3B6GC

Nucleosome core particle treated with oxaliplatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
total genus 19
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gC00
4JJNB 5B31B 3X1UC 2BYKB 5AV6A 2PYOD 3UTAA 5DNMD 3X1SB 3O62C 4CSRB 4J8UB 5GSUB 5DNNA 3AZKB 2NZDA 3AZND 5CPKA 3W97B 3MNNC 1M1AC 5JRGC 1AOID 4KGCA 2RVQC 5CP6A 4Z5TB 4XUJD 2AROB 3C1CB 4QLCD 4G92B 1S32C 4DRAA 4J8VD 3AZFB 1P3MB 5B31G 3UTAD 3AN2B 1JFIA 3B6FB 3KWQC 5E5AC 2F8NB 3MGPA 3REKA 3AYWB 5JA4A 5AV8A 5B0YD 1M1AD 1AOIC 1KU5A 5CHLB 5BS7A 3B6GA 3LZ0B 4QLCC 3AZEB 4ZUXB 1F66B 3WKJD 1KX5C 3AFAB 3KUYA 5B24D 3WA9B 1F1EA 4UUZA 4J8XB 5B40C 3W97C 3RELB 4J8UC 1TZYA 3KXBA 3AZKC 5B1MA 1ULYA 2YFVA 5B2IB 5BO0B 3AV2C 5GXQD 5AVCC 2F8NG 2NZDD 4WU8C 3LZ0A 5CPJA 1M19B 3REJA 3AV1D 1ID3A 1P3PD 3AZLA 4G92C 5BNXB 3AZFC 3MGRD 1P3MC 2F8NK 2HUEC 1P3FC 1KX4D 1BH8A 5GSUA 5DNNB 5F99B 3AV2D 3TU4B 2HIOC 5B2IA 1P3LC 2F8NH 3X1TD 5AV5A 3MGPD 3REKD 2NQBB 1B67A 3AV1C 1P3IA 4CAYA 5DNMC 3O62D 1ID3B 4H9QB 5C3IC 3O62B 3X1SC 3MGRC 1JFIB 3B6FA 4YS3B 5B33A 3REHC 1P3OA 5DNND 5AVBC 4J8XC 3VH5W 1AOIA 2CWEA 5B1MD 1EQZD 3AYWA 1WWIA 3KXBD 1TZYD 4R8PB 5GT3A 4R8PD 3C1CD 4WU9A 3LZ0D 2AROD 4ZBJB 4J8VC 1ZLAA 3UTAC 3LJAC 4CSRA 4J8WC 5AV9C 3REHD 3MGSB 1P3BD 3A6NC 4XZQB 3VH5T 1P3LB 5AV8D 1M1AA 5B0YA 5JRGA 5F99C 4HGAB 2CV5B 4KGCC 3B0DB 3LELD 3AZED 4LD9A 5B24C 2YFWA 3UT9B 4H9OB 3MVDB 3W97D 1P3AB 4H9NA 5B0ZC 3MGRB 1P3FA 5AV8C 4NE5A 5CPKD 2BYMA 2HIOA 1M18D 4KUDB 5AVCB 5KDMB 3AZHB 4J8VB 5CPJD 3UTAB 3X1VC 3B6FD 5DNMA 3AZJC 3KUYC 4UUZB 1P3OC 3W97A 1U35A 3UTBA 3AV2A 4WNNB 3WKJA 5KDMA 5GXQB 5AVCA 3AZNB 5CPJC 4JJNC 5GT3C 4WU9C 5B31D 3NQUB 3AZLC 1KX3A 3W99A 1ID3D 4YM6B 2FJ7A 5B1LD 1P3KC 1BH8B 3UTBB 3B6GC 3TU4D 4QLCA 5JRGB 2CV5A 1Q9CA 4Z5TD 4XUJB 1P3IB 4Z66D 2NQBA 3KUYB 5B24A 4NFTA 2YFWB 1HQ3D 4H9RB 3WTPB 4ZUXA 1F66A 5AV9D 4J8UA 4G91B 5AV9B 3MGSD 2YFVB 3V9RA 3LZ1B 3RELA 3LELC 3C1BA 3REJC 1P3ID 2RVQD 3AZEC 3AZGA 3X1TA 3VH6T 1M19A 3X1VA 3W96A 3REIC 3AZFA 4YM6D 1P3MA 1ZLAC 3AFAC 5B1LB 5B2JC 5CPIB 3AZIB 5B2IC 1P3LA 3V9RB 5E5AD 3LZ1A 5AV5B 5B0YC 4WU8B 3REJD 3AV1A 1P3IC 4KUDC 3AZNA 3AV2B 1R4VA 3AZHD 3X1VD 3AZGD 3X1SA 3X1TB 4H9QA 5AV6B 2PYOA 3AN2D 3W99C 1KX3C 1TAFB 1N1JB 4J8XA 4H9PB 5B0ZA 4WV4B 1M18B 4KUDD 4X23B 3AV1B 5B31C 3X1UB 3LJAA 3X1UD 5CP6C 1P3AD 3AZJA 2PYOB 3AZIC 1S32A 3WAAD 1KX4B 5F99A 3WAAB 3UTBC 3NQJA 1P3LD 4Z66C 1M1AB 4JJNA 3X1TC 4CAYB 1P3PB 2IO5B 1P34A 5BS7C 5GT0A 3MGQD 3AFAA 1P3GA 3UT9A 5B2JA 1BFMA 1HQ3B 3WTPD 4G91C 4YS3A 5BO0A 3B0BA 4J8XD 4AWLC 5B1MC 3B0DC 1EQZC 4QLCB 3W98D 3REID 3LZ0C 2PYOC 5B2JD 5AY8A 4ZUXC 5GT0D 1U35C 1P3GD 1F66C 1P3BB 5AV8B 5CPID 5FUGB 3A6ND 4XZQA 3X1UA 5F99D 4X23A 3W98C 3AZEA 3AZGC 3WKJB 1S32D 5B32G 1P3PC 2FJ7C 3VH5A 1S32B 3W99B 1P3KA 3RELD 3KWQD 1P3FB 2F8ND 2LY8A 4H9NB 5B0ZD 1AOIB 4AWLB 5CPKB 5B33C 3AZMA 2NZDB 5B32A 2NQBC 3WTPE 4X23D 3C1CA 5GT0B 4Z5TA 3UT9D 3KWQA 5BNXA 3MVDD 3AZID 1N1JA 5E5AA 5B40D 1H3OB 2JSSA 1P3OD 4J8WA 3AZKD 5B33D 3B6GB 1M19C 3AZMB 3AZGB 3A6NA 3REIA 5B31A 3C1BB 4JJND 3C1BD 3LJAB 3MVDA 3WTPC 3LJAD 3AZFD 1P3MD 3AZKA 5GSUD 5BNVA 3W96D 1KX4A 5B33B 4J8WB 3MNND 2HIOB 4KUDA 4WU8A 3AZMD 5JRGD 5B32D 1TZYB 3KXBB 5G49B 3TU4C 4Z66A 1BH9B 4HGAC 3REIB 3REJB 5GT0C 4ZUXD 1F66D 1P3GC 3X1SD 1HQ3A 4H9RA 5GSUC 4WZSB 3R45B 4YS3C 5CPIC 1A7WA 4H9PA 5AV5C 5B0ZB 3AZMC 3AYWD 5B32C 3MGPB 3REKB 4XZQD 4R8PC 3C1CC 3W98B 3WKJC 4LD9B 2AROC 3B6FC 2FJ7D 1HTAA 4M6BA 4YM6A 4J8WD 2BYKA 5AV6C 3AZJB 5AV5D 3AYWC 5B2ID 5GXQC 4XZQC 5AVCD 3A6NB 3NQJB 2NZDC 4WU8D 4Z2MG 5CPJB 4J8VA 3MNNA 4X23C 3AZHA 3W98A 3UT9C 1P3GB 3MVDC 5GT3B 4WU9B 3MGQA 1P34B 3AZLD 1KX5B 3WA9C 4E44A 1P34D 5BT1C 5B40B 1P3KB 1P3FD 1KX4C 3MGSA 1P3KD 4WNNA 2HIOD 1M18A 4Z2MH 5B32B 3MGPC 3REKC 4LD9C 3VH6A 3LZ1D 4H9SC 1BH9A 3LELA 3C1BC 1B6WA 3NQUA 3MGQB 3AZJD 1P3AA 2IO5C 3KUYD 1HQ3C 3R45A 3W96C 5DNNC 5AY8B 5AVBD 3WAAA 5AY8D 1H3OA 3UTBD 1TZYC 3KXBC 4EO5B 3LZ1C 1P3PA 5GT3D 4WU9D 4R8PA 1EQZB 3LELB 5DNMB 4YM6C 3AN2A 1ZLAD 1ID3C 5AVBB 5BNVB 5C3IB 4YS3D 3B0CT 1P3BC 4KHAA 3REHB 5B1LC 1U35B 5B0YB 4KGCD 4E45A 5JA4B 5G49A 4Z5TC 4NE3A 4XUJC 4ZBJC 3W96B 2FJ7B 3W99D 3O62A 5AV6D 1U35D 1KX3B 5B40A 3MGSC 5E5AB 5FUGA 3MGRA 2CV5C 4KGCB 3AZIA 5CPKC 1M18C 4EO5C 4H9SA 1ZLAB 3WTPA 5B2JB 5B24B 5CP6D 1P3AC 3WA9D 3AFAD 1KX5D 1P34C 5BT1D 3B0CW 2F8NA 1TAFA 3RELC 3WAAC 2CV5D 5AV9A 4J8UD 3TU4A 5GXQA 4LD9D 3MNNB 3X1VB 2NQBD 3AZHC 3VH6W 3KSYA 4Z66B 1EQZA 3AN2C 1KX3D 1KX5A 3MGQC 3KWQB 5CPIA 3WA9A 1P3BA 1WWSA 4H9OA 2HUEB 5B1LA 4KHAB 3REHA 5AY8C 1P3OB 5AVBA 3AZNC 3B6GD 2L5AA 4DRBA 2BYMB 4NE6A 5B1MB 2AROA 1M19D 5CP6B 4XUJA 3AZLB
chains in the Genus database with same CATH superfamily
4JJNB 5B31B 3X1UC 2BYKB 5AV6A 2PYOD 3UTAA 5DNMD 3X1SB 3O62C 4CSRB 4J8UB 5GSUB 5DNNA 3AZKB 2NZDA 3AZND 5CPKA 3W97B 3MNNC 1M1AC 5JRGC 1AOID 4KGCA 2RVQC 5CP6A 4Z5TB 4XUJD 2AROB 3C1CB 4QLCD 4G92B 2J8PA 1S32C 4DRAA 4J8VD 3AZFB 1P3MB 5B31G 3UTAD 3AN2B 1JFIA 3B6FB 3KWQC 5E5AC 2F8NB 3MGPA 3REKA 3AYWB 5JA4A 5AV8A 5B0YD 1M1AD 1AOIC 2RIQA 1KU5A 5CHLB 5BS7A 3B6GA 3LZ0B 4QLCC 3AZEB 4ZUXB 1F66B 3WKJD 1KX5C 3AFAB 3KUYA 5B24D 3WA9B 1F1EA 4UUZA 4J8XB 5B40C 3W97C 3RELB 4J8UC 1TZYA 3KXBA 3AZKC 5B1MA 1ULYA 2YFVA 5B2IB 5BO0B 3EG5B 3H0MC 3AV2C 5GXQD 5AVCC 2F8NG 2NZDD 4WU8C 3LZ0A 5CPJA 1M19B 3REJA 3AV1D 1ID3A 1P3PD 3AZLA 2Y2QA 4G92C 5BNXB 3AZFC 3MGRD 1P3MC 2F8NK 2HUEC 1P3FC 1KX4D 3EPJA 1BH8A 5GSUA 5DNNB 5F99B 3AV2D 3TU4B 2HIOC 5B2IA 1P3LC 2UWXA 2F8NH 3X1TD 5AV5A 3MGPD 3REKD 2NQBB 4UPKA 1B67A 3AV1C 1P3IA 4CAYA 3A1IA 5DNMC 3O62D 1ID3B 4H9QB 5C3IC 3O62B 3X1SC 3MGRC 1JFIB 3B6FA 4YS3B 5B33A 3REHC 1P3OA 5DNND 5AVBC 4J8XC 3VH5W 2Y2GA 1AOIA 2CWEA 5B1MD 1EQZD 3AYWA 1WWIA 1TZYD 4R8PB 2XD5A 3KXBD 5GT3A 4R8PD 3C1CD 4WU9A 3LZ0D 2AROD 4ZBJB 4J8VC 1ZLAA 3UTAC 3LJAC 4CSRA 4J8WC 5AV9C 3REHD 3MGSB 1P3BD 2G5IC 2Y2OA 4XZQB 3A6NC 3VH5T 1P3LB 5AV8D 1M1AA 5B0YA 5JRGA 5F99C 4HGAB 2CV5B 4KGCC 3B0DB 3LELD 2VQRA 3AZED 4LD9A 5B24C 2YFWA 3UT9B 4H9OB 4DQYB 3MVDB 3W97D 1P3AB 4H9NA 5B0ZC 3H0RC 3MGRB 1P3FA 5AV8C 4NE5A 5CPKD 2BYMA 2HIOA 1M18D 4KUDB 5AVCB 5KDMB 3AZHB 2Y2PA 4J8VB 5CPJD 3EPHA 3UTAB 3X1VC 3B6FD 3FDDA 5DNMA 2DQNC 3AZJC 3KUYC 4UUZB 1P3OC 3W97A 1U35A 3UTBA 3AV2A 4WNNB 3WKJA 5KDMA 5GXQB 5AVCA 3AZNB 5CPJC 4JJNC 5GT3C 4WU9C 5B31D 3NQUB 3AZLC 1KX3A 3W99A 1ID3D 4YM6B 2FJ7A 5B1LD 1P3KC 1BH8B 3UTBB 3B6GC 3TU4D 4QLCA 5JRGB 2CV5A 1Q9CA 4Z5TD 4XUJB 1P3IB 2BG1A 4Z66D 2NQBA 3KUYB 5B24A 4NFTA 2YFWB 1HQ3D 2Y2MA 4H9RB 3WTPB 4ZUXA 3EPLA 2W8SA 5AV9D 4J8UA 1F66A 4G91B 5AV9B 3MGSD 2YFVB 2JCHA 3V9RA 3LZ1B 3RELA 2Y2NA 2DF4C 3LELC 3C1BA 3REJC 1P3ID 2RVQD 3AZEC 3AZGA 3X1TA 3VH6T 1M19A 3X1VA 3W96A 3REIC 3AZFA 4YM6D 1P3MA 1ZLAC 3AFAC 5B1LB 5B2JC 5CPIB 3AZIB 5B2IC 1P3LA 3V9RB 5E5AD 3LZ1A 5AV5B 5B0YC 4WU8B 3REJD 3AV1A 1P3IC 4KUDC 3AZNA 3AV2B 1R4VA 3AZHD 3X1VD 2ZY4A 3AZGD 3X1SA 3X1TB 4H9QA 5AV6B 2PYOA 3AN2D 3W99C 1KX3C 1TAFB 1N1JB 4J8XA 4H9PB 5B0ZA 4WV4B 1M18B 4KUDD 1Z2CB 4X23B 3AV1B 5B31C 3X1UB 3LJAA 3X1UD 5CP6C 1P3AD 3AZJA 2PYOB 3AZIC 1S32A 3WAAD 3F6TA 3IP4C 1KX4B 5F99A 3WAAB 3UTBC 3NQJA 1P3LD 4Z66C 1M1AB 4JJNA 3X1TC 4CAYB 1P3PB 2IO5B 1P34A 5BS7C 5GT0A 3MGQD 3AFAA 1P3GA 3UT9A 5B2JA 1BFMA 1HQ3B 3WTPD 4G91C 4YS3A 5BO0A 3B0BA 4J8XD 2Y2IA 4AWLC 2Y2JA 5B1MC 3B0DC 1EQZC 4QLCB 3W98D 3REID 3LZ0C 2PYOC 5B2JD 5AY8A 4ZUXC 5GT0D 1U35C 1P3GD 1F66C 1P3BB 5AV8B 5CPID 5FUGB 3A6ND 4XZQA 3X1UA 5F99D 4X23A 2JE5A 3W98C 3AZEA 3AZGC 3WKJB 2ZM5A 1S32D 5B32G 1P3PC 2FJ7C 3VH5A 1S32B 3W99B 1P3KA 3RELD 3KWQD 1P3FB 2F8ND 2LY8A 4H9NB 5B0ZD 1AOIB 4AWLB 5CPKB 5B33C 3AZMA 2NZDB 5B32A 2NQBC 3WTPE 4X23D 3C1CA 5GT0B 4Z5TA 3UT9D 3KWQA 5BNXA 3MVDD 3AZID 1N1JA 5E5AA 5B40D 2Y2LA 1H3OB 2JSSA 1P3OD 4J8WA 3AZKD 5B33D 3B6GB 1M19C 3AZMB 1W2EA 3AZGB 3A6NA 3REIA 5B31A 3C1BB 4JJND 3C1BD 3H0LC 3MVDA 3LJAB 3WTPC 3LJAD 3AZFD 1P3MD 3AZKA 5GSUD 5BNVA 3W96D 1KX4A 5B33B 4J8WB 3MNND 2HIOB 4KUDA 4WU8A 3AZMD 5JRGD 5B32D 1TZYB 3KXBB 5G49B 3TU4C 4Z66A 1BH9B 4HGAC 3REIB 3REJB 3KFUG 5GT0C 4ZUXD 1F66D 1P3GC 3X1SD 1HQ3A 4H9RA 5GSUC 4WZSB 3R45B 4YS3C 5CPIC 1A7WA 4H9PA 5AV5C 5B0ZB 3AZMC 3AYWD 5B32C 3MGPB 3REKB 4XZQD 4R8PC 3C1CC 3W98B 3WKJC 4LD9B 2AROC 3B6FC 2FJ7D 1HTAA 4M6BA 4YM6A 4J8WD 2BYKA 5AV6C 3AZJB 5AV5D 3AYWC 5B2ID 5GXQC 4XZQC 5AVCD 3A6NB 3NQJB 2NZDC 4WU8D 4Z2MG 5CPJB 4J8VA 3MNNA 4X23C 3AZHA 3W98A 2XD1A 3UT9C 1P3GB 3MVDC 5GT3B 4WU9B 3MGQA 1P34B 3AZLD 1KX5B 3WA9C 4E44A 1P34D 1T3UA 5BT1C 5B40B 1P3KB 1P3FD 1KX4C 3MGSA 1P3KD 4WNNA 2HIOD 1M18A 4Z2MH 5B32B 3MGPC 3REKC 4LD9C 2Y2KA 3VH6A 3LZ1D 4H9SC 1BH9A 3LELA 3C1BC 1B6WA 2F2AC 3NQUA 3MGQB 3AZJD 1P3AA 2IO5C 3KUYD 1HQ3C 3R45A 3W96C 5DNNC 5AY8B 5AVBD 3WAAA 5AY8D 1H3OA 3UTBD 3A1KA 1TZYC 3KXBC 4EO5B 3LZ1C 1P3PA 5GT3D 4WU9D 4R8PA 3EPKA 1EQZB 3LELB 5DNMB 4YM6C 3AN2A 1ZLAD 1ID3C 5AVBB 5BNVB 5C3IB 4YS3D 3B0CT 2ZY5A 4KHAA 3REHB 1P3BC 5B1LC 2Y2HA 1U35B 4WJ3C 5B0YB 1PZRA 4KGCD 4E45A 5JA4B 5G49A 2FFFB 4Z5TC 4NE3A 4XUJC 4ZBJC 3P5JB 3W96B 2FJ7B 3W99D 3O62A 5AV6D 1U35D 1KX3B 5B40A 3MGSC 5E5AB 5FUGA 3MGRA 2CV5C 4KGCB 3AZIA 5CPKC 1M18C 4EO5C 4H9SA 1ZLAB 3WTPA 5B2JB 2G5HC 5B24B 5CP6D 1P3AC 3WA9D 3AFAD 1KX5D 1P34C 5BT1D 3B0CW 2F8NA 1TAFA 3RELC 3WAAC 2CV5D 3AL0C 5AV9A 4J8UD 3TU4A 5GXQA 4LD9D 3MNNB 2ZY2A 3X1VB 2NQBD 3AZHC 3VH6W 3KSYA 4Z66B 1EQZA 3AN2C 1KX3D 1KX5A 3MGQC 3KWQB 5CPIA 3WA9A 1P3BA 1WWSA 4H9OA 2HUEB 5B1LA 4KHAB 3REHA 5AY8C 1P3OB 5AVBA 3AZNC 3B6GD 2L5AA 4DRBA 2BYMB 4NE6A 5B1MB 2AROA 1M19D 5CP6B 2ZY3A 4XUJA 3AZLB
chains in the Genus database with same CATH topology
4JJNB 5B31B 3X1UC 2BYKB 5AV6A 2PYOD 3UTAA 5DNMD 3X1SB 3O62C 4CSRB 4J8UB 5GSUB 5DNNA 3AZKB 2NZDA 3AZND 5CPKA 3W97B 3MNNC 1M1AC 5JRGC 1AOID 4KGCA 2RVQC 5CP6A 4Z5TB 4XUJD 2AROB 3C1CB 4QLCD 4G92B 2J8PA 1S32C 4DRAA 4J8VD 3AZFB 1P3MB 5B31G 3UTAD 3AN2B 1JFIA 3B6FB 3KWQC 5E5AC 2F8NB 3MGPA 3REKA 3AYWB 5JA4A 5AV8A 5B0YD 1M1AD 1AOIC 2RIQA 1KU5A 5CHLB 5BS7A 3B6GA 3LZ0B 4QLCC 3AZEB 4ZUXB 1F66B 3WKJD 1KX5C 3AFAB 3KUYA 5B24D 3WA9B 1F1EA 4UUZA 4J8XB 5B40C 3W97C 3RELB 4J8UC 1TZYA 3KXBA 3AZKC 5B1MA 1ULYA 2YFVA 5B2IB 5BO0B 3EG5B 3H0MC 3AV2C 5GXQD 5AVCC 2F8NG 2NZDD 4WU8C 3LZ0A 5CPJA 1M19B 3REJA 3AV1D 1ID3A 1P3PD 3AZLA 2Y2QA 4G92C 5BNXB 3AZFC 3MGRD 1P3MC 2F8NK 2HUEC 1P3FC 1KX4D 3EPJA 1BH8A 5GSUA 5DNNB 5F99B 3AV2D 3TU4B 2HIOC 5B2IA 1P3LC 2UWXA 2F8NH 3X1TD 5AV5A 3MGPD 3REKD 2NQBB 4UPKA 1B67A 3AV1C 1P3IA 4CAYA 3A1IA 5DNMC 3O62D 1ID3B 4H9QB 5C3IC 3O62B 3X1SC 3MGRC 1JFIB 3B6FA 4YS3B 5B33A 3REHC 1P3OA 5DNND 5AVBC 4J8XC 3VH5W 2Y2GA 1AOIA 2CWEA 5B1MD 1EQZD 3AYWA 1WWIA 1TZYD 4R8PB 2XD5A 3KXBD 5GT3A 4R8PD 3C1CD 4WU9A 3LZ0D 2AROD 4ZBJB 4J8VC 1ZLAA 3UTAC 3LJAC 4CSRA 4J8WC 5AV9C 3REHD 3MGSB 1P3BD 2G5IC 2Y2OA 4XZQB 3A6NC 3VH5T 1P3LB 5AV8D 1M1AA 5B0YA 5JRGA 5F99C 4HGAB 2CV5B 4KGCC 3B0DB 3LELD 2VQRA 3AZED 4LD9A 5B24C 2YFWA 3UT9B 4H9OB 4DQYB 3MVDB 3W97D 1P3AB 4H9NA 5B0ZC 3H0RC 3MGRB 1P3FA 5AV8C 4NE5A 5CPKD 2BYMA 2HIOA 1M18D 4KUDB 5AVCB 5KDMB 3AZHB 2Y2PA 4J8VB 5CPJD 3EPHA 3UTAB 3X1VC 3B6FD 3FDDA 5DNMA 2DQNC 3AZJC 3KUYC 4UUZB 1P3OC 3W97A 1U35A 3UTBA 3AV2A 4WNNB 3WKJA 5KDMA 5GXQB 5AVCA 3AZNB 5CPJC 4JJNC 5GT3C 4WU9C 5B31D 3NQUB 3AZLC 1KX3A 3W99A 1ID3D 4YM6B 2FJ7A 5B1LD 1P3KC 1BH8B 3UTBB 3B6GC 3TU4D 4QLCA 5JRGB 2CV5A 1Q9CA 4Z5TD 4XUJB 1P3IB 2BG1A 4Z66D 2NQBA 3KUYB 5B24A 4NFTA 2YFWB 1HQ3D 2Y2MA 4H9RB 3WTPB 4ZUXA 3EPLA 2W8SA 5AV9D 4J8UA 1F66A 4G91B 5AV9B 3MGSD 2YFVB 2JCHA 3V9RA 3LZ1B 3RELA 2Y2NA 2DF4C 3LELC 3C1BA 3REJC 1P3ID 2RVQD 3AZEC 3AZGA 3X1TA 3VH6T 1M19A 3X1VA 3W96A 3REIC 3AZFA 4YM6D 1P3MA 1ZLAC 3AFAC 5B1LB 5B2JC 5CPIB 3AZIB 5B2IC 1P3LA 3V9RB 5E5AD 3LZ1A 5AV5B 5B0YC 4WU8B 3REJD 3AV1A 1P3IC 4KUDC 3AZNA 3AV2B 1R4VA 3AZHD 3X1VD 2ZY4A 3AZGD 3X1SA 3X1TB 4H9QA 5AV6B 2PYOA 3AN2D 3W99C 1KX3C 1TAFB 1N1JB 4J8XA 4H9PB 5B0ZA 4WV4B 1M18B 4KUDD 1Z2CB 4X23B 3AV1B 5B31C 3X1UB 3LJAA 3X1UD 5CP6C 1P3AD 3AZJA 2PYOB 3AZIC 1S32A 3WAAD 3F6TA 3IP4C 1KX4B 5F99A 3WAAB 3UTBC 3NQJA 1P3LD 4Z66C 1M1AB 4JJNA 3X1TC 4CAYB 1P3PB 2IO5B 1P34A 5BS7C 5GT0A 3MGQD 3AFAA 1P3GA 3UT9A 5B2JA 1BFMA 1HQ3B 3WTPD 4G91C 4YS3A 5BO0A 3B0BA 4J8XD 2Y2IA 4AWLC 2Y2JA 5B1MC 3B0DC 1EQZC 4QLCB 3W98D 3REID 3LZ0C 2PYOC 5B2JD 5AY8A 4ZUXC 5GT0D 1U35C 1P3GD 1F66C 1P3BB 5AV8B 5CPID 5FUGB 3A6ND 4XZQA 3X1UA 5F99D 4X23A 2JE5A 3W98C 3AZEA 3AZGC 3WKJB 2ZM5A 1S32D 5B32G 1P3PC 2FJ7C 3VH5A 1S32B 3W99B 1P3KA 3RELD 3KWQD 1P3FB 2F8ND 2LY8A 4H9NB 5B0ZD 1AOIB 4AWLB 5CPKB 5B33C 3AZMA 2NZDB 5B32A 2NQBC 3WTPE 4X23D 3C1CA 5GT0B 4Z5TA 3UT9D 3KWQA 5BNXA 3MVDD 3AZID 1N1JA 5E5AA 5B40D 2Y2LA 1H3OB 2JSSA 1P3OD 4J8WA 3AZKD 5B33D 3B6GB 1M19C 3AZMB 1W2EA 3AZGB 3A6NA 3REIA 5B31A 3C1BB 4JJND 3C1BD 3H0LC 3MVDA 3LJAB 3WTPC 3LJAD 3AZFD 1P3MD 3AZKA 5GSUD 5BNVA 3W96D 1KX4A 5B33B 4J8WB 3MNND 2HIOB 4KUDA 4WU8A 3AZMD 5JRGD 5B32D 1TZYB 3KXBB 5G49B 3TU4C 4Z66A 1BH9B 4HGAC 3REIB 3REJB 3KFUG 5GT0C 4ZUXD 1F66D 1P3GC 3X1SD 1HQ3A 4H9RA 5GSUC 4WZSB 3R45B 4YS3C 5CPIC 1A7WA 4H9PA 5AV5C 5B0ZB 3AZMC 3AYWD 5B32C 3MGPB 3REKB 4XZQD 4R8PC 3C1CC 3W98B 3WKJC 4LD9B 2AROC 3B6FC 2FJ7D 1HTAA 4M6BA 4YM6A 4J8WD 2BYKA 5AV6C 3AZJB 5AV5D 3AYWC 5B2ID 5GXQC 4XZQC 5AVCD 3A6NB 3NQJB 2NZDC 4WU8D 4Z2MG 5CPJB 4J8VA 3MNNA 4X23C 3AZHA 3W98A 2XD1A 3UT9C 1P3GB 3MVDC 5GT3B 4WU9B 3MGQA 1P34B 3AZLD 1KX5B 3WA9C 4E44A 1P34D 1T3UA 5BT1C 5B40B 1P3KB 1P3FD 1KX4C 3MGSA 1P3KD 4WNNA 2HIOD 1M18A 4Z2MH 5B32B 3MGPC 3REKC 4LD9C 2Y2KA 3VH6A 3LZ1D 4H9SC 1BH9A 3LELA 3C1BC 1B6WA 2F2AC 3NQUA 3MGQB 3AZJD 1P3AA 2IO5C 3KUYD 1HQ3C 3R45A 3W96C 5DNNC 5AY8B 5AVBD 3WAAA 5AY8D 1H3OA 3UTBD 3A1KA 1TZYC 3KXBC 4EO5B 3LZ1C 1P3PA 5GT3D 4WU9D 4R8PA 3EPKA 1EQZB 3LELB 5DNMB 4YM6C 3AN2A 1ZLAD 1ID3C 5AVBB 5BNVB 5C3IB 4YS3D 3B0CT 2ZY5A 4KHAA 3REHB 1P3BC 5B1LC 2Y2HA 1U35B 4WJ3C 5B0YB 1PZRA 4KGCD 4E45A 5JA4B 5G49A 2FFFB 4Z5TC 4NE3A 4XUJC 4ZBJC 3P5JB 3W96B 2FJ7B 3W99D 3O62A 5AV6D 1U35D 1KX3B 5B40A 3MGSC 5E5AB 5FUGA 3MGRA 2CV5C 4KGCB 3AZIA 5CPKC 1M18C 4EO5C 4H9SA 1ZLAB 3WTPA 5B2JB 2G5HC 5B24B 5CP6D 1P3AC 3WA9D 3AFAD 1KX5D 1P34C 5BT1D 3B0CW 2F8NA 1TAFA 3RELC 3WAAC 2CV5D 3AL0C 5AV9A 4J8UD 3TU4A 5GXQA 4LD9D 3MNNB 2ZY2A 3X1VB 2NQBD 3AZHC 3VH6W 3KSYA 4Z66B 1EQZA 3AN2C 1KX3D 1KX5A 3MGQC 3KWQB 5CPIA 3WA9A 1P3BA 1WWSA 4H9OA 2HUEB 5B1LA 4KHAB 3REHA 5AY8C 1P3OB 5AVBA 3AZNC 3B6GD 2L5AA 4DRBA 2BYMB 4NE6A 5B1MB 2AROA 1M19D 5CP6B 2ZY3A 4XUJA 3AZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN B;  5B31 B;  3X1U C;  2BYK B;  5AV6 A;  2PYO D;  3UTA A;  5DNM D;  3X1S B;  3O62 C;  4CSR B;  4J8U B;  5GSU B;  5DNN A;  3AZK B;  2NZD A;  3AZN D;  5CPK A;  3W97 B;  3MNN C;  1M1A C;  5JRG C;  1AOI D;  4KGC A;  2RVQ C;  5CP6 A;  4Z5T B;  4XUJ D;  2ARO B;  3C1C B;  4QLC D;  4G92 B;  1S32 C;  4DRA A;  4J8V D;  3AZF B;  1P3M B;  5B31 G;  3UTA D;  3AN2 B;  1JFI A;  3B6F B;  3KWQ C;  5E5A C;  2F8N B;  3MGP A;  3REK A;  3AYW B;  5JA4 A;  5AV8 A;  5B0Y D;  1M1A D;  1AOI C;  1KU5 A;  5CHL B;  5BS7 A;  3B6G A;  3LZ0 B;  4QLC C;  3AZE B;  4ZUX B;  1F66 B;  3WKJ D;  1KX5 C;  3AFA B;  3KUY A;  5B24 D;  3WA9 B;  1F1E A;  4UUZ A;  4J8X B;  5B40 C;  3W97 C;  3REL B;  4J8U C;  1TZY A;  3KXB A;  3AZK C;  5B1M A;  1ULY A;  2YFV A;  5B2I B;  5BO0 B;  3AV2 C;  5GXQ D;  5AVC C;  2F8N G;  2NZD D;  4WU8 C;  3LZ0 A;  5CPJ A;  1M19 B;  3REJ A;  3AV1 D;  1ID3 A;  1P3P D;  3AZL A;  4G92 C;  5BNX B;  3AZF C;  3MGR D;  1P3M C;  2F8N K;  2HUE C;  1P3F C;  1KX4 D;  1BH8 A;  5GSU A;  5DNN B;  5F99 B;  3AV2 D;  3TU4 B;  2HIO C;  5B2I A;  1P3L C;  2F8N H;  3X1T D;  5AV5 A;  3MGP D;  3REK D;  2NQB B;  1B67 A;  3AV1 C;  1P3I A;  4CAY A;  5DNM C;  3O62 D;  1ID3 B;  4H9Q B;  5C3I C;  3O62 B;  3X1S C;  3MGR C;  1JFI B;  3B6F A;  4YS3 B;  5B33 A;  3REH C;  1P3O A;  5DNN D;  5AVB C;  4J8X C;  3VH5 W;  1AOI A;  2CWE A;  5B1M D;  1EQZ D;  3AYW A;  1WWI A;  3KXB D;  1TZY D;  4R8P B;  5GT3 A;  4R8P D;  3C1C D;  4WU9 A;  3LZ0 D;  2ARO D;  4ZBJ B;  4J8V C;  1ZLA A;  3UTA C;  3LJA C;  4CSR A;  4J8W C;  5AV9 C;  3REH D;  3MGS B;  1P3B D;  3A6N C;  4XZQ B;  3VH5 T;  1P3L B;  5AV8 D;  1M1A A;  5B0Y A;  5JRG A;  5F99 C;  4HGA B;  2CV5 B;  4KGC C;  3B0D B;  3LEL D;  3AZE D;  4LD9 A;  5B24 C;  2YFW A;  3UT9 B;  4H9O B;  3MVD B;  3W97 D;  1P3A B;  4H9N A;  5B0Z C;  3MGR B;  1P3F A;  5AV8 C;  4NE5 A;  5CPK D;  2BYM A;  2HIO A;  1M18 D;  4KUD B;  5AVC B;  5KDM B;  3AZH B;  4J8V B;  5CPJ D;  3UTA B;  3X1V C;  3B6F D;  5DNM A;  3AZJ C;  3KUY C;  4UUZ B;  1P3O C;  3W97 A;  1U35 A;  3UTB A;  3AV2 A;  4WNN B;  3WKJ A;  5KDM A;  5GXQ B;  5AVC A;  3AZN B;  5CPJ C;  4JJN C;  5GT3 C;  4WU9 C;  5B31 D;  3NQU B;  3AZL C;  1KX3 A;  3W99 A;  1ID3 D;  4YM6 B;  2FJ7 A;  5B1L D;  1P3K C;  1BH8 B;  3UTB B;  3B6G C;  3TU4 D;  4QLC A;  5JRG B;  2CV5 A;  1Q9C A;  4Z5T D;  4XUJ B;  1P3I B;  4Z66 D;  2NQB A;  3KUY B;  5B24 A;  4NFT A;  2YFW B;  1HQ3 D;  4H9R B;  3WTP B;  4ZUX A;  1F66 A;  5AV9 D;  4J8U A;  4G91 B;  5AV9 B;  3MGS D;  2YFV B;  3V9R A;  3LZ1 B;  3REL A;  3LEL C;  3C1B A;  3REJ C;  1P3I D;  2RVQ D;  3AZE C;  3AZG A;  3X1T A;  3VH6 T;  1M19 A;  3X1V A;  3W96 A;  3REI C;  3AZF A;  4YM6 D;  1P3M A;  1ZLA C;  3AFA C;  5B1L B;  5B2J C;  5CPI B;  3AZI B;  5B2I C;  1P3L A;  3V9R B;  5E5A D;  3LZ1 A;  5AV5 B;  5B0Y C;  4WU8 B;  3REJ D;  3AV1 A;  1P3I C;  4KUD C;  3AZN A;  3AV2 B;  1R4V A;  3AZH D;  3X1V D;  3AZG D;  3X1S A;  3X1T B;  4H9Q A;  5AV6 B;  2PYO A;  3AN2 D;  3W99 C;  1KX3 C;  1TAF B;  1N1J B;  4J8X A;  4H9P B;  5B0Z A;  4WV4 B;  1M18 B;  4KUD D;  4X23 B;  3AV1 B;  5B31 C;  3X1U B;  3LJA A;  3X1U D;  5CP6 C;  1P3A D;  3AZJ A;  2PYO B;  3AZI C;  1S32 A;  3WAA D;  1KX4 B;  5F99 A;  3WAA B;  3UTB C;  3NQJ A;  1P3L D;  4Z66 C;  1M1A B;  4JJN A;  3X1T C;  4CAY B;  1P3P B;  2IO5 B;  1P34 A;  5BS7 C;  5GT0 A;  3MGQ D;  3AFA A;  1P3G A;  3UT9 A;  5B2J A;  1BFM A;  1HQ3 B;  3WTP D;  4G91 C;  4YS3 A;  5BO0 A;  3B0B A;  4J8X D;  4AWL C;  5B1M C;  3B0D C;  1EQZ C;  4QLC B;  3W98 D;  3REI D;  3LZ0 C;  2PYO C;  5B2J D;  5AY8 A;  4ZUX C;  5GT0 D;  1U35 C;  1P3G D;  1F66 C;  1P3B B;  5AV8 B;  5CPI D;  5FUG B;  3A6N D;  4XZQ A;  3X1U A;  5F99 D;  4X23 A;  3W98 C;  3AZE A;  3AZG C;  3WKJ B;  1S32 D;  5B32 G;  1P3P C;  2FJ7 C;  3VH5 A;  1S32 B;  3W99 B;  1P3K A;  3REL D;  3KWQ D;  1P3F B;  2F8N D;  2LY8 A;  4H9N B;  5B0Z D;  1AOI B;  4AWL B;  5CPK B;  5B33 C;  3AZM A;  2NZD B;  5B32 A;  2NQB C;  3WTP E;  4X23 D;  3C1C A;  5GT0 B;  4Z5T A;  3UT9 D;  3KWQ A;  5BNX A;  3MVD D;  3AZI D;  1N1J A;  5E5A A;  5B40 D;  1H3O B;  2JSS A;  1P3O D;  4J8W A;  3AZK D;  5B33 D;  3B6G B;  1M19 C;  3AZM B;  3AZG B;  3A6N A;  3REI A;  5B31 A;  3C1B B;  4JJN D;  3C1B D;  3LJA B;  3MVD A;  3WTP C;  3LJA D;  3AZF D;  1P3M D;  3AZK A;  5GSU D;  5BNV A;  3W96 D;  1KX4 A;  5B33 B;  4J8W B;  3MNN D;  2HIO B;  4KUD A;  4WU8 A;  3AZM D;  5JRG D;  5B32 D;  1TZY B;  3KXB B;  5G49 B;  3TU4 C;  4Z66 A;  1BH9 B;  4HGA C;  3REI B;  3REJ B;  5GT0 C;  4ZUX D;  1F66 D;  1P3G C;  3X1S D;  1HQ3 A;  4H9R A;  5GSU C;  4WZS B;  3R45 B;  4YS3 C;  5CPI C;  1A7W A;  4H9P A;  5AV5 C;  5B0Z B;  3AZM C;  3AYW D;  5B32 C;  3MGP B;  3REK B;  4XZQ D;  4R8P C;  3C1C C;  3W98 B;  3WKJ C;  4LD9 B;  2ARO C;  3B6F C;  2FJ7 D;  1HTA A;  4M6B A;  4YM6 A;  4J8W D;  2BYK A;  5AV6 C;  3AZJ B;  5AV5 D;  3AYW C;  5B2I D;  5GXQ C;  4XZQ C;  5AVC D;  3A6N B;  3NQJ B;  2NZD C;  4WU8 D;  4Z2M G;  5CPJ B;  4J8V A;  3MNN A;  4X23 C;  3AZH A;  3W98 A;  3UT9 C;  1P3G B;  3MVD C;  5GT3 B;  4WU9 B;  3MGQ A;  1P34 B;  3AZL D;  1KX5 B;  3WA9 C;  4E44 A;  1P34 D;  5BT1 C;  5B40 B;  1P3K B;  1P3F D;  1KX4 C;  3MGS A;  1P3K D;  4WNN A;  2HIO D;  1M18 A;  4Z2M H;  5B32 B;  3MGP C;  3REK C;  4LD9 C;  3VH6 A;  3LZ1 D;  4H9S C;  1BH9 A;  3LEL A;  3C1B C;  1B6W A;  3NQU A;  3MGQ B;  3AZJ D;  1P3A A;  2IO5 C;  3KUY D;  1HQ3 C;  3R45 A;  3W96 C;  5DNN C;  5AY8 B;  5AVB D;  3WAA A;  5AY8 D;  1H3O A;  3UTB D;  1TZY C;  3KXB C;  4EO5 B;  3LZ1 C;  1P3P A;  5GT3 D;  4WU9 D;  4R8P A;  1EQZ B;  3LEL B;  5DNM B;  4YM6 C;  3AN2 A;  1ZLA D;  1ID3 C;  5AVB B;  5BNV B;  5C3I B;  4YS3 D;  3B0C T;  1P3B C;  4KHA A;  3REH B;  5B1L C;  1U35 B;  5B0Y B;  4KGC D;  4E45 A;  5JA4 B;  5G49 A;  4Z5T C;  4NE3 A;  4XUJ C;  4ZBJ C;  3W96 B;  2FJ7 B;  3W99 D;  3O62 A;  5AV6 D;  1U35 D;  1KX3 B;  5B40 A;  3MGS C;  5E5A B;  5FUG A;  3MGR A;  2CV5 C;  4KGC B;  3AZI A;  5CPK C;  1M18 C;  4EO5 C;  4H9S A;  1ZLA B;  3WTP A;  5B2J B;  5B24 B;  5CP6 D;  1P3A C;  3WA9 D;  3AFA D;  1KX5 D;  1P34 C;  5BT1 D;  3B0C W;  2F8N A;  1TAF A;  3REL C;  3WAA C;  2CV5 D;  5AV9 A;  4J8U D;  3TU4 A;  5GXQ A;  4LD9 D;  3MNN B;  3X1V B;  2NQB D;  3AZH C;  3VH6 W;  3KSY A;  4Z66 B;  1EQZ A;  3AN2 C;  1KX3 D;  1KX5 A;  3MGQ C;  3KWQ B;  5CPI A;  3WA9 A;  1P3B A;  1WWS A;  4H9O A;  2HUE B;  5B1L A;  4KHA B;  3REH A;  5AY8 C;  1P3O B;  5AVB A;  3AZN C;  3B6G D;  2L5A A;  4DRB A;  2BYM B;  4NE6 A;  5B1M B;  2ARO A;  1M19 D;  5CP6 B;  4XUJ A;  3AZL B; 
#chains in the Genus database with same CATH topology
 4JJN B;  5B31 B;  3X1U C;  2BYK B;  5AV6 A;  2PYO D;  3UTA A;  5DNM D;  3X1S B;  3O62 C;  4CSR B;  4J8U B;  5GSU B;  5DNN A;  3AZK B;  2NZD A;  3AZN D;  5CPK A;  3W97 B;  3MNN C;  1M1A C;  5JRG C;  1AOI D;  4KGC A;  2RVQ C;  5CP6 A;  4Z5T B;  4XUJ D;  2ARO B;  3C1C B;  4QLC D;  4G92 B;  2J8P A;  1S32 C;  4DRA A;  4J8V D;  3AZF B;  1P3M B;  5B31 G;  3UTA D;  3AN2 B;  1JFI A;  3B6F B;  3KWQ C;  5E5A C;  2F8N B;  3MGP A;  3REK A;  3AYW B;  5JA4 A;  5AV8 A;  5B0Y D;  1M1A D;  1AOI C;  2RIQ A;  1KU5 A;  5CHL B;  5BS7 A;  3B6G A;  3LZ0 B;  4QLC C;  3AZE B;  4ZUX B;  1F66 B;  3WKJ D;  1KX5 C;  3AFA B;  3KUY A;  5B24 D;  3WA9 B;  1F1E A;  4UUZ A;  4J8X B;  5B40 C;  3W97 C;  3REL B;  4J8U C;  1TZY A;  3KXB A;  3AZK C;  5B1M A;  1ULY A;  2YFV A;  5B2I B;  5BO0 B;  3EG5 B;  3H0M C;  3AV2 C;  5GXQ D;  5AVC C;  2F8N G;  2NZD D;  4WU8 C;  3LZ0 A;  5CPJ A;  1M19 B;  3REJ A;  3AV1 D;  1ID3 A;  1P3P D;  3AZL A;  2Y2Q A;  4G92 C;  5BNX B;  3AZF C;  3MGR D;  1P3M C;  2F8N K;  2HUE C;  1P3F C;  1KX4 D;  3EPJ A;  1BH8 A;  5GSU A;  5DNN B;  5F99 B;  3AV2 D;  3TU4 B;  2HIO C;  5B2I A;  1P3L C;  2UWX A;  2F8N H;  3X1T D;  5AV5 A;  3MGP D;  3REK D;  2NQB B;  4UPK A;  1B67 A;  3AV1 C;  1P3I A;  4CAY A;  3A1I A;  5DNM C;  3O62 D;  1ID3 B;  4H9Q B;  5C3I C;  3O62 B;  3X1S C;  3MGR C;  1JFI B;  3B6F A;  4YS3 B;  5B33 A;  3REH C;  1P3O A;  5DNN D;  5AVB C;  4J8X C;  3VH5 W;  2Y2G A;  1AOI A;  2CWE A;  5B1M D;  1EQZ D;  3AYW A;  1WWI A;  1TZY D;  4R8P B;  2XD5 A;  3KXB D;  5GT3 A;  4R8P D;  3C1C D;  4WU9 A;  3LZ0 D;  2ARO D;  4ZBJ B;  4J8V C;  1ZLA A;  3UTA C;  3LJA C;  4CSR A;  4J8W C;  5AV9 C;  3REH D;  3MGS B;  1P3B D;  2G5I C;  2Y2O A;  4XZQ B;  3A6N C;  3VH5 T;  1P3L B;  5AV8 D;  1M1A A;  5B0Y A;  5JRG A;  5F99 C;  4HGA B;  2CV5 B;  4KGC C;  3B0D B;  3LEL D;  2VQR A;  3AZE D;  4LD9 A;  5B24 C;  2YFW A;  3UT9 B;  4H9O B;  4DQY B;  3MVD B;  3W97 D;  1P3A B;  4H9N A;  5B0Z C;  3H0R C;  3MGR B;  1P3F A;  5AV8 C;  4NE5 A;  5CPK D;  2BYM A;  2HIO A;  1M18 D;  4KUD B;  5AVC B;  5KDM B;  3AZH B;  2Y2P A;  4J8V B;  5CPJ D;  3EPH A;  3UTA B;  3X1V C;  3B6F D;  3FDD A;  5DNM A;  2DQN C;  3AZJ C;  3KUY C;  4UUZ B;  1P3O C;  3W97 A;  1U35 A;  3UTB A;  3AV2 A;  4WNN B;  3WKJ A;  5KDM A;  5GXQ B;  5AVC A;  3AZN B;  5CPJ C;  4JJN C;  5GT3 C;  4WU9 C;  5B31 D;  3NQU B;  3AZL C;  1KX3 A;  3W99 A;  1ID3 D;  4YM6 B;  2FJ7 A;  5B1L D;  1P3K C;  1BH8 B;  3UTB B;  3B6G C;  3TU4 D;  4QLC A;  5JRG B;  2CV5 A;  1Q9C A;  4Z5T D;  4XUJ B;  1P3I B;  2BG1 A;  4Z66 D;  2NQB A;  3KUY B;  5B24 A;  4NFT A;  2YFW B;  1HQ3 D;  2Y2M A;  4H9R B;  3WTP B;  4ZUX A;  3EPL A;  2W8S A;  5AV9 D;  4J8U A;  1F66 A;  4G91 B;  5AV9 B;  3MGS D;  2YFV B;  2JCH A;  3V9R A;  3LZ1 B;  3REL A;  2Y2N A;  2DF4 C;  3LEL C;  3C1B A;  3REJ C;  1P3I D;  2RVQ D;  3AZE C;  3AZG A;  3X1T A;  3VH6 T;  1M19 A;  3X1V A;  3W96 A;  3REI C;  3AZF A;  4YM6 D;  1P3M A;  1ZLA C;  3AFA C;  5B1L B;  5B2J C;  5CPI B;  3AZI B;  5B2I C;  1P3L A;  3V9R B;  5E5A D;  3LZ1 A;  5AV5 B;  5B0Y C;  4WU8 B;  3REJ D;  3AV1 A;  1P3I C;  4KUD C;  3AZN A;  3AV2 B;  1R4V A;  3AZH D;  3X1V D;  2ZY4 A;  3AZG D;  3X1S A;  3X1T B;  4H9Q A;  5AV6 B;  2PYO A;  3AN2 D;  3W99 C;  1KX3 C;  1TAF B;  1N1J B;  4J8X A;  4H9P B;  5B0Z A;  4WV4 B;  1M18 B;  4KUD D;  1Z2C B;  4X23 B;  3AV1 B;  5B31 C;  3X1U B;  3LJA A;  3X1U D;  5CP6 C;  1P3A D;  3AZJ A;  2PYO B;  3AZI C;  1S32 A;  3WAA D;  3F6T A;  3IP4 C;  1KX4 B;  5F99 A;  3WAA B;  3UTB C;  3NQJ A;  1P3L D;  4Z66 C;  1M1A B;  4JJN A;  3X1T C;  4CAY B;  1P3P B;  2IO5 B;  1P34 A;  5BS7 C;  5GT0 A;  3MGQ D;  3AFA A;  1P3G A;  3UT9 A;  5B2J A;  1BFM A;  1HQ3 B;  3WTP D;  4G91 C;  4YS3 A;  5BO0 A;  3B0B A;  4J8X D;  2Y2I A;  4AWL C;  2Y2J A;  5B1M C;  3B0D C;  1EQZ C;  4QLC B;  3W98 D;  3REI D;  3LZ0 C;  2PYO C;  5B2J D;  5AY8 A;  4ZUX C;  5GT0 D;  1U35 C;  1P3G D;  1F66 C;  1P3B B;  5AV8 B;  5CPI D;  5FUG B;  3A6N D;  4XZQ A;  3X1U A;  5F99 D;  4X23 A;  2JE5 A;  3W98 C;  3AZE A;  3AZG C;  3WKJ B;  2ZM5 A;  1S32 D;  5B32 G;  1P3P C;  2FJ7 C;  3VH5 A;  1S32 B;  3W99 B;  1P3K A;  3REL D;  3KWQ D;  1P3F B;  2F8N D;  2LY8 A;  4H9N B;  5B0Z D;  1AOI B;  4AWL B;  5CPK B;  5B33 C;  3AZM A;  2NZD B;  5B32 A;  2NQB C;  3WTP E;  4X23 D;  3C1C A;  5GT0 B;  4Z5T A;  3UT9 D;  3KWQ A;  5BNX A;  3MVD D;  3AZI D;  1N1J A;  5E5A A;  5B40 D;  2Y2L A;  1H3O B;  2JSS A;  1P3O D;  4J8W A;  3AZK D;  5B33 D;  3B6G B;  1M19 C;  3AZM B;  1W2E A;  3AZG B;  3A6N A;  3REI A;  5B31 A;  3C1B B;  4JJN D;  3C1B D;  3H0L C;  3MVD A;  3LJA B;  3WTP C;  3LJA D;  3AZF D;  1P3M D;  3AZK A;  5GSU D;  5BNV A;  3W96 D;  1KX4 A;  5B33 B;  4J8W B;  3MNN D;  2HIO B;  4KUD A;  4WU8 A;  3AZM D;  5JRG D;  5B32 D;  1TZY B;  3KXB B;  5G49 B;  3TU4 C;  4Z66 A;  1BH9 B;  4HGA C;  3REI B;  3REJ B;  3KFU G;  5GT0 C;  4ZUX D;  1F66 D;  1P3G C;  3X1S D;  1HQ3 A;  4H9R A;  5GSU C;  4WZS B;  3R45 B;  4YS3 C;  5CPI C;  1A7W A;  4H9P A;  5AV5 C;  5B0Z B;  3AZM C;  3AYW D;  5B32 C;  3MGP B;  3REK B;  4XZQ D;  4R8P C;  3C1C C;  3W98 B;  3WKJ C;  4LD9 B;  2ARO C;  3B6F C;  2FJ7 D;  1HTA A;  4M6B A;  4YM6 A;  4J8W D;  2BYK A;  5AV6 C;  3AZJ B;  5AV5 D;  3AYW C;  5B2I D;  5GXQ C;  4XZQ C;  5AVC D;  3A6N B;  3NQJ B;  2NZD C;  4WU8 D;  4Z2M G;  5CPJ B;  4J8V A;  3MNN A;  4X23 C;  3AZH A;  3W98 A;  2XD1 A;  3UT9 C;  1P3G B;  3MVD C;  5GT3 B;  4WU9 B;  3MGQ A;  1P34 B;  3AZL D;  1KX5 B;  3WA9 C;  4E44 A;  1P34 D;  1T3U A;  5BT1 C;  5B40 B;  1P3K B;  1P3F D;  1KX4 C;  3MGS A;  1P3K D;  4WNN A;  2HIO D;  1M18 A;  4Z2M H;  5B32 B;  3MGP C;  3REK C;  4LD9 C;  2Y2K A;  3VH6 A;  3LZ1 D;  4H9S C;  1BH9 A;  3LEL A;  3C1B C;  1B6W A;  2F2A C;  3NQU A;  3MGQ B;  3AZJ D;  1P3A A;  2IO5 C;  3KUY D;  1HQ3 C;  3R45 A;  3W96 C;  5DNN C;  5AY8 B;  5AVB D;  3WAA A;  5AY8 D;  1H3O A;  3UTB D;  3A1K A;  1TZY C;  3KXB C;  4EO5 B;  3LZ1 C;  1P3P A;  5GT3 D;  4WU9 D;  4R8P A;  3EPK A;  1EQZ B;  3LEL B;  5DNM B;  4YM6 C;  3AN2 A;  1ZLA D;  1ID3 C;  5AVB B;  5BNV B;  5C3I B;  4YS3 D;  3B0C T;  2ZY5 A;  4KHA A;  3REH B;  1P3B C;  5B1L C;  2Y2H A;  1U35 B;  4WJ3 C;  5B0Y B;  1PZR A;  4KGC D;  4E45 A;  5JA4 B;  5G49 A;  2FFF B;  4Z5T C;  4NE3 A;  4XUJ C;  4ZBJ C;  3P5J B;  3W96 B;  2FJ7 B;  3W99 D;  3O62 A;  5AV6 D;  1U35 D;  1KX3 B;  5B40 A;  3MGS C;  5E5A B;  5FUG A;  3MGR A;  2CV5 C;  4KGC B;  3AZI A;  5CPK C;  1M18 C;  4EO5 C;  4H9S A;  1ZLA B;  3WTP A;  5B2J B;  2G5H C;  5B24 B;  5CP6 D;  1P3A C;  3WA9 D;  3AFA D;  1KX5 D;  1P34 C;  5BT1 D;  3B0C W;  2F8N A;  1TAF A;  3REL C;  3WAA C;  2CV5 D;  3AL0 C;  5AV9 A;  4J8U D;  3TU4 A;  5GXQ A;  4LD9 D;  3MNN B;  2ZY2 A;  3X1V B;  2NQB D;  3AZH C;  3VH6 W;  3KSY A;  4Z66 B;  1EQZ A;  3AN2 C;  1KX3 D;  1KX5 A;  3MGQ C;  3KWQ B;  5CPI A;  3WA9 A;  1P3B A;  1WWS A;  4H9O A;  2HUE B;  5B1L A;  4KHA B;  3REH A;  5AY8 C;  1P3O B;  5AVB A;  3AZN C;  3B6G D;  2L5A A;  4DRB A;  2BYM B;  4NE6 A;  5B1M B;  2ARO A;  1M19 D;  5CP6 B;  2ZY3 A;  4XUJ A;  3AZL B; 
#chains in the Genus database with same CATH homology
 4JJN B;  5B31 B;  3X1U C;  2BYK B;  5AV6 A;  2PYO D;  3UTA A;  5DNM D;  3X1S B;  3O62 C;  4CSR B;  4J8U B;  5GSU B;  5DNN A;  3AZK B;  2NZD A;  3AZN D;  5CPK A;  3W97 B;  3MNN C;  1M1A C;  5JRG C;  1AOI D;  4KGC A;  2RVQ C;  5CP6 A;  4Z5T B;  4XUJ D;  2ARO B;  3C1C B;  4QLC D;  4G92 B;  2J8P A;  1S32 C;  4DRA A;  4J8V D;  3AZF B;  1P3M B;  5B31 G;  3UTA D;  3AN2 B;  1JFI A;  3B6F B;  3KWQ C;  5E5A C;  2F8N B;  3MGP A;  3REK A;  3AYW B;  5JA4 A;  5AV8 A;  5B0Y D;  1M1A D;  1AOI C;  2RIQ A;  1KU5 A;  5CHL B;  5BS7 A;  3B6G A;  3LZ0 B;  4QLC C;  3AZE B;  4ZUX B;  1F66 B;  3WKJ D;  1KX5 C;  3AFA B;  3KUY A;  5B24 D;  3WA9 B;  1F1E A;  4UUZ A;  4J8X B;  5B40 C;  3W97 C;  3REL B;  4J8U C;  1TZY A;  3KXB A;  3AZK C;  5B1M A;  1ULY A;  2YFV A;  5B2I B;  5BO0 B;  3EG5 B;  3H0M C;  3AV2 C;  5GXQ D;  5AVC C;  2F8N G;  2NZD D;  4WU8 C;  3LZ0 A;  5CPJ A;  1M19 B;  3REJ A;  3AV1 D;  1ID3 A;  1P3P D;  3AZL A;  2Y2Q A;  4G92 C;  5BNX B;  3AZF C;  3MGR D;  1P3M C;  2F8N K;  2HUE C;  1P3F C;  1KX4 D;  3EPJ A;  1BH8 A;  5GSU A;  5DNN B;  5F99 B;  3AV2 D;  3TU4 B;  2HIO C;  5B2I A;  1P3L C;  2UWX A;  2F8N H;  3X1T D;  5AV5 A;  3MGP D;  3REK D;  2NQB B;  4UPK A;  1B67 A;  3AV1 C;  1P3I A;  4CAY A;  3A1I A;  5DNM C;  3O62 D;  1ID3 B;  4H9Q B;  5C3I C;  3O62 B;  3X1S C;  3MGR C;  1JFI B;  3B6F A;  4YS3 B;  5B33 A;  3REH C;  1P3O A;  5DNN D;  5AVB C;  4J8X C;  3VH5 W;  2Y2G A;  1AOI A;  2CWE A;  5B1M D;  1EQZ D;  3AYW A;  1WWI A;  1TZY D;  4R8P B;  2XD5 A;  3KXB D;  5GT3 A;  4R8P D;  3C1C D;  4WU9 A;  3LZ0 D;  2ARO D;  4ZBJ B;  4J8V C;  1ZLA A;  3UTA C;  3LJA C;  4CSR A;  4J8W C;  5AV9 C;  3REH D;  3MGS B;  1P3B D;  2G5I C;  2Y2O A;  4XZQ B;  3A6N C;  3VH5 T;  1P3L B;  5AV8 D;  1M1A A;  5B0Y A;  5JRG A;  5F99 C;  4HGA B;  2CV5 B;  4KGC C;  3B0D B;  3LEL D;  2VQR A;  3AZE D;  4LD9 A;  5B24 C;  2YFW A;  3UT9 B;  4H9O B;  4DQY B;  3MVD B;  3W97 D;  1P3A B;  4H9N A;  5B0Z C;  3H0R C;  3MGR B;  1P3F A;  5AV8 C;  4NE5 A;  5CPK D;  2BYM A;  2HIO A;  1M18 D;  4KUD B;  5AVC B;  5KDM B;  3AZH B;  2Y2P A;  4J8V B;  5CPJ D;  3EPH A;  3UTA B;  3X1V C;  3B6F D;  3FDD A;  5DNM A;  2DQN C;  3AZJ C;  3KUY C;  4UUZ B;  1P3O C;  3W97 A;  1U35 A;  3UTB A;  3AV2 A;  4WNN B;  3WKJ A;  5KDM A;  5GXQ B;  5AVC A;  3AZN B;  5CPJ C;  4JJN C;  5GT3 C;  4WU9 C;  5B31 D;  3NQU B;  3AZL C;  1KX3 A;  3W99 A;  1ID3 D;  4YM6 B;  2FJ7 A;  5B1L D;  1P3K C;  1BH8 B;  3UTB B;  3B6G C;  3TU4 D;  4QLC A;  5JRG B;  2CV5 A;  1Q9C A;  4Z5T D;  4XUJ B;  1P3I B;  2BG1 A;  4Z66 D;  2NQB A;  3KUY B;  5B24 A;  4NFT A;  2YFW B;  1HQ3 D;  2Y2M A;  4H9R B;  3WTP B;  4ZUX A;  3EPL A;  2W8S A;  5AV9 D;  4J8U A;  1F66 A;  4G91 B;  5AV9 B;  3MGS D;  2YFV B;  2JCH A;  3V9R A;  3LZ1 B;  3REL A;  2Y2N A;  2DF4 C;  3LEL C;  3C1B A;  3REJ C;  1P3I D;  2RVQ D;  3AZE C;  3AZG A;  3X1T A;  3VH6 T;  1M19 A;  3X1V A;  3W96 A;  3REI C;  3AZF A;  4YM6 D;  1P3M A;  1ZLA C;  3AFA C;  5B1L B;  5B2J C;  5CPI B;  3AZI B;  5B2I C;  1P3L A;  3V9R B;  5E5A D;  3LZ1 A;  5AV5 B;  5B0Y C;  4WU8 B;  3REJ D;  3AV1 A;  1P3I C;  4KUD C;  3AZN A;  3AV2 B;  1R4V A;  3AZH D;  3X1V D;  2ZY4 A;  3AZG D;  3X1S A;  3X1T B;  4H9Q A;  5AV6 B;  2PYO A;  3AN2 D;  3W99 C;  1KX3 C;  1TAF B;  1N1J B;  4J8X A;  4H9P B;  5B0Z A;  4WV4 B;  1M18 B;  4KUD D;  1Z2C B;  4X23 B;  3AV1 B;  5B31 C;  3X1U B;  3LJA A;  3X1U D;  5CP6 C;  1P3A D;  3AZJ A;  2PYO B;  3AZI C;  1S32 A;  3WAA D;  3F6T A;  3IP4 C;  1KX4 B;  5F99 A;  3WAA B;  3UTB C;  3NQJ A;  1P3L D;  4Z66 C;  1M1A B;  4JJN A;  3X1T C;  4CAY B;  1P3P B;  2IO5 B;  1P34 A;  5BS7 C;  5GT0 A;  3MGQ D;  3AFA A;  1P3G A;  3UT9 A;  5B2J A;  1BFM A;  1HQ3 B;  3WTP D;  4G91 C;  4YS3 A;  5BO0 A;  3B0B A;  4J8X D;  2Y2I A;  4AWL C;  2Y2J A;  5B1M C;  3B0D C;  1EQZ C;  4QLC B;  3W98 D;  3REI D;  3LZ0 C;  2PYO C;  5B2J D;  5AY8 A;  4ZUX C;  5GT0 D;  1U35 C;  1P3G D;  1F66 C;  1P3B B;  5AV8 B;  5CPI D;  5FUG B;  3A6N D;  4XZQ A;  3X1U A;  5F99 D;  4X23 A;  2JE5 A;  3W98 C;  3AZE A;  3AZG C;  3WKJ B;  2ZM5 A;  1S32 D;  5B32 G;  1P3P C;  2FJ7 C;  3VH5 A;  1S32 B;  3W99 B;  1P3K A;  3REL D;  3KWQ D;  1P3F B;  2F8N D;  2LY8 A;  4H9N B;  5B0Z D;  1AOI B;  4AWL B;  5CPK B;  5B33 C;  3AZM A;  2NZD B;  5B32 A;  2NQB C;  3WTP E;  4X23 D;  3C1C A;  5GT0 B;  4Z5T A;  3UT9 D;  3KWQ A;  5BNX A;  3MVD D;  3AZI D;  1N1J A;  5E5A A;  5B40 D;  2Y2L A;  1H3O B;  2JSS A;  1P3O D;  4J8W A;  3AZK D;  5B33 D;  3B6G B;  1M19 C;  3AZM B;  1W2E A;  3AZG B;  3A6N A;  3REI A;  5B31 A;  3C1B B;  4JJN D;  3C1B D;  3H0L C;  3MVD A;  3LJA B;  3WTP C;  3LJA D;  3AZF D;  1P3M D;  3AZK A;  5GSU D;  5BNV A;  3W96 D;  1KX4 A;  5B33 B;  4J8W B;  3MNN D;  2HIO B;  4KUD A;  4WU8 A;  3AZM D;  5JRG D;  5B32 D;  1TZY B;  3KXB B;  5G49 B;  3TU4 C;  4Z66 A;  1BH9 B;  4HGA C;  3REI B;  3REJ B;  3KFU G;  5GT0 C;  4ZUX D;  1F66 D;  1P3G C;  3X1S D;  1HQ3 A;  4H9R A;  5GSU C;  4WZS B;  3R45 B;  4YS3 C;  5CPI C;  1A7W A;  4H9P A;  5AV5 C;  5B0Z B;  3AZM C;  3AYW D;  5B32 C;  3MGP B;  3REK B;  4XZQ D;  4R8P C;  3C1C C;  3W98 B;  3WKJ C;  4LD9 B;  2ARO C;  3B6F C;  2FJ7 D;  1HTA A;  4M6B A;  4YM6 A;  4J8W D;  2BYK A;  5AV6 C;  3AZJ B;  5AV5 D;  3AYW C;  5B2I D;  5GXQ C;  4XZQ C;  5AVC D;  3A6N B;  3NQJ B;  2NZD C;  4WU8 D;  4Z2M G;  5CPJ B;  4J8V A;  3MNN A;  4X23 C;  3AZH A;  3W98 A;  2XD1 A;  3UT9 C;  1P3G B;  3MVD C;  5GT3 B;  4WU9 B;  3MGQ A;  1P34 B;  3AZL D;  1KX5 B;  3WA9 C;  4E44 A;  1P34 D;  1T3U A;  5BT1 C;  5B40 B;  1P3K B;  1P3F D;  1KX4 C;  3MGS A;  1P3K D;  4WNN A;  2HIO D;  1M18 A;  4Z2M H;  5B32 B;  3MGP C;  3REK C;  4LD9 C;  2Y2K A;  3VH6 A;  3LZ1 D;  4H9S C;  1BH9 A;  3LEL A;  3C1B C;  1B6W A;  2F2A C;  3NQU A;  3MGQ B;  3AZJ D;  1P3A A;  2IO5 C;  3KUY D;  1HQ3 C;  3R45 A;  3W96 C;  5DNN C;  5AY8 B;  5AVB D;  3WAA A;  5AY8 D;  1H3O A;  3UTB D;  3A1K A;  1TZY C;  3KXB C;  4EO5 B;  3LZ1 C;  1P3P A;  5GT3 D;  4WU9 D;  4R8P A;  3EPK A;  1EQZ B;  3LEL B;  5DNM B;  4YM6 C;  3AN2 A;  1ZLA D;  1ID3 C;  5AVB B;  5BNV B;  5C3I B;  4YS3 D;  3B0C T;  2ZY5 A;  4KHA A;  3REH B;  1P3B C;  5B1L C;  2Y2H A;  1U35 B;  4WJ3 C;  5B0Y B;  1PZR A;  4KGC D;  4E45 A;  5JA4 B;  5G49 A;  2FFF B;  4Z5T C;  4NE3 A;  4XUJ C;  4ZBJ C;  3P5J B;  3W96 B;  2FJ7 B;  3W99 D;  3O62 A;  5AV6 D;  1U35 D;  1KX3 B;  5B40 A;  3MGS C;  5E5A B;  5FUG A;  3MGR A;  2CV5 C;  4KGC B;  3AZI A;  5CPK C;  1M18 C;  4EO5 C;  4H9S A;  1ZLA B;  3WTP A;  5B2J B;  2G5H C;  5B24 B;  5CP6 D;  1P3A C;  3WA9 D;  3AFA D;  1KX5 D;  1P34 C;  5BT1 D;  3B0C W;  2F8N A;  1TAF A;  3REL C;  3WAA C;  2CV5 D;  3AL0 C;  5AV9 A;  4J8U D;  3TU4 A;  5GXQ A;  4LD9 D;  3MNN B;  2ZY2 A;  3X1V B;  2NQB D;  3AZH C;  3VH6 W;  3KSY A;  4Z66 B;  1EQZ A;  3AN2 C;  1KX3 D;  1KX5 A;  3MGQ C;  3KWQ B;  5CPI A;  3WA9 A;  1P3B A;  1WWS A;  4H9O A;  2HUE B;  5B1L A;  4KHA B;  3REH A;  5AY8 C;  1P3O B;  5AVB A;  3AZN C;  3B6G D;  2L5A A;  4DRB A;  2BYM B;  4NE6 A;  5B1M B;  2ARO A;  1M19 D;  5CP6 B;  2ZY3 A;  4XUJ A;  3AZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...