3B6GC

Nucleosome core particle treated with oxaliplatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 19
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gC00
2RVQD 2JSSA 5GT3C 5AV8B 2PYOA 1P3KB 3AZKA 4KGCD 3UTAD 3W97A 3REHA 4G92C 1KX5B 1P3MB 5CPIC 5E5AD 5CPJB 4AWLB 1BH9A 3AV1B 1P3ID 3WAAA 3MGSD 5B24A 5GSUD 3AZEA 3WTPC 3B0CT 5AV6B 3B6GD 5B31C 4X23B 5DNMD 1JFIB 3KWQA 5B33C 5GXQD 3AN2A 3LJAB 4WV4B 3MGRD 5B0YA 4J8UB 5B1MA 4XUJD 5FUGB 4H9NB 4KUDC 4WU8C 4Z66B 4WU9B 5DNNC 1U35A 1AOIB 3O62A 3VH6A 3REJB 3AYWD 2HIOC 4H9RA 2PYOC 1S32B 3AZLB 5C3IB 4WZSB 3X1VB 1M19C 3AZJD 1TZYA 3X1TD 3AZHB 5GT0C 4J8XD 2HUEB 2NQBD 3VH6T 5B40C 1KX4A 4NE6A 3B6FA 3WAAC 2AROA 3X1UA 3UT9A 5B2IA 1P3LA 1KX3D 5B24C 3REIB 4XZQB 3X1SD 3AZEC 2RVQC 3AZNB 3AZMB 1P3BB 1TAFA 3WKJD 4R8PD 3KWQC 4KHAA 5G49A 5AV9D 3AN2C 1P3OA 3W96D 5B2JA 4G91C 2L5AA 1P3GA 4YS3A 5AVCD 3AFAA 4CAYA 3W98D 3C1CB 1EQZC 5CPKD 4CSRB 5AVBB 4LD9B 2FJ7B 5B32D 1U35C 2CV5B 5AV8A 1P3AB 3NQUB 1M18D 1P3KA 2F8ND 1R4VA 4ZUXC 3LZ1D 1P3FA 3W99C 1TZYC 1P3MA 1P3PA 5CPJA 3A6NB 3AZIB 5B1LA 5JA4A 3AV1A 1A7WA 4WNNB 1WWIA 5GT3D 3B6FC 4H9SA 3VH5W 3UT9C 3AZFB 3R45A 5AY8D 4E44A 3AV2A 1P34A 3MVDB 1JFIA 5CPID 3LJAA 1P3OC 5F99B 3AZJC 5B2JC 3KXBB 1P3GC 4J8VB 3WTPD 5B31D 4Z66A 4QLCA 5B33D 3LELB 3AZGA 1AOIA 1ZLAA 2LY8A 1S32A 4H9QB 3WKJC 1P3KC 3X1VA 3MGQC 3UTAB 4KGCB 5AV9C 3W96C 1P3FC 4KUDD 4WU8D 5DNND 4JJNB 5CPJC 1P3PC 5B1LC 3UTBB 3AV1C 1P3IB 2PYOD 4M6BA 3MGPA 3MGSB 3AZKD 4XZQA 1P3BA 3AZNA 3B6GB 1M19D 3AV2C 1M18C 5DNMB 5GT0D 3KUYA 1P34C 5B40D 5BO0B 3V9RA 5AV5C 3MGRB 2F8NK 3WAAD 5B24D 3AZED 4CSRA 3MNNB 5AVBA 4UUZB 3C1BB 4J8WA 4Z66C 4LD9A 4QLCC 3KWQD 3AZGC 5AY8C 3AN2D 1AOIC 1ZLAC 1P3AA 3RELA 3AYWB 4H9PB 2BYMA 1S32C 5C3IC 3X1VC 1EQZD 1Q9CA 3X1TB 2YFWA 4EO5B 4J8XB 2HUEC 4WNNA 1U35D 1M1AB 3AZFA 4ZUXD 3B0DC 2NZDA 3MGPC 3X1SB 2F8NG 3W99D 1TZYD 3KUYC 5F99A 1ID3A 3KXBA 1ULYA 3B6FD 2AROD 3UT9D 5AVCB 4J8VA 3W98B 1F66B 5CPKB 5AVBC 3NQJA 4J8WC 4LD9C 3LZ0A 3AZKC 5B32B 1P3OD 3W97C 3REHC 3RELC 4H9QA 5B2JD 2F8NB 3UTAA 1P3GD 3LZ1B 5B0ZB 3TU4A 3REKA 4JJNA 4ZBJC 3UTBA 5GT3B 1P3KD 3MGQD 2NZDC 3B6GA 1P3FD 3WA9A 4G92B 5BNXB 5B0YC 5KDMB 5CPIB 1P3PD 5CPJD 5BO0A 5B1MC 5F99C 5B1LD 4Z5TA 3AV1D 1ID3C 1HQ3A 4H9OB 4YM6A 3KXBC 5CHLB 3VH6W 3WTPB 3MNNA 3C1BA 3KSYA 3O62C 5B31B 3AV2D 1P34D 3VH5A 5B33B 3LZ0C 5AV5D 1KX5A 1N1JB 3X1TA 2YFVB 3TU4C 1KX4C 3VH5T 4KUDB 5JRGB 3REKC 4Z66D 4QLCD 2AROC 3X1UC 4JJNC 5B2IC 1P3LC 1BFMA 3AZGD 1AOID 5AV6A 1M1AA 3UTBC 1ZLAD 2HIOB 4X23A 1S32D 3X1VD 3X1SA 1M19B 3WA9C 4J8UA 3WTPE 5BS7A 5GT0B 5FUGA 2F8NH 4H9NA 5B40B 4YS3C 3AFAC 5BNVB 1BH9B 5CP6B 4Z5TC 1HQ3C 4WU9A 4YM6C 3W98A 1F66A 3MGPD 4NFTA 5B24B 3AZEB 3REJA 3MNNC 5CPKA 5AV8C 3AZLA 3KUYD 5B32A 3KWQB 3AN2B 3AZHA 4G91B 1KX5C 2F8NA 1P3MC 5E5AB 5B0ZA 4AWLC 1EQZB 5AVBD 4J8WD 4H9SC 4LD9D 5GSUB 2IO5B 3REIA 5AV6C 3AZMA 1M1AC 3REHD 3RELD 3W97D 4X23C 4ZUXB 5GXQB 3LJAC 5BNXA 3W99B 1TZYB 1H3OB 4J8UC 4XUJB 3C1CA 4WU9C 2FJ7A 1F66C 2NZDD 5BT1C 2CV5A 3REJC 3NQUA 5B0YD 3AZLC 5B1MD 4KHAB 5G49B 5F99D 1P3OB 3AZJB 3AZHC 1ID3D 5B2JB 3KXBD 1P3GB 3A6NA 3AZIA 2NQBB 5B0ZC 2YFVA 4KUDA 5JRGA 3O62D 1KX3B 3B0BA 5B32G 3LZ0D 2HIOA 3REIC 4XZQC 1P3BC 3AZMC 3AZNC 3MVDA 3WKJB 3MGQB 4R8PB 5AV9B 4HGAB 1M19A 1P3FB 3W96B 1BH8B 3TU4D 1KX4D 5GT0A 3REKD 5B40A 3X1UD 4JJND 1P3LD 5B2ID 1P3PB 5BNVA 5B1LB 5JA4B 3C1CC 5CP6A 3UTBD 4DRBA 3LELA 3R45B 2FJ7C 2CV5C 3WA9D 3B0CW 1P3AC 3AV2B 1M18B 4KGCA 1P34B 1B67A 4YS3D 3AFAD 4Z2MG 5AV5B 4Z5TD 1HQ3D 4YM6D 5E5AA 3A6NC 3AZIC 1EQZA 5B31G 1P3IA 3MNND 3C1BD 5JRGC 5AV8D 4QLCB 3MGSA 3AZFC 5GSUA 3AZGB 5AY8B 1ZLAB 2CWEA 1KX5D 5DNMA 4ZUXA 3MVDC 1P3MD 5GXQA 2BYKB 3MGRA 3W99A 1H3OA 4XUJA 4J8VC 5AV6D 1M1AD 4UUZA 5CP6C 4X23D 3B0DB 3LELC 3MGPB 3LJAD 1B6WA 3AYWA 4H9PA 4J8UD 4KGCC 3KUYB 3UTAC 3V9RB 3AZJA 4WU8B 4J8XA 4WU9D 5DNNB 5E5AC 2NQBA 1F66D 5BT1D 1P3IC 3REJD 1KX3A 4J8WB 2PYOB 3AZLD 3MGSC 5GSUC 2IO5C 3AZKB 3B6GC 3W97B 3REHB 3RELB 3AZHD 3WKJA 3MGQA 5DNMC 2BYMB 4R8PA 5AV9A 5GXQC 3W96A 5B0ZD 1BH8A 3MGRC 3WAAB 2YFWB 4ZBJB 4XUJC 5AVCA 3REID 4XZQD 1P3BD 3AZMD 3AZND 3C1BC 2NZDB 3AYWC 1M18A 5B0YB 3LZ1A 5B1MB 4NE5A 5AV5A 3C1CD 1ID3B 3X1TC 4EO5C 4Z2MH 4J8XC 2NQBC 2FJ7D 1U35B 4NE3A 5GT3A 3O62B 2CV5D 1P3AD 1WWSA 4H9RB 1KX3C 3NQJB 5AY8A 4E45A 3LZ0B 4DRAA 3X1SC 1KU5A 5KDMA 5CPIA 1F1EA 4R8PC 5BS7C 2BYKA 3A6ND 4HGAC 3AZID 3TU4B 4H9OA 1KX4B 5JRGD 3REKB 3B6FB 1HTAA 3X1UB 2AROB 3UT9B 5B2IB 5AVCC 3AZFD 1P3LB 3W98C 3WTPA 5B31A 2HIOD 5CPKC 5B33A 1TAFB 3MVDD 5B32C 3WA9B 1N1JA 3LZ1C 4YS3B 3AFAB 4J8VD 4CAYB 5CP6D 4Z5TB 4WU8A 1HQ3B 5DNNA 4YM6B 3LELD
chains in the Genus database with same CATH superfamily
2RVQD 2JSSA 5GT3C 5AV8B 2PYOA 1P3KB 3AZKA 4KGCD 3UTAD 3W97A 3REHA 4G92C 1KX5B 1P3MB 5CPIC 5E5AD 5CPJB 4AWLB 2ZY2A 1Z2CB 1BH9A 3AV1B 1P3ID 3WAAA 3EPLA 3MGSD 5B24A 5GSUD 3AZEA 3WTPC 3B0CT 5AV6B 3B6GD 5B31C 4X23B 5DNMD 1JFIB 3KWQA 5B33C 2VQRA 5GXQD 3AN2A 3LJAB 4WV4B 3MGRD 5B0YA 4J8UB 5B1MA 4XUJD 5FUGB 4H9NB 4KUDC 4WU8C 4Z66B 4WU9B 5DNNC 1U35A 1AOIB 3O62A 3VH6A 3REJB 3AYWD 2HIOC 4H9RA 2PYOC 1S32B 3AZLB 5C3IB 4WZSB 3X1VB 1M19C 3AZJD 1TZYA 3X1TD 3AZHB 5GT0C 4J8XD 2HUEB 2NQBD 3VH6T 5B40C 1KX4A 4NE6A 3B6FA 3WAAC 2AROA 3X1UA 3UT9A 5B2IA 1P3LA 1KX3D 5B24C 3REIB 4XZQB 3X1SD 3AZEC 2RVQC 3AZNB 3AZMB 1P3BB 1TAFA 3WKJD 4R8PD 3KWQC 4KHAA 5G49A 5AV9D 3AN2C 1P3OA 3W96D 5B2JA 4G91C 2L5AA 1P3GA 4YS3A 5AVCD 3AFAA 4CAYA 3W98D 3C1CB 1EQZC 5CPKD 4CSRB 5AVBB 4LD9B 2FJ7B 5B32D 1U35C 2CV5B 5AV8A 1P3AB 3NQUB 1M18D 1P3KA 2F8ND 1R4VA 4ZUXC 3LZ1D 1P3FA 3W99C 2J8PA 1TZYC 1P3MA 1P3PA 5CPJA 3A6NB 3AZIB 5B1LA 5JA4A 3AV1A 1A7WA 4WNNB 1WWIA 5GT3D 3B6FC 4H9SA 3VH5W 3UT9C 3AZFB 2Y2MA 3R45A 5AY8D 4E44A 3AV2A 1P34A 3MVDB 1JFIA 5CPID 3LJAA 1P3OC 5F99B 3H0LC 3AZJC 5B2JC 3KXBB 1P3GC 4J8VB 3WTPD 5B31D 4Z66A 4QLCA 5B33D 3LELB 3AZGA 1AOIA 1ZLAA 2LY8A 3H0RC 1S32A 4H9QB 2G5IC 3WKJC 1P3KC 3X1VA 3MGQC 3UTAB 4KGCB 5AV9C 3W96C 1P3FC 4KUDD 4WU8D 5DNND 4JJNB 5CPJC 1P3PC 5B1LC 3UTBB 3AV1C 1P3IB 2JCHA 2PYOD 1T3UA 4M6BA 3MGPA 3IP4C 3MGSB 3AZKD 4XZQA 1P3BA 3AZNA 3B6GB 1M19D 1PZRA 3AV2C 1M18C 5DNMB 5GT0D 3KUYA 1P34C 5B40D 5BO0B 3V9RA 5AV5C 3MGRB 2F8NK 3WAAD 5B24D 3AZED 4CSRA 3MNNB 2Y2KA 5AVBA 4UUZB 3C1BB 4J8WA 4Z66C 4LD9A 4QLCC 3F6TA 3KWQD 3AZGC 5AY8C 3AN2D 1AOIC 1ZLAC 1P3AA 3RELA 3AYWB 4H9PB 2BYMA 1S32C 5C3IC 3X1VC 1EQZD 1Q9CA 3X1TB 2YFWA 4EO5B 4J8XB 2HUEC 4WNNA 1U35D 1M1AB 3AZFA 4ZUXD 3B0DC 2NZDA 3MGPC 3X1SB 2F8NG 3W99D 1TZYD 3KUYC 5F99A 1ID3A 3KXBA 1ULYA 3B6FD 2AROD 3UT9D 5AVCB 4J8VA 3W98B 1F66B 2XD1A 5CPKB 5AVBC 3NQJA 4J8WC 2Y2PA 4LD9C 3LZ0A 3AZKC 5B32B 1P3OD 3W97C 3REHC 3RELC 4H9QA 5B2JD 2DF4C 2F8NB 3UTAA 1P3GD 3LZ1B 5B0ZB 3TU4A 3REKA 4JJNA 4ZBJC 3UTBA 3H0MC 5GT3B 1P3KD 3MGQD 2NZDC 3B6GA 1P3FD 3WA9A 4G92B 5BNXB 5B0YC 5KDMB 3AL0C 5CPIB 1P3PD 5CPJD 5BO0A 5B1MC 5F99C 5B1LD 4Z5TA 3AV1D 1ID3C 1HQ3A 4H9OB 4YM6A 3KXBC 2Y2GA 5CHLB 3VH6W 3WTPB 3MNNA 3C1BA 3KSYA 3O62C 5B31B 3AV2D 4WJ3C 1P34D 3VH5A 5B33B 3LZ0C 5AV5D 1KX5A 1N1JB 3X1TA 2YFVB 3TU4C 1KX4C 3VH5T 4KUDB 5JRGB 3REKC 4Z66D 4QLCD 2AROC 3X1UC 4JJNC 5B2IC 1P3LC 1BFMA 3AZGD 1AOID 5AV6A 1M1AA 3UTBC 1ZLAD 2HIOB 4X23A 3A1KA 1S32D 3X1VD 2Y2LA 3X1SA 1M19B 3WA9C 4J8UA 3WTPE 5BS7A 5GT0B 5FUGA 2F8NH 4H9NA 5B40B 4YS3C 3AFAC 5BNVB 1BH9B 5CP6B 4Z5TC 1HQ3C 4WU9A 4YM6C 3W98A 1F66A 3MGPD 4NFTA 5B24B 3AZEB 3REJA 3MNNC 5CPKA 2Y2JA 5AV8C 3AZLA 3KUYD 5B32A 3KWQB 3AN2B 3AZHA 4G91B 1KX5C 2F8NA 1P3MC 5E5AB 5B0ZA 4AWLC 1EQZB 5AVBD 4J8WD 4H9SC 4LD9D 3EPJA 5GSUB 2FFFB 2IO5B 3P5JB 3REIA 5AV6C 3AZMA 1M1AC 3REHD 3RELD 3W97D 4X23C 4ZUXB 5GXQB 3LJAC 5BNXA 3W99B 1TZYB 1H3OB 4J8UC 4XUJB 3C1CA 4WU9C 2FJ7A 1F66C 2NZDD 5BT1C 2CV5A 3REJC 3NQUA 5B0YD 3AZLC 5B1MD 4KHAB 5G49B 5F99D 1P3OB 3AZJB 3AZHC 1ID3D 5B2JB 3KXBD 2Y2IA 1P3GB 3A6NA 3AZIA 3KFUG 2NQBB 5B0ZC 2YFVA 4KUDA 2XD5A 5JRGA 3O62D 2BG1A 1KX3B 3B0BA 5B32G 3LZ0D 2RIQA 2HIOA 3REIC 4XZQC 1P3BC 3AZMC 3AZNC 3MVDA 3WKJB 3MGQB 4R8PB 5AV9B 4HGAB 1M19A 1P3FB 3W96B 1BH8B 3A1IA 3TU4D 1KX4D 5GT0A 3REKD 5B40A 3X1UD 4JJND 1P3LD 5B2ID 1P3PB 5BNVA 5B1LB 5JA4B 3C1CC 5CP6A 3UTBD 4DRBA 3LELA 2DQNC 3R45B 2FJ7C 3EPHA 2CV5C 3WA9D 3B0CW 1P3AC 3AV2B 1M18B 4KGCA 1P34B 1B67A 4YS3D 2UWXA 3AFAD 4Z2MG 5AV5B 4Z5TD 1HQ3D 5E5AA 4YM6D 3A6NC 3AZIC 1EQZA 5B31G 1P3IA 3MNND 3C1BD 5JRGC 5AV8D 2Y2OA 4QLCB 3MGSA 3AZFC 5GSUA 3AZGB 5AY8B 1ZLAB 2CWEA 1KX5D 5DNMA 4ZUXA 3MVDC 1P3MD 5GXQA 2BYKB 3MGRA 3W99A 2ZM5A 1H3OA 4XUJA 3FDDA 4J8VC 5AV6D 1M1AD 4UUZA 5CP6C 4X23D 3B0DB 3LELC 3MGPB 3LJAD 1B6WA 3AYWA 4H9PA 4J8UD 3EPKA 1W2EA 3KUYB 4KGCC 3UTAC 2ZY5A 3V9RB 2G5HC 3AZJA 4WU8B 4J8XA 4WU9D 5DNNB 5E5AC 2NQBA 2Y2HA 1F66D 4DQYB 5BT1D 1P3IC 3REJD 1KX3A 4J8WB 2PYOB 3AZLD 3MGSC 5GSUC 2IO5C 3AZKB 3B6GC 3W97B 3REHB 3RELB 3AZHD 3WKJA 3MGQA 2JE5A 2BYMB 5DNMC 4R8PA 2Y2QA 5AV9A 5GXQC 3W96A 5B0ZD 1BH8A 3MGRC 3WAAB 2YFWB 4ZBJB 4XUJC 5AVCA 3REID 4XZQD 1P3BD 3AZMD 3AZND 3C1BC 2NZDB 3AYWC 1M18A 5B0YB 3LZ1A 5B1MB 4NE5A 5AV5A 3C1CD 1ID3B 3X1TC 4EO5C 4Z2MH 4J8XC 2NQBC 2Y2NA 2FJ7D 1U35B 2ZY3A 4NE3A 5GT3A 3O62B 2CV5D 1P3AD 1WWSA 4H9RB 1KX3C 3NQJB 5AY8A 4E45A 3LZ0B 4DRAA 3X1SC 1KU5A 5KDMA 5CPIA 1F1EA 4UPKA 4R8PC 2BYKA 5BS7C 4HGAC 3A6ND 3AZID 3TU4B 4H9OA 1KX4B 5JRGD 3REKB 3B6FB 1HTAA 2AROB 3X1UB 3UT9B 5B2IB 5AVCC 3AZFD 1P3LB 3W98C 3WTPA 2ZY4A 5B31A 2HIOD 5CPKC 5B33A 1TAFB 2F2AC 3MVDD 5B32C 3WA9B 1N1JA 3LZ1C 4YS3B 3AFAB 4J8VD 4CAYB 5CP6D 4Z5TB 4WU8A 1HQ3B 5DNNA 4YM6B 3EG5B 2W8SA 3LELD
chains in the Genus database with same CATH topology
2RVQD 2JSSA 5GT3C 5AV8B 2PYOA 1P3KB 3AZKA 4KGCD 3UTAD 3W97A 3REHA 4G92C 1KX5B 1P3MB 5CPIC 5E5AD 5CPJB 4AWLB 2ZY2A 1Z2CB 1BH9A 3AV1B 1P3ID 3WAAA 3EPLA 3MGSD 5B24A 5GSUD 3AZEA 3WTPC 3B0CT 5AV6B 3B6GD 5B31C 4X23B 5DNMD 1JFIB 3KWQA 5B33C 2VQRA 5GXQD 3AN2A 3LJAB 4WV4B 3MGRD 5B0YA 4J8UB 5B1MA 4XUJD 5FUGB 4H9NB 4KUDC 4WU8C 4Z66B 4WU9B 5DNNC 1U35A 1AOIB 3O62A 3VH6A 3REJB 3AYWD 2HIOC 4H9RA 2PYOC 1S32B 3AZLB 5C3IB 4WZSB 3X1VB 1M19C 3AZJD 1TZYA 3X1TD 3AZHB 5GT0C 4J8XD 2HUEB 2NQBD 3VH6T 5B40C 1KX4A 4NE6A 3B6FA 3WAAC 2AROA 3X1UA 3UT9A 5B2IA 1P3LA 1KX3D 5B24C 3REIB 4XZQB 3X1SD 3AZEC 2RVQC 3AZNB 3AZMB 1P3BB 1TAFA 3WKJD 4R8PD 3KWQC 4KHAA 5G49A 5AV9D 3AN2C 1P3OA 3W96D 5B2JA 4G91C 2L5AA 1P3GA 4YS3A 5AVCD 3AFAA 4CAYA 3W98D 3C1CB 1EQZC 5CPKD 4CSRB 5AVBB 4LD9B 2FJ7B 5B32D 1U35C 2CV5B 5AV8A 1P3AB 3NQUB 1M18D 1P3KA 2F8ND 1R4VA 4ZUXC 3LZ1D 1P3FA 3W99C 2J8PA 1TZYC 1P3MA 1P3PA 5CPJA 3A6NB 3AZIB 5B1LA 5JA4A 3AV1A 1A7WA 4WNNB 1WWIA 5GT3D 3B6FC 4H9SA 3VH5W 3UT9C 3AZFB 2Y2MA 3R45A 5AY8D 4E44A 3AV2A 1P34A 3MVDB 1JFIA 5CPID 3LJAA 1P3OC 5F99B 3H0LC 3AZJC 5B2JC 3KXBB 1P3GC 4J8VB 3WTPD 5B31D 4Z66A 4QLCA 5B33D 3LELB 3AZGA 1AOIA 1ZLAA 2LY8A 3H0RC 1S32A 4H9QB 2G5IC 3WKJC 1P3KC 3X1VA 3MGQC 3UTAB 4KGCB 5AV9C 3W96C 1P3FC 4KUDD 4WU8D 5DNND 4JJNB 5CPJC 1P3PC 5B1LC 3UTBB 3AV1C 1P3IB 2JCHA 2PYOD 1T3UA 4M6BA 3MGPA 3IP4C 3MGSB 3AZKD 4XZQA 1P3BA 3AZNA 3B6GB 1M19D 1PZRA 3AV2C 1M18C 5DNMB 5GT0D 3KUYA 1P34C 5B40D 5BO0B 3V9RA 5AV5C 3MGRB 2F8NK 3WAAD 5B24D 3AZED 4CSRA 3MNNB 2Y2KA 5AVBA 4UUZB 3C1BB 4J8WA 4Z66C 4LD9A 4QLCC 3F6TA 3KWQD 3AZGC 5AY8C 3AN2D 1AOIC 1ZLAC 1P3AA 3RELA 3AYWB 4H9PB 2BYMA 1S32C 5C3IC 3X1VC 1EQZD 1Q9CA 3X1TB 2YFWA 4EO5B 4J8XB 2HUEC 4WNNA 1U35D 1M1AB 3AZFA 4ZUXD 3B0DC 2NZDA 3MGPC 3X1SB 2F8NG 3W99D 1TZYD 3KUYC 5F99A 1ID3A 3KXBA 1ULYA 3B6FD 2AROD 3UT9D 5AVCB 4J8VA 3W98B 1F66B 2XD1A 5CPKB 5AVBC 3NQJA 4J8WC 2Y2PA 4LD9C 3LZ0A 3AZKC 5B32B 1P3OD 3W97C 3REHC 3RELC 4H9QA 5B2JD 2DF4C 2F8NB 3UTAA 1P3GD 3LZ1B 5B0ZB 3TU4A 3REKA 4JJNA 4ZBJC 3UTBA 3H0MC 5GT3B 1P3KD 3MGQD 2NZDC 3B6GA 1P3FD 3WA9A 4G92B 5BNXB 5B0YC 5KDMB 3AL0C 5CPIB 1P3PD 5CPJD 5BO0A 5B1MC 5F99C 5B1LD 4Z5TA 3AV1D 1ID3C 1HQ3A 4H9OB 4YM6A 3KXBC 2Y2GA 5CHLB 3VH6W 3WTPB 3MNNA 3C1BA 3KSYA 3O62C 5B31B 3AV2D 4WJ3C 1P34D 3VH5A 5B33B 3LZ0C 5AV5D 1KX5A 1N1JB 3X1TA 2YFVB 3TU4C 1KX4C 3VH5T 4KUDB 5JRGB 3REKC 4Z66D 4QLCD 2AROC 3X1UC 4JJNC 5B2IC 1P3LC 1BFMA 3AZGD 1AOID 5AV6A 1M1AA 3UTBC 1ZLAD 2HIOB 4X23A 3A1KA 1S32D 3X1VD 2Y2LA 3X1SA 1M19B 3WA9C 4J8UA 3WTPE 5BS7A 5GT0B 5FUGA 2F8NH 4H9NA 5B40B 4YS3C 3AFAC 5BNVB 1BH9B 5CP6B 4Z5TC 1HQ3C 4WU9A 4YM6C 3W98A 1F66A 3MGPD 4NFTA 5B24B 3AZEB 3REJA 3MNNC 5CPKA 2Y2JA 5AV8C 3AZLA 3KUYD 5B32A 3KWQB 3AN2B 3AZHA 4G91B 1KX5C 2F8NA 1P3MC 5E5AB 5B0ZA 4AWLC 1EQZB 5AVBD 4J8WD 4H9SC 4LD9D 3EPJA 5GSUB 2FFFB 2IO5B 3P5JB 3REIA 5AV6C 3AZMA 1M1AC 3REHD 3RELD 3W97D 4X23C 4ZUXB 5GXQB 3LJAC 5BNXA 3W99B 1TZYB 1H3OB 4J8UC 4XUJB 3C1CA 4WU9C 2FJ7A 1F66C 2NZDD 5BT1C 2CV5A 3REJC 3NQUA 5B0YD 3AZLC 5B1MD 4KHAB 5G49B 5F99D 1P3OB 3AZJB 3AZHC 1ID3D 5B2JB 3KXBD 2Y2IA 1P3GB 3A6NA 3AZIA 3KFUG 2NQBB 5B0ZC 2YFVA 4KUDA 2XD5A 5JRGA 3O62D 2BG1A 1KX3B 3B0BA 5B32G 3LZ0D 2RIQA 2HIOA 3REIC 4XZQC 1P3BC 3AZMC 3AZNC 3MVDA 3WKJB 3MGQB 4R8PB 5AV9B 4HGAB 1M19A 1P3FB 3W96B 1BH8B 3A1IA 3TU4D 1KX4D 5GT0A 3REKD 5B40A 3X1UD 4JJND 1P3LD 5B2ID 1P3PB 5BNVA 5B1LB 5JA4B 3C1CC 5CP6A 3UTBD 4DRBA 3LELA 2DQNC 3R45B 2FJ7C 3EPHA 2CV5C 3WA9D 3B0CW 1P3AC 3AV2B 1M18B 4KGCA 1P34B 1B67A 4YS3D 2UWXA 3AFAD 4Z2MG 5AV5B 4Z5TD 1HQ3D 5E5AA 4YM6D 3A6NC 3AZIC 1EQZA 5B31G 1P3IA 3MNND 3C1BD 5JRGC 5AV8D 2Y2OA 4QLCB 3MGSA 3AZFC 5GSUA 3AZGB 5AY8B 1ZLAB 2CWEA 1KX5D 5DNMA 4ZUXA 3MVDC 1P3MD 5GXQA 2BYKB 3MGRA 3W99A 2ZM5A 1H3OA 4XUJA 3FDDA 4J8VC 5AV6D 1M1AD 4UUZA 5CP6C 4X23D 3B0DB 3LELC 3MGPB 3LJAD 1B6WA 3AYWA 4H9PA 4J8UD 3EPKA 1W2EA 3KUYB 4KGCC 3UTAC 2ZY5A 3V9RB 2G5HC 3AZJA 4WU8B 4J8XA 4WU9D 5DNNB 5E5AC 2NQBA 2Y2HA 1F66D 4DQYB 5BT1D 1P3IC 3REJD 1KX3A 4J8WB 2PYOB 3AZLD 3MGSC 5GSUC 2IO5C 3AZKB 3B6GC 3W97B 3REHB 3RELB 3AZHD 3WKJA 3MGQA 2JE5A 2BYMB 5DNMC 4R8PA 2Y2QA 5AV9A 5GXQC 3W96A 5B0ZD 1BH8A 3MGRC 3WAAB 2YFWB 4ZBJB 4XUJC 5AVCA 3REID 4XZQD 1P3BD 3AZMD 3AZND 3C1BC 2NZDB 3AYWC 1M18A 5B0YB 3LZ1A 5B1MB 4NE5A 5AV5A 3C1CD 1ID3B 3X1TC 4EO5C 4Z2MH 4J8XC 2NQBC 2Y2NA 2FJ7D 1U35B 2ZY3A 4NE3A 5GT3A 3O62B 2CV5D 1P3AD 1WWSA 4H9RB 1KX3C 3NQJB 5AY8A 4E45A 3LZ0B 4DRAA 3X1SC 1KU5A 5KDMA 5CPIA 1F1EA 4UPKA 4R8PC 2BYKA 5BS7C 4HGAC 3A6ND 3AZID 3TU4B 4H9OA 1KX4B 5JRGD 3REKB 3B6FB 1HTAA 2AROB 3X1UB 3UT9B 5B2IB 5AVCC 3AZFD 1P3LB 3W98C 3WTPA 2ZY4A 5B31A 2HIOD 5CPKC 5B33A 1TAFB 2F2AC 3MVDD 5B32C 3WA9B 1N1JA 3LZ1C 4YS3B 3AFAB 4J8VD 4CAYB 5CP6D 4Z5TB 4WU8A 1HQ3B 5DNNA 4YM6B 3EG5B 2W8SA 3LELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ D;  2JSS A;  5GT3 C;  5AV8 B;  2PYO A;  1P3K B;  3AZK A;  4KGC D;  3UTA D;  3W97 A;  3REH A;  4G92 C;  1KX5 B;  1P3M B;  5CPI C;  5E5A D;  5CPJ B;  4AWL B;  1BH9 A;  3AV1 B;  1P3I D;  3WAA A;  3MGS D;  5B24 A;  5GSU D;  3AZE A;  3WTP C;  3B0C T;  5AV6 B;  3B6G D;  5B31 C;  4X23 B;  5DNM D;  1JFI B;  3KWQ A;  5B33 C;  5GXQ D;  3AN2 A;  3LJA B;  4WV4 B;  3MGR D;  5B0Y A;  4J8U B;  5B1M A;  4XUJ D;  5FUG B;  4H9N B;  4KUD C;  4WU8 C;  4Z66 B;  4WU9 B;  5DNN C;  1U35 A;  1AOI B;  3O62 A;  3VH6 A;  3REJ B;  3AYW D;  2HIO C;  4H9R A;  2PYO C;  1S32 B;  3AZL B;  5C3I B;  4WZS B;  3X1V B;  1M19 C;  3AZJ D;  1TZY A;  3X1T D;  3AZH B;  5GT0 C;  4J8X D;  2HUE B;  2NQB D;  3VH6 T;  5B40 C;  1KX4 A;  4NE6 A;  3B6F A;  3WAA C;  2ARO A;  3X1U A;  3UT9 A;  5B2I A;  1P3L A;  1KX3 D;  5B24 C;  3REI B;  4XZQ B;  3X1S D;  3AZE C;  2RVQ C;  3AZN B;  3AZM B;  1P3B B;  1TAF A;  3WKJ D;  4R8P D;  3KWQ C;  4KHA A;  5G49 A;  5AV9 D;  3AN2 C;  1P3O A;  3W96 D;  5B2J A;  4G91 C;  2L5A A;  1P3G A;  4YS3 A;  5AVC D;  3AFA A;  4CAY A;  3W98 D;  3C1C B;  1EQZ C;  5CPK D;  4CSR B;  5AVB B;  4LD9 B;  2FJ7 B;  5B32 D;  1U35 C;  2CV5 B;  5AV8 A;  1P3A B;  3NQU B;  1M18 D;  1P3K A;  2F8N D;  1R4V A;  4ZUX C;  3LZ1 D;  1P3F A;  3W99 C;  1TZY C;  1P3M A;  1P3P A;  5CPJ A;  3A6N B;  3AZI B;  5B1L A;  5JA4 A;  3AV1 A;  1A7W A;  4WNN B;  1WWI A;  5GT3 D;  3B6F C;  4H9S A;  3VH5 W;  3UT9 C;  3AZF B;  3R45 A;  5AY8 D;  4E44 A;  3AV2 A;  1P34 A;  3MVD B;  1JFI A;  5CPI D;  3LJA A;  1P3O C;  5F99 B;  3AZJ C;  5B2J C;  3KXB B;  1P3G C;  4J8V B;  3WTP D;  5B31 D;  4Z66 A;  4QLC A;  5B33 D;  3LEL B;  3AZG A;  1AOI A;  1ZLA A;  2LY8 A;  1S32 A;  4H9Q B;  3WKJ C;  1P3K C;  3X1V A;  3MGQ C;  3UTA B;  4KGC B;  5AV9 C;  3W96 C;  1P3F C;  4KUD D;  4WU8 D;  5DNN D;  4JJN B;  5CPJ C;  1P3P C;  5B1L C;  3UTB B;  3AV1 C;  1P3I B;  2PYO D;  4M6B A;  3MGP A;  3MGS B;  3AZK D;  4XZQ A;  1P3B A;  3AZN A;  3B6G B;  1M19 D;  3AV2 C;  1M18 C;  5DNM B;  5GT0 D;  3KUY A;  1P34 C;  5B40 D;  5BO0 B;  3V9R A;  5AV5 C;  3MGR B;  2F8N K;  3WAA D;  5B24 D;  3AZE D;  4CSR A;  3MNN B;  5AVB A;  4UUZ B;  3C1B B;  4J8W A;  4Z66 C;  4LD9 A;  4QLC C;  3KWQ D;  3AZG C;  5AY8 C;  3AN2 D;  1AOI C;  1ZLA C;  1P3A A;  3REL A;  3AYW B;  4H9P B;  2BYM A;  1S32 C;  5C3I C;  3X1V C;  1EQZ D;  1Q9C A;  3X1T B;  2YFW A;  4EO5 B;  4J8X B;  2HUE C;  4WNN A;  1U35 D;  1M1A B;  3AZF A;  4ZUX D;  3B0D C;  2NZD A;  3MGP C;  3X1S B;  2F8N G;  3W99 D;  1TZY D;  3KUY C;  5F99 A;  1ID3 A;  3KXB A;  1ULY A;  3B6F D;  2ARO D;  3UT9 D;  5AVC B;  4J8V A;  3W98 B;  1F66 B;  5CPK B;  5AVB C;  3NQJ A;  4J8W C;  4LD9 C;  3LZ0 A;  3AZK C;  5B32 B;  1P3O D;  3W97 C;  3REH C;  3REL C;  4H9Q A;  5B2J D;  2F8N B;  3UTA A;  1P3G D;  3LZ1 B;  5B0Z B;  3TU4 A;  3REK A;  4JJN A;  4ZBJ C;  3UTB A;  5GT3 B;  1P3K D;  3MGQ D;  2NZD C;  3B6G A;  1P3F D;  3WA9 A;  4G92 B;  5BNX B;  5B0Y C;  5KDM B;  5CPI B;  1P3P D;  5CPJ D;  5BO0 A;  5B1M C;  5F99 C;  5B1L D;  4Z5T A;  3AV1 D;  1ID3 C;  1HQ3 A;  4H9O B;  4YM6 A;  3KXB C;  5CHL B;  3VH6 W;  3WTP B;  3MNN A;  3C1B A;  3KSY A;  3O62 C;  5B31 B;  3AV2 D;  1P34 D;  3VH5 A;  5B33 B;  3LZ0 C;  5AV5 D;  1KX5 A;  1N1J B;  3X1T A;  2YFV B;  3TU4 C;  1KX4 C;  3VH5 T;  4KUD B;  5JRG B;  3REK C;  4Z66 D;  4QLC D;  2ARO C;  3X1U C;  4JJN C;  5B2I C;  1P3L C;  1BFM A;  3AZG D;  1AOI D;  5AV6 A;  1M1A A;  3UTB C;  1ZLA D;  2HIO B;  4X23 A;  1S32 D;  3X1V D;  3X1S A;  1M19 B;  3WA9 C;  4J8U A;  3WTP E;  5BS7 A;  5GT0 B;  5FUG A;  2F8N H;  4H9N A;  5B40 B;  4YS3 C;  3AFA C;  5BNV B;  1BH9 B;  5CP6 B;  4Z5T C;  1HQ3 C;  4WU9 A;  4YM6 C;  3W98 A;  1F66 A;  3MGP D;  4NFT A;  5B24 B;  3AZE B;  3REJ A;  3MNN C;  5CPK A;  5AV8 C;  3AZL A;  3KUY D;  5B32 A;  3KWQ B;  3AN2 B;  3AZH A;  4G91 B;  1KX5 C;  2F8N A;  1P3M C;  5E5A B;  5B0Z A;  4AWL C;  1EQZ B;  5AVB D;  4J8W D;  4H9S C;  4LD9 D;  5GSU B;  2IO5 B;  3REI A;  5AV6 C;  3AZM A;  1M1A C;  3REH D;  3REL D;  3W97 D;  4X23 C;  4ZUX B;  5GXQ B;  3LJA C;  5BNX A;  3W99 B;  1TZY B;  1H3O B;  4J8U C;  4XUJ B;  3C1C A;  4WU9 C;  2FJ7 A;  1F66 C;  2NZD D;  5BT1 C;  2CV5 A;  3REJ C;  3NQU A;  5B0Y D;  3AZL C;  5B1M D;  4KHA B;  5G49 B;  5F99 D;  1P3O B;  3AZJ B;  3AZH C;  1ID3 D;  5B2J B;  3KXB D;  1P3G B;  3A6N A;  3AZI A;  2NQB B;  5B0Z C;  2YFV A;  4KUD A;  5JRG A;  3O62 D;  1KX3 B;  3B0B A;  5B32 G;  3LZ0 D;  2HIO A;  3REI C;  4XZQ C;  1P3B C;  3AZM C;  3AZN C;  3MVD A;  3WKJ B;  3MGQ B;  4R8P B;  5AV9 B;  4HGA B;  1M19 A;  1P3F B;  3W96 B;  1BH8 B;  3TU4 D;  1KX4 D;  5GT0 A;  3REK D;  5B40 A;  3X1U D;  4JJN D;  1P3L D;  5B2I D;  1P3P B;  5BNV A;  5B1L B;  5JA4 B;  3C1C C;  5CP6 A;  3UTB D;  4DRB A;  3LEL A;  3R45 B;  2FJ7 C;  2CV5 C;  3WA9 D;  3B0C W;  1P3A C;  3AV2 B;  1M18 B;  4KGC A;  1P34 B;  1B67 A;  4YS3 D;  3AFA D;  4Z2M G;  5AV5 B;  4Z5T D;  1HQ3 D;  4YM6 D;  5E5A A;  3A6N C;  3AZI C;  1EQZ A;  5B31 G;  1P3I A;  3MNN D;  3C1B D;  5JRG C;  5AV8 D;  4QLC B;  3MGS A;  3AZF C;  5GSU A;  3AZG B;  5AY8 B;  1ZLA B;  2CWE A;  1KX5 D;  5DNM A;  4ZUX A;  3MVD C;  1P3M D;  5GXQ A;  2BYK B;  3MGR A;  3W99 A;  1H3O A;  4XUJ A;  4J8V C;  5AV6 D;  1M1A D;  4UUZ A;  5CP6 C;  4X23 D;  3B0D B;  3LEL C;  3MGP B;  3LJA D;  1B6W A;  3AYW A;  4H9P A;  4J8U D;  4KGC C;  3KUY B;  3UTA C;  3V9R B;  3AZJ A;  4WU8 B;  4J8X A;  4WU9 D;  5DNN B;  5E5A C;  2NQB A;  1F66 D;  5BT1 D;  1P3I C;  3REJ D;  1KX3 A;  4J8W B;  2PYO B;  3AZL D;  3MGS C;  5GSU C;  2IO5 C;  3AZK B;  3B6G C;  3W97 B;  3REH B;  3REL B;  3AZH D;  3WKJ A;  3MGQ A;  5DNM C;  2BYM B;  4R8P A;  5AV9 A;  5GXQ C;  3W96 A;  5B0Z D;  1BH8 A;  3MGR C;  3WAA B;  2YFW B;  4ZBJ B;  4XUJ C;  5AVC A;  3REI D;  4XZQ D;  1P3B D;  3AZM D;  3AZN D;  3C1B C;  2NZD B;  3AYW C;  1M18 A;  5B0Y B;  3LZ1 A;  5B1M B;  4NE5 A;  5AV5 A;  3C1C D;  1ID3 B;  3X1T C;  4EO5 C;  4Z2M H;  4J8X C;  2NQB C;  2FJ7 D;  1U35 B;  4NE3 A;  5GT3 A;  3O62 B;  2CV5 D;  1P3A D;  1WWS A;  4H9R B;  1KX3 C;  3NQJ B;  5AY8 A;  4E45 A;  3LZ0 B;  4DRA A;  3X1S C;  1KU5 A;  5KDM A;  5CPI A;  1F1E A;  4R8P C;  5BS7 C;  2BYK A;  3A6N D;  4HGA C;  3AZI D;  3TU4 B;  4H9O A;  1KX4 B;  5JRG D;  3REK B;  3B6F B;  1HTA A;  3X1U B;  2ARO B;  3UT9 B;  5B2I B;  5AVC C;  3AZF D;  1P3L B;  3W98 C;  3WTP A;  5B31 A;  2HIO D;  5CPK C;  5B33 A;  1TAF B;  3MVD D;  5B32 C;  3WA9 B;  1N1J A;  3LZ1 C;  4YS3 B;  3AFA B;  4J8V D;  4CAY B;  5CP6 D;  4Z5T B;  4WU8 A;  1HQ3 B;  5DNN A;  4YM6 B;  3LEL D; 
#chains in the Genus database with same CATH topology
 2RVQ D;  2JSS A;  5GT3 C;  5AV8 B;  2PYO A;  1P3K B;  3AZK A;  4KGC D;  3UTA D;  3W97 A;  3REH A;  4G92 C;  1KX5 B;  1P3M B;  5CPI C;  5E5A D;  5CPJ B;  4AWL B;  2ZY2 A;  1Z2C B;  1BH9 A;  3AV1 B;  1P3I D;  3WAA A;  3EPL A;  3MGS D;  5B24 A;  5GSU D;  3AZE A;  3WTP C;  3B0C T;  5AV6 B;  3B6G D;  5B31 C;  4X23 B;  5DNM D;  1JFI B;  3KWQ A;  5B33 C;  2VQR A;  5GXQ D;  3AN2 A;  3LJA B;  4WV4 B;  3MGR D;  5B0Y A;  4J8U B;  5B1M A;  4XUJ D;  5FUG B;  4H9N B;  4KUD C;  4WU8 C;  4Z66 B;  4WU9 B;  5DNN C;  1U35 A;  1AOI B;  3O62 A;  3VH6 A;  3REJ B;  3AYW D;  2HIO C;  4H9R A;  2PYO C;  1S32 B;  3AZL B;  5C3I B;  4WZS B;  3X1V B;  1M19 C;  3AZJ D;  1TZY A;  3X1T D;  3AZH B;  5GT0 C;  4J8X D;  2HUE B;  2NQB D;  3VH6 T;  5B40 C;  1KX4 A;  4NE6 A;  3B6F A;  3WAA C;  2ARO A;  3X1U A;  3UT9 A;  5B2I A;  1P3L A;  1KX3 D;  5B24 C;  3REI B;  4XZQ B;  3X1S D;  3AZE C;  2RVQ C;  3AZN B;  3AZM B;  1P3B B;  1TAF A;  3WKJ D;  4R8P D;  3KWQ C;  4KHA A;  5G49 A;  5AV9 D;  3AN2 C;  1P3O A;  3W96 D;  5B2J A;  4G91 C;  2L5A A;  1P3G A;  4YS3 A;  5AVC D;  3AFA A;  4CAY A;  3W98 D;  3C1C B;  1EQZ C;  5CPK D;  4CSR B;  5AVB B;  4LD9 B;  2FJ7 B;  5B32 D;  1U35 C;  2CV5 B;  5AV8 A;  1P3A B;  3NQU B;  1M18 D;  1P3K A;  2F8N D;  1R4V A;  4ZUX C;  3LZ1 D;  1P3F A;  3W99 C;  2J8P A;  1TZY C;  1P3M A;  1P3P A;  5CPJ A;  3A6N B;  3AZI B;  5B1L A;  5JA4 A;  3AV1 A;  1A7W A;  4WNN B;  1WWI A;  5GT3 D;  3B6F C;  4H9S A;  3VH5 W;  3UT9 C;  3AZF B;  2Y2M A;  3R45 A;  5AY8 D;  4E44 A;  3AV2 A;  1P34 A;  3MVD B;  1JFI A;  5CPI D;  3LJA A;  1P3O C;  5F99 B;  3H0L C;  3AZJ C;  5B2J C;  3KXB B;  1P3G C;  4J8V B;  3WTP D;  5B31 D;  4Z66 A;  4QLC A;  5B33 D;  3LEL B;  3AZG A;  1AOI A;  1ZLA A;  2LY8 A;  3H0R C;  1S32 A;  4H9Q B;  2G5I C;  3WKJ C;  1P3K C;  3X1V A;  3MGQ C;  3UTA B;  4KGC B;  5AV9 C;  3W96 C;  1P3F C;  4KUD D;  4WU8 D;  5DNN D;  4JJN B;  5CPJ C;  1P3P C;  5B1L C;  3UTB B;  3AV1 C;  1P3I B;  2JCH A;  2PYO D;  1T3U A;  4M6B A;  3MGP A;  3IP4 C;  3MGS B;  3AZK D;  4XZQ A;  1P3B A;  3AZN A;  3B6G B;  1M19 D;  1PZR A;  3AV2 C;  1M18 C;  5DNM B;  5GT0 D;  3KUY A;  1P34 C;  5B40 D;  5BO0 B;  3V9R A;  5AV5 C;  3MGR B;  2F8N K;  3WAA D;  5B24 D;  3AZE D;  4CSR A;  3MNN B;  2Y2K A;  5AVB A;  4UUZ B;  3C1B B;  4J8W A;  4Z66 C;  4LD9 A;  4QLC C;  3F6T A;  3KWQ D;  3AZG C;  5AY8 C;  3AN2 D;  1AOI C;  1ZLA C;  1P3A A;  3REL A;  3AYW B;  4H9P B;  2BYM A;  1S32 C;  5C3I C;  3X1V C;  1EQZ D;  1Q9C A;  3X1T B;  2YFW A;  4EO5 B;  4J8X B;  2HUE C;  4WNN A;  1U35 D;  1M1A B;  3AZF A;  4ZUX D;  3B0D C;  2NZD A;  3MGP C;  3X1S B;  2F8N G;  3W99 D;  1TZY D;  3KUY C;  5F99 A;  1ID3 A;  3KXB A;  1ULY A;  3B6F D;  2ARO D;  3UT9 D;  5AVC B;  4J8V A;  3W98 B;  1F66 B;  2XD1 A;  5CPK B;  5AVB C;  3NQJ A;  4J8W C;  2Y2P A;  4LD9 C;  3LZ0 A;  3AZK C;  5B32 B;  1P3O D;  3W97 C;  3REH C;  3REL C;  4H9Q A;  5B2J D;  2DF4 C;  2F8N B;  3UTA A;  1P3G D;  3LZ1 B;  5B0Z B;  3TU4 A;  3REK A;  4JJN A;  4ZBJ C;  3UTB A;  3H0M C;  5GT3 B;  1P3K D;  3MGQ D;  2NZD C;  3B6G A;  1P3F D;  3WA9 A;  4G92 B;  5BNX B;  5B0Y C;  5KDM B;  3AL0 C;  5CPI B;  1P3P D;  5CPJ D;  5BO0 A;  5B1M C;  5F99 C;  5B1L D;  4Z5T A;  3AV1 D;  1ID3 C;  1HQ3 A;  4H9O B;  4YM6 A;  3KXB C;  2Y2G A;  5CHL B;  3VH6 W;  3WTP B;  3MNN A;  3C1B A;  3KSY A;  3O62 C;  5B31 B;  3AV2 D;  4WJ3 C;  1P34 D;  3VH5 A;  5B33 B;  3LZ0 C;  5AV5 D;  1KX5 A;  1N1J B;  3X1T A;  2YFV B;  3TU4 C;  1KX4 C;  3VH5 T;  4KUD B;  5JRG B;  3REK C;  4Z66 D;  4QLC D;  2ARO C;  3X1U C;  4JJN C;  5B2I C;  1P3L C;  1BFM A;  3AZG D;  1AOI D;  5AV6 A;  1M1A A;  3UTB C;  1ZLA D;  2HIO B;  4X23 A;  3A1K A;  1S32 D;  3X1V D;  2Y2L A;  3X1S A;  1M19 B;  3WA9 C;  4J8U A;  3WTP E;  5BS7 A;  5GT0 B;  5FUG A;  2F8N H;  4H9N A;  5B40 B;  4YS3 C;  3AFA C;  5BNV B;  1BH9 B;  5CP6 B;  4Z5T C;  1HQ3 C;  4WU9 A;  4YM6 C;  3W98 A;  1F66 A;  3MGP D;  4NFT A;  5B24 B;  3AZE B;  3REJ A;  3MNN C;  5CPK A;  2Y2J A;  5AV8 C;  3AZL A;  3KUY D;  5B32 A;  3KWQ B;  3AN2 B;  3AZH A;  4G91 B;  1KX5 C;  2F8N A;  1P3M C;  5E5A B;  5B0Z A;  4AWL C;  1EQZ B;  5AVB D;  4J8W D;  4H9S C;  4LD9 D;  3EPJ A;  5GSU B;  2FFF B;  2IO5 B;  3P5J B;  3REI A;  5AV6 C;  3AZM A;  1M1A C;  3REH D;  3REL D;  3W97 D;  4X23 C;  4ZUX B;  5GXQ B;  3LJA C;  5BNX A;  3W99 B;  1TZY B;  1H3O B;  4J8U C;  4XUJ B;  3C1C A;  4WU9 C;  2FJ7 A;  1F66 C;  2NZD D;  5BT1 C;  2CV5 A;  3REJ C;  3NQU A;  5B0Y D;  3AZL C;  5B1M D;  4KHA B;  5G49 B;  5F99 D;  1P3O B;  3AZJ B;  3AZH C;  1ID3 D;  5B2J B;  3KXB D;  2Y2I A;  1P3G B;  3A6N A;  3AZI A;  3KFU G;  2NQB B;  5B0Z C;  2YFV A;  4KUD A;  2XD5 A;  5JRG A;  3O62 D;  2BG1 A;  1KX3 B;  3B0B A;  5B32 G;  3LZ0 D;  2RIQ A;  2HIO A;  3REI C;  4XZQ C;  1P3B C;  3AZM C;  3AZN C;  3MVD A;  3WKJ B;  3MGQ B;  4R8P B;  5AV9 B;  4HGA B;  1M19 A;  1P3F B;  3W96 B;  1BH8 B;  3A1I A;  3TU4 D;  1KX4 D;  5GT0 A;  3REK D;  5B40 A;  3X1U D;  4JJN D;  1P3L D;  5B2I D;  1P3P B;  5BNV A;  5B1L B;  5JA4 B;  3C1C C;  5CP6 A;  3UTB D;  4DRB A;  3LEL A;  2DQN C;  3R45 B;  2FJ7 C;  3EPH A;  2CV5 C;  3WA9 D;  3B0C W;  1P3A C;  3AV2 B;  1M18 B;  4KGC A;  1P34 B;  1B67 A;  4YS3 D;  2UWX A;  3AFA D;  4Z2M G;  5AV5 B;  4Z5T D;  1HQ3 D;  5E5A A;  4YM6 D;  3A6N C;  3AZI C;  1EQZ A;  5B31 G;  1P3I A;  3MNN D;  3C1B D;  5JRG C;  5AV8 D;  2Y2O A;  4QLC B;  3MGS A;  3AZF C;  5GSU A;  3AZG B;  5AY8 B;  1ZLA B;  2CWE A;  1KX5 D;  5DNM A;  4ZUX A;  3MVD C;  1P3M D;  5GXQ A;  2BYK B;  3MGR A;  3W99 A;  2ZM5 A;  1H3O A;  4XUJ A;  3FDD A;  4J8V C;  5AV6 D;  1M1A D;  4UUZ A;  5CP6 C;  4X23 D;  3B0D B;  3LEL C;  3MGP B;  3LJA D;  1B6W A;  3AYW A;  4H9P A;  4J8U D;  3EPK A;  1W2E A;  3KUY B;  4KGC C;  3UTA C;  2ZY5 A;  3V9R B;  2G5H C;  3AZJ A;  4WU8 B;  4J8X A;  4WU9 D;  5DNN B;  5E5A C;  2NQB A;  2Y2H A;  1F66 D;  4DQY B;  5BT1 D;  1P3I C;  3REJ D;  1KX3 A;  4J8W B;  2PYO B;  3AZL D;  3MGS C;  5GSU C;  2IO5 C;  3AZK B;  3B6G C;  3W97 B;  3REH B;  3REL B;  3AZH D;  3WKJ A;  3MGQ A;  2JE5 A;  2BYM B;  5DNM C;  4R8P A;  2Y2Q A;  5AV9 A;  5GXQ C;  3W96 A;  5B0Z D;  1BH8 A;  3MGR C;  3WAA B;  2YFW B;  4ZBJ B;  4XUJ C;  5AVC A;  3REI D;  4XZQ D;  1P3B D;  3AZM D;  3AZN D;  3C1B C;  2NZD B;  3AYW C;  1M18 A;  5B0Y B;  3LZ1 A;  5B1M B;  4NE5 A;  5AV5 A;  3C1C D;  1ID3 B;  3X1T C;  4EO5 C;  4Z2M H;  4J8X C;  2NQB C;  2Y2N A;  2FJ7 D;  1U35 B;  2ZY3 A;  4NE3 A;  5GT3 A;  3O62 B;  2CV5 D;  1P3A D;  1WWS A;  4H9R B;  1KX3 C;  3NQJ B;  5AY8 A;  4E45 A;  3LZ0 B;  4DRA A;  3X1S C;  1KU5 A;  5KDM A;  5CPI A;  1F1E A;  4UPK A;  4R8P C;  2BYK A;  5BS7 C;  4HGA C;  3A6N D;  3AZI D;  3TU4 B;  4H9O A;  1KX4 B;  5JRG D;  3REK B;  3B6F B;  1HTA A;  2ARO B;  3X1U B;  3UT9 B;  5B2I B;  5AVC C;  3AZF D;  1P3L B;  3W98 C;  3WTP A;  2ZY4 A;  5B31 A;  2HIO D;  5CPK C;  5B33 A;  1TAF B;  2F2A C;  3MVD D;  5B32 C;  3WA9 B;  1N1J A;  3LZ1 C;  4YS3 B;  3AFA B;  4J8V D;  4CAY B;  5CP6 D;  4Z5T B;  4WU8 A;  1HQ3 B;  5DNN A;  4YM6 B;  3EG5 B;  2W8S A;  3LEL D; 
#chains in the Genus database with same CATH homology
 2RVQ D;  2JSS A;  5GT3 C;  5AV8 B;  2PYO A;  1P3K B;  3AZK A;  4KGC D;  3UTA D;  3W97 A;  3REH A;  4G92 C;  1KX5 B;  1P3M B;  5CPI C;  5E5A D;  5CPJ B;  4AWL B;  2ZY2 A;  1Z2C B;  1BH9 A;  3AV1 B;  1P3I D;  3WAA A;  3EPL A;  3MGS D;  5B24 A;  5GSU D;  3AZE A;  3WTP C;  3B0C T;  5AV6 B;  3B6G D;  5B31 C;  4X23 B;  5DNM D;  1JFI B;  3KWQ A;  5B33 C;  2VQR A;  5GXQ D;  3AN2 A;  3LJA B;  4WV4 B;  3MGR D;  5B0Y A;  4J8U B;  5B1M A;  4XUJ D;  5FUG B;  4H9N B;  4KUD C;  4WU8 C;  4Z66 B;  4WU9 B;  5DNN C;  1U35 A;  1AOI B;  3O62 A;  3VH6 A;  3REJ B;  3AYW D;  2HIO C;  4H9R A;  2PYO C;  1S32 B;  3AZL B;  5C3I B;  4WZS B;  3X1V B;  1M19 C;  3AZJ D;  1TZY A;  3X1T D;  3AZH B;  5GT0 C;  4J8X D;  2HUE B;  2NQB D;  3VH6 T;  5B40 C;  1KX4 A;  4NE6 A;  3B6F A;  3WAA C;  2ARO A;  3X1U A;  3UT9 A;  5B2I A;  1P3L A;  1KX3 D;  5B24 C;  3REI B;  4XZQ B;  3X1S D;  3AZE C;  2RVQ C;  3AZN B;  3AZM B;  1P3B B;  1TAF A;  3WKJ D;  4R8P D;  3KWQ C;  4KHA A;  5G49 A;  5AV9 D;  3AN2 C;  1P3O A;  3W96 D;  5B2J A;  4G91 C;  2L5A A;  1P3G A;  4YS3 A;  5AVC D;  3AFA A;  4CAY A;  3W98 D;  3C1C B;  1EQZ C;  5CPK D;  4CSR B;  5AVB B;  4LD9 B;  2FJ7 B;  5B32 D;  1U35 C;  2CV5 B;  5AV8 A;  1P3A B;  3NQU B;  1M18 D;  1P3K A;  2F8N D;  1R4V A;  4ZUX C;  3LZ1 D;  1P3F A;  3W99 C;  2J8P A;  1TZY C;  1P3M A;  1P3P A;  5CPJ A;  3A6N B;  3AZI B;  5B1L A;  5JA4 A;  3AV1 A;  1A7W A;  4WNN B;  1WWI A;  5GT3 D;  3B6F C;  4H9S A;  3VH5 W;  3UT9 C;  3AZF B;  2Y2M A;  3R45 A;  5AY8 D;  4E44 A;  3AV2 A;  1P34 A;  3MVD B;  1JFI A;  5CPI D;  3LJA A;  1P3O C;  5F99 B;  3H0L C;  3AZJ C;  5B2J C;  3KXB B;  1P3G C;  4J8V B;  3WTP D;  5B31 D;  4Z66 A;  4QLC A;  5B33 D;  3LEL B;  3AZG A;  1AOI A;  1ZLA A;  2LY8 A;  3H0R C;  1S32 A;  4H9Q B;  2G5I C;  3WKJ C;  1P3K C;  3X1V A;  3MGQ C;  3UTA B;  4KGC B;  5AV9 C;  3W96 C;  1P3F C;  4KUD D;  4WU8 D;  5DNN D;  4JJN B;  5CPJ C;  1P3P C;  5B1L C;  3UTB B;  3AV1 C;  1P3I B;  2JCH A;  2PYO D;  1T3U A;  4M6B A;  3MGP A;  3IP4 C;  3MGS B;  3AZK D;  4XZQ A;  1P3B A;  3AZN A;  3B6G B;  1M19 D;  1PZR A;  3AV2 C;  1M18 C;  5DNM B;  5GT0 D;  3KUY A;  1P34 C;  5B40 D;  5BO0 B;  3V9R A;  5AV5 C;  3MGR B;  2F8N K;  3WAA D;  5B24 D;  3AZE D;  4CSR A;  3MNN B;  2Y2K A;  5AVB A;  4UUZ B;  3C1B B;  4J8W A;  4Z66 C;  4LD9 A;  4QLC C;  3F6T A;  3KWQ D;  3AZG C;  5AY8 C;  3AN2 D;  1AOI C;  1ZLA C;  1P3A A;  3REL A;  3AYW B;  4H9P B;  2BYM A;  1S32 C;  5C3I C;  3X1V C;  1EQZ D;  1Q9C A;  3X1T B;  2YFW A;  4EO5 B;  4J8X B;  2HUE C;  4WNN A;  1U35 D;  1M1A B;  3AZF A;  4ZUX D;  3B0D C;  2NZD A;  3MGP C;  3X1S B;  2F8N G;  3W99 D;  1TZY D;  3KUY C;  5F99 A;  1ID3 A;  3KXB A;  1ULY A;  3B6F D;  2ARO D;  3UT9 D;  5AVC B;  4J8V A;  3W98 B;  1F66 B;  2XD1 A;  5CPK B;  5AVB C;  3NQJ A;  4J8W C;  2Y2P A;  4LD9 C;  3LZ0 A;  3AZK C;  5B32 B;  1P3O D;  3W97 C;  3REH C;  3REL C;  4H9Q A;  5B2J D;  2DF4 C;  2F8N B;  3UTA A;  1P3G D;  3LZ1 B;  5B0Z B;  3TU4 A;  3REK A;  4JJN A;  4ZBJ C;  3UTB A;  3H0M C;  5GT3 B;  1P3K D;  3MGQ D;  2NZD C;  3B6G A;  1P3F D;  3WA9 A;  4G92 B;  5BNX B;  5B0Y C;  5KDM B;  3AL0 C;  5CPI B;  1P3P D;  5CPJ D;  5BO0 A;  5B1M C;  5F99 C;  5B1L D;  4Z5T A;  3AV1 D;  1ID3 C;  1HQ3 A;  4H9O B;  4YM6 A;  3KXB C;  2Y2G A;  5CHL B;  3VH6 W;  3WTP B;  3MNN A;  3C1B A;  3KSY A;  3O62 C;  5B31 B;  3AV2 D;  4WJ3 C;  1P34 D;  3VH5 A;  5B33 B;  3LZ0 C;  5AV5 D;  1KX5 A;  1N1J B;  3X1T A;  2YFV B;  3TU4 C;  1KX4 C;  3VH5 T;  4KUD B;  5JRG B;  3REK C;  4Z66 D;  4QLC D;  2ARO C;  3X1U C;  4JJN C;  5B2I C;  1P3L C;  1BFM A;  3AZG D;  1AOI D;  5AV6 A;  1M1A A;  3UTB C;  1ZLA D;  2HIO B;  4X23 A;  3A1K A;  1S32 D;  3X1V D;  2Y2L A;  3X1S A;  1M19 B;  3WA9 C;  4J8U A;  3WTP E;  5BS7 A;  5GT0 B;  5FUG A;  2F8N H;  4H9N A;  5B40 B;  4YS3 C;  3AFA C;  5BNV B;  1BH9 B;  5CP6 B;  4Z5T C;  1HQ3 C;  4WU9 A;  4YM6 C;  3W98 A;  1F66 A;  3MGP D;  4NFT A;  5B24 B;  3AZE B;  3REJ A;  3MNN C;  5CPK A;  2Y2J A;  5AV8 C;  3AZL A;  3KUY D;  5B32 A;  3KWQ B;  3AN2 B;  3AZH A;  4G91 B;  1KX5 C;  2F8N A;  1P3M C;  5E5A B;  5B0Z A;  4AWL C;  1EQZ B;  5AVB D;  4J8W D;  4H9S C;  4LD9 D;  3EPJ A;  5GSU B;  2FFF B;  2IO5 B;  3P5J B;  3REI A;  5AV6 C;  3AZM A;  1M1A C;  3REH D;  3REL D;  3W97 D;  4X23 C;  4ZUX B;  5GXQ B;  3LJA C;  5BNX A;  3W99 B;  1TZY B;  1H3O B;  4J8U C;  4XUJ B;  3C1C A;  4WU9 C;  2FJ7 A;  1F66 C;  2NZD D;  5BT1 C;  2CV5 A;  3REJ C;  3NQU A;  5B0Y D;  3AZL C;  5B1M D;  4KHA B;  5G49 B;  5F99 D;  1P3O B;  3AZJ B;  3AZH C;  1ID3 D;  5B2J B;  3KXB D;  2Y2I A;  1P3G B;  3A6N A;  3AZI A;  3KFU G;  2NQB B;  5B0Z C;  2YFV A;  4KUD A;  2XD5 A;  5JRG A;  3O62 D;  2BG1 A;  1KX3 B;  3B0B A;  5B32 G;  3LZ0 D;  2RIQ A;  2HIO A;  3REI C;  4XZQ C;  1P3B C;  3AZM C;  3AZN C;  3MVD A;  3WKJ B;  3MGQ B;  4R8P B;  5AV9 B;  4HGA B;  1M19 A;  1P3F B;  3W96 B;  1BH8 B;  3A1I A;  3TU4 D;  1KX4 D;  5GT0 A;  3REK D;  5B40 A;  3X1U D;  4JJN D;  1P3L D;  5B2I D;  1P3P B;  5BNV A;  5B1L B;  5JA4 B;  3C1C C;  5CP6 A;  3UTB D;  4DRB A;  3LEL A;  2DQN C;  3R45 B;  2FJ7 C;  3EPH A;  2CV5 C;  3WA9 D;  3B0C W;  1P3A C;  3AV2 B;  1M18 B;  4KGC A;  1P34 B;  1B67 A;  4YS3 D;  2UWX A;  3AFA D;  4Z2M G;  5AV5 B;  4Z5T D;  1HQ3 D;  5E5A A;  4YM6 D;  3A6N C;  3AZI C;  1EQZ A;  5B31 G;  1P3I A;  3MNN D;  3C1B D;  5JRG C;  5AV8 D;  2Y2O A;  4QLC B;  3MGS A;  3AZF C;  5GSU A;  3AZG B;  5AY8 B;  1ZLA B;  2CWE A;  1KX5 D;  5DNM A;  4ZUX A;  3MVD C;  1P3M D;  5GXQ A;  2BYK B;  3MGR A;  3W99 A;  2ZM5 A;  1H3O A;  4XUJ A;  3FDD A;  4J8V C;  5AV6 D;  1M1A D;  4UUZ A;  5CP6 C;  4X23 D;  3B0D B;  3LEL C;  3MGP B;  3LJA D;  1B6W A;  3AYW A;  4H9P A;  4J8U D;  3EPK A;  1W2E A;  3KUY B;  4KGC C;  3UTA C;  2ZY5 A;  3V9R B;  2G5H C;  3AZJ A;  4WU8 B;  4J8X A;  4WU9 D;  5DNN B;  5E5A C;  2NQB A;  2Y2H A;  1F66 D;  4DQY B;  5BT1 D;  1P3I C;  3REJ D;  1KX3 A;  4J8W B;  2PYO B;  3AZL D;  3MGS C;  5GSU C;  2IO5 C;  3AZK B;  3B6G C;  3W97 B;  3REH B;  3REL B;  3AZH D;  3WKJ A;  3MGQ A;  2JE5 A;  2BYM B;  5DNM C;  4R8P A;  2Y2Q A;  5AV9 A;  5GXQ C;  3W96 A;  5B0Z D;  1BH8 A;  3MGR C;  3WAA B;  2YFW B;  4ZBJ B;  4XUJ C;  5AVC A;  3REI D;  4XZQ D;  1P3B D;  3AZM D;  3AZN D;  3C1B C;  2NZD B;  3AYW C;  1M18 A;  5B0Y B;  3LZ1 A;  5B1M B;  4NE5 A;  5AV5 A;  3C1C D;  1ID3 B;  3X1T C;  4EO5 C;  4Z2M H;  4J8X C;  2NQB C;  2Y2N A;  2FJ7 D;  1U35 B;  2ZY3 A;  4NE3 A;  5GT3 A;  3O62 B;  2CV5 D;  1P3A D;  1WWS A;  4H9R B;  1KX3 C;  3NQJ B;  5AY8 A;  4E45 A;  3LZ0 B;  4DRA A;  3X1S C;  1KU5 A;  5KDM A;  5CPI A;  1F1E A;  4UPK A;  4R8P C;  2BYK A;  5BS7 C;  4HGA C;  3A6N D;  3AZI D;  3TU4 B;  4H9O A;  1KX4 B;  5JRG D;  3REK B;  3B6F B;  1HTA A;  2ARO B;  3X1U B;  3UT9 B;  5B2I B;  5AVC C;  3AZF D;  1P3L B;  3W98 C;  3WTP A;  2ZY4 A;  5B31 A;  2HIO D;  5CPK C;  5B33 A;  1TAF B;  2F2A C;  3MVD D;  5B32 C;  3WA9 B;  1N1J A;  3LZ1 C;  4YS3 B;  3AFA B;  4J8V D;  4CAY B;  5CP6 D;  4Z5T B;  4WU8 A;  1HQ3 B;  5DNN A;  4YM6 B;  3EG5 B;  2W8S A;  3LEL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...