3B6GC

Nucleosome core particle treated with oxaliplatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gC00
5AV9A 1P3LB 3KXBA 3LJAA 1P3FB 3RELC 3WA9B 1P3KC 2F8ND 2HUEB 5AVBC 5DNNC 1P3BB 3AZJA 3AV2B 4G91B 5CPJA 5B32G 2CV5D 4J8UD 5B1LD 1M18C 5B32C 3B0CT 3REJA 3AZFB 4XUJC 5AV9D 3MNNB 3LZ1A 4UUZB 5BNVB 3KXBD 5BT1D 4R8PD 4H9NA 3O62B 3LJAD 1F66A 2PYOA 5BNXB 3VH6T 3VH5T 5KDMB 3X1VC 1P3OB 3AZJD 1KX4B 5CPJD 3VH5W 2CV5B 4J8UB 3WA9C 3KUYA 1U35C 4Z66C 5GT0B 3AFAA 3AZGB 3REJD 1B67A 1P34A 4DRAA 4H9OB 2NQBA 3LZ1D 5E5AA 4J8VD 5GSUB 4R8PB 1M19B 3AZHC 1F66D 3REKA 2PYOD 4XZQB 4G92C 2NZDA 2F8NG 5BS7A 1BH9A 4H9QA 3B6GB 3AFAD 3X1UB 3B6FA 4J8UC 5B1LC 3LZ1B 3LELB 4WU9C 2NQBD 4WU8B 4J8VB 5E5AD 1EQZA 3REHA 2BYKA 5DNMA 3REKD 5AV9C 5JRGA 4DRBA 3MGQB 2HIOA 2LY8A 5BT1C 3KXBC 3X1SA 3LJAC 3W96B 2NZDD 5AV5A 1KX5A 3UT9A 3KWQA 3AZJC 3TU4B 5B0YA 5CPJC 1P3GC 3B6FD 5CP6A 4KUDA 1N1JA 5B1MB 1EQZD 3REJC 3REHD 3AYWA 4NE6A 3W97A 5DNMD 5B2JB 3LZ1C 3NQJA 5JRGD 2HIOD 3AZMA 3X1SD 1F66C 1TZYA 5AV5D 4J8WB 1KX5D 3UT9D 3MGSB 2PYOC 1P3LA 3KWQD 5B0YD 1P3FA 2YFWB 3MGRD 5BO0B 5CP6D 4KUDD 3KUYC 3AFAC 1P3BA 3AYWD 2IO5C 1P34C 5DNMB 3AV2A 3W97D 5G49B 2NQBC 5E5AC 2HIOB 1KX3B 3AZMD 1WWSA 1TZYD 3REKC 1KX5B 3AZFA 4CSRB 3WTPE 3MNNA 5GT3A 4UUZA 1P3LD 2NZDC 5B0YB 1P3FD 5BS7C 3O62A 3MGRB 3B0DB 1BH8B 1P3OA 5FUGB 1P3BD 3W97B 3B6FC 3AV2D 1KX4A 4ZUXD 2CV5A 1P3MD 1A7WA 5AVCB 1EQZC 3REHC 5F99A 5GT0A 1TZYB 1HTAA 3AZGA 5DNMC 3AZFD 3AZNB 5JRGC 3MNND 5GT3D 2HIOC 3X1SC 5GSUA 4R8PA 5AV5C 3MGPC 3O62D 3UT9C 1KX5C 1M19A 4XZQA 3KWQC 1P3OD 5B0YC 4KGCB 3AN2B 1KX4D 4ZUXB 5CP6C 1P3MB 4KUDC 5F99D 5GT0D 3AYWC 4NE3A 3B6GA 3REIB 3AZGD 3W97C 4Z5TA 3AV1B 3X1UA 5CPKB 4H9RB 4QLCA 5GT3B 3LELA 3AZMC 3B0CW 5C3IB 4WU8A 3WTPA 4J8VA 1M1AB 4ZBJB 5GSUD 1TZYC 1JFIB 1P3IB 4HGAC 1M19D 1P3AB 4XZQD 1P3LC 3MGQA 1ZLAA 3KSYA 1P3FC 3W96A 3VH6W 1P3PA 2FJ7B 4EO5B 2YFVB 5F99B 2HUEC 4JJND 1P3BC 3B6GD 1HQ3B 3TU4A 3AV2C 5B31B 4Z5TD 4G91C 3X1UD 4LD9B 4QLCD 3LELD 1TAFB 4WU8D 3WTPD 5B1MA 3C1CB 3AZFC 3MNNC 5B2JA 5GT3C 3MGQD 1ZLAD 3O62C 3W96D 5JA4B 4J8WA 1P3PD 3MGSA 4JJNB 1P3OC 3WKJB 3MVDA 3TU4D 4Z5TB 1KX4C 5AV8B 2CV5C 2YFWA 2CWEA 5BO0A 4QLCB 3A6NB 1R4VA 3WTPB 5GT0C 5AV6B 5B1MD 3AZGC 3WAAB 3W99A 2F8NH 5B24B 5G49A 5B2JD 4J8XB 1ZLAB 4R8PC 5GSUC 1KX3A 1M19C 1P3PB 3C1BA 4J8WD 4XZQC 3MGSD 4CSRA 3MVDD 4YM6A 1S32B 4CAYA 3R45B 3MGRA 5B0ZA 1BH8A 3B6GC 5FUGA 2BYMB 3W99D 3X1UC 4QLCC 3LELC 4KHAB 3UTBB 3AZKB 5AVCA 3WTPC 4J8VC 4WU8C 3B0BA 1KX3D 4AWLB 3C1BD 3AZNA 3MGQC 3MVDB 3W96C 5B33A 3AZIA 4YM6D 1P3PC 1AOIB 5B0ZD 3TU4C 3W99B 3X1TD 4KGCA 3AN2A 4ZUXA 1P3MA 5AVCD 5B1MC 1H3OB 5AY8A 3C1BB 3REIA 5GXQB 3AZLA 3AV1A 5CPKA 5B2JC 4H9RA 3AZND 4E44A 5B33D 4YM6B 3AZID 4CAYB 5CPIB 1M1AA 1JFIA 4AWLC 4J8WC 1B6WA 5B0ZB 1P3IA 3MGSC 1P3AA 1ID3A 3MVDC 2L5AA 3X1TB 4Z66A 4KGCD 3AN2D 2FJ7A 3W98B 4YS3A 2YFVA 3W99C 1HQ3A 5AY8D 3REID 4WV4B 5B31A 3AZLD 3AV1D 5CPKD 4LD9A 3RELB 1KX3C 5B33B 1TAFA 3AZIB 1P3KB 1F1EA 1M1AD 3C1BC 5AVBB 3C1CA 5DNNB 1P3ID 1P3AD 1ID3D 5B40A 4WNNB 4X23A 4YM6C 2F8NK 1M18B 2RVQD 4Z66D 3MGRC 5JA4A 5B0ZC 3B0DC 2FJ7D 4YS3D 4XUJB 4JJNA 1ULYA 3WKJA 5AY8B 3AZLB 1HQ3D 5B31D 4LD9D 5AV8A 5CHLB 5AVCC 3A6NA 5AV6A 3X1VB 3C1CD 3WAAA 1ID3B 5B24A 3AZNC 4J8XA 5B40D 5B33C 4X23D 3AZIC 1U35B 4Z66B 4YS3B 1P3GA 4H9PA 4WU9D 3AZEA 3WKJD 4KGCC 4H9SA 3AN2C 1S32A 4ZUXC 3R45A 1P3MC 5AV8D 1KU5A 3AZHB 3A6ND 5AV6D 5AY8C 3REIC 4G92B 4M6BA 3AZLC 2BYMA 3AV1C 5CPKC 3WAAD 5B24D 3UTBA 4KHAA 5B40B 4J8XD 4WZSB 2AROA 5C3IC 4X23B 3AZKA 2F8NB 1M1AC 4ZBJC 1P3IC 1P3AC 1ID3C 1P3GD 5B1LB 4WU9B 3AZED 2RVQC 3UTAA 1S32D 2FJ7C 1AOIA 4EO5C 3NQUB 4YS3C 5B31G 5AV9B 5F99C 5B2IA 3LZ0A 1HQ3C 5B31C 3KXBB 3LJAB 4LD9C 4Z2MG 3VH6A 3VH5A 3UTBD 2AROD 3AZKD 3C1CC 1H3OA 3AZJB 5GXQA 5CPJB 1P3GB 5B40C 4H9PB 4X23C 3AZEB 3KUYD 5CPIA 3UTAD 3REJB 1AOID 4Z2MH 1P34D 4JJNC 3WKJC 5B2ID 3LZ0D 4Z5TC 3X1TA 4H9NB 5AV8C 1F66B 3W98A 3A6NC 2PYOB 2AROB 5AV6C 3WAAC 5B24C 5GXQD 3MGPA 4J8XC 3RELA 1ZLAC 3KUYB 3UTAB 5CPID 1P3KA 3AFAB 5AVBA 5DNNA 2IO5B 1P34B 2JSSA 2NQBB 5B2IB 3LZ0B 3AZEC 4WNNA 5E5AB 4H9SC 1S32C 1M18A 5B32A 3W98D 3REKB 3V9RA 4XUJA 1WWIA 2NZDB 3UTBC 3MGPD 1BH9B 4H9QB 2AROC 3RELD 3AZKC 1P3KD 4E45A 4NFTA 3X1VA 5AVBD 5DNND 3B6FB 4NE5A 3WA9A 3UTAC 1EQZB 1U35A 3REHB 5B32D 1M18D 1AOIC 2BYKB 4XUJD 5JRGB 5B2IC 3LZ0C 3X1SB 5AV5B 3MGPB 3UT9B 3AZHA 3KWQB 3X1VD 5GXQC 5BNVA 5CP6B 5BNXA 4KUDB 5CPIC 1N1JB 3WA9D 2F8NA 5B32B 1U35D 5KDMA 3AYWB 3V9RB 3NQJB 4J8UA 5B1LA 1Q9CA 4WU9A 1BFMA 3AZMB 3X1TC 3W98C 4HGAB 3NQUA 3AZHD 4H9OA
chains in the Genus database with same CATH superfamily
5AV9A 1P3LB 3KXBA 3LJAA 1P3FB 3F6TA 3RELC 2Y2NA 3WA9B 1P3KC 2F8ND 2HUEB 5AVBC 5DNNC 1P3BB 3AZJA 3AV2B 4G91B 2Y2MA 5B32G 5CPJA 2VQRA 2CV5D 4J8UD 5B1LD 2W8SA 1M18C 5B32C 3B0CT 3REJA 3AZFB 4XUJC 5AV9D 3MNNB 3LZ1A 4UUZB 1T3UA 5BNVB 3KXBD 5BT1D 4R8PD 4H9NA 3O62B 3LJAD 1F66A 2PYOA 5BNXB 3VH6T 3VH5T 5KDMB 3X1VC 1P3OB 3AZJD 1KX4B 5CPJD 3VH5W 2CV5B 2Y2QA 4J8UB 3WA9C 3KUYA 1U35C 4Z66C 5GT0B 3AFAA 3AZGB 3REJD 2G5IC 1B67A 1P34A 4DRAA 4H9OB 2NQBA 2ZY4A 3LZ1D 5E5AA 4J8VD 5GSUB 4R8PB 1M19B 3AZHC 1F66D 3REKA 2PYOD 4XZQB 4G92C 2Y2PA 2NZDA 2F8NG 5BS7A 1BH9A 4H9QA 3B6GB 3AFAD 3X1UB 3B6FA 4UPKA 4J8UC 5B1LC 3LZ1B 3LELB 4WU9C 2NQBD 4WU8B 2DQNC 5E5AD 4J8VB 1EQZA 3REHA 2BYKA 5DNMA 3REKD 5AV9C 4DRBA 5JRGA 3MGQB 2HIOA 2LY8A 5BT1C 3KXBC 3X1SA 3LJAC 3W96B 2NZDD 5AV5A 1KX5A 3UT9A 3KWQA 3AZJC 3TU4B 5B0YA 5CPJC 1P3GC 3B6FD 1PZRA 5CP6A 4KUDA 3H0MC 1N1JA 5B1MB 1EQZD 3REJC 3REHD 3AYWA 4NE6A 3W97A 5DNMD 5B2JB 3LZ1C 3NQJA 5JRGD 2HIOD 2ZM5A 3AZMA 3X1SD 1F66C 1TZYA 5AV5D 4J8WB 1KX5D 3UT9D 3MGSB 2PYOC 1P3LA 3KWQD 5B0YD 1P3FA 2YFWB 3MGRD 4DQYB 5BO0B 5CP6D 4KUDD 3KUYC 3AFAC 1P3BA 3AYWD 2IO5C 1P34C 5DNMB 3AV2A 3W97D 5G49B 2NQBC 5E5AC 2HIOB 1KX3B 3AZMD 1WWSA 2XD1A 1TZYD 3REKC 1KX5B 3AZFA 4CSRB 3WTPE 3MNNA 5GT3A 4UUZA 1P3LD 2NZDC 2Y2IA 5B0YB 1P3FD 5BS7C 3O62A 3MGRB 3B0DB 1BH8B 1P3OA 3H0RC 5FUGB 1P3BD 2Y2HA 3W97B 3B6FC 3AV2D 1KX4A 4ZUXD 2CV5A 1P3MD 1A7WA 5AVCB 1EQZC 3REHC 5F99A 5GT0A 1TZYB 1HTAA 3AZGA 5DNMC 3AZFD 3AZNB 5JRGC 3MNND 5GT3D 2HIOC 3X1SC 5GSUA 4R8PA 5AV5C 3MGPC 2ZY2A 3O62D 3UT9C 1KX5C 1M19A 4XZQA 3EPJA 3KWQC 1P3OD 5B0YC 4KGCB 2J8PA 3AN2B 1KX4D 4ZUXB 5CP6C 1P3MB 4KUDC 5F99D 5GT0D 3AYWC 4NE3A 3B6GA 3REIB 3AZGD 3W97C 4Z5TA 3AV1B 3X1UA 5CPKB 4H9RB 4QLCA 5GT3B 3LELA 3AZMC 3B0CW 5C3IB 4WU8A 3WTPA 4J8VA 2JCHA 4ZBJB 5GSUD 1TZYC 1M1AB 1P3IB 4HGAC 1JFIB 1M19D 1P3AB 4XZQD 1P3LC 3MGQA 1ZLAA 3KSYA 1P3FC 3W96A 3VH6W 1P3PA 2FJ7B 4EO5B 2YFVB 5F99B 2HUEC 4JJND 1P3BC 3B6GD 1HQ3B 3TU4A 3AV2C 3FDDA 4Z5TD 5B31B 4G91C 3X1UD 4LD9B 4QLCD 3LELD 2Y2JA 1TAFB 4WU8D 3WTPD 5B1MA 3C1CB 3AZFC 3MNNC 5B2JA 5GT3C 3IP4C 3MGQD 1ZLAD 3O62C 3W96D 5JA4B 4J8WA 1P3PD 3MGSA 4JJNB 2Y2OA 1P3OC 3WKJB 3MVDA 3TU4D 4Z5TB 1KX4C 3EPHA 5AV8B 2CV5C 2YFWA 2CWEA 5BO0A 4QLCB 3A6NB 1R4VA 3WTPB 5GT0C 5AV6B 5B1MD 3AZGC 3WAAB 3W99A 2F8NH 5B24B 5G49A 5B2JD 4J8XB 1ZLAB 4R8PC 5GSUC 1KX3A 1M19C 1P3PB 3C1BA 4J8WD 2ZY3A 4XZQC 3MGSD 4CSRA 3MVDD 4YM6A 1S32B 4CAYA 3R45B 3MGRA 5B0ZA 2F2AC 1BH8A 3B6GC 5FUGA 2BYMB 3W99D 3X1UC 4QLCC 3LELC 4KHAB 3UTBB 3AZKB 5AVCA 3WTPC 4J8VC 4WU8C 3B0BA 1KX3D 1W2EA 4AWLB 3C1BD 3AZNA 3MGQC 3MVDB 3W96C 5B33A 3AZIA 4YM6D 1P3PC 1AOIB 5B0ZD 3KFUG 3TU4C 3W99B 3X1TD 4KGCA 3AN2A 4ZUXA 1P3MA 5AVCD 5B1MC 1H3OB 5AY8A 3C1BB 3REIA 5GXQB 3AZLA 3AV1A 5CPKA 5B2JC 4H9RA 3AZND 4E44A 5B33D 4YM6B 3AZID 4CAYB 5CPIB 1M1AA 1JFIA 4AWLC 4J8WC 1B6WA 5B0ZB 1P3IA 3MGSC 1P3AA 1ID3A 2RIQA 3MVDC 2L5AA 3X1TB 4Z66A 4KGCD 3AN2D 2FJ7A 3W98B 3AL0C 4YS3A 2YFVA 3W99C 1HQ3A 5AY8D 3REID 4WV4B 5B31A 3AZLD 3AV1D 5CPKD 4LD9A 3RELB 1KX3C 5B33B 1TAFA 3AZIB 1P3KB 1F1EA 1M1AD 3C1BC 5AVBB 3C1CA 5DNNB 1P3ID 1P3AD 1ID3D 5B40A 4WNNB 4X23A 4YM6C 2F8NK 1M18B 2RVQD 4Z66D 3MGRC 5JA4A 5B0ZC 3B0DC 2FJ7D 4YS3D 4XUJB 4JJNA 1ULYA 3WKJA 5AY8B 3AZLB 1HQ3D 5B31D 4LD9D 2BG1A 5AV8A 5CHLB 5AVCC 3A6NA 5AV6A 3X1VB 3C1CD 2FFFB 3WAAA 1ID3B 5B24A 3AZNC 4J8XA 5B40D 5B33C 4X23D 3AZIC 1U35B 4Z66B 4YS3B 1P3GA 4H9PA 3A1KA 4WU9D 3AZEA 3WKJD 4KGCC 4H9SA 3AN2C 1S32A 4ZUXC 3R45A 1P3MC 5AV8D 1KU5A 3AZHB 3A6ND 3EG5B 5AV6D 5AY8C 3REIC 4G92B 4M6BA 3AZLC 2BYMA 3AV1C 5CPKC 3WAAD 5B24D 3UTBA 4KHAA 5B40B 4J8XD 2AROA 5C3IC 4WZSB 4X23B 3AZKA 2F8NB 1M1AC 4ZBJC 1P3IC 2XD5A 2JE5A 1P3AC 1ID3C 1P3GD 5B1LB 4WU9B 1Z2CB 3AZED 2RVQC 3UTAA 1S32D 2FJ7C 1AOIA 4EO5C 3NQUB 4YS3C 5B31G 5AV9B 5F99C 5B2IA 3LZ0A 1HQ3C 5B31C 3KXBB 3LJAB 4LD9C 4Z2MG 3VH6A 3VH5A 3UTBD 2AROD 3AZKD 3C1CC 1H3OA 3AZJB 5GXQA 2Y2GA 5CPJB 1P3GB 5B40C 2G5HC 4H9PB 4X23C 3AZEB 3KUYD 5CPIA 3UTAD 3REJB 3A1IA 1AOID 4Z2MH 1P34D 4JJNC 3WKJC 5B2ID 3LZ0D 4Z5TC 3X1TA 4H9NB 5AV8C 1F66B 2Y2LA 3A6NC 2PYOB 3W98A 2AROB 2ZY5A 2UWXA 3H0LC 5AV6C 3WAAC 5B24C 5GXQD 3MGPA 4J8XC 3RELA 3EPKA 1ZLAC 3KUYB 3UTAB 5CPID 1P3KA 3AFAB 5AVBA 5DNNA 2IO5B 1P34B 2JSSA 2NQBB 5B2IB 3LZ0B 3AZEC 4WNNA 5E5AB 4H9SC 1S32C 1M18A 5B32A 3W98D 3REKB 3V9RA 4XUJA 1WWIA 2NZDB 2Y2KA 3UTBC 3MGPD 1BH9B 4H9QB 2AROC 3RELD 3AZKC 3P5JB 1P3KD 4E45A 4NFTA 3X1VA 5AVBD 5DNND 3B6FB 4NE5A 3WA9A 3UTAC 1EQZB 1U35A 3REHB 5B32D 1M18D 1AOIC 2BYKB 2DF4C 4XUJD 5JRGB 5B2IC 3LZ0C 3X1SB 5AV5B 3MGPB 3EPLA 3UT9B 3AZHA 3KWQB 3X1VD 5GXQC 5BNVA 5CP6B 5BNXA 4KUDB 5CPIC 1N1JB 3WA9D 2F8NA 5B32B 1U35D 5KDMA 3AYWB 3V9RB 3NQJB 4J8UA 5B1LA 1Q9CA 4WU9A 1BFMA 3AZMB 3X1TC 4WJ3C 3W98C 4HGAB 3NQUA 3AZHD 4H9OA
chains in the Genus database with same CATH topology
5AV9A 1P3LB 3KXBA 3LJAA 1P3FB 3F6TA 3RELC 2Y2NA 3WA9B 1P3KC 2F8ND 2HUEB 5AVBC 5DNNC 1P3BB 3AZJA 3AV2B 4G91B 2Y2MA 5B32G 5CPJA 2VQRA 2CV5D 4J8UD 5B1LD 2W8SA 1M18C 5B32C 3B0CT 3REJA 3AZFB 4XUJC 5AV9D 3MNNB 3LZ1A 4UUZB 1T3UA 5BNVB 3KXBD 5BT1D 4R8PD 4H9NA 3O62B 3LJAD 1F66A 2PYOA 5BNXB 3VH6T 3VH5T 5KDMB 3X1VC 1P3OB 3AZJD 1KX4B 5CPJD 3VH5W 2CV5B 2Y2QA 4J8UB 3WA9C 3KUYA 1U35C 4Z66C 5GT0B 3AFAA 3AZGB 3REJD 2G5IC 1B67A 1P34A 4DRAA 4H9OB 2NQBA 2ZY4A 3LZ1D 5E5AA 4J8VD 5GSUB 4R8PB 1M19B 3AZHC 1F66D 3REKA 2PYOD 4XZQB 4G92C 2Y2PA 2NZDA 2F8NG 5BS7A 1BH9A 4H9QA 3B6GB 3AFAD 3X1UB 3B6FA 4UPKA 4J8UC 5B1LC 3LZ1B 3LELB 4WU9C 2NQBD 4WU8B 2DQNC 5E5AD 4J8VB 1EQZA 3REHA 2BYKA 5DNMA 3REKD 5AV9C 4DRBA 5JRGA 3MGQB 2HIOA 2LY8A 5BT1C 3KXBC 3X1SA 3LJAC 3W96B 2NZDD 5AV5A 1KX5A 3UT9A 3KWQA 3AZJC 3TU4B 5B0YA 5CPJC 1P3GC 3B6FD 1PZRA 5CP6A 4KUDA 3H0MC 1N1JA 5B1MB 1EQZD 3REJC 3REHD 3AYWA 4NE6A 3W97A 5DNMD 5B2JB 3LZ1C 3NQJA 5JRGD 2HIOD 2ZM5A 3AZMA 3X1SD 1F66C 1TZYA 5AV5D 4J8WB 1KX5D 3UT9D 3MGSB 2PYOC 1P3LA 3KWQD 5B0YD 1P3FA 2YFWB 3MGRD 4DQYB 5BO0B 5CP6D 4KUDD 3KUYC 3AFAC 1P3BA 3AYWD 2IO5C 1P34C 5DNMB 3AV2A 3W97D 5G49B 2NQBC 5E5AC 2HIOB 1KX3B 3AZMD 1WWSA 2XD1A 1TZYD 3REKC 1KX5B 3AZFA 4CSRB 3WTPE 3MNNA 5GT3A 4UUZA 1P3LD 2NZDC 2Y2IA 5B0YB 1P3FD 5BS7C 3O62A 3MGRB 3B0DB 1BH8B 1P3OA 3H0RC 5FUGB 1P3BD 2Y2HA 3W97B 3B6FC 3AV2D 1KX4A 4ZUXD 2CV5A 1P3MD 1A7WA 5AVCB 1EQZC 3REHC 5F99A 5GT0A 1TZYB 1HTAA 3AZGA 5DNMC 3AZFD 3AZNB 5JRGC 3MNND 5GT3D 2HIOC 3X1SC 5GSUA 4R8PA 5AV5C 3MGPC 2ZY2A 3O62D 3UT9C 1KX5C 1M19A 4XZQA 3EPJA 3KWQC 1P3OD 5B0YC 4KGCB 2J8PA 3AN2B 1KX4D 4ZUXB 5CP6C 1P3MB 4KUDC 5F99D 5GT0D 3AYWC 4NE3A 3B6GA 3REIB 3AZGD 3W97C 4Z5TA 3AV1B 3X1UA 5CPKB 4H9RB 4QLCA 5GT3B 3LELA 3AZMC 3B0CW 5C3IB 4WU8A 3WTPA 4J8VA 2JCHA 4ZBJB 5GSUD 1TZYC 1M1AB 1P3IB 4HGAC 1JFIB 1M19D 1P3AB 4XZQD 1P3LC 3MGQA 1ZLAA 3KSYA 1P3FC 3W96A 3VH6W 1P3PA 2FJ7B 4EO5B 2YFVB 5F99B 2HUEC 4JJND 1P3BC 3B6GD 1HQ3B 3TU4A 3AV2C 3FDDA 4Z5TD 5B31B 4G91C 3X1UD 4LD9B 4QLCD 3LELD 2Y2JA 1TAFB 4WU8D 3WTPD 5B1MA 3C1CB 3AZFC 3MNNC 5B2JA 5GT3C 3IP4C 3MGQD 1ZLAD 3O62C 3W96D 5JA4B 4J8WA 1P3PD 3MGSA 4JJNB 2Y2OA 1P3OC 3WKJB 3MVDA 3TU4D 4Z5TB 1KX4C 3EPHA 5AV8B 2CV5C 2YFWA 2CWEA 5BO0A 4QLCB 3A6NB 1R4VA 3WTPB 5GT0C 5AV6B 5B1MD 3AZGC 3WAAB 3W99A 2F8NH 5B24B 5G49A 5B2JD 4J8XB 1ZLAB 4R8PC 5GSUC 1KX3A 1M19C 1P3PB 3C1BA 4J8WD 2ZY3A 4XZQC 3MGSD 4CSRA 3MVDD 4YM6A 1S32B 4CAYA 3R45B 3MGRA 5B0ZA 2F2AC 1BH8A 3B6GC 5FUGA 2BYMB 3W99D 3X1UC 4QLCC 3LELC 4KHAB 3UTBB 3AZKB 5AVCA 3WTPC 4J8VC 4WU8C 3B0BA 1KX3D 1W2EA 4AWLB 3C1BD 3AZNA 3MGQC 3MVDB 3W96C 5B33A 3AZIA 4YM6D 1P3PC 1AOIB 5B0ZD 3KFUG 3TU4C 3W99B 3X1TD 4KGCA 3AN2A 4ZUXA 1P3MA 5AVCD 5B1MC 1H3OB 5AY8A 3C1BB 3REIA 5GXQB 3AZLA 3AV1A 5CPKA 5B2JC 4H9RA 3AZND 4E44A 5B33D 4YM6B 3AZID 4CAYB 5CPIB 1M1AA 1JFIA 4AWLC 4J8WC 1B6WA 5B0ZB 1P3IA 3MGSC 1P3AA 1ID3A 2RIQA 3MVDC 2L5AA 3X1TB 4Z66A 4KGCD 3AN2D 2FJ7A 3W98B 3AL0C 4YS3A 2YFVA 3W99C 1HQ3A 5AY8D 3REID 4WV4B 5B31A 3AZLD 3AV1D 5CPKD 4LD9A 3RELB 1KX3C 5B33B 1TAFA 3AZIB 1P3KB 1F1EA 1M1AD 3C1BC 5AVBB 3C1CA 5DNNB 1P3ID 1P3AD 1ID3D 5B40A 4WNNB 4X23A 4YM6C 2F8NK 1M18B 2RVQD 4Z66D 3MGRC 5JA4A 5B0ZC 3B0DC 2FJ7D 4YS3D 4XUJB 4JJNA 1ULYA 3WKJA 5AY8B 3AZLB 1HQ3D 5B31D 4LD9D 2BG1A 5AV8A 5CHLB 5AVCC 3A6NA 5AV6A 3X1VB 3C1CD 2FFFB 3WAAA 1ID3B 5B24A 3AZNC 4J8XA 5B40D 5B33C 4X23D 3AZIC 1U35B 4Z66B 4YS3B 1P3GA 4H9PA 3A1KA 4WU9D 3AZEA 3WKJD 4KGCC 4H9SA 3AN2C 1S32A 4ZUXC 3R45A 1P3MC 5AV8D 1KU5A 3AZHB 3A6ND 3EG5B 5AV6D 5AY8C 3REIC 4G92B 4M6BA 3AZLC 2BYMA 3AV1C 5CPKC 3WAAD 5B24D 3UTBA 4KHAA 5B40B 4J8XD 2AROA 5C3IC 4WZSB 4X23B 3AZKA 2F8NB 1M1AC 4ZBJC 1P3IC 2XD5A 2JE5A 1P3AC 1ID3C 1P3GD 5B1LB 4WU9B 1Z2CB 3AZED 2RVQC 3UTAA 1S32D 2FJ7C 1AOIA 4EO5C 3NQUB 4YS3C 5B31G 5AV9B 5F99C 5B2IA 3LZ0A 1HQ3C 5B31C 3KXBB 3LJAB 4LD9C 4Z2MG 3VH6A 3VH5A 3UTBD 2AROD 3AZKD 3C1CC 1H3OA 3AZJB 5GXQA 2Y2GA 5CPJB 1P3GB 5B40C 2G5HC 4H9PB 4X23C 3AZEB 3KUYD 5CPIA 3UTAD 3REJB 3A1IA 1AOID 4Z2MH 1P34D 4JJNC 3WKJC 5B2ID 3LZ0D 4Z5TC 3X1TA 4H9NB 5AV8C 1F66B 2Y2LA 3A6NC 2PYOB 3W98A 2AROB 2ZY5A 2UWXA 3H0LC 5AV6C 3WAAC 5B24C 5GXQD 3MGPA 4J8XC 3RELA 3EPKA 1ZLAC 3KUYB 3UTAB 5CPID 1P3KA 3AFAB 5AVBA 5DNNA 2IO5B 1P34B 2JSSA 2NQBB 5B2IB 3LZ0B 3AZEC 4WNNA 5E5AB 4H9SC 1S32C 1M18A 5B32A 3W98D 3REKB 3V9RA 4XUJA 1WWIA 2NZDB 2Y2KA 3UTBC 3MGPD 1BH9B 4H9QB 2AROC 3RELD 3AZKC 3P5JB 1P3KD 4E45A 4NFTA 3X1VA 5AVBD 5DNND 3B6FB 4NE5A 3WA9A 3UTAC 1EQZB 1U35A 3REHB 5B32D 1M18D 1AOIC 2BYKB 2DF4C 4XUJD 5JRGB 5B2IC 3LZ0C 3X1SB 5AV5B 3MGPB 3EPLA 3UT9B 3AZHA 3KWQB 3X1VD 5GXQC 5BNVA 5CP6B 5BNXA 4KUDB 5CPIC 1N1JB 3WA9D 2F8NA 5B32B 1U35D 5KDMA 3AYWB 3V9RB 3NQJB 4J8UA 5B1LA 1Q9CA 4WU9A 1BFMA 3AZMB 3X1TC 4WJ3C 3W98C 4HGAB 3NQUA 3AZHD 4H9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 A;  1P3L B;  3KXB A;  3LJA A;  1P3F B;  3REL C;  3WA9 B;  1P3K C;  2F8N D;  2HUE B;  5AVB C;  5DNN C;  1P3B B;  3AZJ A;  3AV2 B;  4G91 B;  5CPJ A;  5B32 G;  2CV5 D;  4J8U D;  5B1L D;  1M18 C;  5B32 C;  3B0C T;  3REJ A;  3AZF B;  4XUJ C;  5AV9 D;  3MNN B;  3LZ1 A;  4UUZ B;  5BNV B;  3KXB D;  5BT1 D;  4R8P D;  4H9N A;  3O62 B;  3LJA D;  1F66 A;  2PYO A;  5BNX B;  3VH6 T;  3VH5 T;  5KDM B;  3X1V C;  1P3O B;  3AZJ D;  1KX4 B;  5CPJ D;  3VH5 W;  2CV5 B;  4J8U B;  3WA9 C;  3KUY A;  1U35 C;  4Z66 C;  5GT0 B;  3AFA A;  3AZG B;  3REJ D;  1B67 A;  1P34 A;  4DRA A;  4H9O B;  2NQB A;  3LZ1 D;  5E5A A;  4J8V D;  5GSU B;  4R8P B;  1M19 B;  3AZH C;  1F66 D;  3REK A;  2PYO D;  4XZQ B;  4G92 C;  2NZD A;  2F8N G;  5BS7 A;  1BH9 A;  4H9Q A;  3B6G B;  3AFA D;  3X1U B;  3B6F A;  4J8U C;  5B1L C;  3LZ1 B;  3LEL B;  4WU9 C;  2NQB D;  4WU8 B;  4J8V B;  5E5A D;  1EQZ A;  3REH A;  2BYK A;  5DNM A;  3REK D;  5AV9 C;  5JRG A;  4DRB A;  3MGQ B;  2HIO A;  2LY8 A;  5BT1 C;  3KXB C;  3X1S A;  3LJA C;  3W96 B;  2NZD D;  5AV5 A;  1KX5 A;  3UT9 A;  3KWQ A;  3AZJ C;  3TU4 B;  5B0Y A;  5CPJ C;  1P3G C;  3B6F D;  5CP6 A;  4KUD A;  1N1J A;  5B1M B;  1EQZ D;  3REJ C;  3REH D;  3AYW A;  4NE6 A;  3W97 A;  5DNM D;  5B2J B;  3LZ1 C;  3NQJ A;  5JRG D;  2HIO D;  3AZM A;  3X1S D;  1F66 C;  1TZY A;  5AV5 D;  4J8W B;  1KX5 D;  3UT9 D;  3MGS B;  2PYO C;  1P3L A;  3KWQ D;  5B0Y D;  1P3F A;  2YFW B;  3MGR D;  5BO0 B;  5CP6 D;  4KUD D;  3KUY C;  3AFA C;  1P3B A;  3AYW D;  2IO5 C;  1P34 C;  5DNM B;  3AV2 A;  3W97 D;  5G49 B;  2NQB C;  5E5A C;  2HIO B;  1KX3 B;  3AZM D;  1WWS A;  1TZY D;  3REK C;  1KX5 B;  3AZF A;  4CSR B;  3WTP E;  3MNN A;  5GT3 A;  4UUZ A;  1P3L D;  2NZD C;  5B0Y B;  1P3F D;  5BS7 C;  3O62 A;  3MGR B;  3B0D B;  1BH8 B;  1P3O A;  5FUG B;  1P3B D;  3W97 B;  3B6F C;  3AV2 D;  1KX4 A;  4ZUX D;  2CV5 A;  1P3M D;  1A7W A;  5AVC B;  1EQZ C;  3REH C;  5F99 A;  5GT0 A;  1TZY B;  1HTA A;  3AZG A;  5DNM C;  3AZF D;  3AZN B;  5JRG C;  3MNN D;  5GT3 D;  2HIO C;  3X1S C;  5GSU A;  4R8P A;  5AV5 C;  3MGP C;  3O62 D;  3UT9 C;  1KX5 C;  1M19 A;  4XZQ A;  3KWQ C;  1P3O D;  5B0Y C;  4KGC B;  3AN2 B;  1KX4 D;  4ZUX B;  5CP6 C;  1P3M B;  4KUD C;  5F99 D;  5GT0 D;  3AYW C;  4NE3 A;  3B6G A;  3REI B;  3AZG D;  3W97 C;  4Z5T A;  3AV1 B;  3X1U A;  5CPK B;  4H9R B;  4QLC A;  5GT3 B;  3LEL A;  3AZM C;  3B0C W;  5C3I B;  4WU8 A;  3WTP A;  4J8V A;  1M1A B;  4ZBJ B;  5GSU D;  1TZY C;  1JFI B;  1P3I B;  4HGA C;  1M19 D;  1P3A B;  4XZQ D;  1P3L C;  3MGQ A;  1ZLA A;  3KSY A;  1P3F C;  3W96 A;  3VH6 W;  1P3P A;  2FJ7 B;  4EO5 B;  2YFV B;  5F99 B;  2HUE C;  4JJN D;  1P3B C;  3B6G D;  1HQ3 B;  3TU4 A;  3AV2 C;  5B31 B;  4Z5T D;  4G91 C;  3X1U D;  4LD9 B;  4QLC D;  3LEL D;  1TAF B;  4WU8 D;  3WTP D;  5B1M A;  3C1C B;  3AZF C;  3MNN C;  5B2J A;  5GT3 C;  3MGQ D;  1ZLA D;  3O62 C;  3W96 D;  5JA4 B;  4J8W A;  1P3P D;  3MGS A;  4JJN B;  1P3O C;  3WKJ B;  3MVD A;  3TU4 D;  4Z5T B;  1KX4 C;  5AV8 B;  2CV5 C;  2YFW A;  2CWE A;  5BO0 A;  4QLC B;  3A6N B;  1R4V A;  3WTP B;  5GT0 C;  5AV6 B;  5B1M D;  3AZG C;  3WAA B;  3W99 A;  2F8N H;  5B24 B;  5G49 A;  5B2J D;  4J8X B;  1ZLA B;  4R8P C;  5GSU C;  1KX3 A;  1M19 C;  1P3P B;  3C1B A;  4J8W D;  4XZQ C;  3MGS D;  4CSR A;  3MVD D;  4YM6 A;  1S32 B;  4CAY A;  3R45 B;  3MGR A;  5B0Z A;  1BH8 A;  3B6G C;  5FUG A;  2BYM B;  3W99 D;  3X1U C;  4QLC C;  3LEL C;  4KHA B;  3UTB B;  3AZK B;  5AVC A;  3WTP C;  4J8V C;  4WU8 C;  3B0B A;  1KX3 D;  4AWL B;  3C1B D;  3AZN A;  3MGQ C;  3MVD B;  3W96 C;  5B33 A;  3AZI A;  4YM6 D;  1P3P C;  1AOI B;  5B0Z D;  3TU4 C;  3W99 B;  3X1T D;  4KGC A;  3AN2 A;  4ZUX A;  1P3M A;  5AVC D;  5B1M C;  1H3O B;  5AY8 A;  3C1B B;  3REI A;  5GXQ B;  3AZL A;  3AV1 A;  5CPK A;  5B2J C;  4H9R A;  3AZN D;  4E44 A;  5B33 D;  4YM6 B;  3AZI D;  4CAY B;  5CPI B;  1M1A A;  1JFI A;  4AWL C;  4J8W C;  1B6W A;  5B0Z B;  1P3I A;  3MGS C;  1P3A A;  1ID3 A;  3MVD C;  2L5A A;  3X1T B;  4Z66 A;  4KGC D;  3AN2 D;  2FJ7 A;  3W98 B;  4YS3 A;  2YFV A;  3W99 C;  1HQ3 A;  5AY8 D;  3REI D;  4WV4 B;  5B31 A;  3AZL D;  3AV1 D;  5CPK D;  4LD9 A;  3REL B;  1KX3 C;  5B33 B;  1TAF A;  3AZI B;  1P3K B;  1F1E A;  1M1A D;  3C1B C;  5AVB B;  3C1C A;  5DNN B;  1P3I D;  1P3A D;  1ID3 D;  5B40 A;  4WNN B;  4X23 A;  4YM6 C;  2F8N K;  1M18 B;  2RVQ D;  4Z66 D;  3MGR C;  5JA4 A;  5B0Z C;  3B0D C;  2FJ7 D;  4YS3 D;  4XUJ B;  4JJN A;  1ULY A;  3WKJ A;  5AY8 B;  3AZL B;  1HQ3 D;  5B31 D;  4LD9 D;  5AV8 A;  5CHL B;  5AVC C;  3A6N A;  5AV6 A;  3X1V B;  3C1C D;  3WAA A;  1ID3 B;  5B24 A;  3AZN C;  4J8X A;  5B40 D;  5B33 C;  4X23 D;  3AZI C;  1U35 B;  4Z66 B;  4YS3 B;  1P3G A;  4H9P A;  4WU9 D;  3AZE A;  3WKJ D;  4KGC C;  4H9S A;  3AN2 C;  1S32 A;  4ZUX C;  3R45 A;  1P3M C;  5AV8 D;  1KU5 A;  3AZH B;  3A6N D;  5AV6 D;  5AY8 C;  3REI C;  4G92 B;  4M6B A;  3AZL C;  2BYM A;  3AV1 C;  5CPK C;  3WAA D;  5B24 D;  3UTB A;  4KHA A;  5B40 B;  4J8X D;  4WZS B;  2ARO A;  5C3I C;  4X23 B;  3AZK A;  2F8N B;  1M1A C;  4ZBJ C;  1P3I C;  1P3A C;  1ID3 C;  1P3G D;  5B1L B;  4WU9 B;  3AZE D;  2RVQ C;  3UTA A;  1S32 D;  2FJ7 C;  1AOI A;  4EO5 C;  3NQU B;  4YS3 C;  5B31 G;  5AV9 B;  5F99 C;  5B2I A;  3LZ0 A;  1HQ3 C;  5B31 C;  3KXB B;  3LJA B;  4LD9 C;  4Z2M G;  3VH6 A;  3VH5 A;  3UTB D;  2ARO D;  3AZK D;  3C1C C;  1H3O A;  3AZJ B;  5GXQ A;  5CPJ B;  1P3G B;  5B40 C;  4H9P B;  4X23 C;  3AZE B;  3KUY D;  5CPI A;  3UTA D;  3REJ B;  1AOI D;  4Z2M H;  1P34 D;  4JJN C;  3WKJ C;  5B2I D;  3LZ0 D;  4Z5T C;  3X1T A;  4H9N B;  5AV8 C;  1F66 B;  3W98 A;  3A6N C;  2PYO B;  2ARO B;  5AV6 C;  3WAA C;  5B24 C;  5GXQ D;  3MGP A;  4J8X C;  3REL A;  1ZLA C;  3KUY B;  3UTA B;  5CPI D;  1P3K A;  3AFA B;  5AVB A;  5DNN A;  2IO5 B;  1P34 B;  2JSS A;  2NQB B;  5B2I B;  3LZ0 B;  3AZE C;  4WNN A;  5E5A B;  4H9S C;  1S32 C;  1M18 A;  5B32 A;  3W98 D;  3REK B;  3V9R A;  4XUJ A;  1WWI A;  2NZD B;  3UTB C;  3MGP D;  1BH9 B;  4H9Q B;  2ARO C;  3REL D;  3AZK C;  1P3K D;  4E45 A;  4NFT A;  3X1V A;  5AVB D;  5DNN D;  3B6F B;  4NE5 A;  3WA9 A;  3UTA C;  1EQZ B;  1U35 A;  3REH B;  5B32 D;  1M18 D;  1AOI C;  2BYK B;  4XUJ D;  5JRG B;  5B2I C;  3LZ0 C;  3X1S B;  5AV5 B;  3MGP B;  3UT9 B;  3AZH A;  3KWQ B;  3X1V D;  5GXQ C;  5BNV A;  5CP6 B;  5BNX A;  4KUD B;  5CPI C;  1N1J B;  3WA9 D;  2F8N A;  5B32 B;  1U35 D;  5KDM A;  3AYW B;  3V9R B;  3NQJ B;  4J8U A;  5B1L A;  1Q9C A;  4WU9 A;  1BFM A;  3AZM B;  3X1T C;  3W98 C;  4HGA B;  3NQU A;  3AZH D;  4H9O A; 
#chains in the Genus database with same CATH topology
 5AV9 A;  1P3L B;  3KXB A;  3LJA A;  1P3F B;  3F6T A;  3REL C;  2Y2N A;  3WA9 B;  1P3K C;  2F8N D;  2HUE B;  5AVB C;  5DNN C;  1P3B B;  3AZJ A;  3AV2 B;  4G91 B;  2Y2M A;  5B32 G;  5CPJ A;  2VQR A;  2CV5 D;  4J8U D;  5B1L D;  2W8S A;  1M18 C;  5B32 C;  3B0C T;  3REJ A;  3AZF B;  4XUJ C;  5AV9 D;  3MNN B;  3LZ1 A;  4UUZ B;  1T3U A;  5BNV B;  3KXB D;  5BT1 D;  4R8P D;  4H9N A;  3O62 B;  3LJA D;  1F66 A;  2PYO A;  5BNX B;  3VH6 T;  3VH5 T;  5KDM B;  3X1V C;  1P3O B;  3AZJ D;  1KX4 B;  5CPJ D;  3VH5 W;  2CV5 B;  2Y2Q A;  4J8U B;  3WA9 C;  3KUY A;  1U35 C;  4Z66 C;  5GT0 B;  3AFA A;  3AZG B;  3REJ D;  2G5I C;  1B67 A;  1P34 A;  4DRA A;  4H9O B;  2NQB A;  2ZY4 A;  3LZ1 D;  5E5A A;  4J8V D;  5GSU B;  4R8P B;  1M19 B;  3AZH C;  1F66 D;  3REK A;  2PYO D;  4XZQ B;  4G92 C;  2Y2P A;  2NZD A;  2F8N G;  5BS7 A;  1BH9 A;  4H9Q A;  3B6G B;  3AFA D;  3X1U B;  3B6F A;  4UPK A;  4J8U C;  5B1L C;  3LZ1 B;  3LEL B;  4WU9 C;  2NQB D;  4WU8 B;  2DQN C;  5E5A D;  4J8V B;  1EQZ A;  3REH A;  2BYK A;  5DNM A;  3REK D;  5AV9 C;  4DRB A;  5JRG A;  3MGQ B;  2HIO A;  2LY8 A;  5BT1 C;  3KXB C;  3X1S A;  3LJA C;  3W96 B;  2NZD D;  5AV5 A;  1KX5 A;  3UT9 A;  3KWQ A;  3AZJ C;  3TU4 B;  5B0Y A;  5CPJ C;  1P3G C;  3B6F D;  1PZR A;  5CP6 A;  4KUD A;  3H0M C;  1N1J A;  5B1M B;  1EQZ D;  3REJ C;  3REH D;  3AYW A;  4NE6 A;  3W97 A;  5DNM D;  5B2J B;  3LZ1 C;  3NQJ A;  5JRG D;  2HIO D;  2ZM5 A;  3AZM A;  3X1S D;  1F66 C;  1TZY A;  5AV5 D;  4J8W B;  1KX5 D;  3UT9 D;  3MGS B;  2PYO C;  1P3L A;  3KWQ D;  5B0Y D;  1P3F A;  2YFW B;  3MGR D;  4DQY B;  5BO0 B;  5CP6 D;  4KUD D;  3KUY C;  3AFA C;  1P3B A;  3AYW D;  2IO5 C;  1P34 C;  5DNM B;  3AV2 A;  3W97 D;  5G49 B;  2NQB C;  5E5A C;  2HIO B;  1KX3 B;  3AZM D;  1WWS A;  2XD1 A;  1TZY D;  3REK C;  1KX5 B;  3AZF A;  4CSR B;  3WTP E;  3MNN A;  5GT3 A;  4UUZ A;  1P3L D;  2NZD C;  2Y2I A;  5B0Y B;  1P3F D;  5BS7 C;  3O62 A;  3MGR B;  3B0D B;  1BH8 B;  1P3O A;  3H0R C;  5FUG B;  1P3B D;  2Y2H A;  3W97 B;  3B6F C;  3AV2 D;  1KX4 A;  4ZUX D;  2CV5 A;  1P3M D;  1A7W A;  5AVC B;  1EQZ C;  3REH C;  5F99 A;  5GT0 A;  1TZY B;  1HTA A;  3AZG A;  5DNM C;  3AZF D;  3AZN B;  5JRG C;  3MNN D;  5GT3 D;  2HIO C;  3X1S C;  5GSU A;  4R8P A;  5AV5 C;  3MGP C;  2ZY2 A;  3O62 D;  3UT9 C;  1KX5 C;  1M19 A;  4XZQ A;  3EPJ A;  3KWQ C;  1P3O D;  5B0Y C;  4KGC B;  2J8P A;  3AN2 B;  1KX4 D;  4ZUX B;  5CP6 C;  1P3M B;  4KUD C;  5F99 D;  5GT0 D;  3AYW C;  4NE3 A;  3B6G A;  3REI B;  3AZG D;  3W97 C;  4Z5T A;  3AV1 B;  3X1U A;  5CPK B;  4H9R B;  4QLC A;  5GT3 B;  3LEL A;  3AZM C;  3B0C W;  5C3I B;  4WU8 A;  3WTP A;  4J8V A;  2JCH A;  4ZBJ B;  5GSU D;  1TZY C;  1M1A B;  1P3I B;  4HGA C;  1JFI B;  1M19 D;  1P3A B;  4XZQ D;  1P3L C;  3MGQ A;  1ZLA A;  3KSY A;  1P3F C;  3W96 A;  3VH6 W;  1P3P A;  2FJ7 B;  4EO5 B;  2YFV B;  5F99 B;  2HUE C;  4JJN D;  1P3B C;  3B6G D;  1HQ3 B;  3TU4 A;  3AV2 C;  3FDD A;  4Z5T D;  5B31 B;  4G91 C;  3X1U D;  4LD9 B;  4QLC D;  3LEL D;  2Y2J A;  1TAF B;  4WU8 D;  3WTP D;  5B1M A;  3C1C B;  3AZF C;  3MNN C;  5B2J A;  5GT3 C;  3IP4 C;  3MGQ D;  1ZLA D;  3O62 C;  3W96 D;  5JA4 B;  4J8W A;  1P3P D;  3MGS A;  4JJN B;  2Y2O A;  1P3O C;  3WKJ B;  3MVD A;  3TU4 D;  4Z5T B;  1KX4 C;  3EPH A;  5AV8 B;  2CV5 C;  2YFW A;  2CWE A;  5BO0 A;  4QLC B;  3A6N B;  1R4V A;  3WTP B;  5GT0 C;  5AV6 B;  5B1M D;  3AZG C;  3WAA B;  3W99 A;  2F8N H;  5B24 B;  5G49 A;  5B2J D;  4J8X B;  1ZLA B;  4R8P C;  5GSU C;  1KX3 A;  1M19 C;  1P3P B;  3C1B A;  4J8W D;  2ZY3 A;  4XZQ C;  3MGS D;  4CSR A;  3MVD D;  4YM6 A;  1S32 B;  4CAY A;  3R45 B;  3MGR A;  5B0Z A;  2F2A C;  1BH8 A;  3B6G C;  5FUG A;  2BYM B;  3W99 D;  3X1U C;  4QLC C;  3LEL C;  4KHA B;  3UTB B;  3AZK B;  5AVC A;  3WTP C;  4J8V C;  4WU8 C;  3B0B A;  1KX3 D;  1W2E A;  4AWL B;  3C1B D;  3AZN A;  3MGQ C;  3MVD B;  3W96 C;  5B33 A;  3AZI A;  4YM6 D;  1P3P C;  1AOI B;  5B0Z D;  3KFU G;  3TU4 C;  3W99 B;  3X1T D;  4KGC A;  3AN2 A;  4ZUX A;  1P3M A;  5AVC D;  5B1M C;  1H3O B;  5AY8 A;  3C1B B;  3REI A;  5GXQ B;  3AZL A;  3AV1 A;  5CPK A;  5B2J C;  4H9R A;  3AZN D;  4E44 A;  5B33 D;  4YM6 B;  3AZI D;  4CAY B;  5CPI B;  1M1A A;  1JFI A;  4AWL C;  4J8W C;  1B6W A;  5B0Z B;  1P3I A;  3MGS C;  1P3A A;  1ID3 A;  2RIQ A;  3MVD C;  2L5A A;  3X1T B;  4Z66 A;  4KGC D;  3AN2 D;  2FJ7 A;  3W98 B;  3AL0 C;  4YS3 A;  2YFV A;  3W99 C;  1HQ3 A;  5AY8 D;  3REI D;  4WV4 B;  5B31 A;  3AZL D;  3AV1 D;  5CPK D;  4LD9 A;  3REL B;  1KX3 C;  5B33 B;  1TAF A;  3AZI B;  1P3K B;  1F1E A;  1M1A D;  3C1B C;  5AVB B;  3C1C A;  5DNN B;  1P3I D;  1P3A D;  1ID3 D;  5B40 A;  4WNN B;  4X23 A;  4YM6 C;  2F8N K;  1M18 B;  2RVQ D;  4Z66 D;  3MGR C;  5JA4 A;  5B0Z C;  3B0D C;  2FJ7 D;  4YS3 D;  4XUJ B;  4JJN A;  1ULY A;  3WKJ A;  5AY8 B;  3AZL B;  1HQ3 D;  5B31 D;  4LD9 D;  2BG1 A;  5AV8 A;  5CHL B;  5AVC C;  3A6N A;  5AV6 A;  3X1V B;  3C1C D;  2FFF B;  3WAA A;  1ID3 B;  5B24 A;  3AZN C;  4J8X A;  5B40 D;  5B33 C;  4X23 D;  3AZI C;  1U35 B;  4Z66 B;  4YS3 B;  1P3G A;  4H9P A;  3A1K A;  4WU9 D;  3AZE A;  3WKJ D;  4KGC C;  4H9S A;  3AN2 C;  1S32 A;  4ZUX C;  3R45 A;  1P3M C;  5AV8 D;  1KU5 A;  3AZH B;  3A6N D;  3EG5 B;  5AV6 D;  5AY8 C;  3REI C;  4G92 B;  4M6B A;  3AZL C;  2BYM A;  3AV1 C;  5CPK C;  3WAA D;  5B24 D;  3UTB A;  4KHA A;  5B40 B;  4J8X D;  2ARO A;  5C3I C;  4WZS B;  4X23 B;  3AZK A;  2F8N B;  1M1A C;  4ZBJ C;  1P3I C;  2XD5 A;  2JE5 A;  1P3A C;  1ID3 C;  1P3G D;  5B1L B;  4WU9 B;  1Z2C B;  3AZE D;  2RVQ C;  3UTA A;  1S32 D;  2FJ7 C;  1AOI A;  4EO5 C;  3NQU B;  4YS3 C;  5B31 G;  5AV9 B;  5F99 C;  5B2I A;  3LZ0 A;  1HQ3 C;  5B31 C;  3KXB B;  3LJA B;  4LD9 C;  4Z2M G;  3VH6 A;  3VH5 A;  3UTB D;  2ARO D;  3AZK D;  3C1C C;  1H3O A;  3AZJ B;  5GXQ A;  2Y2G A;  5CPJ B;  1P3G B;  5B40 C;  2G5H C;  4H9P B;  4X23 C;  3AZE B;  3KUY D;  5CPI A;  3UTA D;  3REJ B;  3A1I A;  1AOI D;  4Z2M H;  1P34 D;  4JJN C;  3WKJ C;  5B2I D;  3LZ0 D;  4Z5T C;  3X1T A;  4H9N B;  5AV8 C;  1F66 B;  2Y2L A;  3A6N C;  2PYO B;  3W98 A;  2ARO B;  2ZY5 A;  2UWX A;  3H0L C;  5AV6 C;  3WAA C;  5B24 C;  5GXQ D;  3MGP A;  4J8X C;  3REL A;  3EPK A;  1ZLA C;  3KUY B;  3UTA B;  5CPI D;  1P3K A;  3AFA B;  5AVB A;  5DNN A;  2IO5 B;  1P34 B;  2JSS A;  2NQB B;  5B2I B;  3LZ0 B;  3AZE C;  4WNN A;  5E5A B;  4H9S C;  1S32 C;  1M18 A;  5B32 A;  3W98 D;  3REK B;  3V9R A;  4XUJ A;  1WWI A;  2NZD B;  2Y2K A;  3UTB C;  3MGP D;  1BH9 B;  4H9Q B;  2ARO C;  3REL D;  3AZK C;  3P5J B;  1P3K D;  4E45 A;  4NFT A;  3X1V A;  5AVB D;  5DNN D;  3B6F B;  4NE5 A;  3WA9 A;  3UTA C;  1EQZ B;  1U35 A;  3REH B;  5B32 D;  1M18 D;  1AOI C;  2BYK B;  2DF4 C;  4XUJ D;  5JRG B;  5B2I C;  3LZ0 C;  3X1S B;  5AV5 B;  3MGP B;  3EPL A;  3UT9 B;  3AZH A;  3KWQ B;  3X1V D;  5GXQ C;  5BNV A;  5CP6 B;  5BNX A;  4KUD B;  5CPI C;  1N1J B;  3WA9 D;  2F8N A;  5B32 B;  1U35 D;  5KDM A;  3AYW B;  3V9R B;  3NQJ B;  4J8U A;  5B1L A;  1Q9C A;  4WU9 A;  1BFM A;  3AZM B;  3X1T C;  4WJ3 C;  3W98 C;  4HGA B;  3NQU A;  3AZH D;  4H9O A; 
#chains in the Genus database with same CATH homology
 5AV9 A;  1P3L B;  3KXB A;  3LJA A;  1P3F B;  3F6T A;  3REL C;  2Y2N A;  3WA9 B;  1P3K C;  2F8N D;  2HUE B;  5AVB C;  5DNN C;  1P3B B;  3AZJ A;  3AV2 B;  4G91 B;  2Y2M A;  5B32 G;  5CPJ A;  2VQR A;  2CV5 D;  4J8U D;  5B1L D;  2W8S A;  1M18 C;  5B32 C;  3B0C T;  3REJ A;  3AZF B;  4XUJ C;  5AV9 D;  3MNN B;  3LZ1 A;  4UUZ B;  1T3U A;  5BNV B;  3KXB D;  5BT1 D;  4R8P D;  4H9N A;  3O62 B;  3LJA D;  1F66 A;  2PYO A;  5BNX B;  3VH6 T;  3VH5 T;  5KDM B;  3X1V C;  1P3O B;  3AZJ D;  1KX4 B;  5CPJ D;  3VH5 W;  2CV5 B;  2Y2Q A;  4J8U B;  3WA9 C;  3KUY A;  1U35 C;  4Z66 C;  5GT0 B;  3AFA A;  3AZG B;  3REJ D;  2G5I C;  1B67 A;  1P34 A;  4DRA A;  4H9O B;  2NQB A;  2ZY4 A;  3LZ1 D;  5E5A A;  4J8V D;  5GSU B;  4R8P B;  1M19 B;  3AZH C;  1F66 D;  3REK A;  2PYO D;  4XZQ B;  4G92 C;  2Y2P A;  2NZD A;  2F8N G;  5BS7 A;  1BH9 A;  4H9Q A;  3B6G B;  3AFA D;  3X1U B;  3B6F A;  4UPK A;  4J8U C;  5B1L C;  3LZ1 B;  3LEL B;  4WU9 C;  2NQB D;  4WU8 B;  2DQN C;  5E5A D;  4J8V B;  1EQZ A;  3REH A;  2BYK A;  5DNM A;  3REK D;  5AV9 C;  4DRB A;  5JRG A;  3MGQ B;  2HIO A;  2LY8 A;  5BT1 C;  3KXB C;  3X1S A;  3LJA C;  3W96 B;  2NZD D;  5AV5 A;  1KX5 A;  3UT9 A;  3KWQ A;  3AZJ C;  3TU4 B;  5B0Y A;  5CPJ C;  1P3G C;  3B6F D;  1PZR A;  5CP6 A;  4KUD A;  3H0M C;  1N1J A;  5B1M B;  1EQZ D;  3REJ C;  3REH D;  3AYW A;  4NE6 A;  3W97 A;  5DNM D;  5B2J B;  3LZ1 C;  3NQJ A;  5JRG D;  2HIO D;  2ZM5 A;  3AZM A;  3X1S D;  1F66 C;  1TZY A;  5AV5 D;  4J8W B;  1KX5 D;  3UT9 D;  3MGS B;  2PYO C;  1P3L A;  3KWQ D;  5B0Y D;  1P3F A;  2YFW B;  3MGR D;  4DQY B;  5BO0 B;  5CP6 D;  4KUD D;  3KUY C;  3AFA C;  1P3B A;  3AYW D;  2IO5 C;  1P34 C;  5DNM B;  3AV2 A;  3W97 D;  5G49 B;  2NQB C;  5E5A C;  2HIO B;  1KX3 B;  3AZM D;  1WWS A;  2XD1 A;  1TZY D;  3REK C;  1KX5 B;  3AZF A;  4CSR B;  3WTP E;  3MNN A;  5GT3 A;  4UUZ A;  1P3L D;  2NZD C;  2Y2I A;  5B0Y B;  1P3F D;  5BS7 C;  3O62 A;  3MGR B;  3B0D B;  1BH8 B;  1P3O A;  3H0R C;  5FUG B;  1P3B D;  2Y2H A;  3W97 B;  3B6F C;  3AV2 D;  1KX4 A;  4ZUX D;  2CV5 A;  1P3M D;  1A7W A;  5AVC B;  1EQZ C;  3REH C;  5F99 A;  5GT0 A;  1TZY B;  1HTA A;  3AZG A;  5DNM C;  3AZF D;  3AZN B;  5JRG C;  3MNN D;  5GT3 D;  2HIO C;  3X1S C;  5GSU A;  4R8P A;  5AV5 C;  3MGP C;  2ZY2 A;  3O62 D;  3UT9 C;  1KX5 C;  1M19 A;  4XZQ A;  3EPJ A;  3KWQ C;  1P3O D;  5B0Y C;  4KGC B;  2J8P A;  3AN2 B;  1KX4 D;  4ZUX B;  5CP6 C;  1P3M B;  4KUD C;  5F99 D;  5GT0 D;  3AYW C;  4NE3 A;  3B6G A;  3REI B;  3AZG D;  3W97 C;  4Z5T A;  3AV1 B;  3X1U A;  5CPK B;  4H9R B;  4QLC A;  5GT3 B;  3LEL A;  3AZM C;  3B0C W;  5C3I B;  4WU8 A;  3WTP A;  4J8V A;  2JCH A;  4ZBJ B;  5GSU D;  1TZY C;  1M1A B;  1P3I B;  4HGA C;  1JFI B;  1M19 D;  1P3A B;  4XZQ D;  1P3L C;  3MGQ A;  1ZLA A;  3KSY A;  1P3F C;  3W96 A;  3VH6 W;  1P3P A;  2FJ7 B;  4EO5 B;  2YFV B;  5F99 B;  2HUE C;  4JJN D;  1P3B C;  3B6G D;  1HQ3 B;  3TU4 A;  3AV2 C;  3FDD A;  4Z5T D;  5B31 B;  4G91 C;  3X1U D;  4LD9 B;  4QLC D;  3LEL D;  2Y2J A;  1TAF B;  4WU8 D;  3WTP D;  5B1M A;  3C1C B;  3AZF C;  3MNN C;  5B2J A;  5GT3 C;  3IP4 C;  3MGQ D;  1ZLA D;  3O62 C;  3W96 D;  5JA4 B;  4J8W A;  1P3P D;  3MGS A;  4JJN B;  2Y2O A;  1P3O C;  3WKJ B;  3MVD A;  3TU4 D;  4Z5T B;  1KX4 C;  3EPH A;  5AV8 B;  2CV5 C;  2YFW A;  2CWE A;  5BO0 A;  4QLC B;  3A6N B;  1R4V A;  3WTP B;  5GT0 C;  5AV6 B;  5B1M D;  3AZG C;  3WAA B;  3W99 A;  2F8N H;  5B24 B;  5G49 A;  5B2J D;  4J8X B;  1ZLA B;  4R8P C;  5GSU C;  1KX3 A;  1M19 C;  1P3P B;  3C1B A;  4J8W D;  2ZY3 A;  4XZQ C;  3MGS D;  4CSR A;  3MVD D;  4YM6 A;  1S32 B;  4CAY A;  3R45 B;  3MGR A;  5B0Z A;  2F2A C;  1BH8 A;  3B6G C;  5FUG A;  2BYM B;  3W99 D;  3X1U C;  4QLC C;  3LEL C;  4KHA B;  3UTB B;  3AZK B;  5AVC A;  3WTP C;  4J8V C;  4WU8 C;  3B0B A;  1KX3 D;  1W2E A;  4AWL B;  3C1B D;  3AZN A;  3MGQ C;  3MVD B;  3W96 C;  5B33 A;  3AZI A;  4YM6 D;  1P3P C;  1AOI B;  5B0Z D;  3KFU G;  3TU4 C;  3W99 B;  3X1T D;  4KGC A;  3AN2 A;  4ZUX A;  1P3M A;  5AVC D;  5B1M C;  1H3O B;  5AY8 A;  3C1B B;  3REI A;  5GXQ B;  3AZL A;  3AV1 A;  5CPK A;  5B2J C;  4H9R A;  3AZN D;  4E44 A;  5B33 D;  4YM6 B;  3AZI D;  4CAY B;  5CPI B;  1M1A A;  1JFI A;  4AWL C;  4J8W C;  1B6W A;  5B0Z B;  1P3I A;  3MGS C;  1P3A A;  1ID3 A;  2RIQ A;  3MVD C;  2L5A A;  3X1T B;  4Z66 A;  4KGC D;  3AN2 D;  2FJ7 A;  3W98 B;  3AL0 C;  4YS3 A;  2YFV A;  3W99 C;  1HQ3 A;  5AY8 D;  3REI D;  4WV4 B;  5B31 A;  3AZL D;  3AV1 D;  5CPK D;  4LD9 A;  3REL B;  1KX3 C;  5B33 B;  1TAF A;  3AZI B;  1P3K B;  1F1E A;  1M1A D;  3C1B C;  5AVB B;  3C1C A;  5DNN B;  1P3I D;  1P3A D;  1ID3 D;  5B40 A;  4WNN B;  4X23 A;  4YM6 C;  2F8N K;  1M18 B;  2RVQ D;  4Z66 D;  3MGR C;  5JA4 A;  5B0Z C;  3B0D C;  2FJ7 D;  4YS3 D;  4XUJ B;  4JJN A;  1ULY A;  3WKJ A;  5AY8 B;  3AZL B;  1HQ3 D;  5B31 D;  4LD9 D;  2BG1 A;  5AV8 A;  5CHL B;  5AVC C;  3A6N A;  5AV6 A;  3X1V B;  3C1C D;  2FFF B;  3WAA A;  1ID3 B;  5B24 A;  3AZN C;  4J8X A;  5B40 D;  5B33 C;  4X23 D;  3AZI C;  1U35 B;  4Z66 B;  4YS3 B;  1P3G A;  4H9P A;  3A1K A;  4WU9 D;  3AZE A;  3WKJ D;  4KGC C;  4H9S A;  3AN2 C;  1S32 A;  4ZUX C;  3R45 A;  1P3M C;  5AV8 D;  1KU5 A;  3AZH B;  3A6N D;  3EG5 B;  5AV6 D;  5AY8 C;  3REI C;  4G92 B;  4M6B A;  3AZL C;  2BYM A;  3AV1 C;  5CPK C;  3WAA D;  5B24 D;  3UTB A;  4KHA A;  5B40 B;  4J8X D;  2ARO A;  5C3I C;  4WZS B;  4X23 B;  3AZK A;  2F8N B;  1M1A C;  4ZBJ C;  1P3I C;  2XD5 A;  2JE5 A;  1P3A C;  1ID3 C;  1P3G D;  5B1L B;  4WU9 B;  1Z2C B;  3AZE D;  2RVQ C;  3UTA A;  1S32 D;  2FJ7 C;  1AOI A;  4EO5 C;  3NQU B;  4YS3 C;  5B31 G;  5AV9 B;  5F99 C;  5B2I A;  3LZ0 A;  1HQ3 C;  5B31 C;  3KXB B;  3LJA B;  4LD9 C;  4Z2M G;  3VH6 A;  3VH5 A;  3UTB D;  2ARO D;  3AZK D;  3C1C C;  1H3O A;  3AZJ B;  5GXQ A;  2Y2G A;  5CPJ B;  1P3G B;  5B40 C;  2G5H C;  4H9P B;  4X23 C;  3AZE B;  3KUY D;  5CPI A;  3UTA D;  3REJ B;  3A1I A;  1AOI D;  4Z2M H;  1P34 D;  4JJN C;  3WKJ C;  5B2I D;  3LZ0 D;  4Z5T C;  3X1T A;  4H9N B;  5AV8 C;  1F66 B;  2Y2L A;  3A6N C;  2PYO B;  3W98 A;  2ARO B;  2ZY5 A;  2UWX A;  3H0L C;  5AV6 C;  3WAA C;  5B24 C;  5GXQ D;  3MGP A;  4J8X C;  3REL A;  3EPK A;  1ZLA C;  3KUY B;  3UTA B;  5CPI D;  1P3K A;  3AFA B;  5AVB A;  5DNN A;  2IO5 B;  1P34 B;  2JSS A;  2NQB B;  5B2I B;  3LZ0 B;  3AZE C;  4WNN A;  5E5A B;  4H9S C;  1S32 C;  1M18 A;  5B32 A;  3W98 D;  3REK B;  3V9R A;  4XUJ A;  1WWI A;  2NZD B;  2Y2K A;  3UTB C;  3MGP D;  1BH9 B;  4H9Q B;  2ARO C;  3REL D;  3AZK C;  3P5J B;  1P3K D;  4E45 A;  4NFT A;  3X1V A;  5AVB D;  5DNN D;  3B6F B;  4NE5 A;  3WA9 A;  3UTA C;  1EQZ B;  1U35 A;  3REH B;  5B32 D;  1M18 D;  1AOI C;  2BYK B;  2DF4 C;  4XUJ D;  5JRG B;  5B2I C;  3LZ0 C;  3X1S B;  5AV5 B;  3MGP B;  3EPL A;  3UT9 B;  3AZH A;  3KWQ B;  3X1V D;  5GXQ C;  5BNV A;  5CP6 B;  5BNX A;  4KUD B;  5CPI C;  1N1J B;  3WA9 D;  2F8N A;  5B32 B;  1U35 D;  5KDM A;  3AYW B;  3V9R B;  3NQJ B;  4J8U A;  5B1L A;  1Q9C A;  4WU9 A;  1BFM A;  3AZM B;  3X1T C;  4WJ3 C;  3W98 C;  4HGA B;  3NQU A;  3AZH D;  4H9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...