5AVCD

Human nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcD00
5JRGD 5AVBB 2IO5B 3AZED 4KGCC 5F99C 3X1SB 3MGQC 5B0ZD 4H9PA 3AZJA 1AOIA 1P3BD 4WNNB 4QLCA 3AZNB 5B1MB 5B1LC 5G49B 3O62C 4KUDB 3W99B 5GT3A 3MVDA 3NQUA 3VH6W 4JJND 1P3MB 4WU9D 3X1TA 1H3OB 5AVCC 3X1UD 3MGSB 4HGAC 3X1VB 3B0DC 1P34B 3WAAD 5CP6C 3W97C 4EO5B 4ZUXB 5AVBC 2IO5C 3V9RA 4XZQA 3W96A 3LELA 2AROD 3REHD 5JA4B 5JRGB 5DNNC 3R45B 4CSRA 5CPIA 3W98D 3AZNC 3AZLC 4KHAB 5B1MC 3KWQD 4H9OB 3AZKB 4KUDC 5B0ZB 1ID3C 3AV1D 1TAFA 3AZFC 1P3BB 1KX3D 5B33D 2BYMB 1P3MC 3AV2B 2BYKB 3MGSC 3TU4D 4WU8A 1ZLAC 2F8NA 5GSUA 4WU9B 3AZHA 1P34C 5DNNA 3X1UB 4EO5C 3WA9A 3WAAB 1ID3A 4J8UA 3AZMA 4H9RA 4CAYB 1EQZA 5JRGC 5B31A 4UUZB 4Z66D 5B40D 3REHB 3AZKC 1M1AD 3LJAD 3AFAD 3AZGC 1P3PA 5E5AD 3W98B 4DRBA 5CPKC 4G91B 3AZJD 1AOID 1KX4B 3AV2C 4QLCD 3LZ1A 3A6NC 3MGRD 1KX5B 5BS7A 1KX3B 5B33B 1P3AA 3X1TD 2NZDD 1P3OD 4LD9A 3WAAC 4H9NB 1M19B 4Z5TA 3REIB 5B2ID 5BT1C 1TZYD 1F66D 1WWIA 2HIOA 4XUJA 4H9SA 3LELD 4J8WC 1P3GA 5B0YA 1P3IA 4M6BA 3W98C 4Z66B 5B40B 4YS3D 1U35B 4R8PD 1M1AB 5BNVB 3LJAB 3KUYD 1KX4C 3AFAB 1KX5C 5E5AB 5CPJD 5B33C 2YFVB 3AZJB 2CV5D 4QLCB 3MGRB 4Z2MG 1BFMA 3WTPB 3REJD 5C3IC 3REKA 1M19C 2F8ND 1P3LC 3WKJD 3AZHD 3X1TB 3REIC 5AV8D 4E45A 1P3OB 2NZDB 1R4VA 3WTPE 3NQJA 3WA9D 3UT9C 4J8UD 5B2IB 3AZMD 2PYOD 2HUEB 1TZYB 4Z66C 5B40C 1F66B 3KXBD 1U35C 5GT0A 5B31D 3LJAC 5B32A 3LELB 3AFAC 4YM6A 3AYWC 5AV6D 5E5AC 1P3LA 3LZ0A 2F8NK 3MGPC 3AN2D 4R8PB 4YS3B 3KUYB 1S32D 2NQBB 4J8VB 3MGRC 4J8XA 3WTPC 3LZ1D 1P3FA 5GXQA 5CPJB 3UT9A 2CV5B 5CHLB 5FUGA 1B6WA 4KGCA 5F99A 2L5AA 1ULYA 5KDMB 1P3OC 2NZDC 3REJB 5DNMC 1P3AD 2YFWA 5B24D 5B2JC 3MGQA 4LD9D 3WKJB 5AV8B 5B2IC 3UTAD 5B1LA 4DRAA 3O62A 4NE6A 1WWSA 3MNND 2FJ7B 2HUEC 1TZYC 1F66C 3B6GD 3X1SC 3UTBD 3AZEB 2PYOB 4H9QB 5AVCA 4X23D 3VH6T 3KXBB 4YS3C 1P3GD 4R8PC 3W99C 1P3ID 2NQBC 4J8VC 5DNMA 3B6FD 5CP6A 3W97A 5AV6B 3AZID 1M18D 1HQ3D 3C1CD 3AN2B 5CPJC 5AVBA 1S32B 5AV9D 1JFIB 1HTAA 5BNXB 3X1VC 3VH5A 2RVQC 4JJNB 4G92B 1N1JB 3WKJC 3RELD 4ZUXC 4WNNA 5AY8D 3AZNA 3AZLA 5B1MA 5G49A 1P3AB 4KUDA 5B24B 2FJ7C 1P3KD 4Z2MH 3AZFA 3VH5W 3UTAB 5AV5D 3C1BD 1P3MA 3MNNB 3AZEC 2PYOC 3MGSA 4ZBJB 2AROB 3KXBC 1ZLAA 3X1VA 3B6GB 5B0ZC 3UTBB 1P34A 1BH9B 5AV6C 4X23B 1P3BC 4YM6D 3AN2C 3KWQB 5BO0B 1P3IB 3AV1B 3B6FB 3LZ0D 3AZIB 1M18B 1HQ3B 5GT3D 3C1CB 4JJNC 4G92C 5JA4A 3MVDD 5JRGA 4WU9C 5AV9B 3X1UC 3TU4B 3R45A 1BH8A 4H9OA 4WV4B 5B24C 3AZKA 5F99D 3RELB 3B0CW 3AZGA 1P3BA 5AY8B 3UTAC 5CPKA 2BYMA 3MNNC 3AV2A 2BYKA 1P3KB 3A6NA 3O62D 4ZBJC 2AROC 3B6GC 3REHC 4XZQD 5AV5B 3C1BB 3UTBC 3W96D 3X1UA 4G91C 3KWQC 5CPID 3AV1C 3B6FC 3WAAA 3AZIC 1M18C 1HQ3C 4CAYA 3C1CC 1KX3C 4H9PB 5CP6D 1AOIB 3W97D 5AV9C 3TU4C 3LZ0B 3KSYA 4UUZA 5GT3B 4WU8D 3MVDB 3NQUB 4J8WA 5GSUD 3RELC 5AY8C 3W98A 5DNND 1KX4A 3AZND 3AZLD 5B1MD 1P3KC 1KX5A 1ID3D 3C1BC 5B33A 3AZFD 1EQZD 3O62B 3V9RB 4XZQB 1M1AC 3MGSD 3W96B 1ZLAD 4H9NA 1M19A 4CSRB 3REIA 3AZJC 1AOIC 5CPIB 1P3PD 4QLCC 1TAFB 3MVDC 3W97B 3X1TC 4Z66A 5B40A 4WU8B 1U35A 1M1AA 5BNVA 3LJAA 3AFAA 3VH6A 5GSUB 2F8NB 3AYWA 3AZHB 5E5AA 3AZKD 5DNNB 4Z5TD 3MGPA 2YFVA 3AZGD 1F1EA 3AZLB 3MGRA 5CPKD 3WA9B 2LY8A 4XZQC 3AV2D 4J8UB 1ID3B 3WTPA 3W96C 3A6ND 4H9RB 3AZMB 3LELC 3AZFB 1EQZB 2HIOD 4XUJD 5B0YD 5B31B 2NZDA 5CPIC 1P3OA 3KUYC 4NE3A 1ZLAB 5B2JA 2CV5C 1P3PB 5B2IA 1TZYA 5BT1D 3LZ1B 1F66A 4WU8C 3REJC 3X1SA 5GSUC 3AZHC 5AV8C 3REKD 4J8WD 4YS3A 4R8PA 4AWLB 1BH8B 2F8NG 3KUYA 2NQBA 3W99A 4J8VA 4LD9B 3WA9C 1KX4D 4J8UC 3AZMC 4Z5TB 1KX5D 5CPJA 2CV5A 3AZGB 1EQZC 1H3OA 4WZSB 5CPKB 5B31C 5KDMA 3A6NB 3REJA 4NE5A 2HIOB 4XUJB 5GT0D 5B32D 3WKJA 5B31G 1P3GB 4ZUXA 4NFTA 5AV8A 5B0YB 1P3PC 1M19D 2CWEA 4E44A 1S32C 1P3LD 2FJ7A 3REID 3LZ1C 4J8XD 5BS7C 1P3FD 5GXQD 3UT9D 3AZEA 2PYOA 4H9QA 3VH5T 4KHAA 3KXBA 4AWLC 1P3AC 5B0ZA 4KGCD 4LD9C 1A7WA 1U35D 5AV6A 3MGQD 3REKB 4J8WB 4Z5TC 3AN2A 3AYWD 1S32A 1JFIA 3MGPD 5B1LD 5BNXA 3NQJB 4JJNA 1KU5A 4WU9A 1N1JA 2HIOC 4XUJC 4X23C 3WTPD 2JSSA 4H9SC 1P3GC 5B0YC 1P3IC 5AVCD 5B24A 5GT0B 5B32B 5C3IB 5DNMD 4YM6B 5B2JD 3UTAA 3B0BA 1P3LB 3MNNA 5AVBD 3B0CT 2AROA 3B6GA 3REHA 4J8XB 3UTBA 1P3FB 5GXQB 3UT9B 1BH9A 3X1SD 4X23A 3REKC 5FUGB 3KWQA 5BO0A 4KGCB 5F99B 3AV1A 3B6FA 3AZIA 1M18A 2YFWB 3MGQB 1HQ3A 3W99D 2NQBD 4J8VD 5AV5C 4KUDD 3C1CA 1KX3A 3AYWB 5AV9A 1B67A 3TU4A 3MGPB 5B1LB 1P3MD 2F8NH 3X1VD 5GT0C 2RVQD 5B32C 3RELA 4YM6C 1P34D 5AY8A 5AVCB 4HGAB 3LZ0C 4ZUXD 5B32G 1Q9CA 1P3KA 5GT3C 5DNMB 3B0DB 5B2JB 5CP6B 4J8XC 2FJ7D 5AV5A 3C1BA 1P3FC 5GXQC
chains in the Genus database with same CATH superfamily
5JRGD 5AVBB 2IO5B 3KFUG 3AZED 4KGCC 5F99C 3X1SB 3MGQC 5B0ZD 2DQNC 4H9PA 3AZJA 1AOIA 1P3BD 4WNNB 4QLCA 3AZNB 5B1MB 5B1LC 5G49B 3O62C 4KUDB 2W8SA 3W99B 5GT3A 3MVDA 2Y2NA 3NQUA 3VH6W 4JJND 1P3MB 4WU9D 3X1TA 1H3OB 5AVCC 3X1UD 3MGSB 4HGAC 3X1VB 3B0DC 1P34B 3WAAD 5CP6C 3W97C 4EO5B 4ZUXB 5AVBC 2IO5C 3V9RA 4XZQA 3W96A 3LELA 2AROD 3REHD 5JA4B 5JRGB 2G5HC 5DNNC 3R45B 2XD5A 4CSRA 5CPIA 3W98D 3AZNC 3AZLC 4KHAB 5B1MC 3KWQD 4H9OB 3AZKB 4KUDC 5B0ZB 1ID3C 3AV1D 1TAFA 3AZFC 1P3BB 1KX3D 5B33D 2BYMB 1P3MC 3AV2B 2BYKB 3MGSC 3TU4D 4WU8A 1ZLAC 2F8NA 5GSUA 4WU9B 3AZHA 1P34C 5DNNA 3X1UB 4EO5C 2Y2JA 3WA9A 3WAAB 1ID3A 4J8UA 3AZMA 4H9RA 4CAYB 3A1KA 4DQYB 1EQZA 5JRGC 3IP4C 2ZM5A 3EPLA 5B31A 4UUZB 4Z66D 5B40D 2UWXA 3REHB 3AZKC 1M1AD 3LJAD 1Z2CB 3AFAD 3AZGC 1P3PA 5E5AD 3W98B 4DRBA 5CPKC 4G91B 2JCHA 3AZJD 1AOID 1KX4B 3AV2C 4QLCD 3LZ1A 3A6NC 3MGRD 1KX5B 5BS7A 1KX3B 5B33B 3A1IA 1P3AA 3X1TD 2NZDD 1P3OD 4LD9A 3WAAC 4H9NB 1M19B 4Z5TA 3FDDA 3REIB 5B2ID 5BT1C 1TZYD 1F66D 1WWIA 2HIOA 4XUJA 4H9SA 3LELD 4J8WC 1P3GA 5B0YA 1P3IA 4M6BA 3W98C 4Z66B 5B40B 4YS3D 1U35B 4R8PD 1M1AB 5BNVB 3LJAB 3KUYD 1KX4C 3AFAB 1KX5C 5E5AB 5CPJD 5B33C 2YFVB 3AZJB 2CV5D 4QLCB 3MGRB 4Z2MG 1BFMA 3WTPB 3REJD 5C3IC 3REKA 1M19C 2F8ND 1P3LC 3WKJD 3AZHD 3X1TB 3REIC 5AV8D 4E45A 1P3OB 2NZDB 1R4VA 3WTPE 3EG5B 3NQJA 3WA9D 3UT9C 4J8UD 5B2IB 3AZMD 2PYOD 2HUEB 1TZYB 4Z66C 5B40C 1F66B 3KXBD 1U35C 5GT0A 5B31D 3LJAC 5B32A 3LELB 3AFAC 4YM6A 3AYWC 5AV6D 5E5AC 1P3LA 3LZ0A 2F8NK 3MGPC 3AN2D 4R8PB 4YS3B 3KUYB 1S32D 2NQBB 4J8VB 3MGRC 4J8XA 3WTPC 3LZ1D 1P3FA 1W2EA 5GXQA 5CPJB 3UT9A 4UPKA 2CV5B 5CHLB 5FUGA 1B6WA 4KGCA 5F99A 2L5AA 1ULYA 5KDMB 1P3OC 2NZDC 3REJB 5DNMC 1P3AD 2YFWA 5B24D 5B2JC 3MGQA 4LD9D 3WKJB 5AV8B 5B2IC 3UTAD 5B1LA 4DRAA 3O62A 4NE6A 1WWSA 3MNND 2FJ7B 2HUEC 1TZYC 1F66C 3B6GD 3X1SC 3UTBD 3AZEB 2PYOB 2Y2QA 4H9QB 5AVCA 4X23D 3VH6T 3KXBB 3H0RC 4YS3C 4R8PC 1P3GD 3W99C 1P3ID 2NQBC 4J8VC 5DNMA 3B6FD 3AL0C 5CP6A 3W97A 5AV6B 2Y2HA 3AZID 1M18D 1HQ3D 3C1CD 3AN2B 5CPJC 5AVBA 1S32B 2J8PA 5AV9D 1JFIB 1HTAA 5BNXB 3X1VC 3VH5A 2RVQC 4JJNB 4G92B 1N1JB 3WKJC 3RELD 4ZUXC 4WNNA 5AY8D 3AZNA 3AZLA 5B1MA 5G49A 1P3AB 4KUDA 5B24B 2FJ7C 1P3KD 1T3UA 4Z2MH 3AZFA 3VH5W 3UTAB 5AV5D 3C1BD 1P3MA 3MNNB 3AZEC 2PYOC 3MGSA 4ZBJB 2AROB 3KXBC 1ZLAA 3X1VA 3B6GB 5B0ZC 3UTBB 1P34A 1BH9B 5AV6C 4X23B 1P3BC 4YM6D 3AN2C 3KWQB 5BO0B 1P3IB 3AV1B 3B6FB 3LZ0D 3AZIB 1M18B 1HQ3B 5GT3D 3C1CB 4JJNC 4G92C 5JA4A 3MVDD 5JRGA 4WU9C 5AV9B 3X1UC 3TU4B 3R45A 1BH8A 4H9OA 4WV4B 5B24C 3AZKA 5F99D 3RELB 3B0CW 3AZGA 1P3BA 5AY8B 3UTAC 5CPKA 4WJ3C 2BYMA 3MNNC 3AV2A 2BYKA 1P3KB 3A6NA 3O62D 4ZBJC 2AROC 3B6GC 3REHC 4XZQD 5AV5B 3C1BB 3UTBC 3W96D 3H0LC 3X1UA 3EPJA 4G91C 3KWQC 5CPID 3AV1C 3B6FC 3WAAA 3AZIC 1M18C 1HQ3C 4CAYA 3C1CC 1KX3C 4H9PB 5CP6D 1AOIB 3W97D 2Y2IA 5AV9C 3TU4C 3LZ0B 3KSYA 4UUZA 5GT3B 4WU8D 2JE5A 3MVDB 3NQUB 3EPKA 2Y2OA 4J8WA 5GSUD 3RELC 5AY8C 3W98A 5DNND 2RIQA 1KX4A 3AZND 3AZLD 5B1MD 1P3KC 1KX5A 1ID3D 3C1BC 5B33A 3AZFD 1EQZD 2DF4C 3O62B 3V9RB 4XZQB 1M1AC 3MGSD 3W96B 1ZLAD 4H9NA 1M19A 4CSRB 3REIA 3AZJC 1AOIC 5CPIB 1P3PD 4QLCC 1TAFB 3MVDC 2Y2PA 3W97B 2G5IC 3X1TC 4Z66A 5B40A 4WU8B 1U35A 1M1AA 5BNVA 3LJAA 3AFAA 2XD1A 3H0MC 3VH6A 5GSUB 2F8NB 3AYWA 3AZHB 5E5AA 3AZKD 5DNNB 4Z5TD 3MGPA 2YFVA 3AZGD 1F1EA 3AZLB 3MGRA 5CPKD 3WA9B 2LY8A 4XZQC 3AV2D 4J8UB 1ID3B 3WTPA 3W96C 3A6ND 4H9RB 3AZMB 3LELC 3AZFB 1EQZB 2HIOD 4XUJD 2FFFB 2Y2LA 5B0YD 5B31B 2NZDA 5CPIC 1P3OA 3KUYC 4NE3A 1ZLAB 5B2JA 2CV5C 1P3PB 5B2IA 1TZYA 5BT1D 3LZ1B 1F66A 4WU8C 3REJC 3X1SA 2Y2GA 2ZY2A 5GSUC 3AZHC 5AV8C 3REKD 4J8WD 4YS3A 4R8PA 4AWLB 1BH8B 2F8NG 3KUYA 2NQBA 3W99A 4J8VA 4LD9B 3WA9C 1KX4D 2ZY4A 4J8UC 3AZMC 4Z5TB 1KX5D 5CPJA 2CV5A 3AZGB 2VQRA 1EQZC 1H3OA 4WZSB 5CPKB 2BG1A 5B31C 5KDMA 3A6NB 3REJA 4NE5A 2HIOB 4XUJB 5GT0D 5B32D 3WKJA 5B31G 1P3GB 4ZUXA 4NFTA 5AV8A 5B0YB 1P3PC 1M19D 2CWEA 3F6TA 4E44A 1S32C 2ZY5A 1P3LD 2FJ7A 3REID 3LZ1C 4J8XD 5BS7C 1P3FD 5GXQD 3UT9D 3AZEA 2PYOA 4H9QA 3VH5T 4KHAA 3KXBA 4AWLC 1P3AC 5B0ZA 4KGCD 4LD9C 1A7WA 1U35D 5AV6A 2ZY3A 3MGQD 3REKB 4J8WB 4Z5TC 3AN2A 3AYWD 1S32A 1JFIA 3MGPD 5B1LD 5BNXA 3NQJB 4JJNA 3P5JB 1KU5A 4WU9A 1N1JA 2Y2KA 2HIOC 4XUJC 4X23C 3WTPD 2JSSA 4H9SC 1P3GC 5B0YC 1P3IC 5AVCD 3EPHA 5B24A 5GT0B 5B32B 5C3IB 5DNMD 4YM6B 5B2JD 3UTAA 3B0BA 1P3LB 1PZRA 3MNNA 5AVBD 3B0CT 2AROA 3B6GA 3REHA 4J8XB 3UTBA 1P3FB 5GXQB 2Y2MA 3UT9B 1BH9A 3X1SD 4X23A 3REKC 5FUGB 3KWQA 5BO0A 4KGCB 5F99B 3AV1A 3B6FA 3AZIA 1M18A 2YFWB 3MGQB 1HQ3A 3W99D 2NQBD 4J8VD 5AV5C 4KUDD 3C1CA 1KX3A 3AYWB 5AV9A 1B67A 3TU4A 3MGPB 5B1LB 1P3MD 2F8NH 3X1VD 5GT0C 2RVQD 5B32C 3RELA 4YM6C 1P34D 5AY8A 5AVCB 4HGAB 3LZ0C 4ZUXD 5B32G 1Q9CA 1P3KA 5GT3C 5DNMB 2F2AC 3B0DB 5B2JB 5CP6B 4J8XC 2FJ7D 5AV5A 3C1BA 1P3FC 5GXQC
chains in the Genus database with same CATH topology
5JRGD 5AVBB 2IO5B 3KFUG 3AZED 4KGCC 5F99C 3X1SB 3MGQC 5B0ZD 2DQNC 4H9PA 3AZJA 1AOIA 1P3BD 4WNNB 4QLCA 3AZNB 5B1MB 5B1LC 5G49B 3O62C 4KUDB 2W8SA 3W99B 5GT3A 3MVDA 2Y2NA 3NQUA 3VH6W 4JJND 1P3MB 4WU9D 3X1TA 1H3OB 5AVCC 3X1UD 3MGSB 4HGAC 3X1VB 3B0DC 1P34B 3WAAD 5CP6C 3W97C 4EO5B 4ZUXB 5AVBC 2IO5C 3V9RA 4XZQA 3W96A 3LELA 2AROD 3REHD 5JA4B 5JRGB 2G5HC 5DNNC 3R45B 2XD5A 4CSRA 5CPIA 3W98D 3AZNC 3AZLC 4KHAB 5B1MC 3KWQD 4H9OB 3AZKB 4KUDC 5B0ZB 1ID3C 3AV1D 1TAFA 3AZFC 1P3BB 1KX3D 5B33D 2BYMB 1P3MC 3AV2B 2BYKB 3MGSC 3TU4D 4WU8A 1ZLAC 2F8NA 5GSUA 4WU9B 3AZHA 1P34C 5DNNA 3X1UB 4EO5C 2Y2JA 3WA9A 3WAAB 1ID3A 4J8UA 3AZMA 4H9RA 4CAYB 3A1KA 4DQYB 1EQZA 5JRGC 3IP4C 2ZM5A 3EPLA 5B31A 4UUZB 4Z66D 5B40D 2UWXA 3REHB 3AZKC 1M1AD 3LJAD 1Z2CB 3AFAD 3AZGC 1P3PA 5E5AD 3W98B 4DRBA 5CPKC 4G91B 2JCHA 3AZJD 1AOID 1KX4B 3AV2C 4QLCD 3LZ1A 3A6NC 3MGRD 1KX5B 5BS7A 1KX3B 5B33B 3A1IA 1P3AA 3X1TD 2NZDD 1P3OD 4LD9A 3WAAC 4H9NB 1M19B 4Z5TA 3FDDA 3REIB 5B2ID 5BT1C 1TZYD 1F66D 1WWIA 2HIOA 4XUJA 4H9SA 3LELD 4J8WC 1P3GA 5B0YA 1P3IA 4M6BA 3W98C 4Z66B 5B40B 4YS3D 1U35B 4R8PD 1M1AB 5BNVB 3LJAB 3KUYD 1KX4C 3AFAB 1KX5C 5E5AB 5CPJD 5B33C 2YFVB 3AZJB 2CV5D 4QLCB 3MGRB 4Z2MG 1BFMA 3WTPB 3REJD 5C3IC 3REKA 1M19C 2F8ND 1P3LC 3WKJD 3AZHD 3X1TB 3REIC 5AV8D 4E45A 1P3OB 2NZDB 1R4VA 3WTPE 3EG5B 3NQJA 3WA9D 3UT9C 4J8UD 5B2IB 3AZMD 2PYOD 2HUEB 1TZYB 4Z66C 5B40C 1F66B 3KXBD 1U35C 5GT0A 5B31D 3LJAC 5B32A 3LELB 3AFAC 4YM6A 3AYWC 5AV6D 5E5AC 1P3LA 3LZ0A 2F8NK 3MGPC 3AN2D 4R8PB 4YS3B 3KUYB 1S32D 2NQBB 4J8VB 3MGRC 4J8XA 3WTPC 3LZ1D 1P3FA 1W2EA 5GXQA 5CPJB 3UT9A 4UPKA 2CV5B 5CHLB 5FUGA 1B6WA 4KGCA 5F99A 2L5AA 1ULYA 5KDMB 1P3OC 2NZDC 3REJB 5DNMC 1P3AD 2YFWA 5B24D 5B2JC 3MGQA 4LD9D 3WKJB 5AV8B 5B2IC 3UTAD 5B1LA 4DRAA 3O62A 4NE6A 1WWSA 3MNND 2FJ7B 2HUEC 1TZYC 1F66C 3B6GD 3X1SC 3UTBD 3AZEB 2PYOB 2Y2QA 4H9QB 5AVCA 4X23D 3VH6T 3KXBB 3H0RC 4YS3C 4R8PC 1P3GD 3W99C 1P3ID 2NQBC 4J8VC 5DNMA 3B6FD 3AL0C 5CP6A 3W97A 5AV6B 2Y2HA 3AZID 1M18D 1HQ3D 3C1CD 3AN2B 5CPJC 5AVBA 1S32B 2J8PA 5AV9D 1JFIB 1HTAA 5BNXB 3X1VC 3VH5A 2RVQC 4JJNB 4G92B 1N1JB 3WKJC 3RELD 4ZUXC 4WNNA 5AY8D 3AZNA 3AZLA 5B1MA 5G49A 1P3AB 4KUDA 5B24B 2FJ7C 1P3KD 1T3UA 4Z2MH 3AZFA 3VH5W 3UTAB 5AV5D 3C1BD 1P3MA 3MNNB 3AZEC 2PYOC 3MGSA 4ZBJB 2AROB 3KXBC 1ZLAA 3X1VA 3B6GB 5B0ZC 3UTBB 1P34A 1BH9B 5AV6C 4X23B 1P3BC 4YM6D 3AN2C 3KWQB 5BO0B 1P3IB 3AV1B 3B6FB 3LZ0D 3AZIB 1M18B 1HQ3B 5GT3D 3C1CB 4JJNC 4G92C 5JA4A 3MVDD 5JRGA 4WU9C 5AV9B 3X1UC 3TU4B 3R45A 1BH8A 4H9OA 4WV4B 5B24C 3AZKA 5F99D 3RELB 3B0CW 3AZGA 1P3BA 5AY8B 3UTAC 5CPKA 4WJ3C 2BYMA 3MNNC 3AV2A 2BYKA 1P3KB 3A6NA 3O62D 4ZBJC 2AROC 3B6GC 3REHC 4XZQD 5AV5B 3C1BB 3UTBC 3W96D 3H0LC 3X1UA 3EPJA 4G91C 3KWQC 5CPID 3AV1C 3B6FC 3WAAA 3AZIC 1M18C 1HQ3C 4CAYA 3C1CC 1KX3C 4H9PB 5CP6D 1AOIB 3W97D 2Y2IA 5AV9C 3TU4C 3LZ0B 3KSYA 4UUZA 5GT3B 4WU8D 2JE5A 3MVDB 3NQUB 3EPKA 2Y2OA 4J8WA 5GSUD 3RELC 5AY8C 3W98A 5DNND 2RIQA 1KX4A 3AZND 3AZLD 5B1MD 1P3KC 1KX5A 1ID3D 3C1BC 5B33A 3AZFD 1EQZD 2DF4C 3O62B 3V9RB 4XZQB 1M1AC 3MGSD 3W96B 1ZLAD 4H9NA 1M19A 4CSRB 3REIA 3AZJC 1AOIC 5CPIB 1P3PD 4QLCC 1TAFB 3MVDC 2Y2PA 3W97B 2G5IC 3X1TC 4Z66A 5B40A 4WU8B 1U35A 1M1AA 5BNVA 3LJAA 3AFAA 2XD1A 3H0MC 3VH6A 5GSUB 2F8NB 3AYWA 3AZHB 5E5AA 3AZKD 5DNNB 4Z5TD 3MGPA 2YFVA 3AZGD 1F1EA 3AZLB 3MGRA 5CPKD 3WA9B 2LY8A 4XZQC 3AV2D 4J8UB 1ID3B 3WTPA 3W96C 3A6ND 4H9RB 3AZMB 3LELC 3AZFB 1EQZB 2HIOD 4XUJD 2FFFB 2Y2LA 5B0YD 5B31B 2NZDA 5CPIC 1P3OA 3KUYC 4NE3A 1ZLAB 5B2JA 2CV5C 1P3PB 5B2IA 1TZYA 5BT1D 3LZ1B 1F66A 4WU8C 3REJC 3X1SA 2Y2GA 2ZY2A 5GSUC 3AZHC 5AV8C 3REKD 4J8WD 4YS3A 4R8PA 4AWLB 1BH8B 2F8NG 3KUYA 2NQBA 3W99A 4J8VA 4LD9B 3WA9C 1KX4D 2ZY4A 4J8UC 3AZMC 4Z5TB 1KX5D 5CPJA 2CV5A 3AZGB 2VQRA 1EQZC 1H3OA 4WZSB 5CPKB 2BG1A 5B31C 5KDMA 3A6NB 3REJA 4NE5A 2HIOB 4XUJB 5GT0D 5B32D 3WKJA 5B31G 1P3GB 4ZUXA 4NFTA 5AV8A 5B0YB 1P3PC 1M19D 2CWEA 3F6TA 4E44A 1S32C 2ZY5A 1P3LD 2FJ7A 3REID 3LZ1C 4J8XD 5BS7C 1P3FD 5GXQD 3UT9D 3AZEA 2PYOA 4H9QA 3VH5T 4KHAA 3KXBA 4AWLC 1P3AC 5B0ZA 4KGCD 4LD9C 1A7WA 1U35D 5AV6A 2ZY3A 3MGQD 3REKB 4J8WB 4Z5TC 3AN2A 3AYWD 1S32A 1JFIA 3MGPD 5B1LD 5BNXA 3NQJB 4JJNA 3P5JB 1KU5A 4WU9A 1N1JA 2Y2KA 2HIOC 4XUJC 4X23C 3WTPD 2JSSA 4H9SC 1P3GC 5B0YC 1P3IC 5AVCD 3EPHA 5B24A 5GT0B 5B32B 5C3IB 5DNMD 4YM6B 5B2JD 3UTAA 3B0BA 1P3LB 1PZRA 3MNNA 5AVBD 3B0CT 2AROA 3B6GA 3REHA 4J8XB 3UTBA 1P3FB 5GXQB 2Y2MA 3UT9B 1BH9A 3X1SD 4X23A 3REKC 5FUGB 3KWQA 5BO0A 4KGCB 5F99B 3AV1A 3B6FA 3AZIA 1M18A 2YFWB 3MGQB 1HQ3A 3W99D 2NQBD 4J8VD 5AV5C 4KUDD 3C1CA 1KX3A 3AYWB 5AV9A 1B67A 3TU4A 3MGPB 5B1LB 1P3MD 2F8NH 3X1VD 5GT0C 2RVQD 5B32C 3RELA 4YM6C 1P34D 5AY8A 5AVCB 4HGAB 3LZ0C 4ZUXD 5B32G 1Q9CA 1P3KA 5GT3C 5DNMB 2F2AC 3B0DB 5B2JB 5CP6B 4J8XC 2FJ7D 5AV5A 3C1BA 1P3FC 5GXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG D;  5AVB B;  2IO5 B;  3AZE D;  4KGC C;  5F99 C;  3X1S B;  3MGQ C;  5B0Z D;  4H9P A;  3AZJ A;  1AOI A;  1P3B D;  4WNN B;  4QLC A;  3AZN B;  5B1M B;  5B1L C;  5G49 B;  3O62 C;  4KUD B;  3W99 B;  5GT3 A;  3MVD A;  3NQU A;  3VH6 W;  4JJN D;  1P3M B;  4WU9 D;  3X1T A;  1H3O B;  5AVC C;  3X1U D;  3MGS B;  4HGA C;  3X1V B;  3B0D C;  1P34 B;  3WAA D;  5CP6 C;  3W97 C;  4EO5 B;  4ZUX B;  5AVB C;  2IO5 C;  3V9R A;  4XZQ A;  3W96 A;  3LEL A;  2ARO D;  3REH D;  5JA4 B;  5JRG B;  5DNN C;  3R45 B;  4CSR A;  5CPI A;  3W98 D;  3AZN C;  3AZL C;  4KHA B;  5B1M C;  3KWQ D;  4H9O B;  3AZK B;  4KUD C;  5B0Z B;  1ID3 C;  3AV1 D;  1TAF A;  3AZF C;  1P3B B;  1KX3 D;  5B33 D;  2BYM B;  1P3M C;  3AV2 B;  2BYK B;  3MGS C;  3TU4 D;  4WU8 A;  1ZLA C;  2F8N A;  5GSU A;  4WU9 B;  3AZH A;  1P34 C;  5DNN A;  3X1U B;  4EO5 C;  3WA9 A;  3WAA B;  1ID3 A;  4J8U A;  3AZM A;  4H9R A;  4CAY B;  1EQZ A;  5JRG C;  5B31 A;  4UUZ B;  4Z66 D;  5B40 D;  3REH B;  3AZK C;  1M1A D;  3LJA D;  3AFA D;  3AZG C;  1P3P A;  5E5A D;  3W98 B;  4DRB A;  5CPK C;  4G91 B;  3AZJ D;  1AOI D;  1KX4 B;  3AV2 C;  4QLC D;  3LZ1 A;  3A6N C;  3MGR D;  1KX5 B;  5BS7 A;  1KX3 B;  5B33 B;  1P3A A;  3X1T D;  2NZD D;  1P3O D;  4LD9 A;  3WAA C;  4H9N B;  1M19 B;  4Z5T A;  3REI B;  5B2I D;  5BT1 C;  1TZY D;  1F66 D;  1WWI A;  2HIO A;  4XUJ A;  4H9S A;  3LEL D;  4J8W C;  1P3G A;  5B0Y A;  1P3I A;  4M6B A;  3W98 C;  4Z66 B;  5B40 B;  4YS3 D;  1U35 B;  4R8P D;  1M1A B;  5BNV B;  3LJA B;  3KUY D;  1KX4 C;  3AFA B;  1KX5 C;  5E5A B;  5CPJ D;  5B33 C;  2YFV B;  3AZJ B;  2CV5 D;  4QLC B;  3MGR B;  4Z2M G;  1BFM A;  3WTP B;  3REJ D;  5C3I C;  3REK A;  1M19 C;  2F8N D;  1P3L C;  3WKJ D;  3AZH D;  3X1T B;  3REI C;  5AV8 D;  4E45 A;  1P3O B;  2NZD B;  1R4V A;  3WTP E;  3NQJ A;  3WA9 D;  3UT9 C;  4J8U D;  5B2I B;  3AZM D;  2PYO D;  2HUE B;  1TZY B;  4Z66 C;  5B40 C;  1F66 B;  3KXB D;  1U35 C;  5GT0 A;  5B31 D;  3LJA C;  5B32 A;  3LEL B;  3AFA C;  4YM6 A;  3AYW C;  5AV6 D;  5E5A C;  1P3L A;  3LZ0 A;  2F8N K;  3MGP C;  3AN2 D;  4R8P B;  4YS3 B;  3KUY B;  1S32 D;  2NQB B;  4J8V B;  3MGR C;  4J8X A;  3WTP C;  3LZ1 D;  1P3F A;  5GXQ A;  5CPJ B;  3UT9 A;  2CV5 B;  5CHL B;  5FUG A;  1B6W A;  4KGC A;  5F99 A;  2L5A A;  1ULY A;  5KDM B;  1P3O C;  2NZD C;  3REJ B;  5DNM C;  1P3A D;  2YFW A;  5B24 D;  5B2J C;  3MGQ A;  4LD9 D;  3WKJ B;  5AV8 B;  5B2I C;  3UTA D;  5B1L A;  4DRA A;  3O62 A;  4NE6 A;  1WWS A;  3MNN D;  2FJ7 B;  2HUE C;  1TZY C;  1F66 C;  3B6G D;  3X1S C;  3UTB D;  3AZE B;  2PYO B;  4H9Q B;  5AVC A;  4X23 D;  3VH6 T;  3KXB B;  4YS3 C;  1P3G D;  4R8P C;  3W99 C;  1P3I D;  2NQB C;  4J8V C;  5DNM A;  3B6F D;  5CP6 A;  3W97 A;  5AV6 B;  3AZI D;  1M18 D;  1HQ3 D;  3C1C D;  3AN2 B;  5CPJ C;  5AVB A;  1S32 B;  5AV9 D;  1JFI B;  1HTA A;  5BNX B;  3X1V C;  3VH5 A;  2RVQ C;  4JJN B;  4G92 B;  1N1J B;  3WKJ C;  3REL D;  4ZUX C;  4WNN A;  5AY8 D;  3AZN A;  3AZL A;  5B1M A;  5G49 A;  1P3A B;  4KUD A;  5B24 B;  2FJ7 C;  1P3K D;  4Z2M H;  3AZF A;  3VH5 W;  3UTA B;  5AV5 D;  3C1B D;  1P3M A;  3MNN B;  3AZE C;  2PYO C;  3MGS A;  4ZBJ B;  2ARO B;  3KXB C;  1ZLA A;  3X1V A;  3B6G B;  5B0Z C;  3UTB B;  1P34 A;  1BH9 B;  5AV6 C;  4X23 B;  1P3B C;  4YM6 D;  3AN2 C;  3KWQ B;  5BO0 B;  1P3I B;  3AV1 B;  3B6F B;  3LZ0 D;  3AZI B;  1M18 B;  1HQ3 B;  5GT3 D;  3C1C B;  4JJN C;  4G92 C;  5JA4 A;  3MVD D;  5JRG A;  4WU9 C;  5AV9 B;  3X1U C;  3TU4 B;  3R45 A;  1BH8 A;  4H9O A;  4WV4 B;  5B24 C;  3AZK A;  5F99 D;  3REL B;  3B0C W;  3AZG A;  1P3B A;  5AY8 B;  3UTA C;  5CPK A;  2BYM A;  3MNN C;  3AV2 A;  2BYK A;  1P3K B;  3A6N A;  3O62 D;  4ZBJ C;  2ARO C;  3B6G C;  3REH C;  4XZQ D;  5AV5 B;  3C1B B;  3UTB C;  3W96 D;  3X1U A;  4G91 C;  3KWQ C;  5CPI D;  3AV1 C;  3B6F C;  3WAA A;  3AZI C;  1M18 C;  1HQ3 C;  4CAY A;  3C1C C;  1KX3 C;  4H9P B;  5CP6 D;  1AOI B;  3W97 D;  5AV9 C;  3TU4 C;  3LZ0 B;  3KSY A;  4UUZ A;  5GT3 B;  4WU8 D;  3MVD B;  3NQU B;  4J8W A;  5GSU D;  3REL C;  5AY8 C;  3W98 A;  5DNN D;  1KX4 A;  3AZN D;  3AZL D;  5B1M D;  1P3K C;  1KX5 A;  1ID3 D;  3C1B C;  5B33 A;  3AZF D;  1EQZ D;  3O62 B;  3V9R B;  4XZQ B;  1M1A C;  3MGS D;  3W96 B;  1ZLA D;  4H9N A;  1M19 A;  4CSR B;  3REI A;  3AZJ C;  1AOI C;  5CPI B;  1P3P D;  4QLC C;  1TAF B;  3MVD C;  3W97 B;  3X1T C;  4Z66 A;  5B40 A;  4WU8 B;  1U35 A;  1M1A A;  5BNV A;  3LJA A;  3AFA A;  3VH6 A;  5GSU B;  2F8N B;  3AYW A;  3AZH B;  5E5A A;  3AZK D;  5DNN B;  4Z5T D;  3MGP A;  2YFV A;  3AZG D;  1F1E A;  3AZL B;  3MGR A;  5CPK D;  3WA9 B;  2LY8 A;  4XZQ C;  3AV2 D;  4J8U B;  1ID3 B;  3WTP A;  3W96 C;  3A6N D;  4H9R B;  3AZM B;  3LEL C;  3AZF B;  1EQZ B;  2HIO D;  4XUJ D;  5B0Y D;  5B31 B;  2NZD A;  5CPI C;  1P3O A;  3KUY C;  4NE3 A;  1ZLA B;  5B2J A;  2CV5 C;  1P3P B;  5B2I A;  1TZY A;  5BT1 D;  3LZ1 B;  1F66 A;  4WU8 C;  3REJ C;  3X1S A;  5GSU C;  3AZH C;  5AV8 C;  3REK D;  4J8W D;  4YS3 A;  4R8P A;  4AWL B;  1BH8 B;  2F8N G;  3KUY A;  2NQB A;  3W99 A;  4J8V A;  4LD9 B;  3WA9 C;  1KX4 D;  4J8U C;  3AZM C;  4Z5T B;  1KX5 D;  5CPJ A;  2CV5 A;  3AZG B;  1EQZ C;  1H3O A;  4WZS B;  5CPK B;  5B31 C;  5KDM A;  3A6N B;  3REJ A;  4NE5 A;  2HIO B;  4XUJ B;  5GT0 D;  5B32 D;  3WKJ A;  5B31 G;  1P3G B;  4ZUX A;  4NFT A;  5AV8 A;  5B0Y B;  1P3P C;  1M19 D;  2CWE A;  4E44 A;  1S32 C;  1P3L D;  2FJ7 A;  3REI D;  3LZ1 C;  4J8X D;  5BS7 C;  1P3F D;  5GXQ D;  3UT9 D;  3AZE A;  2PYO A;  4H9Q A;  3VH5 T;  4KHA A;  3KXB A;  4AWL C;  1P3A C;  5B0Z A;  4KGC D;  4LD9 C;  1A7W A;  1U35 D;  5AV6 A;  3MGQ D;  3REK B;  4J8W B;  4Z5T C;  3AN2 A;  3AYW D;  1S32 A;  1JFI A;  3MGP D;  5B1L D;  5BNX A;  3NQJ B;  4JJN A;  1KU5 A;  4WU9 A;  1N1J A;  2HIO C;  4XUJ C;  4X23 C;  3WTP D;  2JSS A;  4H9S C;  1P3G C;  5B0Y C;  1P3I C;  5AVC D;  5B24 A;  5GT0 B;  5B32 B;  5C3I B;  5DNM D;  4YM6 B;  5B2J D;  3UTA A;  3B0B A;  1P3L B;  3MNN A;  5AVB D;  3B0C T;  2ARO A;  3B6G A;  3REH A;  4J8X B;  3UTB A;  1P3F B;  5GXQ B;  3UT9 B;  1BH9 A;  3X1S D;  4X23 A;  3REK C;  5FUG B;  3KWQ A;  5BO0 A;  4KGC B;  5F99 B;  3AV1 A;  3B6F A;  3AZI A;  1M18 A;  2YFW B;  3MGQ B;  1HQ3 A;  3W99 D;  2NQB D;  4J8V D;  5AV5 C;  4KUD D;  3C1C A;  1KX3 A;  3AYW B;  5AV9 A;  1B67 A;  3TU4 A;  3MGP B;  5B1L B;  1P3M D;  2F8N H;  3X1V D;  5GT0 C;  2RVQ D;  5B32 C;  3REL A;  4YM6 C;  1P34 D;  5AY8 A;  5AVC B;  4HGA B;  3LZ0 C;  4ZUX D;  5B32 G;  1Q9C A;  1P3K A;  5GT3 C;  5DNM B;  3B0D B;  5B2J B;  5CP6 B;  4J8X C;  2FJ7 D;  5AV5 A;  3C1B A;  1P3F C;  5GXQ C; 
#chains in the Genus database with same CATH topology
 5JRG D;  5AVB B;  2IO5 B;  3KFU G;  3AZE D;  4KGC C;  5F99 C;  3X1S B;  3MGQ C;  5B0Z D;  2DQN C;  4H9P A;  3AZJ A;  1AOI A;  1P3B D;  4WNN B;  4QLC A;  3AZN B;  5B1M B;  5B1L C;  5G49 B;  3O62 C;  4KUD B;  2W8S A;  3W99 B;  5GT3 A;  3MVD A;  2Y2N A;  3NQU A;  3VH6 W;  4JJN D;  1P3M B;  4WU9 D;  3X1T A;  1H3O B;  5AVC C;  3X1U D;  3MGS B;  4HGA C;  3X1V B;  3B0D C;  1P34 B;  3WAA D;  5CP6 C;  3W97 C;  4EO5 B;  4ZUX B;  5AVB C;  2IO5 C;  3V9R A;  4XZQ A;  3W96 A;  3LEL A;  2ARO D;  3REH D;  5JA4 B;  5JRG B;  2G5H C;  5DNN C;  3R45 B;  2XD5 A;  4CSR A;  5CPI A;  3W98 D;  3AZN C;  3AZL C;  4KHA B;  5B1M C;  3KWQ D;  4H9O B;  3AZK B;  4KUD C;  5B0Z B;  1ID3 C;  3AV1 D;  1TAF A;  3AZF C;  1P3B B;  1KX3 D;  5B33 D;  2BYM B;  1P3M C;  3AV2 B;  2BYK B;  3MGS C;  3TU4 D;  4WU8 A;  1ZLA C;  2F8N A;  5GSU A;  4WU9 B;  3AZH A;  1P34 C;  5DNN A;  3X1U B;  4EO5 C;  2Y2J A;  3WA9 A;  3WAA B;  1ID3 A;  4J8U A;  3AZM A;  4H9R A;  4CAY B;  3A1K A;  4DQY B;  1EQZ A;  5JRG C;  3IP4 C;  2ZM5 A;  3EPL A;  5B31 A;  4UUZ B;  4Z66 D;  5B40 D;  2UWX A;  3REH B;  3AZK C;  1M1A D;  3LJA D;  1Z2C B;  3AFA D;  3AZG C;  1P3P A;  5E5A D;  3W98 B;  4DRB A;  5CPK C;  4G91 B;  2JCH A;  3AZJ D;  1AOI D;  1KX4 B;  3AV2 C;  4QLC D;  3LZ1 A;  3A6N C;  3MGR D;  1KX5 B;  5BS7 A;  1KX3 B;  5B33 B;  3A1I A;  1P3A A;  3X1T D;  2NZD D;  1P3O D;  4LD9 A;  3WAA C;  4H9N B;  1M19 B;  4Z5T A;  3FDD A;  3REI B;  5B2I D;  5BT1 C;  1TZY D;  1F66 D;  1WWI A;  2HIO A;  4XUJ A;  4H9S A;  3LEL D;  4J8W C;  1P3G A;  5B0Y A;  1P3I A;  4M6B A;  3W98 C;  4Z66 B;  5B40 B;  4YS3 D;  1U35 B;  4R8P D;  1M1A B;  5BNV B;  3LJA B;  3KUY D;  1KX4 C;  3AFA B;  1KX5 C;  5E5A B;  5CPJ D;  5B33 C;  2YFV B;  3AZJ B;  2CV5 D;  4QLC B;  3MGR B;  4Z2M G;  1BFM A;  3WTP B;  3REJ D;  5C3I C;  3REK A;  1M19 C;  2F8N D;  1P3L C;  3WKJ D;  3AZH D;  3X1T B;  3REI C;  5AV8 D;  4E45 A;  1P3O B;  2NZD B;  1R4V A;  3WTP E;  3EG5 B;  3NQJ A;  3WA9 D;  3UT9 C;  4J8U D;  5B2I B;  3AZM D;  2PYO D;  2HUE B;  1TZY B;  4Z66 C;  5B40 C;  1F66 B;  3KXB D;  1U35 C;  5GT0 A;  5B31 D;  3LJA C;  5B32 A;  3LEL B;  3AFA C;  4YM6 A;  3AYW C;  5AV6 D;  5E5A C;  1P3L A;  3LZ0 A;  2F8N K;  3MGP C;  3AN2 D;  4R8P B;  4YS3 B;  3KUY B;  1S32 D;  2NQB B;  4J8V B;  3MGR C;  4J8X A;  3WTP C;  3LZ1 D;  1P3F A;  1W2E A;  5GXQ A;  5CPJ B;  3UT9 A;  4UPK A;  2CV5 B;  5CHL B;  5FUG A;  1B6W A;  4KGC A;  5F99 A;  2L5A A;  1ULY A;  5KDM B;  1P3O C;  2NZD C;  3REJ B;  5DNM C;  1P3A D;  2YFW A;  5B24 D;  5B2J C;  3MGQ A;  4LD9 D;  3WKJ B;  5AV8 B;  5B2I C;  3UTA D;  5B1L A;  4DRA A;  3O62 A;  4NE6 A;  1WWS A;  3MNN D;  2FJ7 B;  2HUE C;  1TZY C;  1F66 C;  3B6G D;  3X1S C;  3UTB D;  3AZE B;  2PYO B;  2Y2Q A;  4H9Q B;  5AVC A;  4X23 D;  3VH6 T;  3KXB B;  3H0R C;  4YS3 C;  4R8P C;  1P3G D;  3W99 C;  1P3I D;  2NQB C;  4J8V C;  5DNM A;  3B6F D;  3AL0 C;  5CP6 A;  3W97 A;  5AV6 B;  2Y2H A;  3AZI D;  1M18 D;  1HQ3 D;  3C1C D;  3AN2 B;  5CPJ C;  5AVB A;  1S32 B;  2J8P A;  5AV9 D;  1JFI B;  1HTA A;  5BNX B;  3X1V C;  3VH5 A;  2RVQ C;  4JJN B;  4G92 B;  1N1J B;  3WKJ C;  3REL D;  4ZUX C;  4WNN A;  5AY8 D;  3AZN A;  3AZL A;  5B1M A;  5G49 A;  1P3A B;  4KUD A;  5B24 B;  2FJ7 C;  1P3K D;  1T3U A;  4Z2M H;  3AZF A;  3VH5 W;  3UTA B;  5AV5 D;  3C1B D;  1P3M A;  3MNN B;  3AZE C;  2PYO C;  3MGS A;  4ZBJ B;  2ARO B;  3KXB C;  1ZLA A;  3X1V A;  3B6G B;  5B0Z C;  3UTB B;  1P34 A;  1BH9 B;  5AV6 C;  4X23 B;  1P3B C;  4YM6 D;  3AN2 C;  3KWQ B;  5BO0 B;  1P3I B;  3AV1 B;  3B6F B;  3LZ0 D;  3AZI B;  1M18 B;  1HQ3 B;  5GT3 D;  3C1C B;  4JJN C;  4G92 C;  5JA4 A;  3MVD D;  5JRG A;  4WU9 C;  5AV9 B;  3X1U C;  3TU4 B;  3R45 A;  1BH8 A;  4H9O A;  4WV4 B;  5B24 C;  3AZK A;  5F99 D;  3REL B;  3B0C W;  3AZG A;  1P3B A;  5AY8 B;  3UTA C;  5CPK A;  4WJ3 C;  2BYM A;  3MNN C;  3AV2 A;  2BYK A;  1P3K B;  3A6N A;  3O62 D;  4ZBJ C;  2ARO C;  3B6G C;  3REH C;  4XZQ D;  5AV5 B;  3C1B B;  3UTB C;  3W96 D;  3H0L C;  3X1U A;  3EPJ A;  4G91 C;  3KWQ C;  5CPI D;  3AV1 C;  3B6F C;  3WAA A;  3AZI C;  1M18 C;  1HQ3 C;  4CAY A;  3C1C C;  1KX3 C;  4H9P B;  5CP6 D;  1AOI B;  3W97 D;  2Y2I A;  5AV9 C;  3TU4 C;  3LZ0 B;  3KSY A;  4UUZ A;  5GT3 B;  4WU8 D;  2JE5 A;  3MVD B;  3NQU B;  3EPK A;  2Y2O A;  4J8W A;  5GSU D;  3REL C;  5AY8 C;  3W98 A;  5DNN D;  2RIQ A;  1KX4 A;  3AZN D;  3AZL D;  5B1M D;  1P3K C;  1KX5 A;  1ID3 D;  3C1B C;  5B33 A;  3AZF D;  1EQZ D;  2DF4 C;  3O62 B;  3V9R B;  4XZQ B;  1M1A C;  3MGS D;  3W96 B;  1ZLA D;  4H9N A;  1M19 A;  4CSR B;  3REI A;  3AZJ C;  1AOI C;  5CPI B;  1P3P D;  4QLC C;  1TAF B;  3MVD C;  2Y2P A;  3W97 B;  2G5I C;  3X1T C;  4Z66 A;  5B40 A;  4WU8 B;  1U35 A;  1M1A A;  5BNV A;  3LJA A;  3AFA A;  2XD1 A;  3H0M C;  3VH6 A;  5GSU B;  2F8N B;  3AYW A;  3AZH B;  5E5A A;  3AZK D;  5DNN B;  4Z5T D;  3MGP A;  2YFV A;  3AZG D;  1F1E A;  3AZL B;  3MGR A;  5CPK D;  3WA9 B;  2LY8 A;  4XZQ C;  3AV2 D;  4J8U B;  1ID3 B;  3WTP A;  3W96 C;  3A6N D;  4H9R B;  3AZM B;  3LEL C;  3AZF B;  1EQZ B;  2HIO D;  4XUJ D;  2FFF B;  2Y2L A;  5B0Y D;  5B31 B;  2NZD A;  5CPI C;  1P3O A;  3KUY C;  4NE3 A;  1ZLA B;  5B2J A;  2CV5 C;  1P3P B;  5B2I A;  1TZY A;  5BT1 D;  3LZ1 B;  1F66 A;  4WU8 C;  3REJ C;  3X1S A;  2Y2G A;  2ZY2 A;  5GSU C;  3AZH C;  5AV8 C;  3REK D;  4J8W D;  4YS3 A;  4R8P A;  4AWL B;  1BH8 B;  2F8N G;  3KUY A;  2NQB A;  3W99 A;  4J8V A;  4LD9 B;  3WA9 C;  1KX4 D;  2ZY4 A;  4J8U C;  3AZM C;  4Z5T B;  1KX5 D;  5CPJ A;  2CV5 A;  3AZG B;  2VQR A;  1EQZ C;  1H3O A;  4WZS B;  5CPK B;  2BG1 A;  5B31 C;  5KDM A;  3A6N B;  3REJ A;  4NE5 A;  2HIO B;  4XUJ B;  5GT0 D;  5B32 D;  3WKJ A;  5B31 G;  1P3G B;  4ZUX A;  4NFT A;  5AV8 A;  5B0Y B;  1P3P C;  1M19 D;  2CWE A;  3F6T A;  4E44 A;  1S32 C;  2ZY5 A;  1P3L D;  2FJ7 A;  3REI D;  3LZ1 C;  4J8X D;  5BS7 C;  1P3F D;  5GXQ D;  3UT9 D;  3AZE A;  2PYO A;  4H9Q A;  3VH5 T;  4KHA A;  3KXB A;  4AWL C;  1P3A C;  5B0Z A;  4KGC D;  4LD9 C;  1A7W A;  1U35 D;  5AV6 A;  2ZY3 A;  3MGQ D;  3REK B;  4J8W B;  4Z5T C;  3AN2 A;  3AYW D;  1S32 A;  1JFI A;  3MGP D;  5B1L D;  5BNX A;  3NQJ B;  4JJN A;  3P5J B;  1KU5 A;  4WU9 A;  1N1J A;  2Y2K A;  2HIO C;  4XUJ C;  4X23 C;  3WTP D;  2JSS A;  4H9S C;  1P3G C;  5B0Y C;  1P3I C;  5AVC D;  3EPH A;  5B24 A;  5GT0 B;  5B32 B;  5C3I B;  5DNM D;  4YM6 B;  5B2J D;  3UTA A;  3B0B A;  1P3L B;  1PZR A;  3MNN A;  5AVB D;  3B0C T;  2ARO A;  3B6G A;  3REH A;  4J8X B;  3UTB A;  1P3F B;  5GXQ B;  2Y2M A;  3UT9 B;  1BH9 A;  3X1S D;  4X23 A;  3REK C;  5FUG B;  3KWQ A;  5BO0 A;  4KGC B;  5F99 B;  3AV1 A;  3B6F A;  3AZI A;  1M18 A;  2YFW B;  3MGQ B;  1HQ3 A;  3W99 D;  2NQB D;  4J8V D;  5AV5 C;  4KUD D;  3C1C A;  1KX3 A;  3AYW B;  5AV9 A;  1B67 A;  3TU4 A;  3MGP B;  5B1L B;  1P3M D;  2F8N H;  3X1V D;  5GT0 C;  2RVQ D;  5B32 C;  3REL A;  4YM6 C;  1P34 D;  5AY8 A;  5AVC B;  4HGA B;  3LZ0 C;  4ZUX D;  5B32 G;  1Q9C A;  1P3K A;  5GT3 C;  5DNM B;  2F2A C;  3B0D B;  5B2J B;  5CP6 B;  4J8X C;  2FJ7 D;  5AV5 A;  3C1B A;  1P3F C;  5GXQ C; 
#chains in the Genus database with same CATH homology
 5JRG D;  5AVB B;  2IO5 B;  3KFU G;  3AZE D;  4KGC C;  5F99 C;  3X1S B;  3MGQ C;  5B0Z D;  2DQN C;  4H9P A;  3AZJ A;  1AOI A;  1P3B D;  4WNN B;  4QLC A;  3AZN B;  5B1M B;  5B1L C;  5G49 B;  3O62 C;  4KUD B;  2W8S A;  3W99 B;  5GT3 A;  3MVD A;  2Y2N A;  3NQU A;  3VH6 W;  4JJN D;  1P3M B;  4WU9 D;  3X1T A;  1H3O B;  5AVC C;  3X1U D;  3MGS B;  4HGA C;  3X1V B;  3B0D C;  1P34 B;  3WAA D;  5CP6 C;  3W97 C;  4EO5 B;  4ZUX B;  5AVB C;  2IO5 C;  3V9R A;  4XZQ A;  3W96 A;  3LEL A;  2ARO D;  3REH D;  5JA4 B;  5JRG B;  2G5H C;  5DNN C;  3R45 B;  2XD5 A;  4CSR A;  5CPI A;  3W98 D;  3AZN C;  3AZL C;  4KHA B;  5B1M C;  3KWQ D;  4H9O B;  3AZK B;  4KUD C;  5B0Z B;  1ID3 C;  3AV1 D;  1TAF A;  3AZF C;  1P3B B;  1KX3 D;  5B33 D;  2BYM B;  1P3M C;  3AV2 B;  2BYK B;  3MGS C;  3TU4 D;  4WU8 A;  1ZLA C;  2F8N A;  5GSU A;  4WU9 B;  3AZH A;  1P34 C;  5DNN A;  3X1U B;  4EO5 C;  2Y2J A;  3WA9 A;  3WAA B;  1ID3 A;  4J8U A;  3AZM A;  4H9R A;  4CAY B;  3A1K A;  4DQY B;  1EQZ A;  5JRG C;  3IP4 C;  2ZM5 A;  3EPL A;  5B31 A;  4UUZ B;  4Z66 D;  5B40 D;  2UWX A;  3REH B;  3AZK C;  1M1A D;  3LJA D;  1Z2C B;  3AFA D;  3AZG C;  1P3P A;  5E5A D;  3W98 B;  4DRB A;  5CPK C;  4G91 B;  2JCH A;  3AZJ D;  1AOI D;  1KX4 B;  3AV2 C;  4QLC D;  3LZ1 A;  3A6N C;  3MGR D;  1KX5 B;  5BS7 A;  1KX3 B;  5B33 B;  3A1I A;  1P3A A;  3X1T D;  2NZD D;  1P3O D;  4LD9 A;  3WAA C;  4H9N B;  1M19 B;  4Z5T A;  3FDD A;  3REI B;  5B2I D;  5BT1 C;  1TZY D;  1F66 D;  1WWI A;  2HIO A;  4XUJ A;  4H9S A;  3LEL D;  4J8W C;  1P3G A;  5B0Y A;  1P3I A;  4M6B A;  3W98 C;  4Z66 B;  5B40 B;  4YS3 D;  1U35 B;  4R8P D;  1M1A B;  5BNV B;  3LJA B;  3KUY D;  1KX4 C;  3AFA B;  1KX5 C;  5E5A B;  5CPJ D;  5B33 C;  2YFV B;  3AZJ B;  2CV5 D;  4QLC B;  3MGR B;  4Z2M G;  1BFM A;  3WTP B;  3REJ D;  5C3I C;  3REK A;  1M19 C;  2F8N D;  1P3L C;  3WKJ D;  3AZH D;  3X1T B;  3REI C;  5AV8 D;  4E45 A;  1P3O B;  2NZD B;  1R4V A;  3WTP E;  3EG5 B;  3NQJ A;  3WA9 D;  3UT9 C;  4J8U D;  5B2I B;  3AZM D;  2PYO D;  2HUE B;  1TZY B;  4Z66 C;  5B40 C;  1F66 B;  3KXB D;  1U35 C;  5GT0 A;  5B31 D;  3LJA C;  5B32 A;  3LEL B;  3AFA C;  4YM6 A;  3AYW C;  5AV6 D;  5E5A C;  1P3L A;  3LZ0 A;  2F8N K;  3MGP C;  3AN2 D;  4R8P B;  4YS3 B;  3KUY B;  1S32 D;  2NQB B;  4J8V B;  3MGR C;  4J8X A;  3WTP C;  3LZ1 D;  1P3F A;  1W2E A;  5GXQ A;  5CPJ B;  3UT9 A;  4UPK A;  2CV5 B;  5CHL B;  5FUG A;  1B6W A;  4KGC A;  5F99 A;  2L5A A;  1ULY A;  5KDM B;  1P3O C;  2NZD C;  3REJ B;  5DNM C;  1P3A D;  2YFW A;  5B24 D;  5B2J C;  3MGQ A;  4LD9 D;  3WKJ B;  5AV8 B;  5B2I C;  3UTA D;  5B1L A;  4DRA A;  3O62 A;  4NE6 A;  1WWS A;  3MNN D;  2FJ7 B;  2HUE C;  1TZY C;  1F66 C;  3B6G D;  3X1S C;  3UTB D;  3AZE B;  2PYO B;  2Y2Q A;  4H9Q B;  5AVC A;  4X23 D;  3VH6 T;  3KXB B;  3H0R C;  4YS3 C;  4R8P C;  1P3G D;  3W99 C;  1P3I D;  2NQB C;  4J8V C;  5DNM A;  3B6F D;  3AL0 C;  5CP6 A;  3W97 A;  5AV6 B;  2Y2H A;  3AZI D;  1M18 D;  1HQ3 D;  3C1C D;  3AN2 B;  5CPJ C;  5AVB A;  1S32 B;  2J8P A;  5AV9 D;  1JFI B;  1HTA A;  5BNX B;  3X1V C;  3VH5 A;  2RVQ C;  4JJN B;  4G92 B;  1N1J B;  3WKJ C;  3REL D;  4ZUX C;  4WNN A;  5AY8 D;  3AZN A;  3AZL A;  5B1M A;  5G49 A;  1P3A B;  4KUD A;  5B24 B;  2FJ7 C;  1P3K D;  1T3U A;  4Z2M H;  3AZF A;  3VH5 W;  3UTA B;  5AV5 D;  3C1B D;  1P3M A;  3MNN B;  3AZE C;  2PYO C;  3MGS A;  4ZBJ B;  2ARO B;  3KXB C;  1ZLA A;  3X1V A;  3B6G B;  5B0Z C;  3UTB B;  1P34 A;  1BH9 B;  5AV6 C;  4X23 B;  1P3B C;  4YM6 D;  3AN2 C;  3KWQ B;  5BO0 B;  1P3I B;  3AV1 B;  3B6F B;  3LZ0 D;  3AZI B;  1M18 B;  1HQ3 B;  5GT3 D;  3C1C B;  4JJN C;  4G92 C;  5JA4 A;  3MVD D;  5JRG A;  4WU9 C;  5AV9 B;  3X1U C;  3TU4 B;  3R45 A;  1BH8 A;  4H9O A;  4WV4 B;  5B24 C;  3AZK A;  5F99 D;  3REL B;  3B0C W;  3AZG A;  1P3B A;  5AY8 B;  3UTA C;  5CPK A;  4WJ3 C;  2BYM A;  3MNN C;  3AV2 A;  2BYK A;  1P3K B;  3A6N A;  3O62 D;  4ZBJ C;  2ARO C;  3B6G C;  3REH C;  4XZQ D;  5AV5 B;  3C1B B;  3UTB C;  3W96 D;  3H0L C;  3X1U A;  3EPJ A;  4G91 C;  3KWQ C;  5CPI D;  3AV1 C;  3B6F C;  3WAA A;  3AZI C;  1M18 C;  1HQ3 C;  4CAY A;  3C1C C;  1KX3 C;  4H9P B;  5CP6 D;  1AOI B;  3W97 D;  2Y2I A;  5AV9 C;  3TU4 C;  3LZ0 B;  3KSY A;  4UUZ A;  5GT3 B;  4WU8 D;  2JE5 A;  3MVD B;  3NQU B;  3EPK A;  2Y2O A;  4J8W A;  5GSU D;  3REL C;  5AY8 C;  3W98 A;  5DNN D;  2RIQ A;  1KX4 A;  3AZN D;  3AZL D;  5B1M D;  1P3K C;  1KX5 A;  1ID3 D;  3C1B C;  5B33 A;  3AZF D;  1EQZ D;  2DF4 C;  3O62 B;  3V9R B;  4XZQ B;  1M1A C;  3MGS D;  3W96 B;  1ZLA D;  4H9N A;  1M19 A;  4CSR B;  3REI A;  3AZJ C;  1AOI C;  5CPI B;  1P3P D;  4QLC C;  1TAF B;  3MVD C;  2Y2P A;  3W97 B;  2G5I C;  3X1T C;  4Z66 A;  5B40 A;  4WU8 B;  1U35 A;  1M1A A;  5BNV A;  3LJA A;  3AFA A;  2XD1 A;  3H0M C;  3VH6 A;  5GSU B;  2F8N B;  3AYW A;  3AZH B;  5E5A A;  3AZK D;  5DNN B;  4Z5T D;  3MGP A;  2YFV A;  3AZG D;  1F1E A;  3AZL B;  3MGR A;  5CPK D;  3WA9 B;  2LY8 A;  4XZQ C;  3AV2 D;  4J8U B;  1ID3 B;  3WTP A;  3W96 C;  3A6N D;  4H9R B;  3AZM B;  3LEL C;  3AZF B;  1EQZ B;  2HIO D;  4XUJ D;  2FFF B;  2Y2L A;  5B0Y D;  5B31 B;  2NZD A;  5CPI C;  1P3O A;  3KUY C;  4NE3 A;  1ZLA B;  5B2J A;  2CV5 C;  1P3P B;  5B2I A;  1TZY A;  5BT1 D;  3LZ1 B;  1F66 A;  4WU8 C;  3REJ C;  3X1S A;  2Y2G A;  2ZY2 A;  5GSU C;  3AZH C;  5AV8 C;  3REK D;  4J8W D;  4YS3 A;  4R8P A;  4AWL B;  1BH8 B;  2F8N G;  3KUY A;  2NQB A;  3W99 A;  4J8V A;  4LD9 B;  3WA9 C;  1KX4 D;  2ZY4 A;  4J8U C;  3AZM C;  4Z5T B;  1KX5 D;  5CPJ A;  2CV5 A;  3AZG B;  2VQR A;  1EQZ C;  1H3O A;  4WZS B;  5CPK B;  2BG1 A;  5B31 C;  5KDM A;  3A6N B;  3REJ A;  4NE5 A;  2HIO B;  4XUJ B;  5GT0 D;  5B32 D;  3WKJ A;  5B31 G;  1P3G B;  4ZUX A;  4NFT A;  5AV8 A;  5B0Y B;  1P3P C;  1M19 D;  2CWE A;  3F6T A;  4E44 A;  1S32 C;  2ZY5 A;  1P3L D;  2FJ7 A;  3REI D;  3LZ1 C;  4J8X D;  5BS7 C;  1P3F D;  5GXQ D;  3UT9 D;  3AZE A;  2PYO A;  4H9Q A;  3VH5 T;  4KHA A;  3KXB A;  4AWL C;  1P3A C;  5B0Z A;  4KGC D;  4LD9 C;  1A7W A;  1U35 D;  5AV6 A;  2ZY3 A;  3MGQ D;  3REK B;  4J8W B;  4Z5T C;  3AN2 A;  3AYW D;  1S32 A;  1JFI A;  3MGP D;  5B1L D;  5BNX A;  3NQJ B;  4JJN A;  3P5J B;  1KU5 A;  4WU9 A;  1N1J A;  2Y2K A;  2HIO C;  4XUJ C;  4X23 C;  3WTP D;  2JSS A;  4H9S C;  1P3G C;  5B0Y C;  1P3I C;  5AVC D;  3EPH A;  5B24 A;  5GT0 B;  5B32 B;  5C3I B;  5DNM D;  4YM6 B;  5B2J D;  3UTA A;  3B0B A;  1P3L B;  1PZR A;  3MNN A;  5AVB D;  3B0C T;  2ARO A;  3B6G A;  3REH A;  4J8X B;  3UTB A;  1P3F B;  5GXQ B;  2Y2M A;  3UT9 B;  1BH9 A;  3X1S D;  4X23 A;  3REK C;  5FUG B;  3KWQ A;  5BO0 A;  4KGC B;  5F99 B;  3AV1 A;  3B6F A;  3AZI A;  1M18 A;  2YFW B;  3MGQ B;  1HQ3 A;  3W99 D;  2NQB D;  4J8V D;  5AV5 C;  4KUD D;  3C1C A;  1KX3 A;  3AYW B;  5AV9 A;  1B67 A;  3TU4 A;  3MGP B;  5B1L B;  1P3M D;  2F8N H;  3X1V D;  5GT0 C;  2RVQ D;  5B32 C;  3REL A;  4YM6 C;  1P34 D;  5AY8 A;  5AVC B;  4HGA B;  3LZ0 C;  4ZUX D;  5B32 G;  1Q9C A;  1P3K A;  5GT3 C;  5DNM B;  2F2A C;  3B0D B;  5B2J B;  5CP6 B;  4J8X C;  2FJ7 D;  5AV5 A;  3C1B A;  1P3F C;  5GXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...