3B6GC

Nucleosome core particle treated with oxaliplatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 19
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gC00
2AROD 3VH6W 4J8WD 3O62D 5BS7A 5B31D 4EO5C 3VH5A 4X23D 5JA4A 4J8VB 5B32C 5B0ZB 5B2ID 5B32A 5AV5A 4CAYB 3LJAA 3KUYC 5AV9A 5BNXA 3LZ0B 3KUYA 3R45A 3X1SC 3VH6A 3W97C 3RELC 3X1SA 2BYKB 3W97A 3AZLB 4J8VD 1S32B 5B0ZD 3WA9D 2PYOB 3X1TD 3NQUB 4ZUXC 1P3BD 1KX3C 4ZUXA 5B31G 2RVQC 3W98C 1KX3A 5JA4B 4XZQC 5DNNC 2F8NB 3W98A 4EO5B 4XZQA 5B32B 4UUZA 1B6WA 3KUYB 3R45B 3AZJC 3X1SB 3B6GA 3W97B 3RELB 3AZJA 2F8ND 1U35C 5B32D 5AV5D 1P3FC 3LJAD 5AV9D 4KHAA 1P3FA 4ZUXB 3KUYD 5F99A 2F8NK 1KX3B 3X1SD 3WAAC 1F66C 3W97D 3W98B 4XZQB 5DNNB 3WAAA 1Q9CA 1F66A 4UUZB 4WU8C 1WWIA 4H9PA 4ZUXD 1KX3D 4H9OB 3AZJB 3AN2C 2RVQD 3W98D 4NE3A 2L5AA 4XZQD 1U35B 5AY8A 3LZ1C 4KHAB 1P3FB 1HQ3C 3WKJC 3LZ1A 1HQ3A 5B1LC 3B6GD 1KX5C 3WKJA 3MNNC 5B1LA 3AZJD 3REHC 2LY8A 1P3GC 1KX5A 1F66B 3WAAB 4H9NA 3REHA 1ZLAC 1WWSA 4WU8B 5DNMC 3MGSC 4AWLC 1ZLAA 2NQBC 5CP6C 1P3FD 3B0CW 5BT1D 5F99D 5DNMA 2NQBA 5E5AC 5CP6A 1AOIC 3MGRA 3AN2B 3WAAD 1F66D 3AZMC 5B33C 3REIC 5GSUC 3AZMA 3LZ1B 5B33A 1HQ3B 3VH5T 5GSUA 4J8UC 3WKJB 3A6NC 4J8UA 5KDMA 4CSRB 4WV4B 3TU4C 1KX5B 3MNNB 4H9NB 3AN2D 3REHB 1P3GB 4WU9C 3TU4A 1ID3C 1ZLAB 1ID3A 3VH6T 4KUDC 1M19C 3MGSB 5DNMB 4AWLB 3LZ1D 2NQBB 5CP6B 4KUDA 3LZ0A 1HQ3D 1M19A 3WKJD 4LD9C 5E5AB 5B1LD 1KX5D 1AOIB 3AZLA 3AZKC 1S32A 3REHD 2PYOA 5G49A 3AZKA 5GT0C 3AZMB 1ZLAD 5B33B 3NQUA 3REIB 5GSUB 5DNMD 5GT0A 2NQBD 3UT9C 5CP6D 4G91C 4J8UB 5KDMB 3UT9A 4NE6A 3MGRD 3A6NB 2F8NA 3TU4B 3AZHC 2CWEA 1P34C 4WU9B 1ID3B 1P3LC 3AZMD 5B33D 1BH9A 5AV8C 4KUDB 5GSUD 1M19B 1TZYC 5AV8A 1TZYA 4J8UD 4J8XC 4LD9B 3RELA 4WNNB 4J8XA 3TU4D 5G49B 3AZKB 1ID3D 3C1CC 2NZDC 5C3IC 5GT0B 4KGCC 3C1CA 4KUDD 3LZ0D 1M19D 4KGCA 3UT9B 5CHLB 4G91B 3AV1C 3AZLD 2YFWA 5DNNA 1S32D 3AZHB 4G92C 3C1BC 5GXQC 2PYOD 3AZKD 1P34B 5CPIC 1BH9B 5GXQA 4YM6C 1P3LB 5GT0D 5CPIA 5AV8B 4QLCC 1TZYB 3UT9D 5CPJC 4QLCA 4H9OA 4J8XB 5B1MC 5AV6C 5B1MA 5AV6A 1U35A 3C1CB 2NZDB 4WZSB 5C3IB 4NFTA 4KGCB 5AV8D 1TZYD 3RELD 2YFWB 1P3AC 4J8XD 3AV1B 4G92B 3C1BB 5GXQB 4WU8A 3C1CD 2JSSA 3KSYA 5CPIB 4YM6B 4KGCD 3B6FC 4QLCB 2F8NG 3AZNC 3B6FA 5CPJB 3AN2A 5DNND 5B32G 5B1MB 3UTBC 3AZNA 5AV6B 5GXQD 5GT3C 3KXBC 1KX4C 3B0CT 5AVBC 3UTAC 3AYWC 5CPID 5JRGC 5GT3A 1KX4A 1M18C 4QLCD 5JRGA 4CSRA 5AVCC 1M18A 3MNNA 5CPJD 1P3AB 1P3GA 5B40C 5B1MD 5AV6D 1U35D 1EQZC 1BFMA 5B40A 3B0BA 1EQZA 1N1JA 4Z5TC 3WTPC 3MGSA 3W96C 2FJ7C 3WTPA 3AV2C 3W96A 3AZIC 5E5AA 3B6FB 1JFIB 3AV2A 3AZIA 3AZNB 1AOIA 3WTPE 3UTBB 4WU8D 3REIA 5GT3B 3KXBB 1KX4B 5AVBB 3UTAB 3AYWB 5JRGB 3V9RB 1M18B 3B6FD 3A6NA 4HGAC 3REKC 5AVCB 5B24C 3AZND 3REKA 4X23C 4WU9A 5B40B 5B24A 1EQZB 1N1JB 1P3IC 5B2IC 4H9QA 1F1EA 3WTPB 4Z5TB 4DRAA 4JJNC 5GT3D 1P3IA 1KX4D 3REJC 3W96B 2FJ7B 5JRGD 4JJNA 2CV5C 3AV2B 3AZIB 3REJA 4WNNA 3MNND 4E45A 1M18D 4LD9A 1P3GD 3X1UC 5B40D 4XUJC 1EQZD 3MGSD 3X1UA 3WA9C 3X1TC 4ZBJC 4XUJA 3WTPD 3W96D 5E5AD 1P3BC 3AV2D 3AZID 1H3OB 1AOID 4HGAB 3REKB 3AZEC 3AZHA 5B24B 1TAFB 4X23B 3KWQC 4H9QB 3AZEA 1P34A 3REID 1P3LA 4Z66C 1P3IB 1HTAA 5B2IB 3KWQA 1M1AC 4Z66A 4JJNB 3REJB 3A6ND 5BS7C 2CV5B 1M1AA 3REKD 3LELC 4WU9D 5B24D 2F8NH 3X1UB 3LELA 4Z2MG 3AZFC 2NZDA 4XUJB 1P3ID 5AV5C 3WA9B 3LJAC 3AZFA 3AFAC 5AV9C 4ZBJB 3X1TB 4JJND 4YS3C 1BH8A 4H9RA 4LD9D 3REJD 3AFAA 1P3BB 4YS3A 2CV5D 3AV1A 3AZEB 4M6BA 3C1BA 3X1UD 3KWQB 4XUJD 4YM6A 4Z66B 1P3MC 1M1AB 2HUEC 3AZGC 5CPJA 4E44A 1P3MA 1P3PC 3AZHD 3AZGA 1P3PA 3LELB 1P34D 3AZED 3MGPC 1P3LD 1P3OC 3KWQD 3MGPA 3AZFB 4Z66D 1P3OA 4H9RB 1BH8B 5AV5B 5BNVA 3LJAB 3AFAB 5AV9B 1M1AD 5BNXB 4YS3B 3B6GC 1P3AA 3MVDC 3MGQC 3LELD 2NZDD 3MVDA 3MGQA 1ULYA 3AZFD 2BYMA 5BT1C 5F99C 3AFAD 1P3MB 1KU5A 2YFVA 1A7WA 4YS3D 2HUEB 1JFIA 3AV1D 3AZGB 1P3PB 3B0DC 3UTBA 3C1BD 3MGPB 4YM6D 1P3OB 3KXBA 5BNVB 5AVBA 3UTAA 3AYWA 5B0YC 3V9RA 2IO5C 5B2JC 5B0YA 1P3MD 5FUGA 5AVCA 3AZGD 5B2JA 3B6GB 1P3PD 3W99C 2HIOC 3MVDB 3MGQB 3X1VC 3W99A 2HIOA 3MGPD 2BYMB 5AY8C 5CPKC 4Z5TA 3X1VA 1P3OD 5BO0A 4R8PC 2FJ7A 5CPKA 2YFVB 4R8PA 5F99B 1P3AD 1P3KC 3B0DB 1P3KA 3MVDD 3MGQD 2AROC 3NQJA 4J8WC 2AROA 3O62C 5B0YB 4Z2MH 4J8WA 4H9PB 5FUGB 1H3OA 2IO5B 5B31C 3O62A 5B2JB 5B31A 3MGRC 3UTBD 1TAFA 4X23A 3W99B 2HIOB 1B67A 3X1VB 5B2IA 3KXBD 5BO0B 5AVBD 3UTAD 3AYWD 5AY8B 5CPKB 4R8PB 5B0YD 2CV5A 5AVCD 5B2JD 4J8VC 5B1LB 1P3KB 4H9SC 3W99D 5B0ZC 2HIOD 4J8VA 3NQJB 4Z5TD 4H9SA 5B0ZA 3X1VD 2AROB 3WA9A 3X1TA 5AY8D 5CPKD 4J8WB 4NE5A 2FJ7D 4CAYA 3LZ0C 3O62B 4R8PD 1P3BA 3VH5W 1R4VA 5B31B 3AZLC 3MGRB 1P3KD 2BYKA 1S32C 2PYOC 4DRBA
chains in the Genus database with same CATH superfamily
2AROD 3VH6W 4J8WD 2ZY3A 3A1IA 3O62D 5BS7A 5B31D 4EO5C 3VH5A 4X23D 5JA4A 4J8VB 5B32C 5B0ZB 5B2ID 5B32A 5AV5A 4CAYB 3LJAA 3KUYC 5AV9A 5BNXA 3LZ0B 3KUYA 3R45A 3X1SC 3VH6A 3W97C 3RELC 3X1SA 2BYKB 2Y2MA 3W97A 3AZLB 4J8VD 1S32B 5B0ZD 3WA9D 2PYOB 3X1TD 2W8SA 3NQUB 4ZUXC 1P3BD 2RIQA 1KX3C 2Y2QA 4ZUXA 5B31G 2RVQC 3W98C 2ZY5A 1KX3A 5JA4B 4XZQC 5DNNC 2F8NB 3W98A 4EO5B 4XZQA 5B32B 4UUZA 1B6WA 3KUYB 3R45B 2XD1A 3AZJC 3X1SB 3B6GA 3W97B 3RELB 3AZJA 2F8ND 1U35C 5B32D 5AV5D 1P3FC 2UWXA 3LJAD 5AV9D 4KHAA 1P3FA 4ZUXB 3KUYD 5F99A 2F8NK 1KX3B 3X1SD 3WAAC 1F66C 3W97D 3W98B 4XZQB 3P5JB 5DNNB 1Q9CA 1F66A 3WAAA 4UUZB 4WU8C 1WWIA 4H9PA 2Y2LA 4ZUXD 1KX3D 4H9OB 3AZJB 3AN2C 2RVQD 3W98D 4NE3A 2L5AA 4XZQD 1U35B 5AY8A 3LZ1C 4KHAB 1P3FB 1HQ3C 3EG5B 3WKJC 3LZ1A 1HQ3A 5B1LC 3EPHA 3B6GD 1KX5C 3WKJA 3A1KA 3MNNC 5B1LA 3AZJD 3REHC 2LY8A 1P3GC 1KX5A 1F66B 3WAAB 4H9NA 3REHA 1ZLAC 1WWSA 4WU8B 5DNMC 3MGSC 4AWLC 1ZLAA 2NQBC 5CP6C 1P3FD 3B0CW 5BT1D 5F99D 5DNMA 2NQBA 5E5AC 5CP6A 1AOIC 3MGRA 3AN2B 3WAAD 1F66D 3AZMC 2Y2OA 5B33C 3REIC 5GSUC 3AZMA 3LZ1B 5B33A 1HQ3B 3VH5T 5GSUA 4J8UC 3WKJB 2DQNC 3A6NC 4J8UA 5KDMA 4CSRB 4WV4B 3TU4C 1KX5B 3MNNB 4H9NB 3AN2D 3REHB 1P3GB 4WU9C 3TU4A 1ID3C 1ZLAB 1ID3A 3VH6T 4KUDC 1M19C 3MGSB 3H0MC 5DNMB 4AWLB 3LZ1D 2NQBB 5CP6B 4KUDA 3LZ0A 1HQ3D 1M19A 3WKJD 4LD9C 5E5AB 5B1LD 1KX5D 1AOIB 3AZLA 3AZKC 1S32A 3REHD 2PYOA 3IP4C 5G49A 3AZKA 5GT0C 3AZMB 1ZLAD 5B33B 3NQUA 3REIB 5GSUB 5DNMD 5GT0A 2NQBD 3UT9C 5CP6D 4G91C 4J8UB 5KDMB 2J8PA 1T3UA 3UT9A 4NE6A 3MGRD 3A6NB 2F8NA 3TU4B 3AZHC 2CWEA 1P34C 4WU9B 1ID3B 1P3LC 3AZMD 5B33D 4UPKA 1BH9A 5AV8C 4KUDB 5GSUD 1M19B 1TZYC 5AV8A 1TZYA 4J8UD 4J8XC 4LD9B 3RELA 4WNNB 4J8XA 3TU4D 5G49B 3AZKB 1ID3D 3C1CC 2NZDC 5C3IC 5GT0B 4KGCC 3C1CA 4KUDD 3LZ0D 1M19D 4KGCA 3UT9B 5CHLB 4G91B 4WJ3C 3AV1C 3H0RC 3AZLD 2YFWA 5DNNA 1S32D 3AZHB 4G92C 3C1BC 5GXQC 2PYOD 3AZKD 1P34B 5CPIC 1BH9B 5GXQA 4YM6C 1P3LB 2JCHA 5GT0D 5CPIA 5AV8B 4QLCC 1TZYB 3UT9D 5CPJC 4QLCA 4H9OA 4J8XB 5B1MC 5AV6C 2ZY2A 5B1MA 1PZRA 5AV6A 1U35A 3C1CB 2NZDB 4WZSB 5C3IB 4NFTA 4KGCB 5AV8D 1TZYD 3RELD 2YFWB 1P3AC 4J8XD 3AV1B 2Y2JA 4G92B 3C1BB 5GXQB 4WU8A 3C1CD 2JSSA 3KSYA 5CPIB 4YM6B 4KGCD 3B6FC 4QLCB 2F8NG 3AZNC 3B6FA 5CPJB 3AN2A 5DNND 5B32G 5B1MB 3UTBC 3AZNA 5AV6B 5GXQD 5GT3C 2FFFB 3KXBC 3B0CT 5AVBC 3EPKA 3UTAC 3AYWC 5CPID 1KX4C 5JRGC 5GT3A 1KX4A 1M18C 4QLCD 5JRGA 4CSRA 5AVCC 1M18A 3MNNA 5CPJD 1P3AB 1P3GA 5B40C 5B1MD 5AV6D 1U35D 1EQZC 1BFMA 3EPJA 5B40A 3B0BA 1EQZA 1N1JA 4Z5TC 3WTPC 3MGSA 3EPLA 3W96C 2FJ7C 3WTPA 3AV2C 3W96A 3AZIC 5E5AA 3B6FB 1JFIB 3AV2A 3AZIA 3AZNB 1AOIA 3WTPE 3UTBB 2Y2IA 4WU8D 3REIA 2ZM5A 2G5IC 5GT3B 3KXBB 1KX4B 5AVBB 3UTAB 3AYWB 5JRGB 3V9RB 1M18B 3B6FD 3A6NA 4HGAC 3REKC 5AVCB 5B24C 3AZND 3KFUG 3REKA 4X23C 4WU9A 5B40B 5B24A 1EQZB 4DQYB 1N1JB 1P3IC 5B2IC 4H9QA 1F1EA 3WTPB 4Z5TB 4DRAA 4JJNC 5GT3D 1P3IA 1KX4D 3REJC 3W96B 2FJ7B 5JRGD 4JJNA 2CV5C 3AV2B 3AZIB 3REJA 4WNNA 3MNND 4E45A 1M18D 4LD9A 2JE5A 1P3GD 3X1UC 5B40D 4XUJC 1EQZD 3MGSD 3X1UA 3WA9C 3X1TC 4ZBJC 4XUJA 3WTPD 3W96D 5E5AD 3H0LC 1P3BC 3AV2D 3AZID 1H3OB 1AOID 2Y2HA 4HGAB 3REKB 3AZEC 3AZHA 5B24B 1TAFB 4X23B 3KWQC 4H9QB 3AZEA 1P34A 3REID 1P3LA 4Z66C 1P3IB 1HTAA 5B2IB 3KWQA 1M1AC 4Z66A 4JJNB 3REJB 3A6ND 5BS7C 2CV5B 1M1AA 3REKD 3LELC 4WU9D 1Z2CB 5B24D 2F8NH 3X1UB 3LELA 4Z2MG 3AZFC 2NZDA 4XUJB 1P3ID 5AV5C 3WA9B 3LJAC 3AZFA 3AFAC 5AV9C 4ZBJB 3X1TB 4JJND 4YS3C 1BH8A 4H9RA 2DF4C 4LD9D 3REJD 3AFAA 1P3BB 4YS3A 2CV5D 3AV1A 3AZEB 4M6BA 3C1BA 3X1UD 3KWQB 4XUJD 4YM6A 4Z66B 3F6TA 1P3MC 1M1AB 2HUEC 3AZGC 5CPJA 4E44A 1P3MA 1P3PC 3AZHD 3AZGA 1P3PA 3LELB 1P34D 3AZED 3MGPC 1P3LD 1P3OC 3KWQD 3MGPA 3AZFB 4Z66D 1P3OA 1BH8B 4H9RB 5AV5B 5BNVA 3LJAB 3AFAB 5AV9B 1M1AD 5BNXB 4YS3B 3B6GC 1P3AA 3AL0C 3MVDC 3MGQC 3LELD 2NZDD 3MVDA 3MGQA 1ULYA 3AZFD 2BYMA 5BT1C 5F99C 3AFAD 1P3MB 1KU5A 2YFVA 1A7WA 4YS3D 2HUEB 1JFIA 3AV1D 3AZGB 1P3PB 3B0DC 3UTBA 3C1BD 3MGPB 1W2EA 4YM6D 1P3OB 3KXBA 5BNVB 5AVBA 3UTAA 3AYWA 5B0YC 3V9RA 2IO5C 5B2JC 5B0YA 1P3MD 2XD5A 5FUGA 5AVCA 2F2AC 3AZGD 5B2JA 3B6GB 1P3PD 3W99C 2HIOC 3MVDB 3MGQB 3X1VC 3W99A 2HIOA 3MGPD 2BYMB 5AY8C 5CPKC 4Z5TA 3X1VA 1P3OD 5BO0A 4R8PC 2FJ7A 5CPKA 2YFVB 4R8PA 5F99B 1P3AD 1P3KC 2Y2KA 3B0DB 1P3KA 3MVDD 3MGQD 2AROC 3NQJA 4J8WC 2G5HC 2AROA 2VQRA 3O62C 5B0YB 4Z2MH 4J8WA 2Y2PA 2BG1A 4H9PB 5FUGB 1H3OA 2IO5B 5B31C 3O62A 5B2JB 5B31A 3FDDA 3MGRC 3UTBD 1TAFA 4X23A 3W99B 2HIOB 1B67A 3X1VB 5B2IA 3KXBD 5BO0B 5AVBD 2Y2GA 3UTAD 5AY8B 3AYWD 5CPKB 4R8PB 5B0YD 2CV5A 5AVCD 5B2JD 2ZY4A 2Y2NA 4J8VC 5B1LB 1P3KB 4H9SC 3W99D 5B0ZC 2HIOD 4J8VA 3NQJB 4Z5TD 4H9SA 5B0ZA 3X1VD 2AROB 3WA9A 3X1TA 5AY8D 5CPKD 4J8WB 4NE5A 2FJ7D 4CAYA 3LZ0C 3O62B 4R8PD 1P3BA 3VH5W 1R4VA 5B31B 3AZLC 3MGRB 1P3KD 2BYKA 1S32C 2PYOC 4DRBA
chains in the Genus database with same CATH topology
2AROD 3VH6W 4J8WD 2ZY3A 3A1IA 3O62D 5BS7A 5B31D 4EO5C 3VH5A 4X23D 5JA4A 4J8VB 5B32C 5B0ZB 5B2ID 5B32A 5AV5A 4CAYB 3LJAA 3KUYC 5AV9A 5BNXA 3LZ0B 3KUYA 3R45A 3X1SC 3VH6A 3W97C 3RELC 3X1SA 2BYKB 2Y2MA 3W97A 3AZLB 4J8VD 1S32B 5B0ZD 3WA9D 2PYOB 3X1TD 2W8SA 3NQUB 4ZUXC 1P3BD 2RIQA 1KX3C 2Y2QA 4ZUXA 5B31G 2RVQC 3W98C 2ZY5A 1KX3A 5JA4B 4XZQC 5DNNC 2F8NB 3W98A 4EO5B 4XZQA 5B32B 4UUZA 1B6WA 3KUYB 3R45B 2XD1A 3AZJC 3X1SB 3B6GA 3W97B 3RELB 3AZJA 2F8ND 1U35C 5B32D 5AV5D 1P3FC 2UWXA 3LJAD 5AV9D 4KHAA 1P3FA 4ZUXB 3KUYD 5F99A 2F8NK 1KX3B 3X1SD 3WAAC 1F66C 3W97D 3W98B 4XZQB 3P5JB 5DNNB 1Q9CA 1F66A 3WAAA 4UUZB 4WU8C 1WWIA 4H9PA 2Y2LA 4ZUXD 1KX3D 4H9OB 3AZJB 3AN2C 2RVQD 3W98D 4NE3A 2L5AA 4XZQD 1U35B 5AY8A 3LZ1C 4KHAB 1P3FB 1HQ3C 3EG5B 3WKJC 3LZ1A 1HQ3A 5B1LC 3EPHA 3B6GD 1KX5C 3WKJA 3A1KA 3MNNC 5B1LA 3AZJD 3REHC 2LY8A 1P3GC 1KX5A 1F66B 3WAAB 4H9NA 3REHA 1ZLAC 1WWSA 4WU8B 5DNMC 3MGSC 4AWLC 1ZLAA 2NQBC 5CP6C 1P3FD 3B0CW 5BT1D 5F99D 5DNMA 2NQBA 5E5AC 5CP6A 1AOIC 3MGRA 3AN2B 3WAAD 1F66D 3AZMC 2Y2OA 5B33C 3REIC 5GSUC 3AZMA 3LZ1B 5B33A 1HQ3B 3VH5T 5GSUA 4J8UC 3WKJB 2DQNC 3A6NC 4J8UA 5KDMA 4CSRB 4WV4B 3TU4C 1KX5B 3MNNB 4H9NB 3AN2D 3REHB 1P3GB 4WU9C 3TU4A 1ID3C 1ZLAB 1ID3A 3VH6T 4KUDC 1M19C 3MGSB 3H0MC 5DNMB 4AWLB 3LZ1D 2NQBB 5CP6B 4KUDA 3LZ0A 1HQ3D 1M19A 3WKJD 4LD9C 5E5AB 5B1LD 1KX5D 1AOIB 3AZLA 3AZKC 1S32A 3REHD 2PYOA 3IP4C 5G49A 3AZKA 5GT0C 3AZMB 1ZLAD 5B33B 3NQUA 3REIB 5GSUB 5DNMD 5GT0A 2NQBD 3UT9C 5CP6D 4G91C 4J8UB 5KDMB 2J8PA 1T3UA 3UT9A 4NE6A 3MGRD 3A6NB 2F8NA 3TU4B 3AZHC 2CWEA 1P34C 4WU9B 1ID3B 1P3LC 3AZMD 5B33D 4UPKA 1BH9A 5AV8C 4KUDB 5GSUD 1M19B 1TZYC 5AV8A 1TZYA 4J8UD 4J8XC 4LD9B 3RELA 4WNNB 4J8XA 3TU4D 5G49B 3AZKB 1ID3D 3C1CC 2NZDC 5C3IC 5GT0B 4KGCC 3C1CA 4KUDD 3LZ0D 1M19D 4KGCA 3UT9B 5CHLB 4G91B 4WJ3C 3AV1C 3H0RC 3AZLD 2YFWA 5DNNA 1S32D 3AZHB 4G92C 3C1BC 5GXQC 2PYOD 3AZKD 1P34B 5CPIC 1BH9B 5GXQA 4YM6C 1P3LB 2JCHA 5GT0D 5CPIA 5AV8B 4QLCC 1TZYB 3UT9D 5CPJC 4QLCA 4H9OA 4J8XB 5B1MC 5AV6C 2ZY2A 5B1MA 1PZRA 5AV6A 1U35A 3C1CB 2NZDB 4WZSB 5C3IB 4NFTA 4KGCB 5AV8D 1TZYD 3RELD 2YFWB 1P3AC 4J8XD 3AV1B 2Y2JA 4G92B 3C1BB 5GXQB 4WU8A 3C1CD 2JSSA 3KSYA 5CPIB 4YM6B 4KGCD 3B6FC 4QLCB 2F8NG 3AZNC 3B6FA 5CPJB 3AN2A 5DNND 5B32G 5B1MB 3UTBC 3AZNA 5AV6B 5GXQD 5GT3C 2FFFB 3KXBC 3B0CT 5AVBC 3EPKA 3UTAC 3AYWC 5CPID 1KX4C 5JRGC 5GT3A 1KX4A 1M18C 4QLCD 5JRGA 4CSRA 5AVCC 1M18A 3MNNA 5CPJD 1P3AB 1P3GA 5B40C 5B1MD 5AV6D 1U35D 1EQZC 1BFMA 3EPJA 5B40A 3B0BA 1EQZA 1N1JA 4Z5TC 3WTPC 3MGSA 3EPLA 3W96C 2FJ7C 3WTPA 3AV2C 3W96A 3AZIC 5E5AA 3B6FB 1JFIB 3AV2A 3AZIA 3AZNB 1AOIA 3WTPE 3UTBB 2Y2IA 4WU8D 3REIA 2ZM5A 2G5IC 5GT3B 3KXBB 1KX4B 5AVBB 3UTAB 3AYWB 5JRGB 3V9RB 1M18B 3B6FD 3A6NA 4HGAC 3REKC 5AVCB 5B24C 3AZND 3KFUG 3REKA 4X23C 4WU9A 5B40B 5B24A 1EQZB 4DQYB 1N1JB 1P3IC 5B2IC 4H9QA 1F1EA 3WTPB 4Z5TB 4DRAA 4JJNC 5GT3D 1P3IA 1KX4D 3REJC 3W96B 2FJ7B 5JRGD 4JJNA 2CV5C 3AV2B 3AZIB 3REJA 4WNNA 3MNND 4E45A 1M18D 4LD9A 2JE5A 1P3GD 3X1UC 5B40D 4XUJC 1EQZD 3MGSD 3X1UA 3WA9C 3X1TC 4ZBJC 4XUJA 3WTPD 3W96D 5E5AD 3H0LC 1P3BC 3AV2D 3AZID 1H3OB 1AOID 2Y2HA 4HGAB 3REKB 3AZEC 3AZHA 5B24B 1TAFB 4X23B 3KWQC 4H9QB 3AZEA 1P34A 3REID 1P3LA 4Z66C 1P3IB 1HTAA 5B2IB 3KWQA 1M1AC 4Z66A 4JJNB 3REJB 3A6ND 5BS7C 2CV5B 1M1AA 3REKD 3LELC 4WU9D 1Z2CB 5B24D 2F8NH 3X1UB 3LELA 4Z2MG 3AZFC 2NZDA 4XUJB 1P3ID 5AV5C 3WA9B 3LJAC 3AZFA 3AFAC 5AV9C 4ZBJB 3X1TB 4JJND 4YS3C 1BH8A 4H9RA 2DF4C 4LD9D 3REJD 3AFAA 1P3BB 4YS3A 2CV5D 3AV1A 3AZEB 4M6BA 3C1BA 3X1UD 3KWQB 4XUJD 4YM6A 4Z66B 3F6TA 1P3MC 1M1AB 2HUEC 3AZGC 5CPJA 4E44A 1P3MA 1P3PC 3AZHD 3AZGA 1P3PA 3LELB 1P34D 3AZED 3MGPC 1P3LD 1P3OC 3KWQD 3MGPA 3AZFB 4Z66D 1P3OA 1BH8B 4H9RB 5AV5B 5BNVA 3LJAB 3AFAB 5AV9B 1M1AD 5BNXB 4YS3B 3B6GC 1P3AA 3AL0C 3MVDC 3MGQC 3LELD 2NZDD 3MVDA 3MGQA 1ULYA 3AZFD 2BYMA 5BT1C 5F99C 3AFAD 1P3MB 1KU5A 2YFVA 1A7WA 4YS3D 2HUEB 1JFIA 3AV1D 3AZGB 1P3PB 3B0DC 3UTBA 3C1BD 3MGPB 1W2EA 4YM6D 1P3OB 3KXBA 5BNVB 5AVBA 3UTAA 3AYWA 5B0YC 3V9RA 2IO5C 5B2JC 5B0YA 1P3MD 2XD5A 5FUGA 5AVCA 2F2AC 3AZGD 5B2JA 3B6GB 1P3PD 3W99C 2HIOC 3MVDB 3MGQB 3X1VC 3W99A 2HIOA 3MGPD 2BYMB 5AY8C 5CPKC 4Z5TA 3X1VA 1P3OD 5BO0A 4R8PC 2FJ7A 5CPKA 2YFVB 4R8PA 5F99B 1P3AD 1P3KC 2Y2KA 3B0DB 1P3KA 3MVDD 3MGQD 2AROC 3NQJA 4J8WC 2G5HC 2AROA 2VQRA 3O62C 5B0YB 4Z2MH 4J8WA 2Y2PA 2BG1A 4H9PB 5FUGB 1H3OA 2IO5B 5B31C 3O62A 5B2JB 5B31A 3FDDA 3MGRC 3UTBD 1TAFA 4X23A 3W99B 2HIOB 1B67A 3X1VB 5B2IA 3KXBD 5BO0B 5AVBD 2Y2GA 3UTAD 5AY8B 3AYWD 5CPKB 4R8PB 5B0YD 2CV5A 5AVCD 5B2JD 2ZY4A 2Y2NA 4J8VC 5B1LB 1P3KB 4H9SC 3W99D 5B0ZC 2HIOD 4J8VA 3NQJB 4Z5TD 4H9SA 5B0ZA 3X1VD 2AROB 3WA9A 3X1TA 5AY8D 5CPKD 4J8WB 4NE5A 2FJ7D 4CAYA 3LZ0C 3O62B 4R8PD 1P3BA 3VH5W 1R4VA 5B31B 3AZLC 3MGRB 1P3KD 2BYKA 1S32C 2PYOC 4DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO D;  3VH6 W;  4J8W D;  3O62 D;  5BS7 A;  5B31 D;  4EO5 C;  3VH5 A;  4X23 D;  5JA4 A;  4J8V B;  5B32 C;  5B0Z B;  5B2I D;  5B32 A;  5AV5 A;  4CAY B;  3LJA A;  3KUY C;  5AV9 A;  5BNX A;  3LZ0 B;  3KUY A;  3R45 A;  3X1S C;  3VH6 A;  3W97 C;  3REL C;  3X1S A;  2BYK B;  3W97 A;  3AZL B;  4J8V D;  1S32 B;  5B0Z D;  3WA9 D;  2PYO B;  3X1T D;  3NQU B;  4ZUX C;  1P3B D;  1KX3 C;  4ZUX A;  5B31 G;  2RVQ C;  3W98 C;  1KX3 A;  5JA4 B;  4XZQ C;  5DNN C;  2F8N B;  3W98 A;  4EO5 B;  4XZQ A;  5B32 B;  4UUZ A;  1B6W A;  3KUY B;  3R45 B;  3AZJ C;  3X1S B;  3B6G A;  3W97 B;  3REL B;  3AZJ A;  2F8N D;  1U35 C;  5B32 D;  5AV5 D;  1P3F C;  3LJA D;  5AV9 D;  4KHA A;  1P3F A;  4ZUX B;  3KUY D;  5F99 A;  2F8N K;  1KX3 B;  3X1S D;  3WAA C;  1F66 C;  3W97 D;  3W98 B;  4XZQ B;  5DNN B;  3WAA A;  1Q9C A;  1F66 A;  4UUZ B;  4WU8 C;  1WWI A;  4H9P A;  4ZUX D;  1KX3 D;  4H9O B;  3AZJ B;  3AN2 C;  2RVQ D;  3W98 D;  4NE3 A;  2L5A A;  4XZQ D;  1U35 B;  5AY8 A;  3LZ1 C;  4KHA B;  1P3F B;  1HQ3 C;  3WKJ C;  3LZ1 A;  1HQ3 A;  5B1L C;  3B6G D;  1KX5 C;  3WKJ A;  3MNN C;  5B1L A;  3AZJ D;  3REH C;  2LY8 A;  1P3G C;  1KX5 A;  1F66 B;  3WAA B;  4H9N A;  3REH A;  1ZLA C;  1WWS A;  4WU8 B;  5DNM C;  3MGS C;  4AWL C;  1ZLA A;  2NQB C;  5CP6 C;  1P3F D;  3B0C W;  5BT1 D;  5F99 D;  5DNM A;  2NQB A;  5E5A C;  5CP6 A;  1AOI C;  3MGR A;  3AN2 B;  3WAA D;  1F66 D;  3AZM C;  5B33 C;  3REI C;  5GSU C;  3AZM A;  3LZ1 B;  5B33 A;  1HQ3 B;  3VH5 T;  5GSU A;  4J8U C;  3WKJ B;  3A6N C;  4J8U A;  5KDM A;  4CSR B;  4WV4 B;  3TU4 C;  1KX5 B;  3MNN B;  4H9N B;  3AN2 D;  3REH B;  1P3G B;  4WU9 C;  3TU4 A;  1ID3 C;  1ZLA B;  1ID3 A;  3VH6 T;  4KUD C;  1M19 C;  3MGS B;  5DNM B;  4AWL B;  3LZ1 D;  2NQB B;  5CP6 B;  4KUD A;  3LZ0 A;  1HQ3 D;  1M19 A;  3WKJ D;  4LD9 C;  5E5A B;  5B1L D;  1KX5 D;  1AOI B;  3AZL A;  3AZK C;  1S32 A;  3REH D;  2PYO A;  5G49 A;  3AZK A;  5GT0 C;  3AZM B;  1ZLA D;  5B33 B;  3NQU A;  3REI B;  5GSU B;  5DNM D;  5GT0 A;  2NQB D;  3UT9 C;  5CP6 D;  4G91 C;  4J8U B;  5KDM B;  3UT9 A;  4NE6 A;  3MGR D;  3A6N B;  2F8N A;  3TU4 B;  3AZH C;  2CWE A;  1P34 C;  4WU9 B;  1ID3 B;  1P3L C;  3AZM D;  5B33 D;  1BH9 A;  5AV8 C;  4KUD B;  5GSU D;  1M19 B;  1TZY C;  5AV8 A;  1TZY A;  4J8U D;  4J8X C;  4LD9 B;  3REL A;  4WNN B;  4J8X A;  3TU4 D;  5G49 B;  3AZK B;  1ID3 D;  3C1C C;  2NZD C;  5C3I C;  5GT0 B;  4KGC C;  3C1C A;  4KUD D;  3LZ0 D;  1M19 D;  4KGC A;  3UT9 B;  5CHL B;  4G91 B;  3AV1 C;  3AZL D;  2YFW A;  5DNN A;  1S32 D;  3AZH B;  4G92 C;  3C1B C;  5GXQ C;  2PYO D;  3AZK D;  1P34 B;  5CPI C;  1BH9 B;  5GXQ A;  4YM6 C;  1P3L B;  5GT0 D;  5CPI A;  5AV8 B;  4QLC C;  1TZY B;  3UT9 D;  5CPJ C;  4QLC A;  4H9O A;  4J8X B;  5B1M C;  5AV6 C;  5B1M A;  5AV6 A;  1U35 A;  3C1C B;  2NZD B;  4WZS B;  5C3I B;  4NFT A;  4KGC B;  5AV8 D;  1TZY D;  3REL D;  2YFW B;  1P3A C;  4J8X D;  3AV1 B;  4G92 B;  3C1B B;  5GXQ B;  4WU8 A;  3C1C D;  2JSS A;  3KSY A;  5CPI B;  4YM6 B;  4KGC D;  3B6F C;  4QLC B;  2F8N G;  3AZN C;  3B6F A;  5CPJ B;  3AN2 A;  5DNN D;  5B32 G;  5B1M B;  3UTB C;  3AZN A;  5AV6 B;  5GXQ D;  5GT3 C;  3KXB C;  1KX4 C;  3B0C T;  5AVB C;  3UTA C;  3AYW C;  5CPI D;  5JRG C;  5GT3 A;  1KX4 A;  1M18 C;  4QLC D;  5JRG A;  4CSR A;  5AVC C;  1M18 A;  3MNN A;  5CPJ D;  1P3A B;  1P3G A;  5B40 C;  5B1M D;  5AV6 D;  1U35 D;  1EQZ C;  1BFM A;  5B40 A;  3B0B A;  1EQZ A;  1N1J A;  4Z5T C;  3WTP C;  3MGS A;  3W96 C;  2FJ7 C;  3WTP A;  3AV2 C;  3W96 A;  3AZI C;  5E5A A;  3B6F B;  1JFI B;  3AV2 A;  3AZI A;  3AZN B;  1AOI A;  3WTP E;  3UTB B;  4WU8 D;  3REI A;  5GT3 B;  3KXB B;  1KX4 B;  5AVB B;  3UTA B;  3AYW B;  5JRG B;  3V9R B;  1M18 B;  3B6F D;  3A6N A;  4HGA C;  3REK C;  5AVC B;  5B24 C;  3AZN D;  3REK A;  4X23 C;  4WU9 A;  5B40 B;  5B24 A;  1EQZ B;  1N1J B;  1P3I C;  5B2I C;  4H9Q A;  1F1E A;  3WTP B;  4Z5T B;  4DRA A;  4JJN C;  5GT3 D;  1P3I A;  1KX4 D;  3REJ C;  3W96 B;  2FJ7 B;  5JRG D;  4JJN A;  2CV5 C;  3AV2 B;  3AZI B;  3REJ A;  4WNN A;  3MNN D;  4E45 A;  1M18 D;  4LD9 A;  1P3G D;  3X1U C;  5B40 D;  4XUJ C;  1EQZ D;  3MGS D;  3X1U A;  3WA9 C;  3X1T C;  4ZBJ C;  4XUJ A;  3WTP D;  3W96 D;  5E5A D;  1P3B C;  3AV2 D;  3AZI D;  1H3O B;  1AOI D;  4HGA B;  3REK B;  3AZE C;  3AZH A;  5B24 B;  1TAF B;  4X23 B;  3KWQ C;  4H9Q B;  3AZE A;  1P34 A;  3REI D;  1P3L A;  4Z66 C;  1P3I B;  1HTA A;  5B2I B;  3KWQ A;  1M1A C;  4Z66 A;  4JJN B;  3REJ B;  3A6N D;  5BS7 C;  2CV5 B;  1M1A A;  3REK D;  3LEL C;  4WU9 D;  5B24 D;  2F8N H;  3X1U B;  3LEL A;  4Z2M G;  3AZF C;  2NZD A;  4XUJ B;  1P3I D;  5AV5 C;  3WA9 B;  3LJA C;  3AZF A;  3AFA C;  5AV9 C;  4ZBJ B;  3X1T B;  4JJN D;  4YS3 C;  1BH8 A;  4H9R A;  4LD9 D;  3REJ D;  3AFA A;  1P3B B;  4YS3 A;  2CV5 D;  3AV1 A;  3AZE B;  4M6B A;  3C1B A;  3X1U D;  3KWQ B;  4XUJ D;  4YM6 A;  4Z66 B;  1P3M C;  1M1A B;  2HUE C;  3AZG C;  5CPJ A;  4E44 A;  1P3M A;  1P3P C;  3AZH D;  3AZG A;  1P3P A;  3LEL B;  1P34 D;  3AZE D;  3MGP C;  1P3L D;  1P3O C;  3KWQ D;  3MGP A;  3AZF B;  4Z66 D;  1P3O A;  4H9R B;  1BH8 B;  5AV5 B;  5BNV A;  3LJA B;  3AFA B;  5AV9 B;  1M1A D;  5BNX B;  4YS3 B;  3B6G C;  1P3A A;  3MVD C;  3MGQ C;  3LEL D;  2NZD D;  3MVD A;  3MGQ A;  1ULY A;  3AZF D;  2BYM A;  5BT1 C;  5F99 C;  3AFA D;  1P3M B;  1KU5 A;  2YFV A;  1A7W A;  4YS3 D;  2HUE B;  1JFI A;  3AV1 D;  3AZG B;  1P3P B;  3B0D C;  3UTB A;  3C1B D;  3MGP B;  4YM6 D;  1P3O B;  3KXB A;  5BNV B;  5AVB A;  3UTA A;  3AYW A;  5B0Y C;  3V9R A;  2IO5 C;  5B2J C;  5B0Y A;  1P3M D;  5FUG A;  5AVC A;  3AZG D;  5B2J A;  3B6G B;  1P3P D;  3W99 C;  2HIO C;  3MVD B;  3MGQ B;  3X1V C;  3W99 A;  2HIO A;  3MGP D;  2BYM B;  5AY8 C;  5CPK C;  4Z5T A;  3X1V A;  1P3O D;  5BO0 A;  4R8P C;  2FJ7 A;  5CPK A;  2YFV B;  4R8P A;  5F99 B;  1P3A D;  1P3K C;  3B0D B;  1P3K A;  3MVD D;  3MGQ D;  2ARO C;  3NQJ A;  4J8W C;  2ARO A;  3O62 C;  5B0Y B;  4Z2M H;  4J8W A;  4H9P B;  5FUG B;  1H3O A;  2IO5 B;  5B31 C;  3O62 A;  5B2J B;  5B31 A;  3MGR C;  3UTB D;  1TAF A;  4X23 A;  3W99 B;  2HIO B;  1B67 A;  3X1V B;  5B2I A;  3KXB D;  5BO0 B;  5AVB D;  3UTA D;  3AYW D;  5AY8 B;  5CPK B;  4R8P B;  5B0Y D;  2CV5 A;  5AVC D;  5B2J D;  4J8V C;  5B1L B;  1P3K B;  4H9S C;  3W99 D;  5B0Z C;  2HIO D;  4J8V A;  3NQJ B;  4Z5T D;  4H9S A;  5B0Z A;  3X1V D;  2ARO B;  3WA9 A;  3X1T A;  5AY8 D;  5CPK D;  4J8W B;  4NE5 A;  2FJ7 D;  4CAY A;  3LZ0 C;  3O62 B;  4R8P D;  1P3B A;  3VH5 W;  1R4V A;  5B31 B;  3AZL C;  3MGR B;  1P3K D;  2BYK A;  1S32 C;  2PYO C;  4DRB A; 
#chains in the Genus database with same CATH topology
 2ARO D;  3VH6 W;  4J8W D;  2ZY3 A;  3A1I A;  3O62 D;  5BS7 A;  5B31 D;  4EO5 C;  3VH5 A;  4X23 D;  5JA4 A;  4J8V B;  5B32 C;  5B0Z B;  5B2I D;  5B32 A;  5AV5 A;  4CAY B;  3LJA A;  3KUY C;  5AV9 A;  5BNX A;  3LZ0 B;  3KUY A;  3R45 A;  3X1S C;  3VH6 A;  3W97 C;  3REL C;  3X1S A;  2BYK B;  2Y2M A;  3W97 A;  3AZL B;  4J8V D;  1S32 B;  5B0Z D;  3WA9 D;  2PYO B;  3X1T D;  2W8S A;  3NQU B;  4ZUX C;  1P3B D;  2RIQ A;  1KX3 C;  2Y2Q A;  4ZUX A;  5B31 G;  2RVQ C;  3W98 C;  2ZY5 A;  1KX3 A;  5JA4 B;  4XZQ C;  5DNN C;  2F8N B;  3W98 A;  4EO5 B;  4XZQ A;  5B32 B;  4UUZ A;  1B6W A;  3KUY B;  3R45 B;  2XD1 A;  3AZJ C;  3X1S B;  3B6G A;  3W97 B;  3REL B;  3AZJ A;  2F8N D;  1U35 C;  5B32 D;  5AV5 D;  1P3F C;  2UWX A;  3LJA D;  5AV9 D;  4KHA A;  1P3F A;  4ZUX B;  3KUY D;  5F99 A;  2F8N K;  1KX3 B;  3X1S D;  3WAA C;  1F66 C;  3W97 D;  3W98 B;  4XZQ B;  3P5J B;  5DNN B;  1Q9C A;  1F66 A;  3WAA A;  4UUZ B;  4WU8 C;  1WWI A;  4H9P A;  2Y2L A;  4ZUX D;  1KX3 D;  4H9O B;  3AZJ B;  3AN2 C;  2RVQ D;  3W98 D;  4NE3 A;  2L5A A;  4XZQ D;  1U35 B;  5AY8 A;  3LZ1 C;  4KHA B;  1P3F B;  1HQ3 C;  3EG5 B;  3WKJ C;  3LZ1 A;  1HQ3 A;  5B1L C;  3EPH A;  3B6G D;  1KX5 C;  3WKJ A;  3A1K A;  3MNN C;  5B1L A;  3AZJ D;  3REH C;  2LY8 A;  1P3G C;  1KX5 A;  1F66 B;  3WAA B;  4H9N A;  3REH A;  1ZLA C;  1WWS A;  4WU8 B;  5DNM C;  3MGS C;  4AWL C;  1ZLA A;  2NQB C;  5CP6 C;  1P3F D;  3B0C W;  5BT1 D;  5F99 D;  5DNM A;  2NQB A;  5E5A C;  5CP6 A;  1AOI C;  3MGR A;  3AN2 B;  3WAA D;  1F66 D;  3AZM C;  2Y2O A;  5B33 C;  3REI C;  5GSU C;  3AZM A;  3LZ1 B;  5B33 A;  1HQ3 B;  3VH5 T;  5GSU A;  4J8U C;  3WKJ B;  2DQN C;  3A6N C;  4J8U A;  5KDM A;  4CSR B;  4WV4 B;  3TU4 C;  1KX5 B;  3MNN B;  4H9N B;  3AN2 D;  3REH B;  1P3G B;  4WU9 C;  3TU4 A;  1ID3 C;  1ZLA B;  1ID3 A;  3VH6 T;  4KUD C;  1M19 C;  3MGS B;  3H0M C;  5DNM B;  4AWL B;  3LZ1 D;  2NQB B;  5CP6 B;  4KUD A;  3LZ0 A;  1HQ3 D;  1M19 A;  3WKJ D;  4LD9 C;  5E5A B;  5B1L D;  1KX5 D;  1AOI B;  3AZL A;  3AZK C;  1S32 A;  3REH D;  2PYO A;  3IP4 C;  5G49 A;  3AZK A;  5GT0 C;  3AZM B;  1ZLA D;  5B33 B;  3NQU A;  3REI B;  5GSU B;  5DNM D;  5GT0 A;  2NQB D;  3UT9 C;  5CP6 D;  4G91 C;  4J8U B;  5KDM B;  2J8P A;  1T3U A;  3UT9 A;  4NE6 A;  3MGR D;  3A6N B;  2F8N A;  3TU4 B;  3AZH C;  2CWE A;  1P34 C;  4WU9 B;  1ID3 B;  1P3L C;  3AZM D;  5B33 D;  4UPK A;  1BH9 A;  5AV8 C;  4KUD B;  5GSU D;  1M19 B;  1TZY C;  5AV8 A;  1TZY A;  4J8U D;  4J8X C;  4LD9 B;  3REL A;  4WNN B;  4J8X A;  3TU4 D;  5G49 B;  3AZK B;  1ID3 D;  3C1C C;  2NZD C;  5C3I C;  5GT0 B;  4KGC C;  3C1C A;  4KUD D;  3LZ0 D;  1M19 D;  4KGC A;  3UT9 B;  5CHL B;  4G91 B;  4WJ3 C;  3AV1 C;  3H0R C;  3AZL D;  2YFW A;  5DNN A;  1S32 D;  3AZH B;  4G92 C;  3C1B C;  5GXQ C;  2PYO D;  3AZK D;  1P34 B;  5CPI C;  1BH9 B;  5GXQ A;  4YM6 C;  1P3L B;  2JCH A;  5GT0 D;  5CPI A;  5AV8 B;  4QLC C;  1TZY B;  3UT9 D;  5CPJ C;  4QLC A;  4H9O A;  4J8X B;  5B1M C;  5AV6 C;  2ZY2 A;  5B1M A;  1PZR A;  5AV6 A;  1U35 A;  3C1C B;  2NZD B;  4WZS B;  5C3I B;  4NFT A;  4KGC B;  5AV8 D;  1TZY D;  3REL D;  2YFW B;  1P3A C;  4J8X D;  3AV1 B;  2Y2J A;  4G92 B;  3C1B B;  5GXQ B;  4WU8 A;  3C1C D;  2JSS A;  3KSY A;  5CPI B;  4YM6 B;  4KGC D;  3B6F C;  4QLC B;  2F8N G;  3AZN C;  3B6F A;  5CPJ B;  3AN2 A;  5DNN D;  5B32 G;  5B1M B;  3UTB C;  3AZN A;  5AV6 B;  5GXQ D;  5GT3 C;  2FFF B;  3KXB C;  3B0C T;  5AVB C;  3EPK A;  3UTA C;  3AYW C;  5CPI D;  1KX4 C;  5JRG C;  5GT3 A;  1KX4 A;  1M18 C;  4QLC D;  5JRG A;  4CSR A;  5AVC C;  1M18 A;  3MNN A;  5CPJ D;  1P3A B;  1P3G A;  5B40 C;  5B1M D;  5AV6 D;  1U35 D;  1EQZ C;  1BFM A;  3EPJ A;  5B40 A;  3B0B A;  1EQZ A;  1N1J A;  4Z5T C;  3WTP C;  3MGS A;  3EPL A;  3W96 C;  2FJ7 C;  3WTP A;  3AV2 C;  3W96 A;  3AZI C;  5E5A A;  3B6F B;  1JFI B;  3AV2 A;  3AZI A;  3AZN B;  1AOI A;  3WTP E;  3UTB B;  2Y2I A;  4WU8 D;  3REI A;  2ZM5 A;  2G5I C;  5GT3 B;  3KXB B;  1KX4 B;  5AVB B;  3UTA B;  3AYW B;  5JRG B;  3V9R B;  1M18 B;  3B6F D;  3A6N A;  4HGA C;  3REK C;  5AVC B;  5B24 C;  3AZN D;  3KFU G;  3REK A;  4X23 C;  4WU9 A;  5B40 B;  5B24 A;  1EQZ B;  4DQY B;  1N1J B;  1P3I C;  5B2I C;  4H9Q A;  1F1E A;  3WTP B;  4Z5T B;  4DRA A;  4JJN C;  5GT3 D;  1P3I A;  1KX4 D;  3REJ C;  3W96 B;  2FJ7 B;  5JRG D;  4JJN A;  2CV5 C;  3AV2 B;  3AZI B;  3REJ A;  4WNN A;  3MNN D;  4E45 A;  1M18 D;  4LD9 A;  2JE5 A;  1P3G D;  3X1U C;  5B40 D;  4XUJ C;  1EQZ D;  3MGS D;  3X1U A;  3WA9 C;  3X1T C;  4ZBJ C;  4XUJ A;  3WTP D;  3W96 D;  5E5A D;  3H0L C;  1P3B C;  3AV2 D;  3AZI D;  1H3O B;  1AOI D;  2Y2H A;  4HGA B;  3REK B;  3AZE C;  3AZH A;  5B24 B;  1TAF B;  4X23 B;  3KWQ C;  4H9Q B;  3AZE A;  1P34 A;  3REI D;  1P3L A;  4Z66 C;  1P3I B;  1HTA A;  5B2I B;  3KWQ A;  1M1A C;  4Z66 A;  4JJN B;  3REJ B;  3A6N D;  5BS7 C;  2CV5 B;  1M1A A;  3REK D;  3LEL C;  4WU9 D;  1Z2C B;  5B24 D;  2F8N H;  3X1U B;  3LEL A;  4Z2M G;  3AZF C;  2NZD A;  4XUJ B;  1P3I D;  5AV5 C;  3WA9 B;  3LJA C;  3AZF A;  3AFA C;  5AV9 C;  4ZBJ B;  3X1T B;  4JJN D;  4YS3 C;  1BH8 A;  4H9R A;  2DF4 C;  4LD9 D;  3REJ D;  3AFA A;  1P3B B;  4YS3 A;  2CV5 D;  3AV1 A;  3AZE B;  4M6B A;  3C1B A;  3X1U D;  3KWQ B;  4XUJ D;  4YM6 A;  4Z66 B;  3F6T A;  1P3M C;  1M1A B;  2HUE C;  3AZG C;  5CPJ A;  4E44 A;  1P3M A;  1P3P C;  3AZH D;  3AZG A;  1P3P A;  3LEL B;  1P34 D;  3AZE D;  3MGP C;  1P3L D;  1P3O C;  3KWQ D;  3MGP A;  3AZF B;  4Z66 D;  1P3O A;  1BH8 B;  4H9R B;  5AV5 B;  5BNV A;  3LJA B;  3AFA B;  5AV9 B;  1M1A D;  5BNX B;  4YS3 B;  3B6G C;  1P3A A;  3AL0 C;  3MVD C;  3MGQ C;  3LEL D;  2NZD D;  3MVD A;  3MGQ A;  1ULY A;  3AZF D;  2BYM A;  5BT1 C;  5F99 C;  3AFA D;  1P3M B;  1KU5 A;  2YFV A;  1A7W A;  4YS3 D;  2HUE B;  1JFI A;  3AV1 D;  3AZG B;  1P3P B;  3B0D C;  3UTB A;  3C1B D;  3MGP B;  1W2E A;  4YM6 D;  1P3O B;  3KXB A;  5BNV B;  5AVB A;  3UTA A;  3AYW A;  5B0Y C;  3V9R A;  2IO5 C;  5B2J C;  5B0Y A;  1P3M D;  2XD5 A;  5FUG A;  5AVC A;  2F2A C;  3AZG D;  5B2J A;  3B6G B;  1P3P D;  3W99 C;  2HIO C;  3MVD B;  3MGQ B;  3X1V C;  3W99 A;  2HIO A;  3MGP D;  2BYM B;  5AY8 C;  5CPK C;  4Z5T A;  3X1V A;  1P3O D;  5BO0 A;  4R8P C;  2FJ7 A;  5CPK A;  2YFV B;  4R8P A;  5F99 B;  1P3A D;  1P3K C;  2Y2K A;  3B0D B;  1P3K A;  3MVD D;  3MGQ D;  2ARO C;  3NQJ A;  4J8W C;  2G5H C;  2ARO A;  2VQR A;  3O62 C;  5B0Y B;  4Z2M H;  4J8W A;  2Y2P A;  2BG1 A;  4H9P B;  5FUG B;  1H3O A;  2IO5 B;  5B31 C;  3O62 A;  5B2J B;  5B31 A;  3FDD A;  3MGR C;  3UTB D;  1TAF A;  4X23 A;  3W99 B;  2HIO B;  1B67 A;  3X1V B;  5B2I A;  3KXB D;  5BO0 B;  5AVB D;  2Y2G A;  3UTA D;  5AY8 B;  3AYW D;  5CPK B;  4R8P B;  5B0Y D;  2CV5 A;  5AVC D;  5B2J D;  2ZY4 A;  2Y2N A;  4J8V C;  5B1L B;  1P3K B;  4H9S C;  3W99 D;  5B0Z C;  2HIO D;  4J8V A;  3NQJ B;  4Z5T D;  4H9S A;  5B0Z A;  3X1V D;  2ARO B;  3WA9 A;  3X1T A;  5AY8 D;  5CPK D;  4J8W B;  4NE5 A;  2FJ7 D;  4CAY A;  3LZ0 C;  3O62 B;  4R8P D;  1P3B A;  3VH5 W;  1R4V A;  5B31 B;  3AZL C;  3MGR B;  1P3K D;  2BYK A;  1S32 C;  2PYO C;  4DRB A; 
#chains in the Genus database with same CATH homology
 2ARO D;  3VH6 W;  4J8W D;  2ZY3 A;  3A1I A;  3O62 D;  5BS7 A;  5B31 D;  4EO5 C;  3VH5 A;  4X23 D;  5JA4 A;  4J8V B;  5B32 C;  5B0Z B;  5B2I D;  5B32 A;  5AV5 A;  4CAY B;  3LJA A;  3KUY C;  5AV9 A;  5BNX A;  3LZ0 B;  3KUY A;  3R45 A;  3X1S C;  3VH6 A;  3W97 C;  3REL C;  3X1S A;  2BYK B;  2Y2M A;  3W97 A;  3AZL B;  4J8V D;  1S32 B;  5B0Z D;  3WA9 D;  2PYO B;  3X1T D;  2W8S A;  3NQU B;  4ZUX C;  1P3B D;  2RIQ A;  1KX3 C;  2Y2Q A;  4ZUX A;  5B31 G;  2RVQ C;  3W98 C;  2ZY5 A;  1KX3 A;  5JA4 B;  4XZQ C;  5DNN C;  2F8N B;  3W98 A;  4EO5 B;  4XZQ A;  5B32 B;  4UUZ A;  1B6W A;  3KUY B;  3R45 B;  2XD1 A;  3AZJ C;  3X1S B;  3B6G A;  3W97 B;  3REL B;  3AZJ A;  2F8N D;  1U35 C;  5B32 D;  5AV5 D;  1P3F C;  2UWX A;  3LJA D;  5AV9 D;  4KHA A;  1P3F A;  4ZUX B;  3KUY D;  5F99 A;  2F8N K;  1KX3 B;  3X1S D;  3WAA C;  1F66 C;  3W97 D;  3W98 B;  4XZQ B;  3P5J B;  5DNN B;  1Q9C A;  1F66 A;  3WAA A;  4UUZ B;  4WU8 C;  1WWI A;  4H9P A;  2Y2L A;  4ZUX D;  1KX3 D;  4H9O B;  3AZJ B;  3AN2 C;  2RVQ D;  3W98 D;  4NE3 A;  2L5A A;  4XZQ D;  1U35 B;  5AY8 A;  3LZ1 C;  4KHA B;  1P3F B;  1HQ3 C;  3EG5 B;  3WKJ C;  3LZ1 A;  1HQ3 A;  5B1L C;  3EPH A;  3B6G D;  1KX5 C;  3WKJ A;  3A1K A;  3MNN C;  5B1L A;  3AZJ D;  3REH C;  2LY8 A;  1P3G C;  1KX5 A;  1F66 B;  3WAA B;  4H9N A;  3REH A;  1ZLA C;  1WWS A;  4WU8 B;  5DNM C;  3MGS C;  4AWL C;  1ZLA A;  2NQB C;  5CP6 C;  1P3F D;  3B0C W;  5BT1 D;  5F99 D;  5DNM A;  2NQB A;  5E5A C;  5CP6 A;  1AOI C;  3MGR A;  3AN2 B;  3WAA D;  1F66 D;  3AZM C;  2Y2O A;  5B33 C;  3REI C;  5GSU C;  3AZM A;  3LZ1 B;  5B33 A;  1HQ3 B;  3VH5 T;  5GSU A;  4J8U C;  3WKJ B;  2DQN C;  3A6N C;  4J8U A;  5KDM A;  4CSR B;  4WV4 B;  3TU4 C;  1KX5 B;  3MNN B;  4H9N B;  3AN2 D;  3REH B;  1P3G B;  4WU9 C;  3TU4 A;  1ID3 C;  1ZLA B;  1ID3 A;  3VH6 T;  4KUD C;  1M19 C;  3MGS B;  3H0M C;  5DNM B;  4AWL B;  3LZ1 D;  2NQB B;  5CP6 B;  4KUD A;  3LZ0 A;  1HQ3 D;  1M19 A;  3WKJ D;  4LD9 C;  5E5A B;  5B1L D;  1KX5 D;  1AOI B;  3AZL A;  3AZK C;  1S32 A;  3REH D;  2PYO A;  3IP4 C;  5G49 A;  3AZK A;  5GT0 C;  3AZM B;  1ZLA D;  5B33 B;  3NQU A;  3REI B;  5GSU B;  5DNM D;  5GT0 A;  2NQB D;  3UT9 C;  5CP6 D;  4G91 C;  4J8U B;  5KDM B;  2J8P A;  1T3U A;  3UT9 A;  4NE6 A;  3MGR D;  3A6N B;  2F8N A;  3TU4 B;  3AZH C;  2CWE A;  1P34 C;  4WU9 B;  1ID3 B;  1P3L C;  3AZM D;  5B33 D;  4UPK A;  1BH9 A;  5AV8 C;  4KUD B;  5GSU D;  1M19 B;  1TZY C;  5AV8 A;  1TZY A;  4J8U D;  4J8X C;  4LD9 B;  3REL A;  4WNN B;  4J8X A;  3TU4 D;  5G49 B;  3AZK B;  1ID3 D;  3C1C C;  2NZD C;  5C3I C;  5GT0 B;  4KGC C;  3C1C A;  4KUD D;  3LZ0 D;  1M19 D;  4KGC A;  3UT9 B;  5CHL B;  4G91 B;  4WJ3 C;  3AV1 C;  3H0R C;  3AZL D;  2YFW A;  5DNN A;  1S32 D;  3AZH B;  4G92 C;  3C1B C;  5GXQ C;  2PYO D;  3AZK D;  1P34 B;  5CPI C;  1BH9 B;  5GXQ A;  4YM6 C;  1P3L B;  2JCH A;  5GT0 D;  5CPI A;  5AV8 B;  4QLC C;  1TZY B;  3UT9 D;  5CPJ C;  4QLC A;  4H9O A;  4J8X B;  5B1M C;  5AV6 C;  2ZY2 A;  5B1M A;  1PZR A;  5AV6 A;  1U35 A;  3C1C B;  2NZD B;  4WZS B;  5C3I B;  4NFT A;  4KGC B;  5AV8 D;  1TZY D;  3REL D;  2YFW B;  1P3A C;  4J8X D;  3AV1 B;  2Y2J A;  4G92 B;  3C1B B;  5GXQ B;  4WU8 A;  3C1C D;  2JSS A;  3KSY A;  5CPI B;  4YM6 B;  4KGC D;  3B6F C;  4QLC B;  2F8N G;  3AZN C;  3B6F A;  5CPJ B;  3AN2 A;  5DNN D;  5B32 G;  5B1M B;  3UTB C;  3AZN A;  5AV6 B;  5GXQ D;  5GT3 C;  2FFF B;  3KXB C;  3B0C T;  5AVB C;  3EPK A;  3UTA C;  3AYW C;  5CPI D;  1KX4 C;  5JRG C;  5GT3 A;  1KX4 A;  1M18 C;  4QLC D;  5JRG A;  4CSR A;  5AVC C;  1M18 A;  3MNN A;  5CPJ D;  1P3A B;  1P3G A;  5B40 C;  5B1M D;  5AV6 D;  1U35 D;  1EQZ C;  1BFM A;  3EPJ A;  5B40 A;  3B0B A;  1EQZ A;  1N1J A;  4Z5T C;  3WTP C;  3MGS A;  3EPL A;  3W96 C;  2FJ7 C;  3WTP A;  3AV2 C;  3W96 A;  3AZI C;  5E5A A;  3B6F B;  1JFI B;  3AV2 A;  3AZI A;  3AZN B;  1AOI A;  3WTP E;  3UTB B;  2Y2I A;  4WU8 D;  3REI A;  2ZM5 A;  2G5I C;  5GT3 B;  3KXB B;  1KX4 B;  5AVB B;  3UTA B;  3AYW B;  5JRG B;  3V9R B;  1M18 B;  3B6F D;  3A6N A;  4HGA C;  3REK C;  5AVC B;  5B24 C;  3AZN D;  3KFU G;  3REK A;  4X23 C;  4WU9 A;  5B40 B;  5B24 A;  1EQZ B;  4DQY B;  1N1J B;  1P3I C;  5B2I C;  4H9Q A;  1F1E A;  3WTP B;  4Z5T B;  4DRA A;  4JJN C;  5GT3 D;  1P3I A;  1KX4 D;  3REJ C;  3W96 B;  2FJ7 B;  5JRG D;  4JJN A;  2CV5 C;  3AV2 B;  3AZI B;  3REJ A;  4WNN A;  3MNN D;  4E45 A;  1M18 D;  4LD9 A;  2JE5 A;  1P3G D;  3X1U C;  5B40 D;  4XUJ C;  1EQZ D;  3MGS D;  3X1U A;  3WA9 C;  3X1T C;  4ZBJ C;  4XUJ A;  3WTP D;  3W96 D;  5E5A D;  3H0L C;  1P3B C;  3AV2 D;  3AZI D;  1H3O B;  1AOI D;  2Y2H A;  4HGA B;  3REK B;  3AZE C;  3AZH A;  5B24 B;  1TAF B;  4X23 B;  3KWQ C;  4H9Q B;  3AZE A;  1P34 A;  3REI D;  1P3L A;  4Z66 C;  1P3I B;  1HTA A;  5B2I B;  3KWQ A;  1M1A C;  4Z66 A;  4JJN B;  3REJ B;  3A6N D;  5BS7 C;  2CV5 B;  1M1A A;  3REK D;  3LEL C;  4WU9 D;  1Z2C B;  5B24 D;  2F8N H;  3X1U B;  3LEL A;  4Z2M G;  3AZF C;  2NZD A;  4XUJ B;  1P3I D;  5AV5 C;  3WA9 B;  3LJA C;  3AZF A;  3AFA C;  5AV9 C;  4ZBJ B;  3X1T B;  4JJN D;  4YS3 C;  1BH8 A;  4H9R A;  2DF4 C;  4LD9 D;  3REJ D;  3AFA A;  1P3B B;  4YS3 A;  2CV5 D;  3AV1 A;  3AZE B;  4M6B A;  3C1B A;  3X1U D;  3KWQ B;  4XUJ D;  4YM6 A;  4Z66 B;  3F6T A;  1P3M C;  1M1A B;  2HUE C;  3AZG C;  5CPJ A;  4E44 A;  1P3M A;  1P3P C;  3AZH D;  3AZG A;  1P3P A;  3LEL B;  1P34 D;  3AZE D;  3MGP C;  1P3L D;  1P3O C;  3KWQ D;  3MGP A;  3AZF B;  4Z66 D;  1P3O A;  1BH8 B;  4H9R B;  5AV5 B;  5BNV A;  3LJA B;  3AFA B;  5AV9 B;  1M1A D;  5BNX B;  4YS3 B;  3B6G C;  1P3A A;  3AL0 C;  3MVD C;  3MGQ C;  3LEL D;  2NZD D;  3MVD A;  3MGQ A;  1ULY A;  3AZF D;  2BYM A;  5BT1 C;  5F99 C;  3AFA D;  1P3M B;  1KU5 A;  2YFV A;  1A7W A;  4YS3 D;  2HUE B;  1JFI A;  3AV1 D;  3AZG B;  1P3P B;  3B0D C;  3UTB A;  3C1B D;  3MGP B;  1W2E A;  4YM6 D;  1P3O B;  3KXB A;  5BNV B;  5AVB A;  3UTA A;  3AYW A;  5B0Y C;  3V9R A;  2IO5 C;  5B2J C;  5B0Y A;  1P3M D;  2XD5 A;  5FUG A;  5AVC A;  2F2A C;  3AZG D;  5B2J A;  3B6G B;  1P3P D;  3W99 C;  2HIO C;  3MVD B;  3MGQ B;  3X1V C;  3W99 A;  2HIO A;  3MGP D;  2BYM B;  5AY8 C;  5CPK C;  4Z5T A;  3X1V A;  1P3O D;  5BO0 A;  4R8P C;  2FJ7 A;  5CPK A;  2YFV B;  4R8P A;  5F99 B;  1P3A D;  1P3K C;  2Y2K A;  3B0D B;  1P3K A;  3MVD D;  3MGQ D;  2ARO C;  3NQJ A;  4J8W C;  2G5H C;  2ARO A;  2VQR A;  3O62 C;  5B0Y B;  4Z2M H;  4J8W A;  2Y2P A;  2BG1 A;  4H9P B;  5FUG B;  1H3O A;  2IO5 B;  5B31 C;  3O62 A;  5B2J B;  5B31 A;  3FDD A;  3MGR C;  3UTB D;  1TAF A;  4X23 A;  3W99 B;  2HIO B;  1B67 A;  3X1V B;  5B2I A;  3KXB D;  5BO0 B;  5AVB D;  2Y2G A;  3UTA D;  5AY8 B;  3AYW D;  5CPK B;  4R8P B;  5B0Y D;  2CV5 A;  5AVC D;  5B2J D;  2ZY4 A;  2Y2N A;  4J8V C;  5B1L B;  1P3K B;  4H9S C;  3W99 D;  5B0Z C;  2HIO D;  4J8V A;  3NQJ B;  4Z5T D;  4H9S A;  5B0Z A;  3X1V D;  2ARO B;  3WA9 A;  3X1T A;  5AY8 D;  5CPK D;  4J8W B;  4NE5 A;  2FJ7 D;  4CAY A;  3LZ0 C;  3O62 B;  4R8P D;  1P3B A;  3VH5 W;  1R4V A;  5B31 B;  3AZL C;  3MGR B;  1P3K D;  2BYK A;  1S32 C;  2PYO C;  4DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...