD9B 1P3LC 3REID 2F8ND 5GSUA 5B1LB 2NQBD 3AZGD 3C1CC 5B40C 5B2IA 5CPKD 2HIOC 4KHAA 3UT9D 3W98D 3AZEB 5JRGC 3AZFC 1M19D 3B6FC 3AFAB 5B33A 3AZNA 5B32D 3WA9C 3KWQA 1TZYA 2HUEB 4YM6A 3X1TD 3AZLC 1P3PA 3NQJA 5DNMD 3WKJA 3WAAD 3MGSA 3AV1D 4ZUXC 1H3OA 3AV2C 5F99D 3NQUA 4KUDD 3W97A 4X23B 3AZJC 2CWEA 1KX4C 5CP6A 3MGPB 5BO0B 1EQZB 3AZMD 5GSUD 3LZ1C 1HQ3C 3LZ0D 5B2ID 4NE5A 3AZKA 1AOIB 1P3FD 1F1EA 3WTPB 3AZND 1HTAA 5CPJB 5B31C 4R8PC 1P3BA 3MGQC 1BH8B 5KDMA 1P3IA 3AZID 1P3LA 1TZYD 5AVBB 3B6GA 4AWLB 4QLCD 4UUZB 5AV9D 3W99C 3RELA 2NZDC 3VH6T 5B40A 4YS3C 4H9PB 2AROD 3W97D 2BYMB 1BH9B 1P3KD 3B6FA 2CV5B 5CP6D 4JJNA 3LJAA 5DNNB 3KXBC 3LELB 1P34B 5CPKC 1ID3C 5CHLB 4J8VD 4J8UA 4WV4B 3AYWB 4XZQA 3W96D 1P3MB 4EO5B 4WU9B 5GT3B 1P3BD 1ZLAB 4Z5TB 4Z66D 1P3LD 3X1TC 1M1AB 4CSRA 3MVDB 3REHC 1HQ3A 3C1CD 3R45B 5B40D 1M18B 2HIOD 2YFWA 4E44A 3B0DC 2F8NH 4HGAB 4WNNB 3AN2B 4CAYA 5JRGD 4XUJC 3B6FD 1KU5A 5AV6B 3X1SB 3UTAB 4JJND 5FUGB 5B24B 3MGRB 4R8PA 3WA9D 5B2IC 4J8XB 5B0ZA 5E5AA 3AZLD 4WU8B 5GT0B 3MNNB 4XZQD 1P3AC 4YS3A 3A6NB 4H9QB 5B33C
chains in the Genus database with same CATH superfamily
4H9OB 4ZUXD 3AV2D 1BFMA 5B2JB 5BNVA 3AZJD 1F66B 5B1MB 3KWQC 2PYOB 4YM6C 5AVCA 1P3PC 5CPIB 2YFVB 2Y2QA 3LZ1D 1HQ3D 3WKJC 3MGSC 5AV5B 1ID3A 3C1BA 3W97C 1S32B 3REIB 2F8NB 4KGCB 2NQBB 3REJC 3AZGB 2FFFB 4G92C 3X1UA 2HUEC 5B31D 4R8PD 3MGQD 2FJ7A 3UT9B 3W98B 2ZY5A 3EG5B 1R4VA 1M19B 3AZKC 4E45A 4Z2MH 2NZDD 5B32B 4YS3D 4X23C 4H9NB 1P3OB 3VH5A 3MGPC 2XD1A 1P3IC 5DNMB 2Y2LA 3B6GC 3WAAB 3F6TA 2IO5B 3AZHC 3RELC 5AV8B 3KXBD 2RVQC 5F99B 3KUYA 4KUDB 5G49B 1ID3D 3C1BD 3AL0C 3WTPC 3AZMB 1P3AA 4H9RA 4JJNC 3LJAC 3LZ0B 4LD9A 5AVBC 5GXQB 1U35B 2Y2PA 2F8NG 5B1LA 4J8UC 1P3FB 3V9RB 4NE3A 4XZQC 2G5HC 3REHD 3AZEA 3TU4B 3AFAA 3AZIB 1TZYB 4XUJD 4H9SA 5AV9B 3NQJB 5B32G 4QLCB 2LY8A 3REJA 1P34C 1KX5C 3O62B 3A1KA 2AROB 1P3KB 2ZY2A 3REKB 5CP6B 3VH5W 3UTBB 4DRAA 5GT3C 5BS7C 1P3AD 4X23A 5B33D 2Y2JA 1N1JB 3MGPA 5BO0A 1EQZA 4J8VB 1ULYA 1M1AC 4ZBJB 5B1LD 5B0ZC 5E5AC 3KWQD 4YM6D 1P3PD 3W96B 3AZHA 3X1VB 1T3UA 3AN2C 3WKJD 3MGSD 1AOIA 4Z66B 1P3LB 2Y2HA 5B24C 3MGRC 3WTPA 5CPJA 1BH8A 4Z2MG 5AVCC 3C1CB 3REJD 1KX3C 2HIOB 5AVBA 1PZRA 4UUZA 2W8SA 5BNXB 5JRGB 2F8NK 3AZFB 5B0YC 3C1BC 3AZKD 4H9PA 1BH9A 4X23D 5B2JC 3WA9B 5B1MC 3X1UC 2CV5A 3MGPD 3AZLB 5CPIC 2FJ7C 1P3ID 4J8WC 5DNNA 1P34A 3B6GD 1KX5A 5AV5C 3AZHD 4ZUXB 3RELD 4G91C 3AYWA 3AV2B 2RVQD 1AOID 1S32C 3AZJB 1KX4B 1P3MA 2ZY4A 5AY8B 3WTPD 5GT3A 5BS7A 3LZ1B 3VH6A 1B6WA 1P3GB 1ZLAA 3LJAD 5AVBD 2F2AC 1M1AA 3KUYC 3MVDA 4CAYB 3R45A 4J8UD 1M18A 4WNNA 3AN2A 5B31B 4R8PB 3MGQB 2L5AA 4LD9C 5AV6A 3UTAA 5B24A 3MGRA 4NFTA 5B1LC 4UPKA 5AV8C 1P34D 1KX3A 2RIQA 1KX5D 3W99B 2NZDB 4J8XA 1TAFB 2XD5A 4WU8A 3AZEC 3AYWD 3MNNA 5B0YA 3AFAC 3A6NA 4H9QA 4H9OA 2J8PA 4H9SC 5GT3D 3KFUG 5BT1C 5B2JA 1F66A 3KXBB 2Y2OA 5B1MA 5CPKB 2PYOA 5CPIA 2YFVA 1M1AD 4J8WA 5B0ZD 5E5AD 1B67A 2BYKA 2JE5A 5AV5A 2JSSA 3AN2D 1S32A 3REIA 2F8NA 4KGCA 3H0RC 2NQBA 3AZGA 1EQZC 3X1TB 5JA4B 3O62C 5B24D 3MGRD 1JFIB 5B31G 3REHB 4DRBA 5AVCD 1KX3D 3W98A 3AV1B 2UWXA 5C3IB 1M19A 3B0DB 3MNND 1AOIC 4XUJB 3UTBC 1A7WA 5B0YD 5B32A 1P3OA 5CPJC 5GSUB 5B2JD 1WWIA 5B1MD 5B2IB 3X1UD 1W2EA 5CPID 3WAAA 4KHAB 4AWLC 2FJ7D 3B0CW 4J8WD 5AV8A 5F99A 4KUDA 1P3AB 5G49A 5AV5D 5B33B 3AZNB 1S32D 4KGCD 3AZMA 2CV5C 3KWQB 4YM6B 3LZ0A 1P3PB 5GXQA 3A1IA 5DNNC 3LELC 1U35A 3WKJB 3MGSB 1H3OB 3AYWC 1P3FA 2Y2KA 3V9RA 3NQUB 3KUYD 3W97B 3TU4A 2Y2GA 1P3MC 1P3OD 3REJB 4EO5C 4G92B 3AZIA 4WU9C 1ZLAC 3EPHA 4Z5TC 4QLCA 5AV9A 4LD9D 3O62A 3AZKB 3MVDC 5AV8D 2AROA 1M18C 2JCHA 1P3KA 4HGAC 3AZED 3REKA 1P3BB 5AY8C 3UTBA 5AV6C 5KDMB 3AFAD 3X1SC 1P3GC 3UTAC 1P3IB 3B6GB 1N1JA 4NE6A 4M6BA 4DQYB 3AZHB 1Q9CA 5GXQD 4J8VA 5BT1D 1U35D 2Y2NA 2Y2MA 5B40B 3RELB 4J8XC 4WU8C 3W96A 5GT0C 3MNNC 3X1VA 3B6FB 3A6NC 3TU4D 4Z66A 4JJNB 3LJAB 2BYMA 1F66C 2PYOC 1EQZD 3C1CA 4J8UB 3O62D 2HIOA 4XZQB 3LELA 5BNXA 5JRGA 3AZFA 3REKD 4KGCC 3REIC 3UTBD 2NQBC 3AZGC 3WA9A 1KX5B 4WZSB 4WU9A 5CPJD 4CSRB 3EPJA 3AZLA 4Z5TA 3UT9C 1HQ3B 3W98C 2BG1A 1M19C 2YFWB 4ZUXA 3X1VD 5B32C 3AV2A 1P3OC 3B0CT 3AZJA 1KX4A 5AY8A 5DNMC 3LZ1A 3X1SA 2CV5D 1P3GA 5B0ZB 5E5AB 3WAAC 5FUGA 3AV1C 5C3IC 2IO5C 2ZY3A 5DNND 3LELD 5F99C 4KUDC 4YS3B 3AZFD 3KSYA 5GT0A 3FDDA 3AZMC 5BNVB 5GSUC 5B31A 3MGQA 1P3MD 5AVCB 3LZ0C 1KX3B 4WU9D 3EPKA 5GXQC 1ZLAD 1U35C 4Z5TD 3VH5T 1ID3B 5B0YB 3C1BB 3W99A 2NZDA 1P3FC 1TAFA 3MVDD 3AZNC 3TU4C 3EPLA 1M18D 1WWSA 3AZIC 3X1UB 1KX4D 1TZYC 5AY8D 2FJ7B 3VH6W 4QLCC 5AV9C 5AV6D 3X1SD 1P3GD 4J8WB 3UTAD 3KXBA 2BYKB 5CPKA 3UT9A 4G91B 2AROC 4J8XD 1P3KC 2VQRA 4WU8D 3IP4C 5GT0D 5CP6C 3REKC 3B0BA 3A6ND 4H9NA 3X1TA 5JA4A 4J8VC 3WTPE 4ZBJC 1JFIA 1F66D 5DNMA 3KUYB 3REHA 2PYOD 3W99D 3W96C 3AV1A 3X1VC 1P3BC 4XUJA 4H9RB 4Z66C 4LD9B 1P3LC 3H0LC 3REID 2F8ND 5GSUA 5B1LB 2NQBD 3AZGD 3C1CC 5B40C 2Y2IA 5B2IA 5CPKD 2HIOC 1Z2CB 4KHAA 3UT9D 3W98D 3AZEB 5JRGC 3AZFC 1M19D 3B6FC 3AFAB 5B33A 3AZNA 5B32D 2G5IC 3WA9C 3KWQA 1TZYA 2HUEB 4YM6A 3X1TD 3AZLC 1P3PA 3NQJA 5DNMD 3WKJA 3WAAD 3MGSA 3AV1D 4ZUXC 1H3OA 3AV2C 5F99D 3NQUA 4KUDD 3W97A 4X23B 3AZJC 2CWEA 1KX4C 5CP6A 3MGPB 5BO0B 1EQZB 3AZMD 5GSUD 3LZ1C 1HQ3C 3LZ0D 5B2ID 4NE5A 3AZKA 1AOIB 1P3FD 1F1EA 3WTPB 3AZND 1HTAA 5CPJB 5B31C 4R8PC 1P3BA 3H0MC 3MGQC 1BH8B 5KDMA 1P3IA 3AZID 1P3LA 1TZYD 5AVBB 3B6GA 4AWLB 4QLCD 4UUZB 5AV9D 3W99C 3RELA 2NZDC 3VH6T 5B40A 4YS3C 3P5JB 4H9PB 2DF4C 2AROD 3W97D 2BYMB 1BH9B 1P3KD 3B6FA 2CV5B 5CP6D 4JJNA 3LJAA 5DNNB 3KXBC 3LELB 1P34B 5CPKC 1ID3C 5CHLB 4J8VD 4J8UA 4WV4B 3AYWB 4XZQA 3W96D 1P3MB 4EO5B 2ZM5A 4WU9B 5GT3B 1P3BD 1ZLAB 4Z5TB 4Z66D 1P3LD 4WJ3C 3X1TC 1M1AB 4CSRA 3MVDB 3REHC 1HQ3A 3C1CD 3R45B 5B40D 1M18B 2HIOD 2YFWA 4E44A 3B0DC 2F8NH 4HGAB 4WNNB 3AN2B 4CAYA 5JRGD 4XUJC 3B6FD 1KU5A 5AV6B 3X1SB 3UTAB 4JJND 5FUGB 5B24B 3MGRB 4R8PA 3WA9D 5B2IC 4J8XB 5B0ZA 5E5AA 3AZLD 2DQNC 4WU8B 5GT0B 3MNNB 4XZQD 1P3AC 4YS3A 3A6NB 4H9QB 5B33C
chains in the Genus database with same CATH topology
4H9OB 4ZUXD 3AV2D 1BFMA 5B2JB 5BNVA 3AZJD 1F66B 5B1MB 3KWQC 2PYOB 4YM6C 5AVCA 1P3PC 5CPIB 2YFVB 2Y2QA 3LZ1D 1HQ3D 3WKJC 3MGSC 5AV5B 1ID3A 3C1BA 3W97C 1S32B 3REIB 2F8NB 4KGCB 2NQBB 3REJC 3AZGB 2FFFB 4G92C 3X1UA 2HUEC 5B31D 4R8PD 3MGQD 2FJ7A 3UT9B 3W98B 2ZY5A 3EG5B 1R4VA 1M19B 3AZKC 4E45A 4Z2MH 2NZDD 5B32B 4YS3D 4X23C 4H9NB 1P3OB 3VH5A 3MGPC 2XD1A 1P3IC 5DNMB 2Y2LA 3B6GC 3WAAB 3F6TA 2IO5B 3AZHC 3RELC 5AV8B 3KXBD 2RVQC 5F99B 3KUYA 4KUDB 5G49B 1ID3D 3C1BD 3AL0C 3WTPC 3AZMB 1P3AA 4H9RA 4JJNC 3LJAC 3LZ0B 4LD9A 5AVBC 5GXQB 1U35B 2Y2PA 2F8NG 5B1LA 4J8UC 1P3FB 3V9RB 4NE3A 4XZQC 2G5HC 3REHD 3AZEA 3TU4B 3AFAA 3AZIB 1TZYB 4XUJD 4H9SA 5AV9B 3NQJB 5B32G 4QLCB 2LY8A 3REJA 1P34C 1KX5C 3O62B 3A1KA 2AROB 1P3KB 2ZY2A 3REKB 5CP6B 3VH5W 3UTBB 4DRAA 5GT3C 5BS7C 1P3AD 4X23A 5B33D 2Y2JA 1N1JB 3MGPA 5BO0A 1EQZA 4J8VB 1ULYA 1M1AC 4ZBJB 5B1LD 5B0ZC 5E5AC 3KWQD 4YM6D 1P3PD 3W96B 3AZHA 3X1VB 1T3UA 3AN2C 3WKJD 3MGSD 1AOIA 4Z66B 1P3LB 2Y2HA 5B24C 3MGRC 3WTPA 5CPJA 1BH8A 4Z2MG 5AVCC 3C1CB 3REJD 1KX3C 2HIOB 5AVBA 1PZRA 4UUZA 2W8SA 5BNXB 5JRGB 2F8NK 3AZFB 5B0YC 3C1BC 3AZKD 4H9PA 1BH9A 4X23D 5B2JC 3WA9B 5B1MC 3X1UC 2CV5A 3MGPD 3AZLB 5CPIC 2FJ7C 1P3ID 4J8WC 5DNNA 1P34A 3B6GD 1KX5A 5AV5C 3AZHD 4ZUXB 3RELD 4G91C 3AYWA 3AV2B 2RVQD 1AOID 1S32C 3AZJB 1KX4B 1P3MA 2ZY4A 5AY8B 3WTPD 5GT3A 5BS7A 3LZ1B 3VH6A 1B6WA 1P3GB 1ZLAA 3LJAD 5AVBD 2F2AC 1M1AA 3KUYC 3MVDA 4CAYB 3R45A 4J8UD 1M18A 4WNNA 3AN2A 5B31B 4R8PB 3MGQB 2L5AA 4LD9C 5AV6A 3UTAA 5B24A 3MGRA 4NFTA 5B1LC 4UPKA 5AV8C 1P34D 1KX3A 2RIQA 1KX5D 3W99B 2NZDB 4J8XA 1TAFB 2XD5A 4WU8A 3AZEC 3AYWD 3MNNA 5B0YA 3AFAC 3A6NA 4H9QA 4H9OA 2J8PA 4H9SC 5GT3D 3KFUG 5BT1C 5B2JA 1F66A 3KXBB 2Y2OA 5B1MA 5CPKB 2PYOA 5CPIA 2YFVA 1M1AD 4J8WA 5B0ZD 5E5AD 1B67A 2BYKA 2JE5A 5AV5A 2JSSA 3AN2D 1S32A 3REIA 2F8NA 4KGCA 3H0RC 2NQBA 3AZGA 1EQZC 3X1TB 5JA4B 3O62C 5B24D 3MGRD 1JFIB 5B31G 3REHB 4DRBA 5AVCD 1KX3D 3W98A 3AV1B 2UWXA 5C3IB 1M19A 3B0DB 3MNND 1AOIC 4XUJB 3UTBC 1A7WA 5B0YD 5B32A 1P3OA 5CPJC 5GSUB 5B2JD 1WWIA 5B1MD 5B2IB 3X1UD 1W2EA 5CPID 3WAAA 4KHAB 4AWLC 2FJ7D 3B0CW 4J8WD 5AV8A 5F99A 4KUDA 1P3AB 5G49A 5AV5D 5B33B 3AZNB 1S32D 4KGCD 3AZMA 2CV5C 3KWQB 4YM6B 3LZ0A 1P3PB 5GXQA 3A1IA 5DNNC 3LELC 1U35A 3WKJB 3MGSB 1H3OB 3AYWC 1P3FA 2Y2KA 3V9RA 3NQUB 3KUYD 3W97B 3TU4A 2Y2GA 1P3MC 1P3OD 3REJB 4EO5C 4G92B 3AZIA 4WU9C 1ZLAC 3EPHA 4Z5TC 4QLCA 5AV9A 4LD9D 3O62A 3AZKB 3MVDC 5AV8D 2AROA 1M18C 2JCHA 1P3KA 4HGAC 3AZED 3REKA 1P3BB 5AY8C 3UTBA 5AV6C 5KDMB 3AFAD 3X1SC 1P3GC 3UTAC 1P3IB 3B6GB 1N1JA 4NE6A 4M6BA 4DQYB 3AZHB 1Q9CA 5GXQD 4J8VA 5BT1D 1U35D 2Y2NA 2Y2MA 5B40B 3RELB 4J8XC 4WU8C 3W96A 5GT0C 3MNNC 3X1VA 3B6FB 3A6NC 3TU4D 4Z66A 4JJNB 3LJAB 2BYMA 1F66C 2PYOC 1EQZD 3C1CA 4J8UB 3O62D 2HIOA 4XZQB 3LELA 5BNXA 5JRGA 3AZFA 3REKD 4KGCC 3REIC 3UTBD 2NQBC 3AZGC 3WA9A 1KX5B 4WZSB 4WU9A 5CPJD 4CSRB 3EPJA 3AZLA 4Z5TA 3UT9C 1HQ3B 3W98C 2BG1A 1M19C 2YFWB 4ZUXA 3X1VD 5B32C 3AV2A 1P3OC 3B0CT 3AZJA 1KX4A 5AY8A 5DNMC 3LZ1A 3X1SA 2CV5D 1P3GA 5B0ZB 5E5AB 3WAAC 5FUGA 3AV1C 5C3IC 2IO5C 2ZY3A 5DNND 3LELD 5F99C 4KUDC 4YS3B 3AZFD 3KSYA 5GT0A 3FDDA 3AZMC 5BNVB 5GSUC 5B31A 3MGQA 1P3MD 5AVCB 3LZ0C 1KX3B 4WU9D 3EPKA 5GXQC 1ZLAD 1U35C 4Z5TD 3VH5T 1ID3B 5B0YB 3C1BB 3W99A 2NZDA 1P3FC 1TAFA 3MVDD 3AZNC 3TU4C 3EPLA 1M18D 1WWSA 3AZIC 3X1UB 1KX4D 1TZYC 5AY8D 2FJ7B 3VH6W 4QLCC 5AV9C 5AV6D 3X1SD 1P3GD 4J8WB 3UTAD 3KXBA 2BYKB 5CPKA 3UT9A 4G91B 2AROC 4J8XD 1P3KC 2VQRA 4WU8D 3IP4C 5GT0D 5CP6C 3REKC 3B0BA 3A6ND 4H9NA 3X1TA 5JA4A 4J8VC 3WTPE 4ZBJC 1JFIA 1F66D 5DNMA 3KUYB 3REHA 2PYOD 3W99D 3W96C 3AV1A 3X1VC 1P3BC 4XUJA 4H9RB 4Z66C 4LD9B 1P3LC 3H0LC 3REID 2F8ND 5GSUA 5B1LB 2NQBD 3AZGD 3C1CC 5B40C 2Y2IA 5B2IA 5CPKD 2HIOC 1Z2CB 4KHAA 3UT9D 3W98D 3AZEB 5JRGC 3AZFC 1M19D 3B6FC 3AFAB 5B33A 3AZNA 5B32D 2G5IC 3WA9C 3KWQA 1TZYA 2HUEB 4YM6A 3X1TD 3AZLC 1P3PA 3NQJA 5DNMD 3WKJA 3WAAD 3MGSA 3AV1D 4ZUXC 1H3OA 3AV2C 5F99D 3NQUA 4KUDD 3W97A 4X23B 3AZJC 2CWEA 1KX4C 5CP6A 3MGPB 5BO0B 1EQZB 3AZMD 5GSUD 3LZ1C 1HQ3C 3LZ0D 5B2ID 4NE5A 3AZKA 1AOIB 1P3FD 1F1EA 3WTPB 3AZND 1HTAA 5CPJB 5B31C 4R8PC 1P3BA 3H0MC 3MGQC 1BH8B 5KDMA 1P3IA 3AZID 1P3LA 1TZYD 5AVBB 3B6GA 4AWLB 4QLCD 4UUZB 5AV9D 3W99C 3RELA 2NZDC 3VH6T 5B40A 4YS3C 3P5JB 4H9PB 2DF4C 2AROD 3W97D 2BYMB 1BH9B 1P3KD 3B6FA 2CV5B 5CP6D 4JJNA 3LJAA 5DNNB 3KXBC 3LELB 1P34B 5CPKC 1ID3C 5CHLB 4J8VD 4J8UA 4WV4B 3AYWB 4XZQA 3W96D 1P3MB 4EO5B 2ZM5A 4WU9B 5GT3B 1P3BD 1ZLAB 4Z5TB 4Z66D 1P3LD 4WJ3C 3X1TC 1M1AB 4CSRA 3MVDB 3REHC 1HQ3A 3C1CD 3R45B 5B40D 1M18B 2HIOD 2YFWA 4E44A 3B0DC 2F8NH 4HGAB 4WNNB 3AN2B 4CAYA 5JRGD 4XUJC 3B6FD 1KU5A 5AV6B 3X1SB 3UTAB 4JJND 5FUGB 5B24B 3MGRB 4R8PA 3WA9D 5B2IC 4J8XB 5B0ZA 5E5AA 3AZLD 2DQNC 4WU8B 5GT0B 3MNNB 4XZQD 1P3AC 4YS3A 3A6NB 4H9QB 5B33C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O B;  4ZUX D;  3AV2 D;  1BFM A;  5B2J B;  5BNV A;  3AZJ D;  1F66 B;  5B1M B;  3KWQ C;  2PYO B;  4YM6 C;  5AVC A;  1P3P C;  5CPI B;  2YFV B;  3LZ1 D;  1HQ3 D;  3WKJ C;  3MGS C;  5AV5 B;  1ID3 A;  3C1B A;  3W97 C;  1S32 B;  3REI B;  2F8N B;  4KGC B;  2NQB B;  3REJ C;  3AZG B;  4G92 C;  3X1U A;  2HUE C;  5B31 D;  4R8P D;  3MGQ D;  2FJ7 A;  3UT9 B;  3W98 B;  1R4V A;  1M19 B;  3AZK C;  4E45 A;  4Z2M H;  2NZD D;  5B32 B;  4YS3 D;  4X23 C;  4H9N B;  1P3O B;  3VH5 A;  3MGP C;  1P3I C;  5DNM B;  3B6G C;  3WAA B;  2IO5 B;  3AZH C;  3REL C;  5AV8 B;  3KXB D;  2RVQ C;  5F99 B;  3KUY A;  4KUD B;  5G49 B;  1ID3 D;  3C1B D;  3WTP C;  3AZM B;  1P3A A;  4H9R A;  4JJN C;  3LJA C;  3LZ0 B;  4LD9 A;  5AVB C;  5GXQ B;  1U35 B;  2F8N G;  5B1L A;  4J8U C;  1P3F B;  3V9R B;  4NE3 A;  4XZQ C;  3REH D;  3AZE A;  3TU4 B;  3AFA A;  3AZI B;  1TZY B;  4XUJ D;  4H9S A;  5AV9 B;  3NQJ B;  5B32 G;  4QLC B;  2LY8 A;  3REJ A;  1P34 C;  1KX5 C;  3O62 B;  2ARO B;  1P3K B;  3REK B;  5CP6 B;  3VH5 W;  3UTB B;  4DRA A;  5GT3 C;  5BS7 C;  1P3A D;  4X23 A;  5B33 D;  1N1J B;  3MGP A;  5BO0 A;  1EQZ A;  4J8V B;  1ULY A;  1M1A C;  4ZBJ B;  5B1L D;  5B0Z C;  5E5A C;  3KWQ D;  4YM6 D;  1P3P D;  3W96 B;  3AZH A;  3X1V B;  3AN2 C;  3WKJ D;  3MGS D;  1AOI A;  4Z66 B;  1P3L B;  5B24 C;  3MGR C;  3WTP A;  5CPJ A;  1BH8 A;  4Z2M G;  5AVC C;  3C1C B;  3REJ D;  1KX3 C;  2HIO B;  5AVB A;  4UUZ A;  5BNX B;  5JRG B;  2F8N K;  3AZF B;  5B0Y C;  3C1B C;  3AZK D;  4H9P A;  1BH9 A;  4X23 D;  5B2J C;  3WA9 B;  5B1M C;  3X1U C;  2CV5 A;  3MGP D;  3AZL B;  5CPI C;  2FJ7 C;  1P3I D;  4J8W C;  5DNN A;  1P34 A;  3B6G D;  1KX5 A;  5AV5 C;  3AZH D;  4ZUX B;  3REL D;  4G91 C;  3AYW A;  3AV2 B;  2RVQ D;  1AOI D;  1S32 C;  3AZJ B;  1KX4 B;  1P3M A;  5AY8 B;  3WTP D;  5GT3 A;  5BS7 A;  3LZ1 B;  3VH6 A;  1B6W A;  1P3G B;  1ZLA A;  3LJA D;  5AVB D;  1M1A A;  3KUY C;  3MVD A;  4CAY B;  3R45 A;  4J8U D;  1M18 A;  4WNN A;  3AN2 A;  5B31 B;  4R8P B;  3MGQ B;  2L5A A;  4LD9 C;  5AV6 A;  3UTA A;  5B24 A;  3MGR A;  4NFT A;  5B1L C;  5AV8 C;  1P34 D;  1KX3 A;  3W99 B;  1KX5 D;  2NZD B;  4J8X A;  1TAF B;  4WU8 A;  3AZE C;  3AYW D;  3MNN A;  5B0Y A;  3AFA C;  3A6N A;  4H9Q A;  4H9O A;  4H9S C;  5GT3 D;  5BT1 C;  5B2J A;  1F66 A;  3KXB B;  5B1M A;  5CPK B;  2PYO A;  5CPI A;  2YFV A;  1M1A D;  4J8W A;  5B0Z D;  5E5A D;  1B67 A;  2BYK A;  5AV5 A;  2JSS A;  3AN2 D;  1S32 A;  3REI A;  2F8N A;  4KGC A;  2NQB A;  3AZG A;  1EQZ C;  3X1T B;  5JA4 B;  3O62 C;  5B24 D;  3MGR D;  1JFI B;  5B31 G;  3REH B;  4DRB A;  5AVC D;  1KX3 D;  3W98 A;  3AV1 B;  5C3I B;  1M19 A;  3B0D B;  3MNN D;  1AOI C;  4XUJ B;  3UTB C;  1A7W A;  5B0Y D;  5B32 A;  1P3O A;  5CPJ C;  5GSU B;  5B2J D;  1WWI A;  5B1M D;  5B2I B;  3X1U D;  5CPI D;  3WAA A;  4KHA B;  4AWL C;  2FJ7 D;  3B0C W;  4J8W D;  5AV8 A;  5F99 A;  4KUD A;  1P3A B;  5G49 A;  5AV5 D;  5B33 B;  3AZN B;  1S32 D;  4KGC D;  3AZM A;  2CV5 C;  3KWQ B;  4YM6 B;  3LZ0 A;  1P3P B;  5GXQ A;  5DNN C;  3LEL C;  1U35 A;  3WKJ B;  3MGS B;  1H3O B;  3AYW C;  1P3F A;  3V9R A;  3NQU B;  3KUY D;  3W97 B;  3TU4 A;  1P3M C;  1P3O D;  3REJ B;  4EO5 C;  4G92 B;  3AZI A;  4WU9 C;  1ZLA C;  4Z5T C;  4QLC A;  5AV9 A;  4LD9 D;  3O62 A;  3AZK B;  3MVD C;  5AV8 D;  2ARO A;  1M18 C;  1P3K A;  4HGA C;  3AZE D;  3REK A;  1P3B B;  5AY8 C;  3UTB A;  5AV6 C;  5KDM B;  3AFA D;  3X1S C;  1P3G C;  3UTA C;  1P3I B;  3B6G B;  1N1J A;  4NE6 A;  4M6B A;  3AZH B;  1Q9C A;  5GXQ D;  4J8V A;  5BT1 D;  1U35 D;  3REL B;  5B40 B;  4J8X C;  4WU8 C;  3W96 A;  5GT0 C;  3MNN C;  3X1V A;  3B6F B;  3A6N C;  3TU4 D;  4Z66 A;  4JJN B;  3LJA B;  2BYM A;  1F66 C;  2PYO C;  1EQZ D;  3C1C A;  4J8U B;  3O62 D;  2HIO A;  4XZQ B;  3LEL A;  5BNX A;  5JRG A;  3AZF A;  3REK D;  4KGC C;  3REI C;  3UTB D;  2NQB C;  3AZG C;  3WA9 A;  1KX5 B;  4WZS B;  4WU9 A;  5CPJ D;  4CSR B;  3AZL A;  4Z5T A;  3UT9 C;  1HQ3 B;  3W98 C;  1M19 C;  2YFW B;  4ZUX A;  3X1V D;  5B32 C;  3AV2 A;  1P3O C;  3B0C T;  3AZJ A;  1KX4 A;  5AY8 A;  5DNM C;  3LZ1 A;  3X1S A;  2CV5 D;  1P3G A;  5B0Z B;  5E5A B;  3WAA C;  5FUG A;  3AV1 C;  5C3I C;  2IO5 C;  5DNN D;  3LEL D;  5F99 C;  4KUD C;  4YS3 B;  3AZF D;  3KSY A;  5GT0 A;  3AZM C;  5BNV B;  5GSU C;  5B31 A;  3MGQ A;  1P3M D;  5AVC B;  3LZ0 C;  1KX3 B;  4WU9 D;  5GXQ C;  1ZLA D;  1U35 C;  4Z5T D;  3VH5 T;  1ID3 B;  5B0Y B;  3C1B B;  3W99 A;  2NZD A;  1P3F C;  1TAF A;  3MVD D;  3AZN C;  3TU4 C;  1M18 D;  1WWS A;  3AZI C;  3X1U B;  1KX4 D;  1TZY C;  5AY8 D;  2FJ7 B;  3VH6 W;  4QLC C;  5AV9 C;  5AV6 D;  3X1S D;  1P3G D;  4J8W B;  3UTA D;  3KXB A;  2BYK B;  5CPK A;  3UT9 A;  4G91 B;  2ARO C;  4J8X D;  1P3K C;  4WU8 D;  5GT0 D;  5CP6 C;  3REK C;  3B0B A;  3A6N D;  4H9N A;  3X1T A;  5JA4 A;  4J8V C;  3WTP E;  4ZBJ C;  1JFI A;  1F66 D;  5DNM A;  3KUY B;  3REH A;  2PYO D;  3W99 D;  3W96 C;  3AV1 A;  3X1V C;  1P3B C;  4XUJ A;  4H9R B;  4Z66 C;  4LD9 B;  1P3L C;  3REI D;  2F8N D;  5GSU A;  5B1L B;  2NQB D;  3AZG D;  3C1C C;  5B40 C;  5B2I A;  5CPK D;  2HIO C;  4KHA A;  3UT9 D;  3W98 D;  3AZE B;  5JRG C;  3AZF C;  1M19 D;  3B6F C;  3AFA B;  5B33 A;  3AZN A;  5B32 D;  3WA9 C;  3KWQ A;  1TZY A;  2HUE B;  4YM6 A;  3X1T D;  3AZL C;  1P3P A;  3NQJ A;  5DNM D;  3WKJ A;  3WAA D;  3MGS A;  3AV1 D;  4ZUX C;  1H3O A;  3AV2 C;  5F99 D;  3NQU A;  4KUD D;  3W97 A;  4X23 B;  3AZJ C;  2CWE A;  1KX4 C;  5CP6 A;  3MGP B;  5BO0 B;  1EQZ B;  3AZM D;  5GSU D;  3LZ1 C;  1HQ3 C;  3LZ0 D;  5B2I D;  4NE5 A;  3AZK A;  1AOI B;  1P3F D;  1F1E A;  3WTP B;  3AZN D;  1HTA A;  5CPJ B;  5B31 C;  4R8P C;  1P3B A;  3MGQ C;  1BH8 B;  5KDM A;  1P3I A;  3AZI D;  1P3L A;  1TZY D;  5AVB B;  3B6G A;  4AWL B;  4QLC D;  4UUZ B;  5AV9 D;  3W99 C;  3REL A;  2NZD C;  3VH6 T;  5B40 A;  4YS3 C;  4H9P B;  2ARO D;  3W97 D;  2BYM B;  1BH9 B;  1P3K D;  3B6F A;  2CV5 B;  5CP6 D;  4JJN A;  3LJA A;  5DNN B;  3KXB C;  3LEL B;  1P34 B;  5CPK C;  1ID3 C;  5CHL B;  4J8V D;  4J8U A;  4WV4 B;  3AYW B;  4XZQ A;  3W96 D;  1P3M B;  4EO5 B;  4WU9 B;  5GT3 B;  1P3B D;  1ZLA B;  4Z5T B;  4Z66 D;  1P3L D;  3X1T C;  1M1A B;  4CSR A;  3MVD B;  3REH C;  1HQ3 A;  3C1C D;  3R45 B;  5B40 D;  1M18 B;  2HIO D;  2YFW A;  4E44 A;  3B0D C;  2F8N H;  4HGA B;  4WNN B;  3AN2 B;  4CAY A;  5JRG D;  4XUJ C;  3B6F D;  1KU5 A;  5AV6 B;  3X1S B;  3UTA B;  4JJN D;  5FUG B;  5B24 B;  3MGR B;  4R8P A;  3WA9 D;  5B2I C;  4J8X B;  5B0Z A;  5E5A A;  3AZL D;  4WU8 B;  5GT0 B;  3MNN B;  4XZQ D;  1P3A C;  4YS3 A;  3A6N B;  4H9Q B;  5B33 C; 
#chains in the Genus database with same CATH topology
 4H9O B;  4ZUX D;  3AV2 D;  1BFM A;  5B2J B;  5BNV A;  3AZJ D;  1F66 B;  5B1M B;  3KWQ C;  2PYO B;  4YM6 C;  5AVC A;  1P3P C;  5CPI B;  2YFV B;  2Y2Q A;  3LZ1 D;  1HQ3 D;  3WKJ C;  3MGS C;  5AV5 B;  1ID3 A;  3C1B A;  3W97 C;  1S32 B;  3REI B;  2F8N B;  4KGC B;  2NQB B;  3REJ C;  3AZG B;  2FFF B;  4G92 C;  3X1U A;  2HUE C;  5B31 D;  4R8P D;  3MGQ D;  2FJ7 A;  3UT9 B;  3W98 B;  2ZY5 A;  3EG5 B;  1R4V A;  1M19 B;  3AZK C;  4E45 A;  4Z2M H;  2NZD D;  5B32 B;  4YS3 D;  4X23 C;  4H9N B;  1P3O B;  3VH5 A;  3MGP C;  2XD1 A;  1P3I C;  5DNM B;  2Y2L A;  3B6G C;  3WAA B;  3F6T A;  2IO5 B;  3AZH C;  3REL C;  5AV8 B;  3KXB D;  2RVQ C;  5F99 B;  3KUY A;  4KUD B;  5G49 B;  1ID3 D;  3C1B D;  3AL0 C;  3WTP C;  3AZM B;  1P3A A;  4H9R A;  4JJN C;  3LJA C;  3LZ0 B;  4LD9 A;  5AVB C;  5GXQ B;  1U35 B;  2Y2P A;  2F8N G;  5B1L A;  4J8U C;  1P3F B;  3V9R B;  4NE3 A;  4XZQ C;  2G5H C;  3REH D;  3AZE A;  3TU4 B;  3AFA A;  3AZI B;  1TZY B;  4XUJ D;  4H9S A;  5AV9 B;  3NQJ B;  5B32 G;  4QLC B;  2LY8 A;  3REJ A;  1P34 C;  1KX5 C;  3O62 B;  3A1K A;  2ARO B;  1P3K B;  2ZY2 A;  3REK B;  5CP6 B;  3VH5 W;  3UTB B;  4DRA A;  5GT3 C;  5BS7 C;  1P3A D;  4X23 A;  5B33 D;  2Y2J A;  1N1J B;  3MGP A;  5BO0 A;  1EQZ A;  4J8V B;  1ULY A;  1M1A C;  4ZBJ B;  5B1L D;  5B0Z C;  5E5A C;  3KWQ D;  4YM6 D;  1P3P D;  3W96 B;  3AZH A;  3X1V B;  1T3U A;  3AN2 C;  3WKJ D;  3MGS D;  1AOI A;  4Z66 B;  1P3L B;  2Y2H A;  5B24 C;  3MGR C;  3WTP A;  5CPJ A;  1BH8 A;  4Z2M G;  5AVC C;  3C1C B;  3REJ D;  1KX3 C;  2HIO B;  5AVB A;  1PZR A;  4UUZ A;  2W8S A;  5BNX B;  5JRG B;  2F8N K;  3AZF B;  5B0Y C;  3C1B C;  3AZK D;  4H9P A;  1BH9 A;  4X23 D;  5B2J C;  3WA9 B;  5B1M C;  3X1U C;  2CV5 A;  3MGP D;  3AZL B;  5CPI C;  2FJ7 C;  1P3I D;  4J8W C;  5DNN A;  1P34 A;  3B6G D;  1KX5 A;  5AV5 C;  3AZH D;  4ZUX B;  3REL D;  4G91 C;  3AYW A;  3AV2 B;  2RVQ D;  1AOI D;  1S32 C;  3AZJ B;  1KX4 B;  1P3M A;  2ZY4 A;  5AY8 B;  3WTP D;  5GT3 A;  5BS7 A;  3LZ1 B;  3VH6 A;  1B6W A;  1P3G B;  1ZLA A;  3LJA D;  5AVB D;  2F2A C;  1M1A A;  3KUY C;  3MVD A;  4CAY B;  3R45 A;  4J8U D;  1M18 A;  4WNN A;  3AN2 A;  5B31 B;  4R8P B;  3MGQ B;  2L5A A;  4LD9 C;  5AV6 A;  3UTA A;  5B24 A;  3MGR A;  4NFT A;  5B1L C;  4UPK A;  5AV8 C;  1P34 D;  1KX3 A;  2RIQ A;  1KX5 D;  3W99 B;  2NZD B;  4J8X A;  1TAF B;  2XD5 A;  4WU8 A;  3AZE C;  3AYW D;  3MNN A;  5B0Y A;  3AFA C;  3A6N A;  4H9Q A;  4H9O A;  2J8P A;  4H9S C;  5GT3 D;  3KFU G;  5BT1 C;  5B2J A;  1F66 A;  3KXB B;  2Y2O A;  5B1M A;  5CPK B;  2PYO A;  5CPI A;  2YFV A;  1M1A D;  4J8W A;  5B0Z D;  5E5A D;  1B67 A;  2BYK A;  2JE5 A;  5AV5 A;  2JSS A;  3AN2 D;  1S32 A;  3REI A;  2F8N A;  4KGC A;  3H0R C;  2NQB A;  3AZG A;  1EQZ C;  3X1T B;  5JA4 B;  3O62 C;  5B24 D;  3MGR D;  1JFI B;  5B31 G;  3REH B;  4DRB A;  5AVC D;  1KX3 D;  3W98 A;  3AV1 B;  2UWX A;  5C3I B;  1M19 A;  3B0D B;  3MNN D;  1AOI C;  4XUJ B;  3UTB C;  1A7W A;  5B0Y D;  5B32 A;  1P3O A;  5CPJ C;  5GSU B;  5B2J D;  1WWI A;  5B1M D;  5B2I B;  3X1U D;  1W2E A;  5CPI D;  3WAA A;  4KHA B;  4AWL C;  2FJ7 D;  3B0C W;  4J8W D;  5AV8 A;  5F99 A;  4KUD A;  1P3A B;  5G49 A;  5AV5 D;  5B33 B;  3AZN B;  1S32 D;  4KGC D;  3AZM A;  2CV5 C;  3KWQ B;  4YM6 B;  3LZ0 A;  1P3P B;  5GXQ A;  3A1I A;  5DNN C;  3LEL C;  1U35 A;  3WKJ B;  3MGS B;  1H3O B;  3AYW C;  1P3F A;  2Y2K A;  3V9R A;  3NQU B;  3KUY D;  3W97 B;  3TU4 A;  2Y2G A;  1P3M C;  1P3O D;  3REJ B;  4EO5 C;  4G92 B;  3AZI A;  4WU9 C;  1ZLA C;  3EPH A;  4Z5T C;  4QLC A;  5AV9 A;  4LD9 D;  3O62 A;  3AZK B;  3MVD C;  5AV8 D;  2ARO A;  1M18 C;  2JCH A;  1P3K A;  4HGA C;  3AZE D;  3REK A;  1P3B B;  5AY8 C;  3UTB A;  5AV6 C;  5KDM B;  3AFA D;  3X1S C;  1P3G C;  3UTA C;  1P3I B;  3B6G B;  1N1J A;  4NE6 A;  4M6B A;  4DQY B;  3AZH B;  1Q9C A;  5GXQ D;  4J8V A;  5BT1 D;  1U35 D;  2Y2N A;  2Y2M A;  5B40 B;  3REL B;  4J8X C;  4WU8 C;  3W96 A;  5GT0 C;  3MNN C;  3X1V A;  3B6F B;  3A6N C;  3TU4 D;  4Z66 A;  4JJN B;  3LJA B;  2BYM A;  1F66 C;  2PYO C;  1EQZ D;  3C1C A;  4J8U B;  3O62 D;  2HIO A;  4XZQ B;  3LEL A;  5BNX A;  5JRG A;  3AZF A;  3REK D;  4KGC C;  3REI C;  3UTB D;  2NQB C;  3AZG C;  3WA9 A;  1KX5 B;  4WZS B;  4WU9 A;  5CPJ D;  4CSR B;  3EPJ A;  3AZL A;  4Z5T A;  3UT9 C;  1HQ3 B;  3W98 C;  2BG1 A;  1M19 C;  2YFW B;  4ZUX A;  3X1V D;  5B32 C;  3AV2 A;  1P3O C;  3B0C T;  3AZJ A;  1KX4 A;  5AY8 A;  5DNM C;  3LZ1 A;  3X1S A;  2CV5 D;  1P3G A;  5B0Z B;  5E5A B;  3WAA C;  5FUG A;  3AV1 C;  5C3I C;  2IO5 C;  2ZY3 A;  5DNN D;  3LEL D;  5F99 C;  4KUD C;  4YS3 B;  3AZF D;  3KSY A;  5GT0 A;  3FDD A;  3AZM C;  5BNV B;  5GSU C;  5B31 A;  3MGQ A;  1P3M D;  5AVC B;  3LZ0 C;  1KX3 B;  4WU9 D;  3EPK A;  5GXQ C;  1ZLA D;  1U35 C;  4Z5T D;  3VH5 T;  1ID3 B;  5B0Y B;  3C1B B;  3W99 A;  2NZD A;  1P3F C;  1TAF A;  3MVD D;  3AZN C;  3TU4 C;  3EPL A;  1M18 D;  1WWS A;  3AZI C;  3X1U B;  1KX4 D;  1TZY C;  5AY8 D;  2FJ7 B;  3VH6 W;  4QLC C;  5AV9 C;  5AV6 D;  3X1S D;  1P3G D;  4J8W B;  3UTA D;  3KXB A;  2BYK B;  5CPK A;  3UT9 A;  4G91 B;  2ARO C;  4J8X D;  1P3K C;  2VQR A;  4WU8 D;  3IP4 C;  5GT0 D;  5CP6 C;  3REK C;  3B0B A;  3A6N D;  4H9N A;  3X1T A;  5JA4 A;  4J8V C;  3WTP E;  4ZBJ C;  1JFI A;  1F66 D;  5DNM A;  3KUY B;  3REH A;  2PYO D;  3W99 D;  3W96 C;  3AV1 A;  3X1V C;  1P3B C;  4XUJ A;  4H9R B;  4Z66 C;  4LD9 B;  1P3L C;  3H0L C;  3REI D;  2F8N D;  5GSU A;  5B1L B;  2NQB D;  3AZG D;  3C1C C;  5B40 C;  2Y2I A;  5B2I A;  5CPK D;  2HIO C;  1Z2C B;  4KHA A;  3UT9 D;  3W98 D;  3AZE B;  5JRG C;  3AZF C;  1M19 D;  3B6F C;  3AFA B;  5B33 A;  3AZN A;  5B32 D;  2G5I C;  3WA9 C;  3KWQ A;  1TZY A;  2HUE B;  4YM6 A;  3X1T D;  3AZL C;  1P3P A;  3NQJ A;  5DNM D;  3WKJ A;  3WAA D;  3MGS A;  3AV1 D;  4ZUX C;  1H3O A;  3AV2 C;  5F99 D;  3NQU A;  4KUD D;  3W97 A;  4X23 B;  3AZJ C;  2CWE A;  1KX4 C;  5CP6 A;  3MGP B;  5BO0 B;  1EQZ B;  3AZM D;  5GSU D;  3LZ1 C;  1HQ3 C;  3LZ0 D;  5B2I D;  4NE5 A;  3AZK A;  1AOI B;  1P3F D;  1F1E A;  3WTP B;  3AZN D;  1HTA A;  5CPJ B;  5B31 C;  4R8P C;  1P3B A;  3H0M C;  3MGQ C;  1BH8 B;  5KDM A;  1P3I A;  3AZI D;  1P3L A;  1TZY D;  5AVB B;  3B6G A;  4AWL B;  4QLC D;  4UUZ B;  5AV9 D;  3W99 C;  3REL A;  2NZD C;  3VH6 T;  5B40 A;  4YS3 C;  3P5J B;  4H9P B;  2DF4 C;  2ARO D;  3W97 D;  2BYM B;  1BH9 B;  1P3K D;  3B6F A;  2CV5 B;  5CP6 D;  4JJN A;  3LJA A;  5DNN B;  3KXB C;  3LEL B;  1P34 B;  5CPK C;  1ID3 C;  5CHL B;  4J8V D;  4J8U A;  4WV4 B;  3AYW B;  4XZQ A;  3W96 D;  1P3M B;  4EO5 B;  2ZM5 A;  4WU9 B;  5GT3 B;  1P3B D;  1ZLA B;  4Z5T B;  4Z66 D;  1P3L D;  4WJ3 C;  3X1T C;  1M1A B;  4CSR A;  3MVD B;  3REH C;  1HQ3 A;  3C1C D;  3R45 B;  5B40 D;  1M18 B;  2HIO D;  2YFW A;  4E44 A;  3B0D C;  2F8N H;  4HGA B;  4WNN B;  3AN2 B;  4CAY A;  5JRG D;  4XUJ C;  3B6F D;  1KU5 A;  5AV6 B;  3X1S B;  3UTA B;  4JJN D;  5FUG B;  5B24 B;  3MGR B;  4R8P A;  3WA9 D;  5B2I C;  4J8X B;  5B0Z A;  5E5A A;  3AZL D;  2DQN C;  4WU8 B;  5GT0 B;  3MNN B;  4XZQ D;  1P3A C;  4YS3 A;  3A6N B;  4H9Q B;  5B33 C; 
#chains in the Genus database with same CATH homology
 4H9O B;  4ZUX D;  3AV2 D;  1BFM A;  5B2J B;  5BNV A;  3AZJ D;  1F66 B;  5B1M B;  3KWQ C;  2PYO B;  4YM6 C;  5AVC A;  1P3P C;  5CPI B;  2YFV B;  2Y2Q A;  3LZ1 D;  1HQ3 D;  3WKJ C;  3MGS C;  5AV5 B;  1ID3 A;  3C1B A;  3W97 C;  1S32 B;  3REI B;  2F8N B;  4KGC B;  2NQB B;  3REJ C;  3AZG B;  2FFF B;  4G92 C;  3X1U A;  2HUE C;  5B31 D;  4R8P D;  3MGQ D;  2FJ7 A;  3UT9 B;  3W98 B;  2ZY5 A;  3EG5 B;  1R4V A;  1M19 B;  3AZK C;  4E45 A;  4Z2M H;  2NZD D;  5B32 B;  4YS3 D;  4X23 C;  4H9N B;  1P3O B;  3VH5 A;  3MGP C;  2XD1 A;  1P3I C;  5DNM B;  2Y2L A;  3B6G C;  3WAA B;  3F6T A;  2IO5 B;  3AZH C;  3REL C;  5AV8 B;  3KXB D;  2RVQ C;  5F99 B;  3KUY A;  4KUD B;  5G49 B;  1ID3 D;  3C1B D;  3AL0 C;  3WTP C;  3AZM B;  1P3A A;  4H9R A;  4JJN C;  3LJA C;  3LZ0 B;  4LD9 A;  5AVB C;  5GXQ B;  1U35 B;  2Y2P A;  2F8N G;  5B1L A;  4J8U C;  1P3F B;  3V9R B;  4NE3 A;  4XZQ C;  2G5H C;  3REH D;  3AZE A;  3TU4 B;  3AFA A;  3AZI B;  1TZY B;  4XUJ D;  4H9S A;  5AV9 B;  3NQJ B;  5B32 G;  4QLC B;  2LY8 A;  3REJ A;  1P34 C;  1KX5 C;  3O62 B;  3A1K A;  2ARO B;  1P3K B;  2ZY2 A;  3REK B;  5CP6 B;  3VH5 W;  3UTB B;  4DRA A;  5GT3 C;  5BS7 C;  1P3A D;  4X23 A;  5B33 D;  2Y2J A;  1N1J B;  3MGP A;  5BO0 A;  1EQZ A;  4J8V B;  1ULY A;  1M1A C;  4ZBJ B;  5B1L D;  5B0Z C;  5E5A C;  3KWQ D;  4YM6 D;  1P3P D;  3W96 B;  3AZH A;  3X1V B;  1T3U A;  3AN2 C;  3WKJ D;  3MGS D;  1AOI A;  4Z66 B;  1P3L B;  2Y2H A;  5B24 C;  3MGR C;  3WTP A;  5CPJ A;  1BH8 A;  4Z2M G;  5AVC C;  3C1C B;  3REJ D;  1KX3 C;  2HIO B;  5AVB A;  1PZR A;  4UUZ A;  2W8S A;  5BNX B;  5JRG B;  2F8N K;  3AZF B;  5B0Y C;  3C1B C;  3AZK D;  4H9P A;  1BH9 A;  4X23 D;  5B2J C;  3WA9 B;  5B1M C;  3X1U C;  2CV5 A;  3MGP D;  3AZL B;  5CPI C;  2FJ7 C;  1P3I D;  4J8W C;  5DNN A;  1P34 A;  3B6G D;  1KX5 A;  5AV5 C;  3AZH D;  4ZUX B;  3REL D;  4G91 C;  3AYW A;  3AV2 B;  2RVQ D;  1AOI D;  1S32 C;  3AZJ B;  1KX4 B;  1P3M A;  2ZY4 A;  5AY8 B;  3WTP D;  5GT3 A;  5BS7 A;  3LZ1 B;  3VH6 A;  1B6W A;  1P3G B;  1ZLA A;  3LJA D;  5AVB D;  2F2A C;  1M1A A;  3KUY C;  3MVD A;  4CAY B;  3R45 A;  4J8U D;  1M18 A;  4WNN A;  3AN2 A;  5B31 B;  4R8P B;  3MGQ B;  2L5A A;  4LD9 C;  5AV6 A;  3UTA A;  5B24 A;  3MGR A;  4NFT A;  5B1L C;  4UPK A;  5AV8 C;  1P34 D;  1KX3 A;  2RIQ A;  1KX5 D;  3W99 B;  2NZD B;  4J8X A;  1TAF B;  2XD5 A;  4WU8 A;  3AZE C;  3AYW D;  3MNN A;  5B0Y A;  3AFA C;  3A6N A;  4H9Q A;  4H9O A;  2J8P A;  4H9S C;  5GT3 D;  3KFU G;  5BT1 C;  5B2J A;  1F66 A;  3KXB B;  2Y2O A;  5B1M A;  5CPK B;  2PYO A;  5CPI A;  2YFV A;  1M1A D;  4J8W A;  5B0Z D;  5E5A D;  1B67 A;  2BYK A;  2JE5 A;  5AV5 A;  2JSS A;  3AN2 D;  1S32 A;  3REI A;  2F8N A;  4KGC A;  3H0R C;  2NQB A;  3AZG A;  1EQZ C;  3X1T B;  5JA4 B;  3O62 C;  5B24 D;  3MGR D;  1JFI B;  5B31 G;  3REH B;  4DRB A;  5AVC D;  1KX3 D;  3W98 A;  3AV1 B;  2UWX A;  5C3I B;  1M19 A;  3B0D B;  3MNN D;  1AOI C;  4XUJ B;  3UTB C;  1A7W A;  5B0Y D;  5B32 A;  1P3O A;  5CPJ C;  5GSU B;  5B2J D;  1WWI A;  5B1M D;  5B2I B;  3X1U D;  1W2E A;  5CPI D;  3WAA A;  4KHA B;  4AWL C;  2FJ7 D;  3B0C W;  4J8W D;  5AV8 A;  5F99 A;  4KUD A;  1P3A B;  5G49 A;  5AV5 D;  5B33 B;  3AZN B;  1S32 D;  4KGC D;  3AZM A;  2CV5 C;  3KWQ B;  4YM6 B;  3LZ0 A;  1P3P B;  5GXQ A;  3A1I A;  5DNN C;  3LEL C;  1U35 A;  3WKJ B;  3MGS B;  1H3O B;  3AYW C;  1P3F A;  2Y2K A;  3V9R A;  3NQU B;  3KUY D;  3W97 B;  3TU4 A;  2Y2G A;  1P3M C;  1P3O D;  3REJ B;  4EO5 C;  4G92 B;  3AZI A;  4WU9 C;  1ZLA C;  3EPH A;  4Z5T C;  4QLC A;  5AV9 A;  4LD9 D;  3O62 A;  3AZK B;  3MVD C;  5AV8 D;  2ARO A;  1M18 C;  2JCH A;  1P3K A;  4HGA C;  3AZE D;  3REK A;  1P3B B;  5AY8 C;  3UTB A;  5AV6 C;  5KDM B;  3AFA D;  3X1S C;  1P3G C;  3UTA C;  1P3I B;  3B6G B;  1N1J A;  4NE6 A;  4M6B A;  4DQY B;  3AZH B;  1Q9C A;  5GXQ D;  4J8V A;  5BT1 D;  1U35 D;  2Y2N A;  2Y2M A;  5B40 B;  3REL B;  4J8X C;  4WU8 C;  3W96 A;  5GT0 C;  3MNN C;  3X1V A;  3B6F B;  3A6N C;  3TU4 D;  4Z66 A;  4JJN B;  3LJA B;  2BYM A;  1F66 C;  2PYO C;  1EQZ D;  3C1C A;  4J8U B;  3O62 D;  2HIO A;  4XZQ B;  3LEL A;  5BNX A;  5JRG A;  3AZF A;  3REK D;  4KGC C;  3REI C;  3UTB D;  2NQB C;  3AZG C;  3WA9 A;  1KX5 B;  4WZS B;  4WU9 A;  5CPJ D;  4CSR B;  3EPJ A;  3AZL A;  4Z5T A;  3UT9 C;  1HQ3 B;  3W98 C;  2BG1 A;  1M19 C;  2YFW B;  4ZUX A;  3X1V D;  5B32 C;  3AV2 A;  1P3O C;  3B0C T;  3AZJ A;  1KX4 A;  5AY8 A;  5DNM C;  3LZ1 A;  3X1S A;  2CV5 D;  1P3G A;  5B0Z B;  5E5A B;  3WAA C;  5FUG A;  3AV1 C;  5C3I C;  2IO5 C;  2ZY3 A;  5DNN D;  3LEL D;  5F99 C;  4KUD C;  4YS3 B;  3AZF D;  3KSY A;  5GT0 A;  3FDD A;  3AZM C;  5BNV B;  5GSU C;  5B31 A;  3MGQ A;  1P3M D;  5AVC B;  3LZ0 C;  1KX3 B;  4WU9 D;  3EPK A;  5GXQ C;  1ZLA D;  1U35 C;  4Z5T D;  3VH5 T;  1ID3 B;  5B0Y B;  3C1B B;  3W99 A;  2NZD A;  1P3F C;  1TAF A;  3MVD D;  3AZN C;  3TU4 C;  3EPL A;  1M18 D;  1WWS A;  3AZI C;  3X1U B;  1KX4 D;  1TZY C;  5AY8 D;  2FJ7 B;  3VH6 W;  4QLC C;  5AV9 C;  5AV6 D;  3X1S D;  1P3G D;  4J8W B;  3UTA D;  3KXB A;  2BYK B;  5CPK A;  3UT9 A;  4G91 B;  2ARO C;  4J8X D;  1P3K C;  2VQR A;  4WU8 D;  3IP4 C;  5GT0 D;  5CP6 C;  3REK C;  3B0B A;  3A6N D;  4H9N A;  3X1T A;  5JA4 A;  4J8V C;  3WTP E;  4ZBJ C;  1JFI A;  1F66 D;  5DNM A;  3KUY B;  3REH A;  2PYO D;  3W99 D;  3W96 C;  3AV1 A;  3X1V C;  1P3B C;  4XUJ A;  4H9R B;  4Z66 C;  4LD9 B;  1P3L C;  3H0L C;  3REI D;  2F8N D;  5GSU A;  5B1L B;  2NQB D;  3AZG D;  3C1C C;  5B40 C;  2Y2I A;  5B2I A;  5CPK D;  2HIO C;  1Z2C B;  4KHA A;  3UT9 D;  3W98 D;  3AZE B;  5JRG C;  3AZF C;  1M19 D;  3B6F C;  3AFA B;  5B33 A;  3AZN A;  5B32 D;  2G5I C;  3WA9 C;  3KWQ A;  1TZY A;  2HUE B;  4YM6 A;  3X1T D;  3AZL C;  1P3P A;  3NQJ A;  5DNM D;  3WKJ A;  3WAA D;  3MGS A;  3AV1 D;  4ZUX C;  1H3O A;  3AV2 C;  5F99 D;  3NQU A;  4KUD D;  3W97 A;  4X23 B;  3AZJ C;  2CWE A;  1KX4 C;  5CP6 A;  3MGP B;  5BO0 B;  1EQZ B;  3AZM D;  5GSU D;  3LZ1 C;  1HQ3 C;  3LZ0 D;  5B2I D;  4NE5 A;  3AZK A;  1AOI B;  1P3F D;  1F1E A;  3WTP B;  3AZN D;  1HTA A;  5CPJ B;  5B31 C;  4R8P C;  1P3B A;  3H0M C;  3MGQ C;  1BH8 B;  5KDM A;  1P3I A;  3AZI D;  1P3L A;  1TZY D;  5AVB B;  3B6G A;  4AWL B;  4QLC D;  4UUZ B;  5AV9 D;  3W99 C;  3REL A;  2NZD C;  3VH6 T;  5B40 A;  4YS3 C;  3P5J B;  4H9P B;  2DF4 C;  2ARO D;  3W97 D;  2BYM B;  1BH9 B;  1P3K D;  3B6F A;  2CV5 B;  5CP6 D;  4JJN A;  3LJA A;  5DNN B;  3KXB C;  3LEL B;  1P34 B;  5CPK C;  1ID3 C;  5CHL B;  4J8V D;  4J8U A;  4WV4 B;  3AYW B;  4XZQ A;  3W96 D;  1P3M B;  4EO5 B;  2ZM5 A;  4WU9 B;  5GT3 B;  1P3B D;  1ZLA B;  4Z5T B;  4Z66 D;  1P3L D;  4WJ3 C;  3X1T C;  1M1A B;  4CSR A;  3MVD B;  3REH C;  1HQ3 A;  3C1C D;  3R45 B;  5B40 D;  1M18 B;  2HIO D;  2YFW A;  4E44 A;  3B0D C;  2F8N H;  4HGA B;  4WNN B;  3AN2 B;  4CAY A;  5JRG D;  4XUJ C;  3B6F D;  1KU5 A;  5AV6 B;  3X1S B;  3UTA B;  4JJN D;  5FUG B;  5B24 B;  3MGR B;  4R8P A;  3WA9 D;  5B2I C;  4J8X B;  5B0Z A;  5E5A A;  3AZL D;  2DQN C;  4WU8 B;  5GT0 B;  3MNN B;  4XZQ D;  1P3A C;  4YS3 A;  3A6N B;  4H9Q B;  5B33 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...